BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78546_g1_i1 len=2092 path=[1:0-2091]

Length=2092
                                                                      Score     E

ref|XP_011100821.1|  PREDICTED: uncharacterized protein LOC105178927    785   0.0      
ref|XP_006435674.1|  hypothetical protein CICLE_v10031018mg             776   0.0      
ref|XP_002529978.1|  gulonolactone oxidase, putative                    771   0.0      Ricinus communis
ref|XP_009615106.1|  PREDICTED: L-gulonolactone oxidase-like            770   0.0      
ref|XP_002520499.1|  d-lactate dehydrogenase, putative                  769   0.0      Ricinus communis
ref|XP_007051445.1|  D-arabinono-1,4-lactone oxidase family protein     767   0.0      
ref|XP_010267413.1|  PREDICTED: uncharacterized protein LOC104604665    767   0.0      
ref|XP_006491357.1|  PREDICTED: L-gulonolactone oxidase-like            764   0.0      
ref|XP_009799011.1|  PREDICTED: L-gulonolactone oxidase-like isof...    761   0.0      
ref|XP_006444740.1|  hypothetical protein CICLE_v10019421mg             760   0.0      
ref|XP_010251945.1|  PREDICTED: L-gulonolactone oxidase-like isof...    760   0.0      
ref|XP_010690348.1|  PREDICTED: L-gulonolactone oxidase-like            759   0.0      
ref|XP_004246775.1|  PREDICTED: L-gulonolactone oxidase-like            759   0.0      
gb|KDP28425.1|  hypothetical protein JCGZ_14196                         758   0.0      
ref|XP_006363599.1|  PREDICTED: L-gulonolactone oxidase-like            756   0.0      
gb|KHG02056.1|  L-gulonolactone oxidase                                 755   0.0      
ref|XP_002267268.2|  PREDICTED: L-gulonolactone oxidase-like            754   0.0      Vitis vinifera
ref|XP_003548404.1|  PREDICTED: uncharacterized protein LOC100789425    752   0.0      
ref|XP_003548184.1|  PREDICTED: L-gulonolactone oxidase-like isof...    750   0.0      
ref|XP_004308281.1|  PREDICTED: L-gulonolactone oxidase-like            749   0.0      
ref|XP_007219131.1|  hypothetical protein PRUPE_ppa015890mg             747   0.0      
ref|XP_003548406.2|  PREDICTED: L-gulonolactone oxidase-like            746   0.0      
ref|XP_010054135.1|  PREDICTED: L-gulonolactone oxidase-like            746   0.0      
gb|KDO86595.1|  hypothetical protein CISIN_1g009304mg                   744   0.0      
ref|XP_007135308.1|  hypothetical protein PHAVU_010G118400g             745   0.0      
ref|XP_008233058.1|  PREDICTED: L-gulonolactone oxidase-like            745   0.0      
ref|XP_002302668.1|  FAD-binding domain-containing family protein       744   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_182199.1|  D-arabinono-1,4-lactone oxidase family protein        745   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366360.1|  PREDICTED: L-gulonolactone oxidase-like            744   0.0      
gb|KHN15894.1|  L-gulonolactone oxidase                                 743   0.0      
gb|KCW78513.1|  hypothetical protein EUGRSUZ_D02649                     742   0.0      
ref|XP_009366612.1|  PREDICTED: L-gulonolactone oxidase-like            739   0.0      
gb|KHN06354.1|  D-arabinono-1,4-lactone oxidase                         737   0.0      
ref|XP_010032428.1|  PREDICTED: uncharacterized protein LOC104421946    738   0.0      
ref|XP_011025384.1|  PREDICTED: uncharacterized protein LOC105126261    736   0.0      
ref|XP_003529878.2|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    736   0.0      
ref|XP_009786565.1|  PREDICTED: L-gulonolactone oxidase-like            735   0.0      
ref|XP_011025383.1|  PREDICTED: uncharacterized protein LOC105126260    734   0.0      
ref|XP_006418590.1|  hypothetical protein EUTSA_v10002773mg             735   0.0      
ref|XP_009595692.1|  PREDICTED: L-gulonolactone oxidase-like            732   0.0      
gb|KCW51822.1|  hypothetical protein EUGRSUZ_J01272                     731   0.0      
ref|XP_007139011.1|  hypothetical protein PHAVU_009G257400g             730   0.0      
ref|XP_006340105.1|  PREDICTED: L-gulonolactone oxidase-like            729   0.0      
ref|XP_002882088.1|  FAD-binding domain-containing protein              729   0.0      
emb|CAZ68129.1|  FAD-binding domain-containing protein                  729   0.0      Arabidopsis halleri subsp. halleri
gb|KFK37441.1|  hypothetical protein AALP_AA4G257300                    728   0.0      
ref|XP_006397866.1|  hypothetical protein EUTSA_v10001364mg             726   0.0      
emb|CDX80044.1|  BnaA05g01120D                                          725   0.0      
ref|XP_009142608.1|  PREDICTED: L-gulonolactone oxidase-like            725   0.0      
ref|XP_006280234.1|  hypothetical protein CARUB_v10026149mg             723   0.0      
ref|XP_006604910.1|  PREDICTED: L-gulonolactone oxidase-like            723   0.0      
ref|XP_003521824.2|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    723   0.0      
ref|XP_004308282.1|  PREDICTED: L-gulono-1,4-lactone dehydrogenas...    720   0.0      
ref|XP_010544874.1|  PREDICTED: L-gulonolactone oxidase-like            721   0.0      
ref|XP_006293869.1|  hypothetical protein CARUB_v10022850mg             721   0.0      
ref|XP_009142609.1|  PREDICTED: L-gulonolactone oxidase                 721   0.0      
emb|CAZ68130.1|  FAD-binding domain-containing protein                  720   0.0      Arabidopsis halleri subsp. halleri
gb|KHN16407.1|  L-gulonolactone oxidase                                 719   0.0      
ref|XP_006397865.1|  hypothetical protein EUTSA_v10001763mg             719   0.0      
ref|NP_182197.1|  D-arabinono-1,4-lactone oxidase-like protein          718   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512820.1|  PREDICTED: LOW QUALITY PROTEIN: L-gulonolact...    717   0.0      
ref|XP_006293871.1|  hypothetical protein CARUB_v10022855mg             718   0.0      
ref|XP_003554782.1|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    717   0.0      
ref|XP_009142611.1|  PREDICTED: uncharacterized protein LOC103866439    717   0.0      
gb|KHN11381.1|  D-arabinono-1,4-lactone oxidase                         717   0.0      
dbj|BAF01297.1|  hypothetical protein                                   717   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_182198.2|  D-arabinono-1,4-lactone oxidase-like protein          717   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507976.1|  PREDICTED: L-gulonolactone oxidase-like            717   0.0      
ref|XP_004494863.1|  PREDICTED: L-gulono-1,4-lactone dehydrogenas...    716   0.0      
ref|XP_010507977.1|  PREDICTED: L-gulonolactone oxidase isoform X1      716   0.0      
ref|XP_008437774.1|  PREDICTED: L-gulonolactone oxidase-like            716   0.0      
ref|XP_010518352.1|  PREDICTED: uncharacterized protein LOC104793...    716   0.0      
emb|CDY41552.1|  BnaC04g00700D                                          715   0.0      
gb|AAC33494.1|  unknown protein                                         712   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451223.1|  PREDICTED: uncharacterized protein LOC104733...    712   0.0      
emb|CDX80042.1|  BnaA05g01140D                                          712   0.0      
emb|CAZ68131.1|  FAD-binding domain-containing protein                  711   0.0      Arabidopsis halleri subsp. halleri
gb|KEH18585.1|  D-arabinono-1,4-lactone oxidase-like protein            709   0.0      
ref|NP_200460.1|  D-arabinono-1,4-lactone oxidase family protein        709   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510622.1|  PREDICTED: L-gulono-1,4-lactone dehydrogenas...    709   0.0      
ref|XP_010443300.1|  PREDICTED: uncharacterized protein LOC104726195    708   0.0      
gb|AAO42132.1|  unknown protein                                         708   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU32297.1|  hypothetical protein MIMGU_mgv1a003073mg                709   0.0      
ref|XP_009799012.1|  PREDICTED: L-gulonolactone oxidase-like isof...    704   0.0      
ref|XP_010485184.1|  PREDICTED: uncharacterized protein LOC104763519    705   0.0      
emb|CDY41553.1|  BnaC04g00690D                                          725   0.0      
ref|NP_564393.1|  D-arabinono-1,4-lactone oxidase family protein        701   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418589.1|  hypothetical protein EUTSA_v10002834mg             701   0.0      
ref|XP_006306011.1|  hypothetical protein CARUB_v10011305mg             699   0.0      
emb|CDP05567.1|  unnamed protein product                                696   0.0      
emb|CDP05564.1|  unnamed protein product                                696   0.0      
gb|KDO69088.1|  hypothetical protein CISIN_1g009245mg                   697   0.0      
ref|XP_002864457.1|  predicted protein                                  697   0.0      
ref|XP_004134280.1|  PREDICTED: L-gulono-1,4-lactone dehydrogenas...    697   0.0      
ref|XP_006846581.1|  hypothetical protein AMTR_s00018p00252240          696   0.0      
ref|XP_010554522.1|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    695   0.0      
ref|XP_010690463.1|  PREDICTED: L-gulonolactone oxidase-like            696   0.0      
ref|XP_008776218.1|  PREDICTED: LOW QUALITY PROTEIN: L-gulonolact...    693   0.0      
emb|CDY20720.1|  BnaA02g08600D                                          693   0.0      
emb|CDY41810.1|  BnaC02g12210D                                          693   0.0      
ref|XP_009126937.1|  PREDICTED: uncharacterized protein LOC103851822    692   0.0      
ref|XP_009120161.1|  PREDICTED: L-gulonolactone oxidase-like            692   0.0      
emb|CDY32777.1|  BnaA10g10720D                                          692   0.0      
ref|XP_002882086.1|  FAD-binding domain-containing protein              692   0.0      
ref|XP_010507978.1|  PREDICTED: L-gulonolactone oxidase isoform X2      689   0.0      
ref|XP_010451193.1|  PREDICTED: L-gulonolactone oxidase-like            688   0.0      
gb|KGN56343.1|  hypothetical protein Csa_3G116800                       687   0.0      
ref|XP_009396582.1|  PREDICTED: uncharacterized protein LOC103981555    684   0.0      
ref|XP_002890980.1|  hypothetical protein ARALYDRAFT_313803             686   0.0      
ref|XP_010523835.1|  PREDICTED: LOW QUALITY PROTEIN: L-gulonolact...    683   0.0      
gb|AAF81326.1|AC007767_6  Strong similarity to an unknown protein...    685   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940852.1|  PREDICTED: L-gulonolactone oxidase-like            682   0.0      
emb|CDY68110.1|  BnaCnng57660D                                          682   0.0      
ref|XP_010451207.1|  PREDICTED: uncharacterized protein LOC104733318    680   0.0      
gb|AES93614.2|  D-arabinono-1,4-lactone oxidase-like protein            676   0.0      
emb|CDP05563.1|  unnamed protein product                                689   0.0      
ref|XP_007139013.1|  hypothetical protein PHAVU_009G257600g             675   0.0      
gb|AAV31183.1|  Putative FAD binding domain containing protein, i...    669   0.0      Solanum tuberosum [potatoes]
ref|XP_003610656.1|  hypothetical protein MTR_5g005540                  658   0.0      
emb|CBI38702.3|  unnamed protein product                                646   0.0      
emb|CDP05566.1|  unnamed protein product                                646   0.0      
ref|NP_001050492.1|  Os03g0563100                                       639   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001152512.1|  FAD binding domain containing protein              623   0.0      Zea mays [maize]
ref|XP_002466918.1|  hypothetical protein SORBIDRAFT_01g016650          622   0.0      Sorghum bicolor [broomcorn]
tpg|DAA49257.1|  TPA: FAD binding domain containing protein             622   0.0      
ref|XP_004982560.1|  PREDICTED: uncharacterized protein LOC101777017    624   0.0      
ref|XP_008680953.1|  PREDICTED: FAD binding domain containing pro...    622   0.0      
gb|ACF84587.1|  unknown                                                 620   0.0      Zea mays [maize]
ref|XP_008678317.1|  PREDICTED: L-gulonolactone oxidase-like            617   0.0      
ref|XP_006646815.1|  PREDICTED: uncharacterized protein LOC102715368    610   0.0      
emb|CDM86624.1|  unnamed protein product                                609   0.0      
ref|XP_010676589.1|  PREDICTED: L-gulonolactone oxidase-like            609   0.0      
gb|KFK37440.1|  hypothetical protein AALP_AA4G257200                    642   0.0      
ref|XP_003559677.1|  PREDICTED: uncharacterized protein LOC100839560    606   0.0      
ref|NP_001045739.1|  Os02g0124600                                       606   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973024.1|  PREDICTED: L-gulonolactone oxidase-like            604   0.0      
dbj|BAJ89636.1|  predicted protein                                      604   0.0      
dbj|BAJ94691.1|  predicted protein                                      603   0.0      
ref|XP_010676977.1|  PREDICTED: uncharacterized protein LOC104892687    602   0.0      
ref|XP_003571315.1|  PREDICTED: uncharacterized protein LOC100846108    601   0.0      
ref|XP_010695317.1|  PREDICTED: uncharacterized protein LOC104907984    600   0.0      
ref|XP_006648261.1|  PREDICTED: uncharacterized protein LOC102714071    604   0.0      
gb|EAY84285.1|  hypothetical protein OsI_05664                          598   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010496265.1|  PREDICTED: L-gulonolactone oxidase-like            595   0.0      
ref|XP_003573784.1|  PREDICTED: uncharacterized protein LOC100831264    596   0.0      
gb|ABK24821.1|  unknown                                                 588   0.0      Picea sitchensis
ref|XP_002444922.1|  hypothetical protein SORBIDRAFT_07g001500          592   0.0      Sorghum bicolor [broomcorn]
dbj|BAJ98506.1|  predicted protein                                      591   0.0      
ref|XP_004980737.1|  PREDICTED: uncharacterized protein LOC101758891    588   0.0      
gb|EMT27466.1|  L-gulonolactone oxidase                                 586   0.0      
gb|EAY93710.1|  hypothetical protein OsI_15502                          582   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001060850.1|  Os08g0114300                                       582   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41305.1|  hypothetical protein OsJ_25816                          581   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADE76308.1|  unknown                                                 579   0.0      
ref|XP_008661463.1|  PREDICTED: uncharacterized protein LOC103640501    580   0.0      
tpg|DAA47285.1|  TPA: hypothetical protein ZEAMMB73_182931              580   0.0      
ref|XP_002442412.1|  hypothetical protein SORBIDRAFT_08g019590          578   0.0      Sorghum bicolor [broomcorn]
ref|XP_004980739.1|  PREDICTED: uncharacterized protein LOC101760109    578   0.0      
dbj|BAJ94779.1|  predicted protein                                      574   0.0      
dbj|BAJ92688.1|  predicted protein                                      573   0.0      
ref|XP_010518353.1|  PREDICTED: uncharacterized protein LOC104793...    568   0.0      
ref|XP_003573563.1|  PREDICTED: L-gulonolactone oxidase-like            570   0.0      
gb|EEC72386.1|  hypothetical protein OsI_05665                          569   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002962083.1|  hypothetical protein SELMODRAFT_77373              564   0.0      
gb|EMT18657.1|  L-gulonolactone oxidase                                 563   0.0      
gb|EMT25480.1|  L-gulonolactone oxidase                                 561   0.0      
ref|XP_002971003.1|  hypothetical protein SELMODRAFT_94694              560   0.0      
gb|EAZ05385.1|  hypothetical protein OsI_27592                          560   0.0      Oryza sativa Indica Group [Indian rice]
gb|KHG01649.1|  L-gulonolactone oxidase                                 555   0.0      
gb|EMT11279.1|  L-gulonolactone oxidase                                 556   0.0      
ref|XP_002974095.1|  hypothetical protein SELMODRAFT_100820             555   0.0      
ref|XP_004973273.1|  PREDICTED: uncharacterized protein LOC101767367    553   0.0      
ref|XP_008790302.1|  PREDICTED: uncharacterized protein LOC103707548    551   0.0      
emb|CAE05914.1|  OSJNBa0034E24.8                                        553   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99730.1|  predicted protein                                      549   0.0      
ref|XP_002968876.1|  hypothetical protein SELMODRAFT_91192              550   0.0      
ref|XP_006659761.1|  PREDICTED: uncharacterized protein LOC102718199    549   0.0      
ref|XP_002982103.1|  hypothetical protein SELMODRAFT_115915             548   0.0      
ref|XP_002992203.1|  hypothetical protein SELMODRAFT_236475             546   0.0      
ref|XP_003571543.2|  PREDICTED: uncharacterized protein LOC100833703    545   0.0      
gb|EMT15789.1|  L-gulonolactone oxidase                                 545   0.0      
ref|XP_002982127.1|  hypothetical protein SELMODRAFT_115966             544   0.0      
ref|XP_002993414.1|  hypothetical protein SELMODRAFT_137111             545   0.0      
gb|AFW68326.1|  hypothetical protein ZEAMMB73_477624                    550   0.0      
ref|XP_010234473.1|  PREDICTED: uncharacterized protein LOC104583572    540   0.0      
gb|EMT29824.1|  L-gulonolactone oxidase                                 538   0.0      
ref|NP_001052551.2|  Os04g0361500                                       538   3e-180   Oryza sativa Japonica Group [Japonica rice]
gb|EMT16865.1|  L-gulonolactone oxidase                                 549   3e-180   
ref|XP_010936174.1|  PREDICTED: uncharacterized protein LOC105055864    538   5e-180   
dbj|BAJ94584.1|  predicted protein                                      534   6e-180   
ref|XP_009389446.1|  PREDICTED: L-gulonolactone oxidase-like            537   1e-179   
ref|XP_009389445.1|  PREDICTED: uncharacterized protein LOC103976...    537   1e-179   
gb|EMS46905.1|  L-gulonolactone oxidase                                 532   5e-179   
ref|XP_002885579.1|  hypothetical protein ARALYDRAFT_319075             526   8e-177   
ref|XP_009389444.1|  PREDICTED: L-gulonolactone oxidase-like isof...    526   3e-175   
ref|XP_002985505.1|  hypothetical protein SELMODRAFT_181802             523   5e-174   
gb|EMT12398.1|  L-gulonolactone oxidase                                 520   6e-174   
ref|XP_009389443.1|  PREDICTED: L-gulonolactone oxidase-like isof...    516   3e-171   
ref|XP_009389844.1|  PREDICTED: L-gulonolactone oxidase-like            513   4e-170   
gb|KFK25416.1|  hypothetical protein AALP_AA8G111800                    505   3e-167   
emb|CDP16177.1|  unnamed protein product                                500   3e-165   
ref|XP_008378092.1|  PREDICTED: L-gulonolactone oxidase                 499   5e-165   
ref|XP_002882087.1|  hypothetical protein ARALYDRAFT_904146             499   5e-165   
ref|XP_007012090.1|  D-arabinono-1,4-lactone oxidase family protein     499   7e-165   
ref|XP_008789306.1|  PREDICTED: LOW QUALITY PROTEIN: L-gulonolact...    499   8e-165   
ref|XP_009760726.1|  PREDICTED: L-gulonolactone oxidase                 498   9e-165   
gb|EMT19772.1|  L-gulonolactone oxidase                                 495   1e-163   
ref|XP_004498473.1|  PREDICTED: L-gulonolactone oxidase-like isof...    496   1e-163   
ref|XP_010917611.1|  PREDICTED: L-gulonolactone oxidase                 493   9e-163   
ref|XP_002516554.1|  gulonolactone oxidase, putative                    492   3e-162   Ricinus communis
ref|XP_010668160.1|  PREDICTED: L-gulonolactone oxidase                 491   6e-162   
ref|XP_009597988.1|  PREDICTED: L-gulonolactone oxidase                 491   7e-162   
ref|XP_011070434.1|  PREDICTED: L-gulonolactone oxidase                 489   3e-161   
ref|XP_009346083.1|  PREDICTED: L-gulonolactone oxidase-like            489   4e-161   
gb|KDO79761.1|  hypothetical protein CISIN_1g008595mg                   488   4e-161   
ref|XP_010100664.1|  hypothetical protein L484_023432                   483   6e-161   
ref|XP_006476136.1|  PREDICTED: L-gulonolactone oxidase-like            488   8e-161   
ref|XP_006833405.1|  hypothetical protein AMTR_s00109p00128740          488   8e-161   
ref|XP_010254041.1|  PREDICTED: L-gulonolactone oxidase                 488   1e-160   
ref|XP_002324238.1|  hypothetical protein POPTR_0018s00570g             486   2e-160   Populus trichocarpa [western balsam poplar]
ref|XP_007161499.1|  hypothetical protein PHAVU_001G074300g             487   3e-160   
ref|XP_009125808.1|  PREDICTED: L-gulonolactone oxidase                 486   5e-160   
ref|XP_008345666.1|  PREDICTED: uncharacterized protein LOC103408607    478   9e-160   
ref|XP_008370596.1|  PREDICTED: uncharacterized protein LOC103434065    476   2e-159   
ref|XP_010100256.1|  L-gulonolactone oxidase                            485   2e-159   
ref|XP_010648508.1|  PREDICTED: L-gulonolactone oxidase                 485   2e-159   
emb|CAN71327.1|  hypothetical protein VITISV_031548                     483   9e-159   Vitis vinifera
ref|XP_011026614.1|  PREDICTED: L-gulonolactone oxidase                 483   1e-158   
ref|XP_008220057.1|  PREDICTED: L-gulonolactone oxidase                 483   2e-158   
gb|KDP34196.1|  hypothetical protein JCGZ_07767                         481   3e-158   
ref|XP_008353193.1|  PREDICTED: uncharacterized protein LOC103416748    477   4e-158   
ref|XP_006287247.1|  hypothetical protein CARUB_v10000435mg             483   5e-158   
ref|XP_007224611.1|  hypothetical protein PRUPE_ppa026902mg             481   5e-158   
ref|XP_006450656.1|  hypothetical protein CICLE_v10007892mg             479   1e-157   
ref|XP_004291192.1|  PREDICTED: L-gulonolactone oxidase-like            480   1e-157   
ref|XP_006365179.1|  PREDICTED: L-gulonolactone oxidase-like            478   9e-157   
ref|XP_002302669.2|  hypothetical protein POPTR_0002s17910g             469   1e-156   Populus trichocarpa [western balsam poplar]
gb|KCW81547.1|  hypothetical protein EUGRSUZ_C02902                     477   1e-156   
ref|XP_010541261.1|  PREDICTED: uncharacterized protein LOC104814776    477   2e-156   
ref|XP_011081809.1|  PREDICTED: uncharacterized protein LOC105164756    477   2e-156   
ref|XP_010049092.1|  PREDICTED: L-gulonolactone oxidase                 477   2e-156   
ref|XP_010419726.1|  PREDICTED: L-gulonolactone oxidase-like isof...    476   4e-156   
gb|EYU29272.1|  hypothetical protein MIMGU_mgv1a003820mg                474   1e-155   
ref|XP_004245272.1|  PREDICTED: L-gulonolactone oxidase                 474   5e-155   
ref|XP_010491887.1|  PREDICTED: L-gulonolactone oxidase-like            473   8e-155   
ref|XP_006651549.1|  PREDICTED: uncharacterized protein LOC102717331    467   2e-154   
dbj|BAK08164.1|  predicted protein                                      469   2e-154   
ref|NP_196715.1|  L-gulono-1,4-lactone (L-GulL) oxidase 3               471   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396668.1|  PREDICTED: L-gulonolactone oxidase                 470   9e-154   
ref|XP_003551148.1|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    468   2e-152   
ref|XP_002873518.1|  FAD-binding domain-containing protein              466   5e-152   
ref|XP_009367896.1|  PREDICTED: uncharacterized protein LOC103957464    462   1e-150   
gb|EMS52686.1|  hypothetical protein TRIUR3_32795                       460   6e-150   
ref|XP_008644208.1|  PREDICTED: uncharacterized protein LOC100501...    455   9e-148   
gb|EMS48861.1|  hypothetical protein TRIUR3_32440                       450   2e-147   
ref|XP_010453203.1|  PREDICTED: L-gulonolactone oxidase-like            453   4e-147   
ref|XP_006399661.1|  hypothetical protein EUTSA_v10013068mg             451   3e-146   
ref|XP_002453714.1|  hypothetical protein SORBIDRAFT_04g011130          447   6e-145   Sorghum bicolor [broomcorn]
ref|XP_002987060.1|  hypothetical protein SELMODRAFT_158414             442   3e-144   
emb|CBI20874.3|  unnamed protein product                                444   4e-144   
ref|XP_004952251.1|  PREDICTED: L-gulonolactone oxidase-like isof...    442   1e-142   
ref|NP_001043916.1|  Os01g0687800                                       442   1e-142   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992248.1|  hypothetical protein SELMODRAFT_134896             439   2e-141   
gb|EAY75418.1|  hypothetical protein OsI_03321                          438   5e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_002982221.1|  hypothetical protein SELMODRAFT_115895             437   1e-140   
ref|XP_010251951.1|  PREDICTED: uncharacterized protein LOC104593...    426   3e-140   
ref|XP_006644196.1|  PREDICTED: L-gulonolactone oxidase-like            435   5e-140   
dbj|BAJ91736.1|  predicted protein                                      434   7e-140   
ref|XP_002989646.1|  hypothetical protein SELMODRAFT_235822             431   1e-138   
ref|XP_002986098.1|  hypothetical protein SELMODRAFT_123507             431   1e-138   
ref|XP_003563031.1|  PREDICTED: L-gulonolactone oxidase                 430   3e-138   
ref|XP_002989863.1|  hypothetical protein SELMODRAFT_130502             429   9e-138   
ref|XP_002982113.1|  hypothetical protein SELMODRAFT_115992             429   9e-138   
ref|XP_002991974.1|  hypothetical protein SELMODRAFT_134470             427   2e-137   
ref|XP_001767708.1|  predicted protein                                  426   1e-135   
ref|XP_002962056.1|  hypothetical protein SELMODRAFT_403567             419   5e-134   
ref|XP_002971034.1|  hypothetical protein SELMODRAFT_171869             416   7e-133   
ref|XP_002972902.1|  hypothetical protein SELMODRAFT_97935              416   9e-133   
emb|CDX85709.1|  BnaA02g01040D                                          411   3e-132   
gb|KEH40279.1|  D-arabinono-1,4-lactone oxidase family protein          411   7e-132   
ref|XP_002971037.1|  hypothetical protein SELMODRAFT_94673              412   3e-131   
ref|NP_001183362.1|  uncharacterized protein LOC100501771 precursor     409   9e-131   
ref|XP_002962054.1|  hypothetical protein SELMODRAFT_76913              408   1e-129   
gb|ABK24851.1|  unknown                                                 409   2e-129   
gb|EAZ30369.1|  hypothetical protein OsJ_14420                          402   2e-129   
gb|EMT29609.1|  hypothetical protein F775_20427                         401   3e-129   
ref|XP_004952252.1|  PREDICTED: L-gulonolactone oxidase-like isof...    405   1e-128   
ref|XP_002991560.1|  hypothetical protein SELMODRAFT_429865             403   5e-128   
gb|EAY90668.1|  hypothetical protein OsI_12269                          394   2e-127   
ref|XP_002992214.1|  hypothetical protein SELMODRAFT_430460             399   8e-127   
gb|AAX95611.1|  plant-specific FAD-dependent oxidoreductase             393   9e-127   
ref|XP_010451226.1|  PREDICTED: uncharacterized protein LOC104733...    381   1e-123   
gb|EMT06164.1|  L-gulonolactone oxidase                                 360   3e-113   
emb|CCW28730.1|  putative D-arabinono-1,4-lactone oxidase               354   7e-113   
gb|ABR18152.1|  unknown                                                 365   8e-113   
gb|EMS65287.1|  hypothetical protein TRIUR3_19171                       355   1e-112   
gb|ADE76620.1|  unknown                                                 351   8e-111   
gb|EMT31812.1|  L-gulonolactone oxidase                                 348   9e-110   
ref|XP_010496261.1|  PREDICTED: uncharacterized protein LOC104773365    343   3e-108   
ref|XP_006350269.1|  PREDICTED: L-gulonolactone oxidase-like            342   5e-108   
gb|EMT30185.1|  hypothetical protein F775_09925                         344   5e-107   
ref|XP_009389845.1|  PREDICTED: uncharacterized protein LOC103976376    340   7e-105   
ref|NP_200458.1|  L-gulono-1, 4-lactone oxidase 1                       330   3e-104   
gb|EMT29062.1|  hypothetical protein F775_19923                         339   6e-104   
gb|KHN48779.1|  L-gulonolactone oxidase                                 332   3e-103   
gb|EAZ27501.1|  hypothetical protein OsJ_11450                          330   6e-103   
ref|NP_001045738.1|  Os02g0124400                                       319   2e-99    
ref|XP_009389846.1|  PREDICTED: uncharacterized protein LOC103976377    323   7e-99    
gb|EMS68754.1|  L-gulonolactone oxidase                                 318   9e-98    
gb|EMT13118.1|  hypothetical protein F775_52297                         317   5e-96    
gb|EMS53517.1|  hypothetical protein TRIUR3_26482                       311   4e-95    
gb|EMT20499.1|  L-gulonolactone oxidase                                 305   1e-92    
ref|XP_003626595.1|  hypothetical protein MTR_7g118100                  302   1e-91    
ref|XP_002862174.1|  predicted protein                                  298   2e-91    
gb|EMT04843.1|  hypothetical protein F775_12360                         299   7e-91    
emb|CDY47748.1|  BnaCnng15390D                                          292   5e-90    
gb|EMS50361.1|  hypothetical protein TRIUR3_12752                       286   7e-86    
ref|XP_010668161.1|  PREDICTED: L-gulonolactone oxidase                 276   8e-84    
ref|XP_006386645.1|  hypothetical protein POPTR_0002s17920g             268   5e-81    
ref|XP_010100663.1|  L-gulonolactone oxidase                            267   2e-80    
ref|XP_010689847.1|  PREDICTED: L-gulonolactone oxidase-like            262   2e-78    
ref|XP_008376216.1|  PREDICTED: L-gulonolactone oxidase-like            262   3e-78    
gb|EMT04734.1|  hypothetical protein F775_22132                         260   2e-77    
ref|XP_008343449.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    277   2e-76    
gb|EAZ21568.1|  hypothetical protein OsJ_05196                          259   9e-76    
gb|AAX95612.1|  FAD binding domain, putative                            251   2e-74    
ref|NP_001062257.1|  Os08g0519100                                       256   1e-73    
dbj|BAD09690.1|  oxidase-like                                           256   6e-73    
gb|EEE59357.1|  hypothetical protein OsJ_11449                          247   6e-73    
ref|XP_006840332.1|  hypothetical protein AMTR_s00045p00092460          254   2e-72    
emb|CCW28729.1|  putative FAD_binding domain containing protein         243   3e-71    
ref|XP_002862175.1|  predicted protein                                  238   3e-70    
ref|XP_010534726.1|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    234   6e-68    
ref|XP_001786490.1|  predicted protein                                  224   2e-64    
gb|EEE55207.1|  hypothetical protein OsJ_03060                          234   2e-63    
ref|XP_008666373.1|  PREDICTED: L-gulonolactone oxidase-like            214   1e-60    
tpg|DAA47284.1|  TPA: hypothetical protein ZEAMMB73_126405              215   1e-60    
gb|EEC75579.1|  hypothetical protein OsI_12266                          218   3e-60    
gb|AES82813.2|  D-arabinono-1,4-lactone oxidase family protein          204   4e-58    
ref|XP_008664148.1|  PREDICTED: uncharacterized protein LOC103642720    203   6e-56    
ref|XP_008646848.1|  PREDICTED: uncharacterized protein LOC103628423    201   3e-55    
ref|XP_008666905.1|  PREDICTED: uncharacterized protein LOC103645666    198   2e-54    
ref|XP_008660968.1|  PREDICTED: uncharacterized protein LOC103640101    199   4e-54    
gb|KEH40276.1|  D-arabinono-1,4-lactone oxidase family protein          198   7e-54    
gb|EMT20500.1|  L-gulonolactone oxidase                                 196   1e-53    
ref|XP_008676302.1|  PREDICTED: uncharacterized protein LOC103652515    198   1e-53    
ref|XP_008671116.1|  PREDICTED: uncharacterized protein LOC103648419    197   2e-53    
tpg|DAA36231.1|  TPA: hypothetical protein ZEAMMB73_049782              198   2e-53    
ref|XP_002971036.1|  hypothetical protein SELMODRAFT_411796             194   2e-52    
ref|XP_008352019.1|  PREDICTED: L-gulonolactone oxidase-like            191   7e-52    
ref|NP_001052550.2|  Os04g0360500                                       191   3e-51    
gb|AFG53516.1|  hypothetical protein UMN_5015_01                        182   5e-50    
gb|AEW09332.1|  hypothetical protein UMN_5015_01                        182   5e-50    
gb|AFW71599.1|  hypothetical protein ZEAMMB73_633375                    185   8e-49    
ref|XP_010924631.1|  PREDICTED: L-gulonolactone oxidase-like            181   2e-48    
emb|CDX97124.1|  BnaC09g45010D                                          181   3e-48    
ref|XP_002971035.1|  hypothetical protein SELMODRAFT_411795             177   9e-47    
tpg|DAA50656.1|  TPA: hypothetical protein ZEAMMB73_520965              179   2e-45    
ref|WP_020409597.1|  dehydrogenase                                      178   1e-44    
ref|WP_026305287.1|  dehydrogenase                                      166   1e-40    
ref|WP_004737518.1|  dehydrogenase                                      160   7e-39    
ref|WP_017105017.1|  dehydrogenase                                      159   2e-38    
ref|XP_002988027.1|  hypothetical protein SELMODRAFT_15358              146   3e-37    
ref|WP_011398439.1|  dehydrogenase                                      150   2e-35    
gb|KEH24699.1|  D-arabinono-1,4-lactone oxidase family protein          141   2e-35    
ref|XP_009776533.1|  PREDICTED: D-arabinono-1,4-lactone oxidase-like    139   5e-35    
gb|EMT13119.1|  hypothetical protein F775_42994                         145   1e-34    
ref|WP_021707967.1|  hypothetical protein                               148   1e-34    
ref|WP_018693321.1|  dehydrogenase                                      145   1e-33    
ref|XP_008644209.1|  PREDICTED: uncharacterized protein LOC100501...    144   3e-33    
ref|WP_005533021.1|  FAD/FMN-containing dehydrogenase                   143   4e-33    
ref|WP_010648635.1|  dehydrogenase                                      143   6e-33    
ref|WP_038163239.1|  dehydrogenase                                      140   6e-32    
ref|WP_009600093.1|  dehydrogenase                                      140   6e-32    
ref|WP_019277112.1|  dehydrogenase                                      139   1e-31    
ref|WP_038511487.1|  dehydrogenase                                      139   2e-31    
ref|WP_006962201.1|  dehydrogenase                                      138   2e-31    
gb|AIW18825.1|  dehydrogenase                                           138   3e-31    
ref|XP_010100666.1|  hypothetical protein L484_023434                   117   2e-27    
gb|EMS65286.1|  hypothetical protein TRIUR3_19170                       117   2e-26    
ref|XP_006840333.1|  hypothetical protein AMTR_s00045p00092660          110   1e-24    
gb|EDK26638.1|  FAD/FMN-containing dehydrogenase                        110   3e-23    
ref|XP_009776534.1|  PREDICTED: uncharacterized protein LOC104226281    104   3e-22    
gb|KFK27218.1|  hypothetical protein AALP_AA8G352700                    102   2e-21    
ref|XP_001212435.1|  conserved hypothetical protein                     106   1e-20    
gb|KEH18584.1|  D-arabinono-1,4-lactone oxidase family protein        95.5    5e-20    
gb|AAH28822.1|  Gulonolactone (L-) oxidase                              101   2e-19    
ref|XP_010490073.1|  PREDICTED: uncharacterized protein LOC104767795  96.7    3e-18    
ref|NP_848862.1|  L-gulonolactone oxidase                             97.1    5e-18    
ref|XP_008826389.1|  PREDICTED: L-gulonolactone oxidase               95.5    2e-17    
gb|AAH34835.1|  Gulo protein                                          94.7    3e-17    
gb|AAH19856.1|  Gulonolactone (L-) oxidase                            94.7    3e-17    
ref|XP_004775164.1|  PREDICTED: L-gulonolactone oxidase-like          94.4    5e-17    
gb|AEX12233.1|  hypothetical protein 0_7427_01                        88.2    6e-17    
ref|XP_004411725.1|  PREDICTED: L-gulonolactone oxidase-like          93.6    8e-17    
ref|XP_009980519.1|  PREDICTED: L-gulonolactone oxidase-like          93.2    9e-17    
gb|EQL35467.1|  hypothetical protein BDFG_02950                       94.0    9e-17    
gb|AEX12224.1|  hypothetical protein 0_7427_01                        87.4    1e-16    
ref|NP_001123420.1|  L-gulonolactone oxidase                          92.8    1e-16    
gb|KFV00817.1|  L-gulonolactone oxidase                               92.8    1e-16    
ref|XP_002622578.1|  FAD/FMN-containing dehydrogenase                 94.0    1e-16    
gb|EEQ92153.1|  FAD/FMN-containing dehydrogenase                      93.6    1e-16    
ref|XP_005146526.1|  PREDICTED: L-gulonolactone oxidase-like          92.4    2e-16    
ref|NP_001060849.1|  Os08g0114400                                     91.3    2e-16    
ref|XP_005236733.1|  PREDICTED: L-gulonolactone oxidase-like          91.7    4e-16    
gb|AAA41164.1|  L-gulono-gamma-lactone oxidase precursor              90.5    7e-16    
dbj|BAA02232.1|  L-gulono-gamma-lactone oxidase                       90.1    9e-16    
ref|NP_071556.2|  L-gulonolactone oxidase                             90.1    1e-15    
sp|P10867.3|GGLO_RAT  RecName: Full=L-gulonolactone oxidase; Shor...  90.1    1e-15    
ref|WP_015290131.1|  L-gulono-1,4-lactone dehydrogenase               89.7    1e-15    
gb|EWZ30386.1|  hypothetical protein FOZG_15873                       90.1    1e-15    
ref|XP_005684101.1|  PREDICTED: L-gulonolactone oxidase-like isof...  89.7    2e-15    
ref|XP_005443605.1|  PREDICTED: L-gulonolactone oxidase-like          90.1    2e-15    
gb|EXK35769.1|  hypothetical protein FOMG_08972                       90.1    2e-15    
ref|WP_031660372.1|  oxidoreductase                                   89.4    2e-15    
ref|XP_007517356.1|  PREDICTED: L-gulonolactone oxidase               89.4    2e-15    
gb|EXL51717.1|  hypothetical protein FOCG_07543                       89.7    2e-15    
gb|EWZ85394.1|  hypothetical protein FOWG_11894                       89.7    2e-15    
ref|XP_009489099.1|  PREDICTED: L-gulonolactone oxidase-like          89.0    2e-15    
ref|WP_031701365.1|  oxidoreductase                                   89.0    3e-15    
ref|XP_010206806.1|  PREDICTED: L-gulonolactone oxidase-like          89.0    3e-15    
ref|WP_023641339.1|  oxidoreductase                                   88.6    3e-15    
ref|XP_009814225.1|  PREDICTED: L-gulonolactone oxidase-like          88.6    3e-15    
ref|XP_005635730.1|  PREDICTED: L-gulonolactone oxidase-like isof...  88.6    4e-15    
gb|AIH57980.1|  oxidoreductase                                        87.8    4e-15    
ref|XP_010310844.1|  PREDICTED: L-gulonolactone oxidase-like          88.2    4e-15    
gb|KEH41492.1|  D-arabinono-1,4-lactone oxidase family protein, p...  82.8    4e-15    
ref|WP_031749193.1|  oxidoreductase                                   88.2    4e-15    
ref|XP_005635731.1|  PREDICTED: L-gulonolactone oxidase-like isof...  87.8    4e-15    
ref|WP_031675555.1|  oxidoreductase                                   87.8    5e-15    
ref|WP_015293187.1|  L-gulono-1,4-lactone dehydrogenase               87.8    5e-15    
ref|WP_031663967.1|  oxidoreductase                                   87.8    6e-15    
ref|WP_003910436.1|  oxidoreductase                                   87.8    6e-15    
ref|WP_031743417.1|  oxidoreductase                                   87.8    6e-15    
ref|WP_014848107.1|  oxidoreductase                                   87.8    6e-15    
ref|WP_014000938.1|  oxidoreductase                                   87.8    6e-15    
ref|WP_003408749.1|  MULTISPECIES: oxidoreductase                     87.8    6e-15    
ref|WP_003903607.1|  oxidoreductase                                   87.8    6e-15    
ref|XP_003794067.1|  PREDICTED: L-gulonolactone oxidase-like          88.6    6e-15    
ref|WP_031666687.1|  oxidoreductase                                   87.4    8e-15    
ref|WP_031665453.1|  oxidoreductase                                   87.0    1e-14    
ref|WP_003909509.1|  MULTISPECIES: oxidoreductase                     87.0    1e-14    
ref|XP_009251667.1|  hypothetical protein FPSE_00272                  87.0    1e-14    
ref|XP_009871625.1|  PREDICTED: L-gulonolactone oxidase-like          86.7    1e-14    
ref|XP_009643567.1|  PREDICTED: L-gulonolactone oxidase-like          85.1    4e-14    
gb|EKG21139.1|  FAD linked oxidase                                    85.1    6e-14    
ref|WP_036418929.1|  oxidoreductase                                   84.3    7e-14    
ref|XP_007851635.1|  fad fmn-containing dehydrogenase                 85.1    7e-14    
ref|WP_036403162.1|  oxidoreductase                                   84.0    1e-13    
ref|XP_009936988.1|  PREDICTED: L-gulonolactone oxidase-like          84.0    1e-13    
ref|WP_020725220.1|  MULTISPECIES: oxidoreductase                     83.6    1e-13    
ref|WP_012394368.1|  MULTISPECIES: oxidoreductase                     83.6    1e-13    
emb|CEF74525.1|  unnamed protein product                              84.0    1e-13    
ref|WP_015627647.1|  L-gulono-1,4-lactone dehydrogenase               83.2    2e-13    
ref|XP_003028130.1|  hypothetical protein SCHCODRAFT_237513           84.0    2e-13    
gb|KFV56815.1|  L-gulonolactone oxidase                               83.6    2e-13    
ref|WP_011740971.1|  oxidoreductase                                   83.2    2e-13    
ref|WP_031724840.1|  oxidoreductase                                   82.8    2e-13    
emb|CCA74713.1|  related to ALO1-D-arabinono-1,4-lactone oxidase      83.6    3e-13    
ref|WP_023363938.1|  oxidoreductase                                   82.4    3e-13    
ref|XP_007829805.1|  hypothetical protein PFICI_03033                 82.8    3e-13    
gb|EUA16836.1|  FAD-linked oxidoreductase family protein              82.4    3e-13    
ref|XP_382432.1|  hypothetical protein FG02256.1                      82.8    5e-13    
gb|KEH25678.1|  cytochrome C biogenesis protein ccsA, putative        78.6    6e-13    
ref|WP_036360366.1|  oxidoreductase                                   81.3    8e-13    
ref|WP_004570381.1|  FAD-linked oxidoreductase                        80.9    1e-12    
ref|WP_036783357.1|  D-arabinono-14-lactone oxidase                   80.5    1e-12    
ref|XP_002962057.1|  hypothetical protein SELMODRAFT_403568           77.0    3e-12    
ref|XP_007811218.1|  sugar 1,4-lactone oxidase, putative              79.3    4e-12    
ref|XP_007915580.1|  putative fad fmn-containing dehydrogenase pr...  79.0    6e-12    
emb|CEG77039.1|  hypothetical protein RMATCC62417_11853               78.6    7e-12    
ref|WP_038546954.1|  hypothetical protein                             78.2    7e-12    
ref|XP_002962055.1|  hypothetical protein SELMODRAFT_403566           76.6    9e-12    
ref|WP_020408467.1|  hypothetical protein                             78.6    9e-12    
ref|WP_036827081.1|  D-arabinono-14-lactone oxidase                   77.4    1e-11    
gb|EDK26637.1|  FAD/FMN-containing dehydrogenase                      75.5    1e-11    
gb|EWM22098.1|  fad-dependent oxidoreductase                          77.8    1e-11    
gb|KDB15290.1|  FAD/FMN-containing dehydrogenase                      77.0    2e-11    
gb|EDL36009.1|  mCG2517                                               76.3    2e-11    
ref|WP_007186040.1|  FAD-binding protein                              76.6    3e-11    
ref|XP_660439.1|  hypothetical protein AN2835.2                       76.6    3e-11    
ref|WP_028952917.1|  hypothetical protein                             76.3    3e-11    
ref|XP_006626154.1|  PREDICTED: L-gulonolactone oxidase-like          76.3    3e-11    
ref|WP_031075924.1|  FAD-linked oxidoreductase                        75.9    4e-11    
ref|XP_010697823.1|  L-gulonolactone oxidase, putative                76.3    4e-11    
gb|KIH94599.1|  D-arabinono-1,4-lactone oxidase                       76.3    4e-11    
ref|WP_029553580.1|  FAD-linked oxidoreductase                        75.9    4e-11    
ref|WP_037572301.1|  FAD-binding protein                              75.9    4e-11    
gb|ERS99525.1|  hypothetical protein HMPREF1624_04727                 76.3    5e-11    
ref|WP_031134806.1|  FAD-linked oxidoreductase                        75.1    5e-11    
gb|KAM18473.1|  l-gulono-1,4-lactone dehydrogenase                    74.3    1e-10    
ref|WP_037947101.1|  FAD-linked oxidoreductase                        74.3    1e-10    
ref|XP_001563915.1|  putative L-gulonolactone oxidase                 74.3    2e-10    
ref|XP_007695659.1|  hypothetical protein COCSADRAFT_156375           73.9    2e-10    
ref|XP_007798549.1|  putative d-arabinono- -lactone oxidase protein   74.3    2e-10    
ref|WP_010180363.1|  oxidoreductase                                   73.6    2e-10    
gb|EMD90809.1|  hypothetical protein COCHEDRAFT_1104911               73.9    2e-10    
gb|EXM20855.1|  hypothetical protein FOTG_11238                       73.6    2e-10    
gb|EGU82909.1|  hypothetical protein FOXB_06574                       73.6    3e-10    
ref|WP_030609130.1|  FAD-linked oxidoreductase                        73.2    3e-10    



>ref|XP_011100821.1| PREDICTED: uncharacterized protein LOC105178927 [Sesamum indicum]
Length=598

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/588 (66%), Positives = 465/588 (79%), Gaps = 16/588 (3%)
 Frame = +2

Query  113   ISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnc---titnSYGTFPDRGVC  283
             I++AK+ I  +IT       F    S PEDPI+C     +     TITNSYG FPDR +C
Sbjct  12    IAIAKIGILSVIT-------FVANCSTPEDPIQCRSAGAVKNSYCTITNSYGAFPDRSIC  64

Query  284   RAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRT  463
             RAA+ VYP +EAEL+S +A AT  KRK+K ATRYSHSIPKL CP+GDDGLLISTKYLNRT
Sbjct  65    RAAQVVYPSSEAELISAVANATLAKRKIKVATRYSHSIPKLVCPDGDDGLLISTKYLNRT  124

Query  464   LEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVG  643
             L +N S+MT+TVESGV+LRQ+I +AAK  LALPYSPYWWGLTVGG++GTG+HGSSLWG+G
Sbjct  125   LNINPSAMTITVESGVTLRQLINDAAKTKLALPYSPYWWGLTVGGMLGTGAHGSSLWGLG  184

Query  644   SSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFK  823
             S VHD+VI +RI++PAT +EGYA +RTL+ GN ++ AA+VSLGVLGVISQVT KLQPMFK
Sbjct  185   SQVHDYVIQLRIISPATAEEGYAKVRTLETGNPELDAAKVSLGVLGVISQVTLKLQPMFK  244

Query  824   RSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFG  1003
             RSI+++ KND D G EA  FG  HEFAD  W P  + VVYR+DDRVS+N SGNGL DF G
Sbjct  245   RSITYITKNDSDFGDEAASFGRLHEFADFMWYPSQKLVVYRIDDRVSSNASGNGLNDFPG  304

Query  1004  LRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVI  1183
              R+  +  L  LR  EE QES+GD D KC N  L     +  + YGL NDG+ F+GYPVI
Sbjct  305   FRSTPSIVLATLRTSEETQESLGDLDGKCINGKL-TTSTLRTMGYGLKNDGILFTGYPVI  363

Query  1184  GYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL  1357
             G+QN +Q+SGTCLDSL D     CPWD RV GLFF+QTTFSI L+KVK FI+D+QKL  L
Sbjct  364   GFQNRIQASGTCLDSLEDARITACPWDSRVRGLFFYQTTFSIGLSKVKKFIQDIQKLAAL  423

Query  1358  EPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQ  1537
             EPKS+C L LY+GILMRYV AS+AYLGKQED++DFDITYYRSKDP+ PRLYEDILEEIEQ
Sbjct  424   EPKSMCGLDLYNGILMRYVTASSAYLGKQEDALDFDITYYRSKDPLAPRLYEDILEEIEQ  483

Query  1538  MAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTG  1717
             +A+FKY ALPHWGKNRNVAFQGAI KYK A EFLK+K+ +DPLGLFSS W+DQILGL + 
Sbjct  484   IAVFKYNALPHWGKNRNVAFQGAINKYKKATEFLKIKQMYDPLGLFSSNWTDQILGLSSR  543

Query  1718  LSIV---KDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
               ++   ++GCALEGLC+CSQD HCAPNKGYFCR GKVY++A+VC K+
Sbjct  544   SVVMMNDEEGCALEGLCVCSQDIHCAPNKGYFCRPGKVYEEARVCAKL  591



>ref|XP_006435674.1| hypothetical protein CICLE_v10031018mg [Citrus clementina]
 ref|XP_006486534.1| PREDICTED: D-arabinono-1,4-lactone oxidase-like [Citrus sinensis]
 gb|ESR48914.1| hypothetical protein CICLE_v10031018mg [Citrus clementina]
Length=595

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/586 (65%), Positives = 468/586 (80%), Gaps = 4/586 (1%)
 Frame = +2

Query  104   SHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVC  283
             ++T+  A+        I++  L   V  S PEDPIKC+ NN  +CTITNSYG FPDR VC
Sbjct  2     AYTVCTARSLFRSKCVIFL-LLFIAVNGSPPEDPIKCSSNNNSSCTITNSYGMFPDRSVC  60

Query  284   RAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRT  463
             +AA   YP +E EL+SI+A A   K ++K ATR+SHSIPKL CP G +GLLISTK+LNR 
Sbjct  61    KAANVAYPASEQELISIVAAAAMAKTRIKVATRFSHSIPKLVCPAGQEGLLISTKHLNRV  120

Query  464   LEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVG  643
             L+++  +MT+TVESGV+LRQVIEE+AKAGLALPY PYWWGLTVGG++GTG+HGSSLWG G
Sbjct  121   LKLDVQAMTVTVESGVTLRQVIEESAKAGLALPYGPYWWGLTVGGMLGTGAHGSSLWGRG  180

Query  644   SSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFK  823
             SSVHD+ + IRIVTP   +E +  +R L + + D  AA+VSLGVLGVISQVT KL+P+FK
Sbjct  181   SSVHDYAVEIRIVTPGNPEEEFVNVRVLNESHQDFYAAKVSLGVLGVISQVTLKLEPLFK  240

Query  824   RSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFG  1003
             RSI++V K+D DLG +A  FG +HEFAD+ W P  R   YRVDDR+S+NTSGNGL++FF 
Sbjct  241   RSIAYVQKSDSDLGDQAAIFGHRHEFADITWYPSQRKAAYRVDDRISSNTSGNGLYNFFP  300

Query  1004  LRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVI  1183
              R + +  +  +R  EE+QES+ DAD KC    L+   +  F ++GLTNDGV F+GYPVI
Sbjct  301   FRPMLSVAMAVVRATEENQESLRDADGKCIGGKLVTSTLNAF-AFGLTNDGVVFAGYPVI  359

Query  1184  GYQNHMQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL  1357
             GYQN +QSSGTCLDS  D++   C WDPR+NG FFHQTTFS++L+ VK+FI+D+QKLV +
Sbjct  360   GYQNRLQSSGTCLDSAEDSMITGCGWDPRINGEFFHQTTFSVALSVVKNFIQDIQKLVQM  419

Query  1358  EPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQ  1537
             EPK+LC L LY+GI+MRYVKAS AYLGKQEDS+DFDI YYRSKDPM PRLYED+LEEIEQ
Sbjct  420   EPKALCGLELYNGIIMRYVKASNAYLGKQEDSLDFDIMYYRSKDPMAPRLYEDVLEEIEQ  479

Query  1538  MAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTG  1717
             +A+FKYG LPHWGKNRN+ F G I+KYK+AGEFLKVK+KFDPLGLFSSEW+DQ+LGLK G
Sbjct  480   LAVFKYGGLPHWGKNRNLVFDGVIKKYKNAGEFLKVKQKFDPLGLFSSEWTDQMLGLKDG  539

Query  1718  LSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             + I K+GCALEGLCICSQD HCAP+KGYFCR GKVYKDA+VC +++
Sbjct  540   VMIFKEGCALEGLCICSQDIHCAPSKGYFCRPGKVYKDARVCTRLS  585



>ref|XP_002529978.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF32421.1| gulonolactone oxidase, putative [Ricinus communis]
Length=589

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/567 (66%), Positives = 452/567 (80%), Gaps = 13/567 (2%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S+ PEDPIKCT  N        SYGTFPDR +CRAA   YP TE EL+S++A ATK KRK
Sbjct  22    STPPEDPIKCTSVNINCTITN-SYGTFPDRSICRAANVAYPTTEEELISVVANATKSKRK  80

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MKAATRYSHSIPKL CP+G+DGLLISTKYLN  L ++  SMTMTVESGV+LRQ+I E A 
Sbjct  81    MKAATRYSHSIPKLVCPDGEDGLLISTKYLNHVLSIDVRSMTMTVESGVTLRQIINEGAN  140

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
             AGLALPY+PYWWGLT+GGL+ TG+HGS+LWG GSSVHD+V+ + IV+P   + GY  +R 
Sbjct  141   AGLALPYAPYWWGLTIGGLLSTGAHGSTLWGKGSSVHDYVVELTIVSPGEPENGYVKVRR  200

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L++ NS++ AA+VSLGVLGVIS+VT KLQP+FKRSI++V KND DLG +AT FG QHEFA
Sbjct  201   LEERNSELNAAKVSLGVLGVISKVTLKLQPLFKRSITYVAKNDTDLGDQATTFGHQHEFA  260

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P     +YR+DDR+S+N SGNGL++    R   +  L  +R  EE+QES+GDA+ 
Sbjct  261   DITWYPSQHKAIYRIDDRISSNISGNGLYNSIPFRPTPSLELLLIRHTEENQESLGDAEG  320

Query  1085  KCSNQWLINVWMVWFLS-YGLTNDGVK-------FSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             KC +  L +   V F S YGLTN+G+        F+GYPVIGYQN +QSSGTCLDSL D 
Sbjct  321   KCISARLTS--NVLFTSAYGLTNNGIPPKVTGVLFTGYPVIGYQNRLQSSGTCLDSLEDA  378

Query  1241  L--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
                 CPWDPRV G +FHQTTFSI L+ VKSFI+DVQ+LV LEPK LCV+  Y+GILMRYV
Sbjct  379   FITACPWDPRVRGEYFHQTTFSIGLSAVKSFIQDVQELVKLEPKGLCVIEQYNGILMRYV  438

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
             KAS+AY GKQED+IDFDITYYRSKDPM PR+YEDILEEIEQMA+FKYGALPHWGKNRNVA
Sbjct  439   KASSAYFGKQEDAIDFDITYYRSKDPMTPRMYEDILEEIEQMAVFKYGALPHWGKNRNVA  498

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F+GAI+KYK+AGEFL+V++ +DP+GLFS+EW+DQ+LG K GL IVK+GCALEGLCICS+D
Sbjct  499   FKGAIKKYKNAGEFLRVRQMYDPIGLFSNEWTDQVLGQKEGLIIVKEGCALEGLCICSED  558

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
              HCAP KGY CR GK+YK A+VC  ++
Sbjct  559   IHCAPKKGYLCRPGKIYKHARVCTLVS  585



>ref|XP_009615106.1| PREDICTED: L-gulonolactone oxidase-like [Nicotiana tomentosiformis]
Length=579

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/578 (66%), Positives = 466/578 (81%), Gaps = 3/578 (1%)
 Frame = +2

Query  128   MSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYP  307
             M I  LI IY   ++  V SS PEDPIKCT NN  NCTITNSYG FPDR +CRA +AV+P
Sbjct  1     MEILTLICIYFLMILNLVKSSPPEDPIKCTSNNNFNCTITNSYGAFPDRSICRAGQAVFP  60

Query  308   KTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSM  487
              TE EL++++A AT  KRKMK  TR+SHSIPKL CP+G+DGLLISTK+LN+ L V+  +M
Sbjct  61    TTEEELIAVVANATMIKRKMKVTTRFSHSIPKLVCPDGEDGLLISTKFLNKILSVDKENM  120

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
             ++TVESGV+L+Q+I EAAK+GL LPY+PYWWGLT+GGL+GTG+HGSSLWG+GSSVHD+++
Sbjct  121   SITVESGVTLKQLISEAAKSGLVLPYAPYWWGLTIGGLIGTGAHGSSLWGLGSSVHDYIL  180

Query  668   HIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
              +RIVTPA   + YA IRTL+ GN ++ AARVSLGVLGVISQVT K++P+FKRSI+   +
Sbjct  181   QLRIVTPAEAAQNYAQIRTLENGNPELDAARVSLGVLGVISQVTLKVEPVFKRSITLSER  240

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             ND +LG EA  FG +HEFAD  W P  R VVYR+DDRV  NT GNGL DF G R+  +  
Sbjct  241   NDSELGDEAVVFGRKHEFADFTWYPSQRKVVYRIDDRVPANTPGNGLNDFLGFRSTASLV  300

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
             L  LR  EE+QES  D+  KC++  L    +    +YGLTN+G  F+GYPV+G+ N +Q+
Sbjct  301   LAILRSSEENQESRNDSGGKCTSAKLTTSTLK-IGAYGLTNNGFAFTGYPVVGFHNRVQA  359

Query  1208  SGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             SGTCL+SL D     CPWD RV GLFFHQTTFSI+L+KVK FI+DVQKLV LEPK+LCVL
Sbjct  360   SGTCLNSLEDARITACPWDSRVKGLFFHQTTFSINLSKVKGFIQDVQKLVALEPKALCVL  419

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
              LY+GILMRY+  S AYLG+QED++DFDITYYRSKDPM PRL+ED LEE+EQ+A FKYGA
Sbjct  420   DLYNGILMRYLTTSNAYLGEQEDALDFDITYYRSKDPMSPRLFEDFLEEVEQLAFFKYGA  479

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGC  1741
             LPHWGKNRNVAF GAI+KY++A +FLKVK+++D LGLFSSEW+DQ+LGLK GL+IVK+GC
Sbjct  480   LPHWGKNRNVAFIGAIKKYRNADKFLKVKQRYDKLGLFSSEWTDQVLGLKDGLTIVKEGC  539

Query  1742  ALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             ALEGLCICS+D HCAP KGYFCR GK+YKDA+VC +++
Sbjct  540   ALEGLCICSEDIHCAPQKGYFCRPGKIYKDARVCARLS  577



>ref|XP_002520499.1| d-lactate dehydrogenase, putative [Ricinus communis]
 gb|EEF41912.1| d-lactate dehydrogenase, putative [Ricinus communis]
Length=579

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/560 (66%), Positives = 451/560 (81%), Gaps = 4/560 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
             V S+ PEDPI+CT  NT       SYGTFPDR +C+AA   YP TE EL+S++A ATK K
Sbjct  20    VISTPPEDPIECTSRNTNCTITN-SYGTFPDRSICQAANVAYPTTEEELISVVANATKAK  78

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RKMK ATRYSHSIPKL CP+G DGLLISTK LN  L ++  SMTMTVESGV+LRQ+I+E 
Sbjct  79    RKMKVATRYSHSIPKLVCPDGKDGLLISTKNLNHVLSIDVQSMTMTVESGVTLRQIIDEG  138

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A AGLALPY+PYWWGLT+GGL+GTG+HGS+LWG+GSSVHD+V+ + IV+P   + GYA +
Sbjct  139   ANAGLALPYAPYWWGLTIGGLLGTGAHGSTLWGIGSSVHDYVVGLTIVSPGGPENGYANV  198

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L + NS+  AA+VSLGVLGVIS+VT KLQP+FKRSI++V K+D DLG +AT FG QHE
Sbjct  199   RILDEKNSEFNAAKVSLGVLGVISKVTLKLQPLFKRSITYVAKDDTDLGDQATSFGLQHE  258

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FAD+ W P     +YR+DDR+S+NTSGNGL+DF   R+  +  L+ +R  EE+QE++GD 
Sbjct  259   FADITWYPTQSKAIYRIDDRISSNTSGNGLYDFIPFRSTLSLGLSVIRATEENQEALGDV  318

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
             + +C +  L    ++   +YGLTN G+ F+GYPVIG+ N +QSSGTCLDS  D L   CP
Sbjct  319   EGRCISARLTTGTLL-TAAYGLTNRGILFTGYPVIGFHNRLQSSGTCLDSREDALITACP  377

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WD R+ G +FHQTTFSISL+ VKSFI+DVQ+LV LEPK LC +  Y+GILMRYVKASTAY
Sbjct  378   WDSRIKGEYFHQTTFSISLSNVKSFIQDVQQLVKLEPKGLCTVEQYNGILMRYVKASTAY  437

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGKQED+IDFDITYYRSKDP+ PR++EDILEEIEQ+A+FKYGALPHWGKNRN AF GAI 
Sbjct  438   LGKQEDAIDFDITYYRSKDPLTPRMFEDILEEIEQIAVFKYGALPHWGKNRNAAFSGAIT  497

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             +YK+AGEFL+VK+ +DP GLFSSEW+DQ+LGLK GL IVK+GCALEGLCICS+D+HCAP 
Sbjct  498   RYKNAGEFLRVKQMYDPTGLFSSEWTDQVLGLKEGLIIVKEGCALEGLCICSEDSHCAPK  557

Query  1793  KGYFCRAGKVYKDAKVCVKI  1852
             KGY CR GKVY++A+VC  +
Sbjct  558   KGYLCRPGKVYQNARVCTLV  577



>ref|XP_007051445.1| D-arabinono-1,4-lactone oxidase family protein [Theobroma cacao]
 gb|EOX95602.1| D-arabinono-1,4-lactone oxidase family protein [Theobroma cacao]
Length=586

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/566 (65%), Positives = 456/566 (81%), Gaps = 4/566 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
               +  V  + PE+P+KC+  ++       SYG+FPDR +CRA    YP TE EL+SI++ 
Sbjct  21    LFVIMVSCTPPEEPVKCSSKDSNCTISN-SYGSFPDRTICRAGNVAYPTTEKELVSIVSA  79

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
             A + KRKMK  TR+SHSIPKL CP+G+DGLLISTKYLN TL+++A++MTMTVESGV+LRQ
Sbjct  80    AAEAKRKMKVITRFSHSIPKLVCPDGEDGLLISTKYLNHTLKIDAAAMTMTVESGVTLRQ  139

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +I +AAKAGLALP++PYWWGLT+GGL+GTG+HGSSLWG GSSVHD+V+ +R+V+PA  KE
Sbjct  140   LINDAAKAGLALPHAPYWWGLTIGGLLGTGAHGSSLWGKGSSVHDYVVEMRMVSPAGAKE  199

Query  704   GYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             GYA +R L + + D+ AA+VSLGVLGVISQVTFKLQP+FKRSIS+V K+D DLG EA  F
Sbjct  200   GYAKVRVLNESDKDLDAAKVSLGVLGVISQVTFKLQPLFKRSISYVTKDDADLGDEAITF  259

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G QHEFAD+ W P  R  VYR+DDRVS+N SG GL+DF   R+  +  L  +R  EE QE
Sbjct  260   GKQHEFADVSWYPSQRKAVYRIDDRVSSNASGCGLYDFIPFRSTPSLALAFIRTTEETQE  319

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
             S+ DAD KC +  LI V  +   +YGLTN+G+ F+GYPVIG+ N +QSSGTCLDS  D+L
Sbjct  320   SLRDADGKCLSGKLI-VSTLQTAAYGLTNNGIIFTGYPVIGFHNRLQSSGTCLDSPEDSL  378

Query  1244  --TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
                CPWDPR+ G FF Q+TFS+ L+ VKSFI+DVQKLV LEPK+LC L LY GILMRYVK
Sbjct  379   ITACPWDPRIKGEFFQQSTFSVGLSVVKSFIQDVQKLVALEPKALCGLELYSGILMRYVK  438

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             AS+AYLGKQED+IDFDITYYRSKDPM PRLY+DILEEIEQ+A+FKYGALPHWGKNRN+AF
Sbjct  439   ASSAYLGKQEDAIDFDITYYRSKDPMAPRLYQDILEEIEQIALFKYGALPHWGKNRNLAF  498

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              G I++YK+AGEFLKVK  +DP  LFSSEW+DQILGL+ G++ +K+GCALEGLCICS D 
Sbjct  499   DGVIKRYKNAGEFLKVKNMYDPSRLFSSEWTDQILGLRNGVTTLKEGCALEGLCICSHDI  558

Query  1778  HCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             HCAP+KGY CR GK +++AKVC +++
Sbjct  559   HCAPSKGYLCRPGKTFQNAKVCTRVS  584



>ref|XP_010267413.1| PREDICTED: uncharacterized protein LOC104604665 [Nelumbo nucifera]
Length=594

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/566 (66%), Positives = 457/566 (81%), Gaps = 5/566 (1%)
 Frame = +2

Query  164   FLIFT-VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             FLI   V  S P+DPIKC+   +       SYG FPDR VC+AA+ VYP +E EL++++A
Sbjct  21    FLILCMVWCSPPDDPIKCSAQTSNCTITN-SYGAFPDRSVCQAAETVYPTSEKELVAVVA  79

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              AT  KRKMK ATRYSHSIPKL CP+G++GLLI+TKYLN TLEV+A+ MTM VESGV+LR
Sbjct  80    KATMSKRKMKVATRYSHSIPKLVCPDGEEGLLITTKYLNHTLEVDAAKMTMKVESGVTLR  139

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             ++I +AAKAGLALPY+PYWWGLTVGGL+GTG+HGSSLWG GSSVHDHVI +RIVTPA  +
Sbjct  140   ELINQAAKAGLALPYAPYWWGLTVGGLLGTGAHGSSLWGKGSSVHDHVIGLRIVTPAGPE  199

Query  701   EGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             +GYA +R L   + D+ AA+VSLGVLGVISQ+TF+LQP+FKRSI+ +VKND DL  EA +
Sbjct  200   DGYAKVRVLNNSHPDMDAAKVSLGVLGVISQITFQLQPIFKRSITNLVKNDSDLADEAVR  259

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
             FG QHEFADM W P    V+YR+DDRVSTN SGNGL DF G R+  +  L  +R  EE Q
Sbjct  260   FGNQHEFADMTWYPSQGKVIYRIDDRVSTNLSGNGLNDFIGFRSTLSLSLALVRSSEEIQ  319

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             ES  +AD KC +  +    ++    +GLTNDGV F GYPVIGY N +Q+SG+CLDS  D+
Sbjct  320   ESTKNADGKCISSKITTSTLMGG-GFGLTNDGVSFKGYPVIGYHNRLQASGSCLDSPRDS  378

Query  1241  --LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
                 CPWDP+V   FFHQTT SI L+ VK+FI+DVQ+L+ LEPK++C L LYDGILMRYV
Sbjct  379   HITACPWDPKVKSQFFHQTTVSIGLSNVKNFIQDVQELIALEPKAMCGLELYDGILMRYV  438

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
             KAS+AYLGKQED+IDFD+TYYRSK+P+ PRL+EDI EE+EQMA+FKYG LPHWGKNRNVA
Sbjct  439   KASSAYLGKQEDAIDFDMTYYRSKNPLTPRLFEDIYEEVEQMALFKYGGLPHWGKNRNVA  498

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F GAI+KY ++ EFL+VK+ +DPLGLFSS+W+DQ+LGL+TG++I+K+GCALEGLCICSQD
Sbjct  499   FDGAIKKYHNSREFLRVKEAYDPLGLFSSQWTDQVLGLQTGVTIIKEGCALEGLCICSQD  558

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKI  1852
              HCAP+KGYFCR G+VYKDA+VC ++
Sbjct  559   IHCAPDKGYFCRPGRVYKDARVCTRL  584



>ref|XP_006491357.1| PREDICTED: L-gulonolactone oxidase-like [Citrus sinensis]
Length=592

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/564 (65%), Positives = 455/564 (81%), Gaps = 3/564 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             +F VG S PEDPIKC+ +   +CTITNSYG FPDR  C+AA   YP +E E++S+++ AT
Sbjct  25    VFIVGCSPPEDPIKCSSSKNSSCTITNSYGMFPDRSACKAADVAYPTSEQEIISVVSAAT  84

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
               KRKMK ATR+SHSIPKL CP+G DGLLISTKYLN+ + ++  +MT+T+ESGV+LRQ+I
Sbjct  85    IAKRKMKVATRFSHSIPKLVCPDGQDGLLISTKYLNKIINIDTEAMTITMESGVTLRQII  144

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
              E+AKAGLALPY+PYWWGLT+GGL+GTG+HGSSLWG GSS+HD+V+ +RIV+     +GY
Sbjct  145   GESAKAGLALPYTPYWWGLTIGGLIGTGAHGSSLWGRGSSIHDYVVELRIVSSGGPDDGY  204

Query  710   ATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGF  889
             A +R L + + D+ AA+VSLGVLGVISQVT KLQP+FKRSI+F++KND +LG EA  FG 
Sbjct  205   AKVRVLNENDQDLDAAKVSLGVLGVISQVTLKLQPLFKRSITFLMKNDSELGDEAGSFGH  264

Query  890   QHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESI  1069
             QHEFAD+ W P     +YR+DDR+S+N +GN ++++   R+  +  L  +R  EE+QES 
Sbjct  265   QHEFADIVWYPSQHKALYRIDDRISSNATGNAVYNYIPFRSTLSATLATIRTTEENQESR  324

Query  1070  GDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--  1243
              DA+ KC    L+   +V   ++GLTN+G+ F+GYPVIG+ N +QSSGTCLDS  D+L  
Sbjct  325   SDANGKCIGAKLVTSTLVTS-AFGLTNNGIAFTGYPVIGHHNRLQSSGTCLDSPQDSLIT  383

Query  1244  TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAS  1423
              C WDPR+ G FFHQTTFSI L+ VKSFI+D+QKL+ LEPK+LC L LY+GILMRYVKAS
Sbjct  384   ACAWDPRIKGEFFHQTTFSIRLSVVKSFIDDIQKLIKLEPKALCGLELYNGILMRYVKAS  443

Query  1424  TAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQG  1603
             +AYLGKQEDS+DFDITYYRSKDPM PRLYEDILEEIEQ+A+FKYG  PHWGKNRN+ F G
Sbjct  444   SAYLGKQEDSLDFDITYYRSKDPMTPRLYEDILEEIEQLAVFKYGGFPHWGKNRNLVFDG  503

Query  1604  AIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHC  1783
              I+KYK+AGEF KVK K+DPLGLFSSEW+DQ+LGLK G++I K+GCALEGLCICSQD HC
Sbjct  504   VIKKYKNAGEFFKVKDKYDPLGLFSSEWTDQVLGLKEGVTIYKEGCALEGLCICSQDIHC  563

Query  1784  APNKGYFCRAGKVYKDAKVCVKIN  1855
             AP KGY CR GKVYKDA+VC +I+
Sbjct  564   APTKGYLCRPGKVYKDARVCTRIS  587



>ref|XP_009799011.1| PREDICTED: L-gulonolactone oxidase-like isoform X1 [Nicotiana 
sylvestris]
Length=564

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/560 (67%), Positives = 456/560 (81%), Gaps = 3/560 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
             V SS PEDPIKCT  N  NCTITNSYG FPDR +C+A +AV+P TE EL+S++A AT  K
Sbjct  6     VKSSPPEDPIKCTYKNNFNCTITNSYGAFPDRSICKAGQAVFPTTEEELISVVANATMIK  65

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RKMK  TR+SHSIPKL CP+G+DGLLISTK+LN+ L V+  +M++TVESGV+L+Q+I EA
Sbjct  66    RKMKVTTRFSHSIPKLVCPDGEDGLLISTKFLNKILRVDQENMSITVESGVTLKQLISEA  125

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             AK+GL LPY+PYWWGLT+GGL+GTG+HGSSLWG+GSSVHD+++ +RIVTPA   + YA I
Sbjct  126   AKSGLVLPYAPYWWGLTIGGLIGTGAHGSSLWGLGSSVHDYIVQLRIVTPAEAAQNYAQI  185

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             RTL+ GN ++ AARVSLGVLGVISQ+T KL+P+FKR+I+   +ND DLG EA  FG +HE
Sbjct  186   RTLENGNPELDAARVSLGVLGVISQITLKLEPVFKRAITLSERNDSDLGDEAAVFGRKHE  245

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F D  W P  R VVYR+DDRV  NT GNGL DF G R+  +  L  LR  EE+QES  D+
Sbjct  246   FGDFTWYPSQRKVVYRIDDRVPANTPGNGLNDFPGFRSTASLVLAILRSSEENQESRNDS  305

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCP  1252
               KC++  L    +    +YGLTN+G  F+GYPV+G+ N +Q+SGTCL+SL D     CP
Sbjct  306   GGKCASAKLTTSTLK-IGAYGLTNNGFAFTGYPVVGFHNRVQASGTCLNSLEDARITACP  364

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WD RV GLFFHQTTFSI+L+KVK FI+DVQKLVDLEPK+LCVL LY+GILMRY+ AS AY
Sbjct  365   WDSRVKGLFFHQTTFSINLSKVKGFIQDVQKLVDLEPKALCVLDLYNGILMRYLTASNAY  424

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LG+QED++DFDITYYRSKDPM PRL+ED LEE+EQ+A FKYGALPHWGKNRNVAF GAI+
Sbjct  425   LGEQEDALDFDITYYRSKDPMSPRLFEDFLEEVEQLAFFKYGALPHWGKNRNVAFIGAIK  484

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KY++AG+FLKVK+++D LGLFSSEW+DQ+LGLK GL IVK+GCALEGLCICS+D HCAP 
Sbjct  485   KYRNAGKFLKVKERYDKLGLFSSEWTDQVLGLKDGLIIVKEGCALEGLCICSEDIHCAPK  544

Query  1793  KGYFCRAGKVYKDAKVCVKI  1852
              GYFCR GK+YKDA+VC ++
Sbjct  545   MGYFCRPGKIYKDARVCTRL  564



>ref|XP_006444740.1| hypothetical protein CICLE_v10019421mg [Citrus clementina]
 gb|ESR57980.1| hypothetical protein CICLE_v10019421mg [Citrus clementina]
Length=589

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/562 (65%), Positives = 453/562 (81%), Gaps = 3/562 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I  +G S PEDPIKC+ +   +CTITNSYG FPDR VC+AA   YP +E E++S+++ AT
Sbjct  21    IAALGCSPPEDPIKCSSSKNSSCTITNSYGMFPDRSVCKAADVAYPTSEQEIISVVSAAT  80

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
               KRKMK ATR+SHSIPKL CP+G DGLLISTKYLN+ + ++  +MT+T+ESGV+LRQ+I
Sbjct  81    IAKRKMKVATRFSHSIPKLVCPDGQDGLLISTKYLNKIINIDTEAMTITMESGVTLRQII  140

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
              E+AKAGLALPY+PYWWGLT+GGL+GTG+HGSSLWG GSS+HD+V+ +RIV+     +GY
Sbjct  141   GESAKAGLALPYTPYWWGLTIGGLIGTGAHGSSLWGRGSSIHDYVVELRIVSSGGPDDGY  200

Query  710   ATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGF  889
             A +R L + + D+ AA+VSLGVLGVISQVT KLQP+FKRSI+F++KND +LG EA  FG 
Sbjct  201   AKVRVLNENDQDLDAAKVSLGVLGVISQVTLKLQPLFKRSITFLMKNDSELGDEAGSFGH  260

Query  890   QHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESI  1069
             QHEFAD+ W P     +YR+DDR+S+N +GN ++++   R+  +  L  +R  EE+QES 
Sbjct  261   QHEFADIVWYPSQHKALYRIDDRISSNATGNAVYNYIPFRSTLSATLATIRTTEENQESR  320

Query  1070  GDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--  1243
              DA+ KC    L+   +V   ++GLTN+G+ F+GYPVIG+ N +QSSGTCLDS  D+L  
Sbjct  321   SDANGKCIGAKLVTSTLVTS-AFGLTNNGIAFTGYPVIGHHNRLQSSGTCLDSPQDSLIT  379

Query  1244  TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAS  1423
              C WDPR+ G FFHQTTFSI L+ VKSFI+D+QKL+ LEPK+LC L LY+GILMRYVKAS
Sbjct  380   ACAWDPRIKGEFFHQTTFSIRLSVVKSFIDDIQKLIKLEPKALCGLELYNGILMRYVKAS  439

Query  1424  TAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQG  1603
             +AYLGKQEDS+DFDITYYRSKDPM PRLYEDILEEIEQ+A+FKYG  PHWGKNRN+ F G
Sbjct  440   SAYLGKQEDSLDFDITYYRSKDPMTPRLYEDILEEIEQLAVFKYGGFPHWGKNRNLVFDG  499

Query  1604  AIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHC  1783
              I+KYK+AGEF KVK K+DPLGLFSSEW+DQ+LGLK G++I K+GCALEGLCICSQD HC
Sbjct  500   VIKKYKNAGEFFKVKDKYDPLGLFSSEWTDQVLGLKEGVTIYKEGCALEGLCICSQDIHC  559

Query  1784  APNKGYFCRAGKVYKDAKVCVK  1849
             AP KGY CR GKVYKDA+VC +
Sbjct  560   APTKGYLCRPGKVYKDARVCTQ  581



>ref|XP_010251945.1| PREDICTED: L-gulonolactone oxidase-like isoform X1 [Nelumbo nucifera]
Length=588

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/578 (65%), Positives = 467/578 (81%), Gaps = 10/578 (2%)
 Frame = +2

Query  131   SINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPK  310
             S+N+L+  +    +  +  S PEDPIKC+  +T NCTITNSYG FPDR VCRAA+ VYP 
Sbjct  15    SLNLLLISH----MVRMRCSPPEDPIKCSPPSTSNCTITNSYGAFPDRSVCRAAEVVYPI  70

Query  311   TEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMT  490
             +E EL+S++A AT +KRKMK  TRYSHSIPKL CP+G DGLLISTKYL + L+V+A++M 
Sbjct  71    SEEELISVVANATMRKRKMKVVTRYSHSIPKLVCPDGQDGLLISTKYLRQILKVDATAMR  130

Query  491   MTVESGVSLRQVIEEAA-KAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
             MTVESGV+LR++I+EAA KAGLALPY+PYWWGLTVGGL+GTG+HGSSLWG GSSVHD+VI
Sbjct  131   MTVESGVTLRELIDEAANKAGLALPYTPYWWGLTVGGLLGTGAHGSSLWGKGSSVHDYVI  190

Query  668   HIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
              +RIVTPA   +GYA +R L   + DI AA++SLGVLGV+SQVTF+LQP+FKRSI+ +VK
Sbjct  191   GLRIVTPAGPNQGYAVVRVLDNSHDDINAAKLSLGVLGVVSQVTFELQPLFKRSITNLVK  250

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             +D DLG++A  FG QHE+ADM W P  + VVYR+DDRVS+N SGNG  +F G R+  +  
Sbjct  251   SDSDLGEQALNFGKQHEYADMAWYPSQQKVVYRIDDRVSSNVSGNGFNNFIGFRSTPSLT  310

Query  1028  LNALREKEEHQESIGDADEKC-SNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQ  1204
             L  +R  EE QES  DAD KC ++Q   +  M     YGLTNDG+ F+GYPVIGY N +Q
Sbjct  311   LAMIRSTEETQESTSDADAKCLTSQITTSTLMAN--GYGLTNDGISFTGYPVIGYHNLLQ  368

Query  1205  SSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCV  1378
             +SGTCLDS  D+L   CPWDPRV   FFHQT  SI L KV++FIEDVQKLV +EPK++C 
Sbjct  369   ASGTCLDSPEDSLVTACPWDPRVKSQFFHQTAISIGLNKVRNFIEDVQKLVAMEPKAMCG  428

Query  1379  LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYG  1558
             L L +GILMRYVKAS AYLGKQED+IDFD+TYYRS++PM PRL+EDILEE+EQ+A+FKYG
Sbjct  429   LELNNGILMRYVKASNAYLGKQEDAIDFDMTYYRSRNPMTPRLFEDILEEVEQLALFKYG  488

Query  1559  ALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
              LPHWGKNRN+AF   I KY++A  FL+V++++DPLGLFSSEW+DQ+LGL+ G++I K+G
Sbjct  489   GLPHWGKNRNLAFDDVINKYRNARAFLQVRERYDPLGLFSSEWTDQVLGLQKGVAINKEG  548

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CALEGLCICSQD HCAP+KGYFCRAG+VYKDA+VC ++
Sbjct  549   CALEGLCICSQDIHCAPDKGYFCRAGRVYKDARVCTRL  586



>ref|XP_010690348.1| PREDICTED: L-gulonolactone oxidase-like [Beta vulgaris subsp. 
vulgaris]
Length=587

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/562 (66%), Positives = 449/562 (80%), Gaps = 4/562 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
              L++ VG S PEDPIKC+  N+       SYG FPDR  CR A+A+YP +E EL++ +A 
Sbjct  23    LLLYNVGCSPPEDPIKCSTKNSNCTITN-SYGMFPDRTTCRVAEAMYPTSEDELIAAVAE  81

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
             ATK  RKMK ATR+SHSIPKL CP+G DGLLISTK LN+  +++ ++ TMTV+SGV+LRQ
Sbjct  82    ATKNSRKMKVATRFSHSIPKLVCPDGKDGLLISTKNLNKIHKIDTTAKTMTVDSGVTLRQ  141

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +I EAAKA L+LPY+PYWWGLT+GG++GTG+HGSSLWG+GS+VHDHV+ +RIV+P   K+
Sbjct  142   LINEAAKANLSLPYAPYWWGLTIGGMLGTGAHGSSLWGMGSAVHDHVVELRIVSPGGPKD  201

Query  704   GYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             GY  IRTL + + D+ AA+VSLGVLGVISQVT KL+P+FKRSI++  K D DLG +A  F
Sbjct  202   GYVKIRTLNETDVDLDAAKVSLGVLGVISQVTLKLEPIFKRSITYTKKIDSDLGDQALIF  261

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G QHEFAD+ W P  + V+YR+DDRV   T GNGL DF G R+  +  L  +R  EE+QE
Sbjct  262   GNQHEFADLTWYPSRKEVMYRIDDRVPLTTKGNGLNDFTGFRSTLSAALAIIRSSEENQE  321

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
             S  DA+ KC    L    ++   +YGLTN+GV F+GYPV+GYQN +QSSGTCLDS  D L
Sbjct  322   SREDAEGKCIGSKLTTS-LLRANAYGLTNNGVLFTGYPVVGYQNRLQSSGTCLDSREDAL  380

Query  1244  T--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
             T  CPWD RV G FFHQTTFSI ++KVK+FI+DVQKLV LEPKS C    Y+GILMRYVK
Sbjct  381   TTACPWDSRVKGEFFHQTTFSIGMSKVKAFIQDVQKLVSLEPKSFCGTEQYNGILMRYVK  440

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             ASTAYLGKQED IDFDITYYRSK+P+ PRL+EDILEE+EQMAMFKYG LPHWGKNRN+AF
Sbjct  441   ASTAYLGKQEDGIDFDITYYRSKNPLTPRLFEDILEEMEQMAMFKYGGLPHWGKNRNLAF  500

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
             +GAI+KYKS GEF+KV K+FDP GLFSSEW +Q+LGL+ GLSIVK+GCALEGLCICSQD+
Sbjct  501   EGAIKKYKSGGEFIKVMKRFDPKGLFSSEWINQVLGLEEGLSIVKEGCALEGLCICSQDS  560

Query  1778  HCAPNKGYFCRAGKVYKDAKVC  1843
             HCAP KGYFCR G+VYKDA+VC
Sbjct  561   HCAPTKGYFCRPGRVYKDARVC  582



>ref|XP_004246775.1| PREDICTED: L-gulonolactone oxidase-like [Solanum lycopersicum]
Length=602

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/589 (65%), Positives = 466/589 (79%), Gaps = 8/589 (1%)
 Frame = +2

Query  104   SHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVC  283
             SH+  M  + I  L  I+  FLIF+V SS PEDPIKC+ N   NCTITNSYG FPDR +C
Sbjct  15    SHSPVMVDLKIIKLSLIF--FLIFSVKSSPPEDPIKCSHNTNFNCTITNSYGAFPDRAIC  72

Query  284   RAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDD---GLLISTKYL  454
             +A++A++P TE EL+S++A A ++KRKMK ATR+SHSIPKL C + DD   GLLISTKYL
Sbjct  73    KASEAIFPTTEEELISVVANAAREKRKMKIATRFSHSIPKLVCLDNDDQDQGLLISTKYL  132

Query  455   NRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLW  634
             N+ L ++  +M++TVESGV+LRQ+I EA KAGL LPY+PYWWGLT+GGL+GTG+HGSSLW
Sbjct  133   NKILRIDQENMSITVESGVTLRQLISEAGKAGLVLPYAPYWWGLTIGGLIGTGAHGSSLW  192

Query  635   GVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQP  814
             G+GSSVHD+++ +RIVTPA     YA +R L+ G+S++ AARVSLGVLGV+SQVT KL+ 
Sbjct  193   GMGSSVHDYIMQLRIVTPADVSYNYAKVRILENGSSELNAARVSLGVLGVVSQVTLKLER  252

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             +FKRSI+   ++D +LG++AT FG QHEFAD  W P  R V+YR+DDRVS NT GN L D
Sbjct  253   VFKRSITLSERDDSNLGEDATTFGRQHEFADFTWYPSQRKVIYRIDDRVSPNTRGNALND  312

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             F G R+  +  L  LR  EE+QE   DA  KCS+  L    +    +YGLTN+G  F+GY
Sbjct  313   FLGFRSTPSLVLAILRTTEENQELTNDAGGKCSSAKLTTSTLK-LGAYGLTNNGFTFTGY  371

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PV+G  N +Q+SGTCLDSL D    TCPWD RV GLFFHQTTFSISL+KVK FIEDVQKL
Sbjct  372   PVVGLHNRVQASGTCLDSLEDATITTCPWDHRVKGLFFHQTTFSISLSKVKGFIEDVQKL  431

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V LEPK+LCVL LY+GILMRYV  S AYLGKQED +DFDITYYRSKD M PRL+EDILEE
Sbjct  432   VVLEPKALCVLDLYNGILMRYVTTSNAYLGKQEDGLDFDITYYRSKDAMSPRLFEDILEE  491

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             +EQ+A FKYGALPHWGKNRNVAF GAI KYK+  +FLKVK+ +D LGLFSSEW++Q+LGL
Sbjct  492   VEQLAFFKYGALPHWGKNRNVAFIGAITKYKNVDKFLKVKQSYDQLGLFSSEWTNQVLGL  551

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             K GL+I+K+GCALEGLCICS+D HCAP KGYFCR G++YKDA+VC +++
Sbjct  552   KEGLTILKEGCALEGLCICSEDIHCAPKKGYFCRPGRIYKDARVCTRLS  600



>gb|KDP28425.1| hypothetical protein JCGZ_14196 [Jatropha curcas]
Length=581

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/582 (64%), Positives = 458/582 (79%), Gaps = 10/582 (2%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLI-FTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAK  295
             M K+   +L + Y  FL+ F V  + PEDPIKC   NT       SYGTFPDR +C+AA 
Sbjct  1     MGKIFRRVLRSTYCLFLLLFAVNCTPPEDPIKCASKNTNCTITN-SYGTFPDRSICKAAN  59

Query  296   AVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVN  475
               YP TE EL+S++A ATK K KMK ATRYSHSIPKL CPEG++GLLISTKYLN+ LE++
Sbjct  60    VAYPTTEKELVSVVANATKAKTKMKVATRYSHSIPKLVCPEGENGLLISTKYLNKVLEID  119

Query  476   ASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVH  655
               SM MTVESGV+LRQ+I+EAAKAGL LPYSPYWWGLT+GGL+ TG+HGS+LW  GSSVH
Sbjct  120   FESMKMTVESGVTLRQLIDEAAKAGLVLPYSPYWWGLTIGGLLSTGAHGSTLWNKGSSVH  179

Query  656   DHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSIS  835
             D+V+ + IV+P + ++GY  +R L + NS++KAARVSLGVLGVIS+VTF+L+P+FKRSIS
Sbjct  180   DYVVALTIVSPGSAEDGYVNVRRLDERNSELKAARVSLGVLGVISKVTFQLEPLFKRSIS  239

Query  836   FVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAV  1015
             FVVKND DL  +A  FG QHEFAD+ W P     VYR DDRV  NTSGNG +D    R+ 
Sbjct  240   FVVKNDSDLADQAASFGRQHEFADITWYPSQHQAVYRTDDRVPINTSGNGKYDSIPFRSA  299

Query  1016  GTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQN  1195
              +  L  +R  EE QES+GDA+ KC +  L+   ++   ++GLTN+     GYPVIG+QN
Sbjct  300   PSLGLAVIRATEESQESLGDAEGKCISARLVTTSLLTS-AFGLTNN-----GYPVIGFQN  353

Query  1196  HMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKS  1369
              +QSSGTCLDSL D L   CPWDPRV G +F QTTF ISLT V  FI+DVQKLV LEPK 
Sbjct  354   RIQSSGTCLDSLEDALITACPWDPRVKGEYFLQTTFRISLTAVNFFIQDVQKLVKLEPKG  413

Query  1370  LCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMF  1549
             LCVL  Y+GILMRYVKASTAYLG+QED++DFDITYYRSKDP+ PRL+EDILEEIEQ+A+F
Sbjct  414   LCVLEQYNGILMRYVKASTAYLGEQEDALDFDITYYRSKDPLTPRLFEDILEEIEQIAVF  473

Query  1550  KYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIV  1729
             KYG LPHWGKNRN+AF+G I+KYK+A EFLK+K ++DP+GLFS++W+D++LG+K G+++V
Sbjct  474   KYGGLPHWGKNRNLAFEGVIKKYKNAKEFLKIKDEYDPMGLFSNDWTDRVLGVKDGVTVV  533

Query  1730  KDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             K+GCALEGLCICS+D HCAP+KGYFCR GKV K+A+VC  I+
Sbjct  534   KEGCALEGLCICSEDIHCAPSKGYFCRPGKVDKNARVCTLIS  575



>ref|XP_006363599.1| PREDICTED: L-gulonolactone oxidase-like [Solanum tuberosum]
Length=583

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/568 (66%), Positives = 457/568 (80%), Gaps = 6/568 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             F+I++V SS PEDPIKC+ N   NCTITNSYG FPDR +C+A++A+YP TE EL+SI+A 
Sbjct  14    FIIYSVKSSPPEDPIKCSYNTNFNCTITNSYGAFPDRAICKASQAIYPSTEEELISIVAN  73

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDD---GLLISTKYLNRTLEVNASSMTMTVESGVS  514
             AT++KRKMK ATR+SHSIPKL C + DD   GLLISTKYLN+ L ++   M++TVESGV+
Sbjct  74    ATREKRKMKVATRFSHSIPKLVCLDNDDQYRGLLISTKYLNKILRIDQEDMSITVESGVT  133

Query  515   LRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPAT  694
             L+Q+I EA KAGL LPY+PYWWGLT+GGL+GTG+HGSSLWG+GSSVHD+++ +RIVTPA 
Sbjct  134   LKQLISEAGKAGLVLPYAPYWWGLTIGGLIGTGAHGSSLWGMGSSVHDYIMRLRIVTPAD  193

Query  695   EKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
                 YA +  L+ G+S++ A RVSLGVLGV+SQVT KL+ +FKRSI+   ++D +LG++A
Sbjct  194   ASYNYAKVHILENGSSELNAVRVSLGVLGVVSQVTLKLERVFKRSITLSERDDSNLGEDA  253

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
             + FG QHEFAD  W P  R V+YR+DDRVS +T GN L DFFG R+  +  L  LR  EE
Sbjct  254   STFGRQHEFADFTWSPSQRKVIYRIDDRVSASTPGNALNDFFGFRSTSSLVLAILRTTEE  313

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
             +QES  DA  KCS+  L    +    +YGLTN+G  F+GYPV+G  N +Q+SGTCLDSL 
Sbjct  314   YQESKNDAGGKCSSAKLTTSTLK-IGAYGLTNNGFTFTGYPVVGLHNRVQASGTCLDSLE  372

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             D    TCPWD RV GLFFHQTTFSISL+KVK FIEDVQKLV LEPK+LCVL LY+GILMR
Sbjct  373   DATITTCPWDHRVKGLFFHQTTFSISLSKVKGFIEDVQKLVVLEPKALCVLDLYNGILMR  432

Query  1409  YVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRN  1588
             YV  S AYLGKQED +DFDITYYRSKDPM PRL+EDI+EE+EQ+A FKYGALPHWGKNRN
Sbjct  433   YVTTSNAYLGKQEDGLDFDITYYRSKDPMSPRLFEDIIEEVEQLAYFKYGALPHWGKNRN  492

Query  1589  VAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICS  1768
             VAF GAI KYK+  +FLKVK+ +D LGLFSSEW++Q+LGLK GL+IVK+GCALEGLCICS
Sbjct  493   VAFIGAINKYKNVDKFLKVKQSYDQLGLFSSEWTNQVLGLKDGLTIVKEGCALEGLCICS  552

Query  1769  QDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +D HCAP KGYFCR G++YKDA+VC ++
Sbjct  553   EDIHCAPKKGYFCRPGRIYKDARVCTRL  580



>gb|KHG02056.1| L-gulonolactone oxidase [Gossypium arboreum]
Length=589

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/564 (64%), Positives = 449/564 (80%), Gaps = 4/564 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             +  VG + P +P+KC+  ++       SYG FPDR +CRA    YP +E EL+SI++ AT
Sbjct  25    VVLVGCNPPGEPVKCSTKDSNCTVTN-SYGMFPDRAICRAGNVAYPTSEQELVSIVSAAT  83

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             K KRKMK  T +SHSIPKL CP+G DGLL+STK LNR L+ N  +MTMTVESGV+LRQ+I
Sbjct  84    KSKRKMKVVTHFSHSIPKLVCPDGQDGLLVSTKNLNRVLKTNTEAMTMTVESGVTLRQLI  143

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
              EAAKAGLALPY+PYWWGLT+GGL+GTG+HGSSLWG GSSVHD+V+ +RIV+PA  ++GY
Sbjct  144   TEAAKAGLALPYAPYWWGLTIGGLLGTGAHGSSLWGKGSSVHDYVVEMRIVSPAKAEDGY  203

Query  710   ATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGF  889
             A +  L + + D+ AA+VSLGVLGVISQVTFKLQP+FKRSI++V K+D DLG EA  FG 
Sbjct  204   AKVWVLNERDKDLDAAKVSLGVLGVISQVTFKLQPLFKRSITYVRKDDTDLGDEAVTFGK  263

Query  890   QHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESI  1069
              HEFAD+ W P  R  +YR+DDRV  N SGNG+++F   R+  +  L  +R  EE QES 
Sbjct  264   LHEFADIFWYPSQRKAIYRIDDRVPINVSGNGVYNFTPFRSTLSLVLALVRSSEETQESS  323

Query  1070  GDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--  1243
             GDA+ KC N  L+    +   +YGLTN+G  F+GYPVIG+ + +QSSGTCLDSL D+L  
Sbjct  324   GDAEGKCLNAKLMTS-TLQSSAYGLTNNGAIFTGYPVIGFHDRLQSSGTCLDSLEDSLIT  382

Query  1244  TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAS  1423
              CPWDPR+ G FFHQTTFSI L+ VKSFI+DVQKLV ++PKSLC L LY+GILMRYVKAS
Sbjct  383   ACPWDPRIKGEFFHQTTFSIGLSVVKSFIQDVQKLVSMDPKSLCGLELYNGILMRYVKAS  442

Query  1424  TAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQG  1603
             TAYLGKQED+IDFDITYYRSKDPM PRLY+D+LEEIEQMA+FKY ALPHWGKNRN+ F G
Sbjct  443   TAYLGKQEDAIDFDITYYRSKDPMAPRLYQDVLEEIEQMALFKYKALPHWGKNRNLLFDG  502

Query  1604  AIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHC  1783
              +++YK+ GEFLKVK K+DP GLFSSEW+DQ+LGL+ G++I+K+GCALEGLC+CSQD HC
Sbjct  503   VMKRYKNGGEFLKVKNKYDPWGLFSSEWTDQVLGLRNGVTILKEGCALEGLCVCSQDVHC  562

Query  1784  APNKGYFCRAGKVYKDAKVCVKIN  1855
             AP+KGY C+ GK++ DA+VC ++N
Sbjct  563   APSKGYLCKFGKIFSDARVCARVN  586



>ref|XP_002267268.2| PREDICTED: L-gulonolactone oxidase-like [Vitis vinifera]
Length=583

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/558 (65%), Positives = 442/558 (79%), Gaps = 4/558 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              G S PEDPIKC   NT       SYG FPDR  CRA+   YP TE EL+S++A A   +
Sbjct  20    AGCSPPEDPIKCASKNTNCTITN-SYGAFPDRSRCRASAVAYPTTEEELISVVAKAAMDR  78

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
              KMKA TR+SHSIPKL C +G+DGLLISTKYLNRTL ++ S+MT+++ESG +LRQVI+EA
Sbjct  79    TKMKAVTRFSHSIPKLVCTDGEDGLLISTKYLNRTLNIDPSAMTISIESGATLRQVIDEA  138

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             AKAGLALPY+PYWWGLT+GGL+ +G+HGSSLW  GSSVH++V  +RI+TPA  + GY  +
Sbjct  139   AKAGLALPYAPYWWGLTIGGLLSSGAHGSSLWSKGSSVHEYVEQLRIITPAGRENGYVQV  198

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             RTL   + D+ AA+VS+GVLGVISQ T +LQP+FKRSI +  KND DL  +A  FG +HE
Sbjct  199   RTLDTSHEDLNAAKVSIGVLGVISQATLRLQPLFKRSIDYTTKNDSDLADQAATFGSRHE  258

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FAD+ W P     VYR+DDRV +NTSGNGL DF G R+  +  L  LR  EE+QE  G+A
Sbjct  259   FADITWYPSQGKAVYRIDDRVPSNTSGNGLNDFTGFRSTSSLALALLRTTEENQELKGNA  318

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCP  1252
             D KC+   L  + +    +YGLTN+G+ F+GYPVIGY N +Q+SGTCLDS+ D     CP
Sbjct  319   DGKCTAAKLTTLALSR-AAYGLTNNGIIFTGYPVIGYHNRLQASGTCLDSIEDARITACP  377

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPRV G FFHQTTFSI+L++V+SFI DVQKL+++EPK++C L LY+GILMRYVKASTAY
Sbjct  378   WDPRVKGQFFHQTTFSIALSRVRSFIRDVQKLLEIEPKAMCGLELYNGILMRYVKASTAY  437

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGKQED++DFDIT+YRSKDPM PRLYEDILEE+EQM +FKYG LPHW KNRN+AF GAI+
Sbjct  438   LGKQEDALDFDITHYRSKDPMTPRLYEDILEEVEQMGLFKYGGLPHWAKNRNLAFDGAIK  497

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KYK+A +FLKVK+++DPLGLFSSEW+DQ+LGLK G++I K GCALEGLCICS+D+HCAP 
Sbjct  498   KYKNAWKFLKVKERYDPLGLFSSEWTDQVLGLKKGVTIFKKGCALEGLCICSEDSHCAPE  557

Query  1793  KGYFCRAGKVYKDAKVCV  1846
             KGYFCR GKVYKDA+VC 
Sbjct  558   KGYFCRPGKVYKDARVCT  575



>ref|XP_003548404.1| PREDICTED: uncharacterized protein LOC100789425 [Glycine max]
Length=577

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/580 (64%), Positives = 458/580 (79%), Gaps = 14/580 (2%)
 Frame = +2

Query  137   NILITIYVQFLIFT-VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKT  313
             NI     + FL+F+ V S+ PEDPIKC  +    CTITNSYG FPDR +C+AA+ +YP T
Sbjct  3     NIAFRSTIVFLLFSAVLSTPPEDPIKCATSENTTCTITNSYGAFPDRSICKAAQVLYPTT  62

Query  314   EAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTM  493
             E EL+S++A AT+ K KMK ATR+SHSIPKL CPEG++GLLISTKYLN+ L+V+  + TM
Sbjct  63    EQELVSVVASATRNKTKMKVATRFSHSIPKLVCPEGENGLLISTKYLNKILKVDVETRTM  122

Query  494   TVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHI  673
             TVESGV+L+Q+I EAAK GLALPY+PYWWGLT+GGLMGTG+HGS+L G GS+VHD+V+ +
Sbjct  123   TVESGVTLQQLINEAAKVGLALPYAPYWWGLTIGGLMGTGAHGSTLRGKGSAVHDYVVEL  182

Query  674   RIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             RIV PA  ++GYA +  L + + D+ AA+VSLGVLGVISQ+T KL+P+FKRSI++V K+D
Sbjct  183   RIVRPAGPEDGYAMVENLNEQHEDLNAAKVSLGVLGVISQITLKLEPLFKRSITYVAKDD  242

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              DLG +   FG  HEFAD+ W P     +YRVDDRV  NTSGNGL+DF   R   +    
Sbjct  243   SDLGGQVVAFGDAHEFADITWYPSQHKAIYRVDDRVPINTSGNGLYDFIPFRPTPSLASV  302

Query  1034  ALREKEEHQESIGDADEKC-----SNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNH  1198
              +R  EE QES  DA+ KC     ++  LI        +YGLTN+G+ F+GYP+IG+QN 
Sbjct  303   FIRTTEEIQESTNDANGKCIVASTASNTLITA------AYGLTNNGIIFAGYPIIGFQNR  356

Query  1199  MQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSL  1372
             +QSSG+CLDSL D L  TC WDPR+ GLFFHQTTFSI L+ VKSFIEDVQKLV+LEPK L
Sbjct  357   LQSSGSCLDSLQDALITTCAWDPRMKGLFFHQTTFSIRLSFVKSFIEDVQKLVELEPKGL  416

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             CVLGLY+G+LMRYV AS+AYLG QE+++D DITYYRSKDPM PRLYEDILEE+EQ+ +FK
Sbjct  417   CVLGLYNGMLMRYVTASSAYLGHQENALDIDITYYRSKDPMTPRLYEDILEEVEQLGIFK  476

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVK  1732
             YG LPHWGKNRN+AF+GAI+KYKSA  FLKVK+K+D  GLFSS W+DQ+LGLK G++I+K
Sbjct  477   YGGLPHWGKNRNLAFEGAIKKYKSAEYFLKVKEKYDLDGLFSSTWTDQVLGLKDGVTILK  536

Query  1733  DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             DGCALEGLCIC QD+HC P+KGY+CR GKVYK+A+VC  +
Sbjct  537   DGCALEGLCICLQDSHCNPSKGYYCRPGKVYKEARVCTNL  576



>ref|XP_003548184.1| PREDICTED: L-gulonolactone oxidase-like isoform 1 [Glycine max]
Length=585

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/583 (64%), Positives = 462/583 (79%), Gaps = 5/583 (1%)
 Frame = +2

Query  113   ISMAKMSINILITIYVQFLIFT-VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRA  289
             +S+  MS NI   + + FL+F+ V S+ PEDPIKC  +    CTITNSYG FPDR +C+A
Sbjct  4     LSLTMMS-NIAFRLTLVFLLFSAVLSTPPEDPIKCATSENTTCTITNSYGAFPDRSICKA  62

Query  290   AKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLE  469
             A+ +YP TE EL+S++A AT+ K KMK ATR+SHSIPKL CPEG++GLLISTKYLN+ L+
Sbjct  63    AQVLYPTTEQELVSVVASATRNKTKMKVATRFSHSIPKLVCPEGENGLLISTKYLNKILK  122

Query  470   VNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSS  649
             V+  + TMTVESGV+L+Q+I EAAK GLALPY+PYWWGLT+GGLMGTG+HGS+L G GS+
Sbjct  123   VDVETRTMTVESGVTLQQLINEAAKVGLALPYAPYWWGLTIGGLMGTGAHGSTLRGKGSA  182

Query  650   VHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRS  829
             VHD+V+ IRIV PA  ++GYA +  L + + D+ AA+VSLGVLGVISQ+T KL+P+FKRS
Sbjct  183   VHDYVVGIRIVRPAGSEDGYAKVEILNEQHQDLSAAKVSLGVLGVISQITLKLEPLFKRS  242

Query  830   ISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLR  1009
             I++V K+D DLG +A  FG  HEF D+ W P  R V+YRVDDRV TNTSGNGL+D    R
Sbjct  243   ITYVEKDDSDLGDQAAAFGDAHEFGDILWYPSQRKVLYRVDDRVPTNTSGNGLYDIISFR  302

Query  1010  AVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGY  1189
                ++    +R +E+ QES  DA+ KC +            +YGLTN+G+ F+GYPVIG+
Sbjct  303   PTPSNTSAFIRTREDIQESTKDANGKCIDA-TTTTDTFITEAYGLTNNGIIFTGYPVIGF  361

Query  1190  QNHMQSSGTCLDSLND--NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEP  1363
             QN +QSSG+CLDS  D  N TC WDPRV GLFF+QT FSI L+ VKSFIEDVQKLV+LEP
Sbjct  362   QNRLQSSGSCLDSPQDALNTTCAWDPRVKGLFFYQTAFSIKLSFVKSFIEDVQKLVELEP  421

Query  1364  KSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMA  1543
             K LCVLGLY+G+LMRYV AS+AYLG QED++D DITYYRSKDPM PRLYEDILEEIEQ+ 
Sbjct  422   KGLCVLGLYNGMLMRYVTASSAYLGHQEDALDIDITYYRSKDPMAPRLYEDILEEIEQVG  481

Query  1544  MFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLS  1723
             +FKYG LPHWGKNRN+AF+G I+KYK A +FLKVK+K+D  GLFS+ W+DQ+LGLK G++
Sbjct  482   IFKYGGLPHWGKNRNLAFKGVIKKYKDAKKFLKVKEKYDSHGLFSNTWTDQVLGLKDGVT  541

Query  1724  IVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             I+KDGCALEGLCICSQD+HC P+KGY+CR GKVYK A+VC  +
Sbjct  542   ILKDGCALEGLCICSQDSHCNPSKGYYCRPGKVYKKARVCTHL  584



>ref|XP_004308281.1| PREDICTED: L-gulonolactone oxidase-like [Fragaria vesca subsp. 
vesca]
Length=576

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/573 (65%), Positives = 448/573 (78%), Gaps = 5/573 (1%)
 Frame = +2

Query  134   INILITIYVQFLI-FTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPK  310
             + I+I     FL+ F V S+ PED IKC+ +NT       SYG FPDR VC+A    YP 
Sbjct  4     LGIVIRANCLFLLSFLVCSTPPEDHIKCSSSNTNCTITN-SYGIFPDRTVCKATSVSYPS  62

Query  311   TEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMT  490
             TE EL+ ++A ATK K+ MK ATRYSHSIPKL CP G+DGL+IST  LNR ++V+   M 
Sbjct  63    TEEELIKVVANATKNKQSMKVATRYSHSIPKLVCPRGEDGLIISTNNLNRVVKVDVEGMK  122

Query  491   MTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIH  670
             MTVESGV+LRQVI EAAK  LALPY+PYWWGLTVGGL+GTG+HGS+LWG GSSVHD+V+ 
Sbjct  123   MTVESGVTLRQVISEAAKVALALPYAPYWWGLTVGGLLGTGAHGSTLWGKGSSVHDYVVG  182

Query  671   IRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             +RIV+P   ++GY  +R + +G+ D+ AA+VSLGVLGVISQVT  LQPMFKRSI+++ KN
Sbjct  183   LRIVSPGEPEDGYVKVRDIGEGDKDLNAAKVSLGVLGVISQVTLNLQPMFKRSITYLSKN  242

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D DLG +  KFG QHEFAD+ W P  R  +YRVDDRVS+NTSG GL+DF   RA  +  L
Sbjct  243   DSDLGDQVLKFGKQHEFADILWYPSQRKAIYRVDDRVSSNTSGQGLYDFLPFRATPSLAL  302

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
               LR  EE+QES  DAD KCS   LI   ++   +YGLTN+G  F+GYPVIGYQN +Q+S
Sbjct  303   AVLRTAEENQESKSDADGKCSGAKLITSGLI-STAYGLTNNGKIFTGYPVIGYQNRLQAS  361

Query  1211  GTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLG  1384
             GTCLDS  D+    C WD R+ G FFHQTTFSISL+  KSFI+DVQKLV++EPKSLC + 
Sbjct  362   GTCLDSHEDSRITVCAWDSRIKGEFFHQTTFSISLSVAKSFIQDVQKLVEIEPKSLCGVE  421

Query  1385  LYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGAL  1564
             +Y+GILMRYV ASTAYLGKQED+IDFDITYYRSKDPM PRL+E ILEEIEQ+AMFKYGAL
Sbjct  422   IYNGILMRYVTASTAYLGKQEDAIDFDITYYRSKDPMTPRLHEGILEEIEQLAMFKYGAL  481

Query  1565  PHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCA  1744
             PHWGKNRN+AF G ++KYK   EFL+VK  +DP+GLFSSEWSDQ+LG+K  +++VK+GCA
Sbjct  482   PHWGKNRNIAFDGVMKKYKKGKEFLRVKDVYDPMGLFSSEWSDQVLGIKGEVNLVKEGCA  541

Query  1745  LEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LEGLCICSQD HCAP+KGYFCR GKV+ DA++C
Sbjct  542   LEGLCICSQDIHCAPSKGYFCRPGKVFSDARIC  574



>ref|XP_007219131.1| hypothetical protein PRUPE_ppa015890mg [Prunus persica]
 gb|EMJ20330.1| hypothetical protein PRUPE_ppa015890mg [Prunus persica]
Length=584

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/555 (65%), Positives = 447/555 (81%), Gaps = 3/555 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S+ PE+ IKC+ ++  NCTITNSYG FPDR VCRA    YP TE EL+S++A ATK K K
Sbjct  21    STPPEEHIKCSSSSNTNCTITNSYGIFPDRTVCRAGSVAYPSTEEELISVVAYATKSKTK  80

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK ATR+SHSIPKL CP G DGL+ISTKYLNR + ++A + TMT+ESGV+LRQ+I EAAK
Sbjct  81    MKVATRFSHSIPKLVCPGGQDGLIISTKYLNRVVGIDAEAKTMTLESGVTLRQLISEAAK  140

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
              GLALPY+PYWWGLT+GG++GTG+HGS+LWG GSSVHD+V+ +RI +P   ++GY  IR 
Sbjct  141   VGLALPYAPYWWGLTIGGMLGTGAHGSTLWGKGSSVHDYVVGLRIASPGGPEDGYVKIRR  200

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L  G+ D+KAA+VSLGVLGVISQVT  LQPMFKRSI+++ KND DLG +   FG QHEFA
Sbjct  201   LNDGDKDLKAAKVSLGVLGVISQVTLNLQPMFKRSITYLRKNDSDLGDQVVGFGKQHEFA  260

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P     VYR+DDRVS+NTSGNG FDF   RA  +  L  +R  EE+QES  DAD 
Sbjct  261   DVLWYPSQHKAVYRMDDRVSSNTSGNGFFDFIPFRATSSLELAIIRTTEENQESTRDADG  320

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWD  1258
             KCS   L+   ++   +YGLTN+GV F+GYPVIGYQN +Q+SGTCLDSL D     C WD
Sbjct  321   KCSGAKLVTSALI-NDAYGLTNNGVIFTGYPVIGYQNRLQASGTCLDSLEDARITACAWD  379

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PR+ G FFHQTTFSISL+  K+FI+DV+KLV++EPK+LC + +Y+GIL+RYV AS+AYLG
Sbjct  380   PRIKGEFFHQTTFSISLSVAKNFIQDVKKLVEIEPKALCGVDIYNGILLRYVTASSAYLG  439

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQE++IDFDITYYRSKDPM PRLY+ +LEEIEQMA+FKYGALPHWGKNRN+ F G ++KY
Sbjct  440   KQENAIDFDITYYRSKDPMAPRLYQGVLEEIEQMAVFKYGALPHWGKNRNIVFDGVMKKY  499

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
             K A EFL+VK  +DP+GLFSSEW+DQ+LGLK G++IVK+GCALEGLC+CSQD HCAP+KG
Sbjct  500   KGAKEFLRVKDVYDPMGLFSSEWTDQVLGLKGGVTIVKEGCALEGLCVCSQDIHCAPSKG  559

Query  1799  YFCRAGKVYKDAKVC  1843
             Y CR GKV++ A++C
Sbjct  560   YLCRPGKVFEGARIC  574



>ref|XP_003548406.2| PREDICTED: L-gulonolactone oxidase-like [Glycine max]
Length=592

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/580 (64%), Positives = 457/580 (79%), Gaps = 6/580 (1%)
 Frame = +2

Query  125   KMSINILITIYVQFLIFTVG-SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAV  301
             KM  N  +T  + FL F+V  S+ PEDPIKC+ +   +CTITNSYG FPDR +C+A++ +
Sbjct  12    KMMSNKALTSTLVFLFFSVVLSTPPEDPIKCSNSKNTSCTITNSYGMFPDRSICKASQVL  71

Query  302   YPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNAS  481
             YP +E EL+S++A AT+ K KMK ATRYSHSIPKL CPEG++GLLISTKYLN+  +V+  
Sbjct  72    YPTSEQELVSVVASATRNKTKMKVATRYSHSIPKLVCPEGENGLLISTKYLNKIAKVDVE  131

Query  482   SMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDH  661
             + TMTVESGV+++Q+I EAAK GLALPY+PYWWGLT+GGLMGTG+HGS+LWG GSSVHD+
Sbjct  132   ARTMTVESGVTMKQLINEAAKVGLALPYAPYWWGLTIGGLMGTGAHGSTLWGKGSSVHDY  191

Query  662   VIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFV  841
             V+ +RIV  A  +EGYA   +L + + D+ AA+VSLGVLGVISQVT KL+P+FKRSI++V
Sbjct  192   VVELRIVRAAGPEEGYAKAESLNEQHEDLNAAKVSLGVLGVISQVTLKLEPLFKRSITYV  251

Query  842   VKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGT  1021
              KND DLG +   FG  HEFAD+ W P  R  VYRVDDRV  NTSGNGL+DF   R   +
Sbjct  252   AKNDSDLGDQVAAFGHAHEFADITWYPSQRKAVYRVDDRVPFNTSGNGLYDFIPFRPTPS  311

Query  1022  DCLNALREKEEHQESIGDADEKC-SNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNH  1198
               L  LR  E+ QES GDAD KC  ++   N  +    +YGLTN+G+ F+ YPVIG+QN 
Sbjct  312   LELAILRTTEDLQESTGDADGKCIGSKTTTNTLIT--AAYGLTNNGIIFTVYPVIGFQNR  369

Query  1199  MQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSL  1372
             +Q+SG+CLDSL D     C WD RV G FFHQTTFSISL+  K FIEDVQKLV LEPK  
Sbjct  370   LQASGSCLDSLQDAKITACAWDSRVKGEFFHQTTFSISLSVAKKFIEDVQKLVQLEPKGF  429

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             C + LY+GILMRYVKAS+AYLGKQED++D DITYYRSKDPM PRLYEDILEE+EQ+ +FK
Sbjct  430   CGIELYNGILMRYVKASSAYLGKQEDALDIDITYYRSKDPMTPRLYEDILEEVEQLGIFK  489

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVK  1732
             YG LPHWGKNRN+AF+GAI+KYK+AG FL+VK+K+D  GLFSS W+DQ+LGLK G++I+K
Sbjct  490   YGGLPHWGKNRNLAFEGAIKKYKNAGRFLRVKEKYDLQGLFSSTWTDQMLGLKDGVTILK  549

Query  1733  DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             DGCALEGLCICSQD+HC P+K Y+C+ GKVYK+A+VC  +
Sbjct  550   DGCALEGLCICSQDSHCNPSKDYYCKPGKVYKEARVCTHL  589



>ref|XP_010054135.1| PREDICTED: L-gulonolactone oxidase-like [Eucalyptus grandis]
Length=606

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/581 (62%), Positives = 456/581 (78%), Gaps = 11/581 (2%)
 Frame = +2

Query  131   SINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPK  310
             S++I++ +    +I +V ++ P DPI+CT +         SYG FPDR  C+A    YP 
Sbjct  27    SLHIVVMV-AATMIMSVSATPPADPIRCTSSGCTITN---SYGAFPDRSTCKAGAVAYPT  82

Query  311   TEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMT  490
             +E EL+ ++  ATK KRKMK  TR+SHSIPKL CP+G++GLL+STKY+ R + V+   M 
Sbjct  83    SEEELVWVVGNATKSKRKMKVVTRFSHSIPKLVCPDGEEGLLVSTKYMTRIVRVDQEGMR  142

Query  491   MTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIH  670
             M+VE GV+LRQ+IEEAAK G+ALPY+PYWWGLT+GG++GTG+HGSSLWG GS++HD+V  
Sbjct  143   MSVEGGVTLRQLIEEAAKVGMALPYAPYWWGLTIGGMLGTGAHGSSLWGKGSALHDYVEA  202

Query  671   IRIVTPATEKEGYATIRTL----KQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISF  838
             +RIV P    +GYA IRTL    K  ++++ A +VSLGVLGVI+QVT KLQP+FKRS+++
Sbjct  203   MRIVIPGGPGDGYARIRTLDVNTKSTHAEMNAVKVSLGVLGVIAQVTLKLQPLFKRSLTY  262

Query  839   VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVG  1018
              +K D +LG+++  FG  HEFAD+ W P  + VVYR+D+R + + SGNGL+DF   RA  
Sbjct  263   SIKGDSNLGEQSANFGNLHEFADIIWYPSQQKVVYRIDNRTTLDASGNGLYDFIPFRATS  322

Query  1019  TDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNH  1198
             +  L  +R  EE QESI +AD KC+   LI+   +   +YGLTN+G+ FSGYPVIGY N 
Sbjct  323   SLTLALVRSTEELQESINNADGKCNGAKLISS-TLETDAYGLTNNGIIFSGYPVIGYHNR  381

Query  1199  MQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSL  1372
             +QSSGTCLDS +D LT  CPWDPRV G FFHQTTFSI L+ V+SFIED+Q+LV LEPK+L
Sbjct  382   LQSSGTCLDSPHDGLTTACPWDPRVKGEFFHQTTFSIGLSMVRSFIEDIQQLVTLEPKAL  441

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             C + LY+GILMRYVKAS+AYLGKQED IDFDITYYRSKDP+ PRLY+D+LEEIEQMA+FK
Sbjct  442   CGVELYNGILMRYVKASSAYLGKQEDGIDFDITYYRSKDPLSPRLYQDVLEEIEQMALFK  501

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVK  1732
             YGALPHWGKNRN+AF GAI++YK A EFLKVK+ +DPLGLFSSEW+DQ+LGLK G+SIVK
Sbjct  502   YGALPHWGKNRNLAFDGAIKRYKKAQEFLKVKETYDPLGLFSSEWTDQVLGLKEGVSIVK  561

Query  1733  DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             DGCALEGLCICSQD HCAPNKGY+C+ GKVYK+A+VC + +
Sbjct  562   DGCALEGLCICSQDAHCAPNKGYYCKPGKVYKEARVCTRTS  602



>gb|KDO86595.1| hypothetical protein CISIN_1g009304mg [Citrus sinensis]
Length=538

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/533 (65%), Positives = 432/533 (81%), Gaps = 3/533 (1%)
 Frame = +2

Query  263   FPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLIS  442
             FPDR  C+AA   YP +E E++S+++ AT  KRKMK ATR+SHSIPKL CP+G DGLLIS
Sbjct  2     FPDRSACKAADVAYPTSEQEIISVVSAATIAKRKMKVATRFSHSIPKLVCPDGQDGLLIS  61

Query  443   TKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHG  622
             TKYLN+ + ++  +MT+T+ESGV+LRQ+I E+AKAGLALPY+PYWWGLT+GGL+GTG+HG
Sbjct  62    TKYLNKIINIDTEAMTITMESGVTLRQIIGESAKAGLALPYTPYWWGLTIGGLIGTGAHG  121

Query  623   SSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTF  802
             SSLWG GSS+HD+V+ +RIV+     +GYA +R L + + D+ AA+VSLGVLGVISQVT 
Sbjct  122   SSLWGRGSSIHDYVVELRIVSSGGPDDGYAKVRVLNENDQDLDAAKVSLGVLGVISQVTL  181

Query  803   KLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGN  982
             KLQP+FKRSI+F++KND +LG EA  FG QHEFAD+ W P     +YR+DDR+S+N +GN
Sbjct  182   KLQPLFKRSITFLMKNDSELGDEAGSFGHQHEFADIVWYPSQHKALYRIDDRISSNATGN  241

Query  983   GLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVK  1162
              ++++   R+  +  L  +R  EE+QES  DA+ KC    L+   +V   ++GLTN+G+ 
Sbjct  242   AVYNYIPFRSTLSATLATIRTTEENQESRSDANGKCIGAKLVTSTLVTS-AFGLTNNGIA  300

Query  1163  FSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIED  1336
             F+GYPVIG+ N +QSSGTCLDS  D+L   C WDPR+ G FFHQTTFSI L+ VKSFI+D
Sbjct  301   FTGYPVIGHHNRLQSSGTCLDSPQDSLITACAWDPRIKGEFFHQTTFSIRLSVVKSFIDD  360

Query  1337  VQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYED  1516
             +QKL+ LEPK+LC L LY+GILMRYVKAS+AYLGKQEDS+DFDITYYRSKDPM PRLYED
Sbjct  361   IQKLIKLEPKALCGLELYNGILMRYVKASSAYLGKQEDSLDFDITYYRSKDPMTPRLYED  420

Query  1517  ILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQ  1696
             ILEEIEQ+A+FKYG  PHWGKNRN+ F G I+KYK+AGEF KVK K+DPLGLFSSEW+DQ
Sbjct  421   ILEEIEQLAVFKYGGFPHWGKNRNLVFDGVIKKYKNAGEFFKVKDKYDPLGLFSSEWTDQ  480

Query  1697  ILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +LGLK G++I K+GCALEGLCICSQD HCAP KGY CR GKVYKDA+VC +I+
Sbjct  481   VLGLKEGVTIYKEGCALEGLCICSQDIHCAPTKGYLCRPGKVYKDARVCTRIS  533



>ref|XP_007135308.1| hypothetical protein PHAVU_010G118400g [Phaseolus vulgaris]
 gb|ESW07302.1| hypothetical protein PHAVU_010G118400g [Phaseolus vulgaris]
Length=580

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/570 (64%), Positives = 446/570 (78%), Gaps = 4/570 (1%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELL  328
             T+   F    V S+ PEDPIKC+  NT       SYG FPDR +C A+K +YP TE EL+
Sbjct  10    TLVFLFFCVAVFSTPPEDPIKCSSGNTTCTITN-SYGMFPDRSICHASKVLYPTTEQELV  68

Query  329   SIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESG  508
             S++A A + K KMK ATR+SHSIPKL CPEG +G+LISTKYLN+ ++V+  + TMTVESG
Sbjct  69    SMVASAARSKSKMKVATRFSHSIPKLVCPEGQNGVLISTKYLNKIVKVDVEARTMTVESG  128

Query  509   VSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTP  688
             V+++ +I EAAKAGLALPY+PYWWGLT+GGLMG+G+HGS+LWG GSSVHD+V+++RIV P
Sbjct  129   VTMKDLISEAAKAGLALPYAPYWWGLTIGGLMGSGAHGSTLWGKGSSVHDYVVNLRIVRP  188

Query  689   ATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
             A+ +EGYA + +L + + D+ AA+VSLGVLGVISQ+T KL+  FKRSI++V KND DLG+
Sbjct  189   ASPQEGYAKVESLNEQHEDLNAAKVSLGVLGVISQITLKLEGSFKRSITYVAKNDSDLGE  248

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             E   FG++HEF D+ W P  +  VYRVDDRV  N SGNGL+DF   R   +  L  LR  
Sbjct  249   EVGDFGYEHEFGDITWYPSQQRAVYRVDDRVPINASGNGLYDFIPFRPTSSLALALLRTT  308

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             E+ QES GDAD KC N       ++   +YGLTN+G+ F+GYPVIG+QN +Q+SGTCLDS
Sbjct  309   EDIQESAGDADGKCINAKTTTNTLITS-AYGLTNNGIIFTGYPVIGFQNRLQASGTCLDS  367

Query  1229  LNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
             L D     C WD RV G FFHQTTFSI L+ VK FIEDVQKLV LEPK LC + LY+GIL
Sbjct  368   LKDGKITACAWDSRVKGEFFHQTTFSIGLSVVKDFIEDVQKLVRLEPKGLCGIELYNGIL  427

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             MRYVKAS AYLGKQED++D DITYYRSKDPM PRLYEDILEEIEQ+ +FKYG +PHWGKN
Sbjct  428   MRYVKASKAYLGKQEDALDIDITYYRSKDPMTPRLYEDILEEIEQLGIFKYGGIPHWGKN  487

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN+AF+GAI+KYK+A +FLKVK+K+D  GLFSS W+DQILGLK GL IVKDGCALEGLCI
Sbjct  488   RNLAFEGAIKKYKNAEKFLKVKEKYDSEGLFSSTWTDQILGLKDGLIIVKDGCALEGLCI  547

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CSQD+HC P+KGY+CR GKVYK+A+VC  +
Sbjct  548   CSQDSHCNPSKGYYCRPGKVYKEARVCTHL  577



>ref|XP_008233058.1| PREDICTED: L-gulonolactone oxidase-like [Prunus mume]
Length=593

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/555 (65%), Positives = 446/555 (80%), Gaps = 3/555 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S+ PE+ IKC+ ++  NCTITNSYG FPDR VCRA    YP TE EL+S++A ATK K K
Sbjct  30    STPPEEHIKCSSSSNTNCTITNSYGIFPDRTVCRAGSVAYPSTEEELISVVAYATKSKTK  89

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK ATR+SHSIPKL CP G DGL+ISTKYLNR +E++A + TMT ESGV+L+Q+I EAAK
Sbjct  90    MKVATRFSHSIPKLVCPGGPDGLIISTKYLNRVVEIDAEAKTMTFESGVTLKQLISEAAK  149

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
              GLALPY+PYWWGLT+GG++GTG+HGS+LWG GSSVHD+V+ +RI +P   ++GY  IR 
Sbjct  150   VGLALPYAPYWWGLTIGGMLGTGAHGSTLWGKGSSVHDYVVGLRIASPGGPEDGYVKIRR  209

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L  G+ D+ AA+VSLGVLGVISQVT  LQPMFKRSI+++ K+D DLG +   FG QHEFA
Sbjct  210   LSDGDKDLNAAKVSLGVLGVISQVTLNLQPMFKRSITYLRKSDSDLGDQVVGFGKQHEFA  269

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P     VYR+DDRVS+NTSGNG FDF   RA  +  L  +R  EE+QES  DAD 
Sbjct  270   DVLWYPSQHKAVYRMDDRVSSNTSGNGFFDFIPFRATSSLELAIIRTTEENQESTRDADG  329

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWD  1258
             KCS   L+   ++   +YGLTN+GV F+GYPVIGYQN +Q+SGTCLDSL D     C WD
Sbjct  330   KCSGAKLVTSALI-NNAYGLTNNGVIFTGYPVIGYQNRLQASGTCLDSLEDARITACAWD  388

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PR+ G FFHQTTFSISL+  K+FI+DV+KLV++EPK+LC + +Y+GIL+RYV AS+AYLG
Sbjct  389   PRIKGEFFHQTTFSISLSVAKNFIQDVKKLVEIEPKALCGVDIYNGILLRYVTASSAYLG  448

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQE++IDFDITYYRSKDPM PRLY+ ILEEIEQMA+FKYGALPHWGKNRN+ F G ++KY
Sbjct  449   KQENAIDFDITYYRSKDPMAPRLYQGILEEIEQMAVFKYGALPHWGKNRNIVFDGVMKKY  508

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
             K A EFL+VK  +DP+GLFSSEW+DQ+LGLK G++IVK+GCALEGLCICSQD HCAP+KG
Sbjct  509   KRAKEFLRVKDVYDPMGLFSSEWTDQVLGLKGGVTIVKEGCALEGLCICSQDIHCAPSKG  568

Query  1799  YFCRAGKVYKDAKVC  1843
             Y CR GKV++ A++C
Sbjct  569   YLCRPGKVFEGARIC  583



>ref|XP_002302668.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE81941.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=584

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/565 (63%), Positives = 454/565 (80%), Gaps = 5/565 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             +F VG S PE+ IKC+  NT       SYGTFPDR +C+AA A YP TE EL+SI+A AT
Sbjct  18    VFMVGCSPPENHIKCSSTNTNCTITN-SYGTFPDRSICQAANAAYPTTEEELISIVAAAT  76

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             K KRK+K ATRYSHSIPKL CP+G +GLLIST YLNRTLE++  SMTM+VESGV+LRQ+I
Sbjct  77    KAKRKVKVATRYSHSIPKLVCPDGQNGLLISTDYLNRTLEIDVQSMTMSVESGVTLRQLI  136

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
              EAAKAGLALPYSPYWWGLT+GGL+ TG+HGS+LWG GS++HD+V+ + I++P   ++GY
Sbjct  137   NEAAKAGLALPYSPYWWGLTIGGLLSTGAHGSTLWGKGSAIHDYVVALTIISPGGPEDGY  196

Query  710   ATIRTLKQGNS-DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFG  886
             A +R+L + NS ++ AA+VSLGVLGVIS+VT +LQP+FKRSIS+ VK D DLG +   FG
Sbjct  197   AKVRSLDESNSAELDAAKVSLGVLGVISKVTLQLQPLFKRSISYEVKKDTDLGDQVASFG  256

Query  887   FQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQES  1066
              QHEFAD+ W P     VYR+DDR+S+NTSGNGL+D+   R+  +  L  +R  E+ QES
Sbjct  257   RQHEFADITWYPSQGKAVYRIDDRISSNTSGNGLYDYIPFRSTPSLGLAVVRATEDAQES  316

Query  1067  IGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
             + D D KC++  LI   +   L+YGLTN+G+ F+GYP+IGY N +QSSGTCLDS  D + 
Sbjct  317   LKDPDGKCASAKLITSTLK-NLAYGLTNNGIVFTGYPIIGYHNRLQSSGTCLDSPEDAMI  375

Query  1244  -TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               CPWD R+ G +F Q TFSISL+ VKSFI+DVQ LV L+P++LC L  Y+GILMRYVKA
Sbjct  376   TACPWDSRIKGEYFFQATFSISLSVVKSFIQDVQMLVKLDPRALCGLEQYNGILMRYVKA  435

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             S+AYLGK++D++DFDIT+YR+KDP  PRLYEDILEEIEQ+A+FKYG LPHWGKNRN+ F 
Sbjct  436   SSAYLGKEDDALDFDITFYRNKDPAKPRLYEDILEEIEQLAVFKYGGLPHWGKNRNLVFN  495

Query  1601  GAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNH  1780
             GA++KYK+AG FL+VK+ +DPLGLFS+EW+DQ+LGLK  ++I+K+GCALEGLCICSQD H
Sbjct  496   GALKKYKNAGAFLRVKEMYDPLGLFSNEWTDQVLGLKGDVNIIKEGCALEGLCICSQDIH  555

Query  1781  CAPNKGYFCRAGKVYKDAKVCVKIN  1855
             CAP+KGY CRAGK+Y++A+VC  ++
Sbjct  556   CAPSKGYLCRAGKIYQEARVCAHVS  580



>ref|NP_182199.1| D-arabinono-1,4-lactone oxidase family protein [Arabidopsis thaliana]
 gb|AAC33495.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10749.1| D-arabinono-1,4-lactone oxidase family protein [Arabidopsis thaliana]
Length=603

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/589 (61%), Positives = 449/589 (76%), Gaps = 6/589 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PS+    A     I +   +  L+FT  S+ PEDP+KC   NT       SYG FPDR  
Sbjct  7     PSYGSLNAAFWRTIFVVHCISTLVFTTISTPPEDPVKCVSGNTNCTVTN-SYGAFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             CRAA   YP TEAEL+S++A ATK  RKM+  TRYSHSI KLAC +G DGLLISTK+LN 
Sbjct  66    CRAANVAYPTTEAELISVVAAATKAGRKMRVTTRYSHSITKLACTDGTDGLLISTKFLNH  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T+  +A++MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVRTDATAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IRIV+P +  +G+A +R L++  +  +  AA+VSLGVLGVISQVT KLQP
Sbjct  186   GSAVHDYVTEIRIVSPGSVNDGFAKVRVLRETTTPKEFNAAKVSLGVLGVISQVTLKLQP  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+ +V++ND D G +A  FG +HEFAD  WLP    VVYR+DDRV+ NTSGNGL D
Sbjct  246   MFKRSLRYVMRNDSDFGDQAVTFGMKHEFADFIWLPSQGKVVYRMDDRVAVNTSGNGLLD  305

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             F   R+  +  L  +R  EE QE   DA+ KC+   LI    ++  SYGLTN+G+ F+GY
Sbjct  306   FMPFRSQLSAALAIIRSSEETQERFRDANGKCAGATLITS-TLFATSYGLTNNGMIFTGY  364

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PVIG QN M SSG+CLDSL+D L   CPWD R+   FFHQTTFSI LT+VKSFI D++ L
Sbjct  365   PVIGSQNRMMSSGSCLDSLHDGLITACPWDSRIKSEFFHQTTFSIPLTQVKSFINDIKSL  424

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V +E KSLCVL LYDGILMRYV +S AYLGK+ +++DFD+TYYR+KDP+ PRLYED +EE
Sbjct  425   VKIESKSLCVLELYDGILMRYVTSSPAYLGKETEALDFDLTYYRAKDPLSPRLYEDFIEE  484

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A+FKY ALPHWGKNRN+AF G I+KYK+   FLKVK+ +DP+GLFSSEW+DQILG+
Sbjct  485   IEQIALFKYNALPHWGKNRNLAFDGVIKKYKNVPAFLKVKESYDPMGLFSSEWTDQILGI  544

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             K  ++I+KDGCALEGLC+CS+D HCAP KGYFCR GKVYK+A+VC + +
Sbjct  545   KGNVTIIKDGCALEGLCVCSEDAHCAPTKGYFCRPGKVYKEARVCTRAD  593



>ref|XP_006366360.1| PREDICTED: L-gulonolactone oxidase-like [Solanum tuberosum]
Length=582

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/570 (64%), Positives = 456/570 (80%), Gaps = 5/570 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             F+I+ V SS PEDPIKC+ N  +NCTITNSYGTFPDR +C+AA+AV+P TE EL+SI+A 
Sbjct  14    FVIYLVKSSPPEDPIKCSYNTNLNCTITNSYGTFPDRTICKAAQAVFPTTENELISIVAN  73

Query  344   ATKQKRKMKAATRYSHSIPKLACPEG--DDGLLISTKYLNRTLEVNASSMTMTVESGVSL  517
             AT++ RKMK ATR+SHSIPKL C +    DGLLISTK+LN+ L ++  +M++TVESGV+L
Sbjct  74    ATRENRKMKIATRFSHSIPKLVCLDDSVQDGLLISTKFLNKILRIDQENMSITVESGVTL  133

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATE  697
             RQ+I EA KAGL LPY+PYWWG+T+GGL+GTG+HGSSLWG+GSSVHD+++ +RIVTP+  
Sbjct  134   RQLISEAGKAGLVLPYTPYWWGITIGGLIGTGAHGSSLWGLGSSVHDYIVQLRIVTPSDA  193

Query  698   KEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEAT  877
                Y  +R L+ G+ ++ A RVSLGVLGV+SQVT KL+ +FKRSI+   ++D +LG++A 
Sbjct  194   PNNYTKVRILENGSPELNAVRVSLGVLGVVSQVTLKLERVFKRSITLSERDDSNLGEDAV  253

Query  878   KFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEH  1057
              FG QHEFAD  W P  R V+YR+DDRV TNT GN L  F G R++ +  L  LR  EE+
Sbjct  254   TFGRQHEFADFTWYPSQRKVIYRIDDRVPTNTPGNALNAFLGFRSIPSLVLAILRTTEEN  313

Query  1058  QESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
             QES  DAD KC +  L    +    +YGLTN+G+ F+GYPV+G+QN +Q+SGTCLDS+ D
Sbjct  314   QESTNDADGKCLSAKLTTSTLK-IGAYGLTNNGIAFTGYPVVGFQNRLQASGTCLDSVED  372

Query  1238  N--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRY  1411
                  CPWD RV GLF HQT FSISL+KVK FIEDVQ+LV LEP++LCVL LY+GIL+RY
Sbjct  373   ARITACPWDHRVKGLFVHQTAFSISLSKVKGFIEDVQRLVVLEPRALCVLDLYNGILIRY  432

Query  1412  VKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNV  1591
             V  S AYLGKQED++DFDITYYRSKDPM PRL+ED LEEIEQ+A FKYGALPHWGKNRNV
Sbjct  433   VTTSNAYLGKQEDALDFDITYYRSKDPMSPRLFEDFLEEIEQLAFFKYGALPHWGKNRNV  492

Query  1592  AFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQ  1771
             AF GAI KYK+  +FL+VK+ +D LGLFSSEW++Q+LGLK GL+IVK+GCALEGLCICSQ
Sbjct  493   AFIGAINKYKNVDKFLEVKQSYDQLGLFSSEWTNQVLGLKDGLTIVKEGCALEGLCICSQ  552

Query  1772  DNHCAPNKGYFCRAGKVYKDAKVCVKIN*Q  1861
             D HCAP KGYFCR G++YKDA+VC +++ Q
Sbjct  553   DIHCAPKKGYFCRPGRIYKDARVCTRLSSQ  582



>gb|KHN15894.1| L-gulonolactone oxidase [Glycine soja]
Length=579

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/573 (64%), Positives = 454/573 (79%), Gaps = 6/573 (1%)
 Frame = +2

Query  146   ITIYVQFLIFTVG-SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAE  322
             +T  + FL F+V  S+ PEDPIKC+ +   +CTITNSYG FPDR +C+A++ +YP +E E
Sbjct  6     LTSTLVFLFFSVVLSTPPEDPIKCSNSKNTSCTITNSYGMFPDRSICKASQVLYPTSEQE  65

Query  323   LLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVE  502
             L+S++A AT+ K KMK ATRYSHSIPKL CPEG++GLLISTKYLN+  +V+  + TMTVE
Sbjct  66    LVSVVASATRNKTKMKVATRYSHSIPKLVCPEGENGLLISTKYLNKIAKVDVEARTMTVE  125

Query  503   SGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIV  682
             SGV+++Q+I EAAK GLALPY+PYWWGLT+GGLMGTG+HGS+LWG GSSVHD+V+ +RIV
Sbjct  126   SGVTMKQLINEAAKVGLALPYAPYWWGLTIGGLMGTGAHGSTLWGKGSSVHDYVVELRIV  185

Query  683   TPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDL  862
               A  +EGYA   +L + + D+ AA+VSLGVLGVISQVT KL+P+FKRSI++V KND DL
Sbjct  186   RAAGPEEGYAKAESLNEQHEDLNAAKVSLGVLGVISQVTLKLEPLFKRSITYVAKNDSDL  245

Query  863   GKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALR  1042
             G +   FG  HEFAD+ W P  R  VYRVDDRV  NTSGNGL+DF   R   +  L  LR
Sbjct  246   GDQVAAFGHAHEFADITWYPSQRKAVYRVDDRVPFNTSGNGLYDFIPFRPTPSLELAILR  305

Query  1043  EKEEHQESIGDADEKC-SNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTC  1219
               E+ QES GDAD KC  ++   N  +    +YGLTN+G+ F+ YPVIG+QN +Q+SG+C
Sbjct  306   TTEDLQESTGDADGKCIGSKTTTNTLIT--AAYGLTNNGIIFTVYPVIGFQNRLQASGSC  363

Query  1220  LDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYD  1393
             LDSL D     C WD RV G FFHQTTFSISL+  K FIEDVQKLV LEPK  C + LY+
Sbjct  364   LDSLQDAKITACAWDSRVKGEFFHQTTFSISLSVAKKFIEDVQKLVQLEPKGFCGIELYN  423

Query  1394  GILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHW  1573
             GILMRYVKAS+AYLGKQED++D DITYYRSKDPM PRLYEDILEE+EQ+ +FKYG LPHW
Sbjct  424   GILMRYVKASSAYLGKQEDALDIDITYYRSKDPMTPRLYEDILEEVEQLGIFKYGGLPHW  483

Query  1574  GKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEG  1753
             GKNRN+AF+GAI+KYK+AG FL+VK+K+D  GLFSS W+DQ+LGLK G++I+KDGCALEG
Sbjct  484   GKNRNLAFEGAIKKYKNAGRFLRVKEKYDLQGLFSSTWTDQMLGLKDGVTILKDGCALEG  543

Query  1754  LCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             LCICSQD+HC P+K Y+C+ GKVYK+A+VC  +
Sbjct  544   LCICSQDSHCNPSKDYYCKPGKVYKEARVCTHL  576



>gb|KCW78513.1| hypothetical protein EUGRSUZ_D02649 [Eucalyptus grandis]
Length=567

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/567 (63%), Positives = 447/567 (79%), Gaps = 10/567 (2%)
 Frame = +2

Query  173   FTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATK  352
              +V ++ P DPI+CT +         SYG FPDR  C+A    YP +E EL+ ++  ATK
Sbjct  1     MSVSATPPADPIRCTSSGCTITN---SYGAFPDRSTCKAGAVAYPTSEEELVWVVGNATK  57

Query  353   QKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIE  532
              KRKMK  TR+SHSIPKL CP+G++GLL+STKY+ R + V+   M M+VE GV+LRQ+IE
Sbjct  58    SKRKMKVVTRFSHSIPKLVCPDGEEGLLVSTKYMTRIVRVDQEGMRMSVEGGVTLRQLIE  117

Query  533   EAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYA  712
             EAAK G+ALPY+PYWWGLT+GG++GTG+HGSSLWG GS++HD+V  +RIV P    +GYA
Sbjct  118   EAAKVGMALPYAPYWWGLTIGGMLGTGAHGSSLWGKGSALHDYVEAMRIVIPGGPGDGYA  177

Query  713   TIRTL----KQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
              IRTL    K  ++++ A +VSLGVLGVI+QVT KLQP+FKRS+++ +K D +LG+++  
Sbjct  178   RIRTLDVNTKSTHAEMNAVKVSLGVLGVIAQVTLKLQPLFKRSLTYSIKGDSNLGEQSAN  237

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
             FG  HEFAD+ W P  + VVYR+D+R + + SGNGL+DF   RA  +  L  +R  EE Q
Sbjct  238   FGNLHEFADIIWYPSQQKVVYRIDNRTTLDASGNGLYDFIPFRATSSLTLALVRSTEELQ  297

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             ESI +AD KC+   LI+   +   +YGLTN+G+ FSGYPVIGY N +QSSGTCLDS +D 
Sbjct  298   ESINNADGKCNGAKLISS-TLETDAYGLTNNGIIFSGYPVIGYHNRLQSSGTCLDSPHDG  356

Query  1241  LT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
             LT  CPWDPRV G FFHQTTFSI L+ V+SFIED+Q+LV LEPK+LC + LY+GILMRYV
Sbjct  357   LTTACPWDPRVKGEFFHQTTFSIGLSMVRSFIEDIQQLVTLEPKALCGVELYNGILMRYV  416

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
             KAS+AYLGKQED IDFDITYYRSKDP+ PRLY+D+LEEIEQMA+FKYGALPHWGKNRN+A
Sbjct  417   KASSAYLGKQEDGIDFDITYYRSKDPLSPRLYQDVLEEIEQMALFKYGALPHWGKNRNLA  476

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F GAI++YK A EFLKVK+ +DPLGLFSSEW+DQ+LGLK G+SIVKDGCALEGLCICSQD
Sbjct  477   FDGAIKRYKKAQEFLKVKETYDPLGLFSSEWTDQVLGLKEGVSIVKDGCALEGLCICSQD  536

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
              HCAPNKGY+C+ GKVYK+A+VC + +
Sbjct  537   AHCAPNKGYYCKPGKVYKEARVCTRTS  563



>ref|XP_009366612.1| PREDICTED: L-gulonolactone oxidase-like [Pyrus x bretschneideri]
Length=592

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/558 (63%), Positives = 447/558 (80%), Gaps = 3/558 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S+ PED I C+ ++  NCTITNSYG FPDR +CRA    YP  E EL+S++A ATK K K
Sbjct  30    STPPEDHINCSSSSNTNCTITNSYGIFPDRSMCRAGTVAYPSNEEELISVVANATKNKTK  89

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK ATRYSHSIPKL CP  +DGL+ISTK+L+R +E++A + TMT+ESGV+L+Q+I EAAK
Sbjct  90    MKVATRYSHSIPKLVCPSEEDGLIISTKHLSRVVEIDAEAKTMTLESGVTLKQLISEAAK  149

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
             AGLALPY+PYWWGLT+GGL+GTG+HGS+LW  GSSVHD+V+ + IV+P   K+GY  +R 
Sbjct  150   AGLALPYTPYWWGLTIGGLLGTGAHGSTLWSKGSSVHDYVVGLTIVSPGGPKDGYVKVRR  209

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L  G+ D+ AA+VSLGVLGVISQVT  LQPMFKR+I+++ K+D DLG +  +FG +HEFA
Sbjct  210   LNDGDKDLNAAKVSLGVLGVISQVTLNLQPMFKRAITYLSKSDSDLGDQVVRFGKEHEFA  269

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P     VYR+DDRVSTNTSGNGL+DF   RA  +  L  +R  EE+QES  DAD 
Sbjct  270   DIIWYPSQHKAVYRMDDRVSTNTSGNGLYDFIPFRATPSLALAVIRATEENQESQSDADG  329

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWD  1258
             KC++  L+   ++   +YGLTN+G+ F+GYPVIGYQ+ +QSSGTCL SL D+    CPWD
Sbjct  330   KCTSAKLVTSTLITN-AYGLTNNGLFFTGYPVIGYQHRLQSSGTCLHSLEDSRITACPWD  388

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             P++ G FFHQTTFSI+L+  K+FI+DVQKLV +EPK+LC + +Y+GILMRYV  S+AYLG
Sbjct  389   PKIKGEFFHQTTFSINLSLAKNFIQDVQKLVKIEPKALCGVEIYNGILMRYVTTSSAYLG  448

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQED++DFDITYYRSKDPM PRLYE ILEEIEQ+A+ KY ALPHWGKNRN+AF G + KY
Sbjct  449   KQEDAVDFDITYYRSKDPMTPRLYEGILEEIEQLALVKYKALPHWGKNRNIAFDGVMNKY  508

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
             K + EFL+VK  +DP+GLFSSEW+DQ+LGLK G++IVK+GCALEGLCICS+D HCAP+KG
Sbjct  509   KGSEEFLRVKDVYDPMGLFSSEWTDQVLGLKDGVTIVKEGCALEGLCICSKDIHCAPSKG  568

Query  1799  YFCRAGKVYKDAKVCVKI  1852
             YFCR GKV+ DA++C  +
Sbjct  569   YFCRPGKVFNDARICTLV  586



>gb|KHN06354.1| D-arabinono-1,4-lactone oxidase [Glycine soja]
Length=578

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/570 (63%), Positives = 453/570 (79%), Gaps = 3/570 (1%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELL  328
             T  V  L+  V S+ PEDPIKCT +    CTITNSYG+FPDR +C+AA+ +YP TE EL+
Sbjct  9     TTLVFLLLSVVFSTPPEDPIKCTTSENTTCTITNSYGSFPDRSICKAAQVLYPTTEQELV  68

Query  329   SIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESG  508
             S++A AT+ K KMK ATRYSHSIPKL CP+G++G+LISTKYLN+ ++V+  + TMTVESG
Sbjct  69    SVVASATRNKTKMKVATRYSHSIPKLVCPDGENGMLISTKYLNKIVKVDVEANTMTVESG  128

Query  509   VSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTP  688
             V+L+Q I EAAK GLALPY+PYWWG+T+GGLMGTG+HGS+L G GS+VHD+V+ +RIV P
Sbjct  129   VTLQQFINEAAKVGLALPYAPYWWGVTIGGLMGTGAHGSTLRGKGSAVHDYVVGLRIVRP  188

Query  689   ATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
             A  ++GYA + +L + + D+ A +VSLGVLGVISQ+T KL+ +FKRSI++V KND DLG 
Sbjct  189   AGHEDGYAKVESLNERHEDLNATKVSLGVLGVISQITLKLERLFKRSITYVAKNDSDLGD  248

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             +   FG  HEFAD+ W P  R VVYRVDDRV  NTSGNGL+DF  LR   ++     R  
Sbjct  249   QVAAFGHAHEFADIMWYPSQRKVVYRVDDRVPFNTSGNGLYDFIPLRPTPSNISIFRRTT  308

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             E+ QES  DA  KC +    +   ++ ++YGLTN+G+ F+GYPVIG+QNH+QSSG+CLDS
Sbjct  309   EDIQESTNDAIGKCIDAN-ASSNALFTVAYGLTNNGISFTGYPVIGFQNHLQSSGSCLDS  367

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
               D L  TC WDPRV GLF++ T FSI L+ VK FIEDVQKLV LEPK LC+LGLY+GI+
Sbjct  368   PQDALITTCGWDPRVEGLFYYNTAFSIRLSVVKKFIEDVQKLVQLEPKGLCILGLYNGIV  427

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             MRYV AS+AYLGKQED+++FD  YYRS+DPM PRLYEDILEE+EQ+ +FKYG LPHWGKN
Sbjct  428   MRYVTASSAYLGKQEDALEFDFLYYRSRDPMTPRLYEDILEEVEQLGIFKYGGLPHWGKN  487

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN+AFQG I+KYK+A +FLKVK K+DP GLFS+ W+DQ+LGLK G++I+KDGCALEGLCI
Sbjct  488   RNLAFQGVIKKYKNAKKFLKVKNKYDPKGLFSNTWTDQVLGLKDGVTILKDGCALEGLCI  547

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CSQD+HC P+KGY+CR GKVYK A+VC  +
Sbjct  548   CSQDSHCNPSKGYYCRPGKVYKKARVCTHL  577



>ref|XP_010032428.1| PREDICTED: uncharacterized protein LOC104421946 [Eucalyptus grandis]
Length=604

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/577 (61%), Positives = 452/577 (78%), Gaps = 10/577 (2%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAE  322
             +I +    ++ +V +S P DPI+CT +         SYGTFPDR  C+A  A +P +E E
Sbjct  28    IIVMAATAMMMSVSASPPADPIRCTSSGCTITN---SYGTFPDRSTCKAGAAAFPTSEEE  84

Query  323   LLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVE  502
             L+ ++  ATK +RKMK AT  SHSIPKL CP+G+DGLL+STKY+ R + V+   M M+VE
Sbjct  85    LVWVVGNATKSRRKMKVATHSSHSIPKLVCPDGEDGLLVSTKYMKRIVRVDRQGMRMSVE  144

Query  503   SGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIV  682
              GV+LRQ+IEEAAKAG+ALPY+PYWWG+TVGG++GTG+HGSSLWG GS++HD+V  +RIV
Sbjct  145   GGVTLRQLIEEAAKAGMALPYAPYWWGVTVGGMLGTGAHGSSLWGKGSALHDYVEAMRIV  204

Query  683   TPATEKEGYATIRTL----KQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             +P    +GYA IRTL        +++ A +VSLGVLGVISQVT KLQP+FKRS+++ +K 
Sbjct  205   SPGRPGDGYAKIRTLDVNRNSTRAEMDAVKVSLGVLGVISQVTLKLQPLFKRSLTYSIKG  264

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D DLG++AT FG QHEFAD+ W P  R  VYR+DDRV+ N  G+GL+DF   R+  +  L
Sbjct  265   DLDLGEQATSFGKQHEFADIMWYPSQRKAVYRIDDRVTFNAVGSGLYDFTPFRSTPSLTL  324

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
               +R  EE QES+ DA+ KC++  L++   +  ++YGLTN+G+ F+GYPVIGY N +QSS
Sbjct  325   ALVRSTEELQESLNDAEGKCNSAKLVSS-TLETIAYGLTNNGIIFTGYPVIGYHNKLQSS  383

Query  1211  GTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLG  1384
             GTCLDS  D L   CPWDPRV G FF+QTTFS+ L+ VK+FI+D+Q+L+  EPK+LC + 
Sbjct  384   GTCLDSPQDGLITACPWDPRVEGEFFYQTTFSVGLSMVKNFIKDIQQLIAFEPKALCGVE  443

Query  1385  LYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGAL  1564
             LY+GILMRYV AS+AYLGKQED++DFDITYY+SKDP+ PRLYED+LEEIEQMA+FKY AL
Sbjct  444   LYNGILMRYVTASSAYLGKQEDAVDFDITYYKSKDPLSPRLYEDVLEEIEQMALFKYNAL  503

Query  1565  PHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCA  1744
             PHWGKNRN+AF G I+KYK A EFLKVK+ +DPLGLFSSEW+DQ+LGLK G+SIV+DGCA
Sbjct  504   PHWGKNRNLAFDGVIKKYKKAREFLKVKEMYDPLGLFSSEWTDQVLGLKEGVSIVRDGCA  563

Query  1745  LEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             LEGLCICSQD HCAP KGY+CR+GKVYK+AKVC +IN
Sbjct  564   LEGLCICSQDAHCAPKKGYYCRSGKVYKEAKVCTRIN  600



>ref|XP_011025384.1| PREDICTED: uncharacterized protein LOC105126261 [Populus euphratica]
Length=584

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/575 (61%), Positives = 455/575 (79%), Gaps = 5/575 (1%)
 Frame = +2

Query  140   ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             +L T  +   +F VG S PE+ IKC+  NT       SYGTFPDR +C+AA A YP TE 
Sbjct  8     LLSTSCLLLAVFMVGCSPPENHIKCSSTNTNCTITN-SYGTFPDRSICQAANAAYPTTEE  66

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+S++A AT+ +RK+K ATRYSHSIPKL CP+G +GLLIST +LNRTLE++  SM ++V
Sbjct  67    ELISVVAAATRARRKVKVATRYSHSIPKLVCPDGQNGLLISTDHLNRTLEIDVQSMKISV  126

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESGV+LRQ+I EAAKAGLALPYSPYWWGLT+GGL+ TG+HGS+LWG GS++HD+V+ + I
Sbjct  127   ESGVTLRQLINEAAKAGLALPYSPYWWGLTIGGLLSTGAHGSTLWGKGSAIHDYVVALTI  186

Query  680   VTPATEKEGYATIRTLKQGNS-DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             V+P   ++GYA +R L + NS ++ AA+VSLGVLGVIS+VT +LQP+FKRSIS+V K D 
Sbjct  187   VSPGRPQDGYAKVRRLNESNSAELDAAKVSLGVLGVISKVTLQLQPLFKRSISYVAKKDT  246

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             DLG +   FG QHEFAD+ W P     VYR+DDRVS+NTSGNGL+D+   R+  +  L  
Sbjct  247   DLGDQVASFGRQHEFADITWYPSQGKAVYRIDDRVSSNTSGNGLYDYIPFRSTSSLGLAV  306

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             +R  E+ QES+ D D KC +  L+   +   L+YGLTN+G+ F+GYP+IGY N +QSSGT
Sbjct  307   VRATEDAQESLKDPDGKCVSAKLVTSTLK-HLAYGLTNNGIVFTGYPIIGYHNRLQSSGT  365

Query  1217  CLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             CLDS  D L   CPWD R+ G +F Q TFSISL+ VKSFI+DVQKLV L+P++LC L  Y
Sbjct  366   CLDSPEDALITACPWDSRIKGEYFFQATFSISLSVVKSFIQDVQKLVKLDPRALCGLEQY  425

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPH  1570
             +GILMRYVKAS+AYLGK++D++DFDIT+YR+KDP  PRLYEDILEEIEQ+A+FKYG LPH
Sbjct  426   NGILMRYVKASSAYLGKEDDALDFDITFYRNKDPTKPRLYEDILEEIEQLAVFKYGGLPH  485

Query  1571  WGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALE  1750
             WGKNRN+ F GA++KYK+AG FL+VK+ +DP+GLFS+EW+DQ+LGL+  ++I+K+GCALE
Sbjct  486   WGKNRNLVFNGALKKYKNAGAFLRVKEMYDPMGLFSNEWTDQVLGLQGDVNIIKEGCALE  545

Query  1751  GLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             GLCICSQD HCAP+KGY CR GK+Y++A+VC  ++
Sbjct  546   GLCICSQDIHCAPSKGYLCRPGKIYQEARVCEHVS  580



>ref|XP_003529878.2| PREDICTED: D-arabinono-1,4-lactone oxidase-like [Glycine max]
Length=586

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/570 (63%), Positives = 453/570 (79%), Gaps = 3/570 (1%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELL  328
             T  V  L+  V S+ PEDPIKCT +    CTITNSYG+FPDR +C+AA+ +YP TE EL+
Sbjct  17    TTLVFLLLSVVFSTPPEDPIKCTTSENTTCTITNSYGSFPDRSICKAAQVLYPTTEQELV  76

Query  329   SIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESG  508
             S++A AT+ K KMK ATRYSHSIPKL CP+G++G+LISTKYLN+ ++V+  + TMTVESG
Sbjct  77    SVVASATRNKTKMKIATRYSHSIPKLVCPDGENGMLISTKYLNKIVKVDVEANTMTVESG  136

Query  509   VSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTP  688
             V+L+Q I EAAK GLALPY+PYWWG+T+GGLMGTG+HGS+L G GS+VHD+V+ +RIV P
Sbjct  137   VTLQQFINEAAKVGLALPYAPYWWGVTIGGLMGTGAHGSTLRGKGSAVHDYVVGLRIVRP  196

Query  689   ATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
             A  ++GYA + +L + + D+ A +VSLGVLGVISQ+T KL+ +FKRSI++V KND DLG 
Sbjct  197   AGHEDGYAKVESLNERHEDLNATKVSLGVLGVISQITLKLERLFKRSITYVAKNDSDLGD  256

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             +   FG  HEFAD+ W P  R VVYRVDDRV  NTSGNGL+DF  LR   ++     R  
Sbjct  257   QVAAFGHAHEFADIMWYPSQRKVVYRVDDRVPFNTSGNGLYDFIPLRPTPSNISIFRRTT  316

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             E+ QES  DA  KC +    +   ++ ++YGLTN+G+ F+GYPVIG+QNH+QSSG+CLDS
Sbjct  317   EDIQESTNDAIGKCIDAN-ASSNALFTVAYGLTNNGISFTGYPVIGFQNHLQSSGSCLDS  375

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
               D L  TC WDPRV GLF++ T FSI L+ VK FIEDVQKLV LEPK LC+LGLY+GI+
Sbjct  376   PQDALITTCGWDPRVEGLFYYNTAFSIRLSVVKKFIEDVQKLVQLEPKGLCILGLYNGIV  435

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             MRYV AS+AYLGKQED+++FD  YYRS+DPM PRLYEDILEE+EQ+ +FKYG LPHWGKN
Sbjct  436   MRYVTASSAYLGKQEDALEFDFLYYRSRDPMTPRLYEDILEEVEQLGIFKYGGLPHWGKN  495

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN+AFQG I+KYK+A +FLKVK K+DP GLFS+ W+DQ+LGLK G++I+KDGCALEGLCI
Sbjct  496   RNLAFQGVIKKYKNAKKFLKVKNKYDPKGLFSNTWTDQVLGLKDGVTILKDGCALEGLCI  555

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CSQD+HC P+KGY+CR GKVYK A+VC  +
Sbjct  556   CSQDSHCNPSKGYYCRPGKVYKKARVCTHL  585



>ref|XP_009786565.1| PREDICTED: L-gulonolactone oxidase-like [Nicotiana sylvestris]
Length=590

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/574 (63%), Positives = 448/574 (78%), Gaps = 6/574 (1%)
 Frame = +2

Query  134   INILITIYVQFLI--FTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYP  307
             I  ++T Y  FLI  F V  SLP+DPIKC   N+        YG+FPDR +CRAA+  YP
Sbjct  11    IRQILTSYCIFLIMIFLVEGSLPQDPIKCITKNSNCTITNI-YGSFPDRSICRAAEVAYP  69

Query  308   KTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSM  487
              TE EL+S +  ATK+KRKM+ ATRYS SIPKL CP  DDGL+ISTK LN+   ++  +M
Sbjct  70    TTEEELISAVGKATKEKRKMRVATRYSQSIPKLVCPGDDDGLIISTKLLNKVQMMDRQNM  129

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
              M V+SG+ LR +I+EAA+  +ALP+SPYWWG++VGGL+GTG+HGSSLWG+GS+V+++V+
Sbjct  130   KMRVDSGLILRDLIDEAAQVDMALPHSPYWWGMSVGGLLGTGAHGSSLWGLGSAVNNYVV  189

Query  668   HIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
              +RIVTPATE+EGYA +RTL   N +  AA++SLGVLGVISQVTFKLQPMFKR+I+FV K
Sbjct  190   EVRIVTPATEEEGYAKVRTLDTANPEFYAAKLSLGVLGVISQVTFKLQPMFKRNITFVEK  249

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             ND +LG E   FG ++EFAD  W P  + V+YR+D+RV  NTSGN L D+ G R      
Sbjct  250   NDSNLGDEVITFGRKNEFADFSWFPSQKKVLYRIDNRVPLNTSGNALNDYLGFRPTSPLI  309

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
             L+++R  EE QE++ D+D KC +  L    ++    YG TNDG+ F+GYP+IG QN +Q+
Sbjct  310   LSSMRTSEETQEALRDSDGKCISGKLTKS-LLDTAKYGYTNDGIFFTGYPLIGPQNRLQA  368

Query  1208  SGTCL--DSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             SG+CL  D + D+L CPWDPR+ GLFFHQTTFSI L+KVK+FI+DVQKLV L+PK+LC L
Sbjct  369   SGSCLINDGILDDLVCPWDPRIKGLFFHQTTFSIGLSKVKNFIQDVQKLVVLQPKALCGL  428

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
              LY GILMRYV  S AYLG QED++DFDITYYRSK+P+ PRLYEDILEEIEQMAMFKYG 
Sbjct  429   DLYSGILMRYVTVSNAYLGHQEDAVDFDITYYRSKNPLTPRLYEDILEEIEQMAMFKYGG  488

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGC  1741
              PHWGKNRNVAF   I+KYK A +FLKVK+ +DPLGLFS+EW+DQILGLK+GLSIVK+GC
Sbjct  489   EPHWGKNRNVAFIDVIKKYKDADKFLKVKENYDPLGLFSNEWTDQILGLKSGLSIVKEGC  548

Query  1742  ALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             ALEGLCICS+D+HCAP KGYFC+ GKVY +A+VC
Sbjct  549   ALEGLCICSEDSHCAPKKGYFCKPGKVYVEARVC  582



>ref|XP_011025383.1| PREDICTED: uncharacterized protein LOC105126260 [Populus euphratica]
Length=584

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/575 (61%), Positives = 452/575 (79%), Gaps = 5/575 (1%)
 Frame = +2

Query  140   ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             +L T  +   +F V  S PE  IKC+  NT       SYGTFPDR +C+AA   YP TE 
Sbjct  8     LLSTSCLLLAVFMVDCSPPESHIKCSSTNTNCTITN-SYGTFPDRSICQAANVAYPTTEE  66

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+SI+AGAT+ KRK+K ATRYSHSIPKLACP+G +GLLIST YLNR LE++  SM ++V
Sbjct  67    ELISIVAGATEAKRKVKVATRYSHSIPKLACPDGQNGLLISTDYLNRPLEIDVQSMKISV  126

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESGV+LRQ+I EAAKAGLALPYSPYWWGLT+GGL+ TG+HGS+LWG GS++HD+V+ + I
Sbjct  127   ESGVTLRQLINEAAKAGLALPYSPYWWGLTIGGLLSTGAHGSTLWGKGSAIHDYVVALTI  186

Query  680   VTPATEKEGYATIRTLKQGNS-DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             ++P   ++GYA +R+L + NS ++ AA+VSLGVLGVIS+VT +LQP+FKRSIS+V K D 
Sbjct  187   ISPGGPEDGYAKVRSLNESNSTELNAAKVSLGVLGVISKVTLQLQPLFKRSISYVAKKDT  246

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             DLG +   FG QHEFAD+ W P     VYR+DDR+S+N SGNGL+D+   R+  +  L A
Sbjct  247   DLGDQVASFGRQHEFADITWYPSQGKAVYRIDDRISSNISGNGLYDYIPFRSTLSLGLAA  306

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             +R  E+ QES+ D D KC++  LI   +  F +YGLTN+G+ F+GYP+IGY N +QSSGT
Sbjct  307   IRTTEDTQESLKDPDGKCASAKLITSTLENF-AYGLTNNGIVFTGYPIIGYHNRLQSSGT  365

Query  1217  CLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             CLDS  D L   CPWD R+ G +F Q TFSISL+ VK F++DV+ LV LEP++LC L  Y
Sbjct  366   CLDSPEDALITACPWDSRIKGEYFFQATFSISLSVVKRFLQDVRDLVKLEPRALCGLEQY  425

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPH  1570
             +GILMRYVKAS+AYLGK++D++DFDIT+YR+KDP  PRLYEDILEEIEQ+A+FKYG LPH
Sbjct  426   NGILMRYVKASSAYLGKEDDALDFDITFYRNKDPTKPRLYEDILEEIEQLAVFKYGGLPH  485

Query  1571  WGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALE  1750
             WGKNRN+ F GA++KYK+AG FL+VK+ +DP+GLFS+EW+DQ+LGLK  ++I+K+GCALE
Sbjct  486   WGKNRNLVFNGALKKYKNAGAFLRVKEMYDPMGLFSNEWTDQVLGLKGDVNIIKEGCALE  545

Query  1751  GLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             GLCICSQD HCAP  GY CRAGK+Y+DA+VC  ++
Sbjct  546   GLCICSQDTHCAPRDGYLCRAGKIYQDARVCALVS  580



>ref|XP_006418590.1| hypothetical protein EUTSA_v10002773mg [Eutrema salsugineum]
 gb|ESQ37026.1| hypothetical protein EUTSA_v10002773mg [Eutrema salsugineum]
Length=603

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/589 (61%), Positives = 447/589 (76%), Gaps = 6/589 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PS+    A     +L+  Y+  L+    S+ PEDP+KC   NT       SYG FPDR  
Sbjct  7     PSNGSQNAMFWRTLLVFYYIFTLVLMAVSTPPEDPVKCVSGNTNCTVTN-SYGAFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             CRAA   YP TE E+++I+A ATK  RKM+  TRYSHSI KL C +G DGL ISTK LNR
Sbjct  66    CRAANVAYPTTEDEVVAIVAAATKAGRKMRVTTRYSHSITKLVCTDGTDGLFISTKLLNR  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T+  +A +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVRADAEAMTLTVESGVTLRQLITEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IRIV+P +  +G+A +R L +  +  + KAA+VSLGVLGVISQVTFKLQP
Sbjct  186   GSAVHDYVTEIRIVSPGSVNDGFAKVRVLSETTTPNEFKAAKVSLGVLGVISQVTFKLQP  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+++ ++ND D G +A  FG +HEFAD  WLP    VVYR DDRV  NTSGNGLFD
Sbjct  246   MFKRSLAYTMRNDSDFGDQAVSFGKKHEFADFLWLPSQGKVVYRRDDRVPVNTSGNGLFD  305

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             F   R+  +  +  +R  EE QE+  DA+ KC+   LI+   ++  SYGLTN+G+ F+GY
Sbjct  306   FLPFRSQLSVAIAIIRSSEETQETFRDANGKCAGATLISS-TLFATSYGLTNNGLIFTGY  364

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PVIG QN M SSG+CLDSL D L   C WD R+ G FFHQTTFS+SLT+VKSFI D++ L
Sbjct  365   PVIGSQNRMMSSGSCLDSLQDGLITACAWDSRIKGEFFHQTTFSVSLTQVKSFINDIKSL  424

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V +EPKSLC L L+ GILMRYV++S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EE
Sbjct  425   VKIEPKSLCGLELHYGILMRYVRSSPAYLGKETEALDFDITYYRAKDPLTPRLYEDFIEE  484

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A+FKY ALPHWGKNRN+AF G IRKYK+A  FLKVK+ +DP GLFSS+W+DQILG+
Sbjct  485   IEQIALFKYNALPHWGKNRNLAFDGVIRKYKNAPAFLKVKESYDPNGLFSSKWTDQILGI  544

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             K  ++IVKDGCALEG+CICS+D HCAPNKGY CR GKVYK+A VC +++
Sbjct  545   KGNVTIVKDGCALEGMCICSEDAHCAPNKGYLCRPGKVYKEAMVCTRVS  593



>ref|XP_009595692.1| PREDICTED: L-gulonolactone oxidase-like [Nicotiana tomentosiformis]
Length=600

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/562 (63%), Positives = 445/562 (79%), Gaps = 4/562 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
              +IF V  +LP+DPIKCT  N+        YG+FPDR +CRAA+  YP TE EL+S +  
Sbjct  33    IMIFLVEGTLPQDPIKCTTKNSNCTITNI-YGSFPDRSICRAAEVTYPTTEEELISAVGK  91

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
             ATK+KRKM+ ATRYS SIPKL CP  DDGL+ISTK L++   ++  +M M V+SG+ L+ 
Sbjct  92    ATKEKRKMRVATRYSQSIPKLVCPGEDDGLIISTKLLDKVQMMDRQNMKMRVDSGLILKD  151

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +I+EAA+ GLALP+SPYWWG++VGGL+GTG+HGSSLWG+GS+VH++V+ +RIVTPATE+E
Sbjct  152   LIDEAARVGLALPHSPYWWGMSVGGLLGTGAHGSSLWGLGSAVHNYVVELRIVTPATEEE  211

Query  704   GYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             GYA +RTL   N +  AA++SLGVLGVISQVTFKLQPMFKR+I+FV K+D +LG E   F
Sbjct  212   GYAKVRTLDAANPEFYAAKLSLGVLGVISQVTFKLQPMFKRNITFVEKSDSNLGDEVITF  271

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G +HEFAD  W P  + V+YR+D+RV  N SGN L D+ G R      L+++R  EE QE
Sbjct  272   GRKHEFADFSWFPSQKTVLYRIDNRVPLNISGNALNDYLGFRPTSPLILSSMRSSEETQE  331

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL--DSLND  1237
             ++ D++ KC +  L    ++    YG TN+G+ F+GYP+IG QN +Q+SG+CL  D + D
Sbjct  332   ALRDSNGKCLSGKLTKS-LLDTAKYGYTNNGILFTGYPLIGPQNRLQASGSCLINDGILD  390

Query  1238  NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
             +L CPWDPR+ GLFFHQTTFSI L+KVK+FI+DVQKLV L+PK+LC L LY GILMRYV 
Sbjct  391   DLVCPWDPRIKGLFFHQTTFSIGLSKVKNFIQDVQKLVVLQPKALCGLDLYSGILMRYVT  450

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             AS AYLG QED++DFDITYYRSK+P+ PRLYEDILEEIEQMAMFKYGA PHWGKNRNVAF
Sbjct  451   ASNAYLGHQEDAVDFDITYYRSKNPLTPRLYEDILEEIEQMAMFKYGAEPHWGKNRNVAF  510

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
                I+KYK A +FLKVK+ +DPLGLFS++W+DQILGL++GLSIVK+GCALEGLCICS+D+
Sbjct  511   IDVIKKYKDADKFLKVKETYDPLGLFSNDWTDQILGLRSGLSIVKEGCALEGLCICSEDS  570

Query  1778  HCAPNKGYFCRAGKVYKDAKVC  1843
             HCAP KGYFC+ GKVY +A+VC
Sbjct  571   HCAPTKGYFCKPGKVYVEARVC  592



>gb|KCW51822.1| hypothetical protein EUGRSUZ_J01272, partial [Eucalyptus grandis]
Length=561

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/560 (63%), Positives = 443/560 (79%), Gaps = 10/560 (2%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             P DPI+CT +         SYGTFPDR  C+A  A +P +E EL+ ++  ATK +RKMK 
Sbjct  2     PADPIRCTSSGCTITN---SYGTFPDRSTCKAGAAAFPTSEEELVWVVGNATKSRRKMKV  58

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             AT  SHSIPKL CP+G+DGLL+STKY+ R + V+   M M+VE GV+LRQ+IEEAAKAG+
Sbjct  59    ATHSSHSIPKLVCPDGEDGLLVSTKYMKRIVRVDRQGMRMSVEGGVTLRQLIEEAAKAGM  118

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTL--  727
             ALPY+PYWWG+TVGG++GTG+HGSSLWG GS++HD+V  +RIV+P    +GYA IRTL  
Sbjct  119   ALPYAPYWWGVTVGGMLGTGAHGSSLWGKGSALHDYVEAMRIVSPGRPGDGYAKIRTLDV  178

Query  728   --KQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEF  901
                   +++ A +VSLGVLGVISQVT KLQP+FKRS+++ +K D DLG++AT FG QHEF
Sbjct  179   NRNSTRAEMDAVKVSLGVLGVISQVTLKLQPLFKRSLTYSIKGDLDLGEQATSFGKQHEF  238

Query  902   ADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDAD  1081
             AD+ W P  R  VYR+DDRV+ N  G+GL+DF   R+  +  L  +R  EE QES+ DA+
Sbjct  239   ADIMWYPSQRKAVYRIDDRVTFNAVGSGLYDFTPFRSTPSLTLALVRSTEELQESLNDAE  298

Query  1082  EKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPW  1255
              KC++  L++   +  ++YGLTN+G+ F+GYPVIGY N +QSSGTCLDS  D L   CPW
Sbjct  299   GKCNSAKLVSS-TLETIAYGLTNNGIIFTGYPVIGYHNKLQSSGTCLDSPQDGLITACPW  357

Query  1256  DPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYL  1435
             DPRV G FF+QTTFS+ L+ VK+FI+D+Q+L+  EPK+LC + LY+GILMRYV AS+AYL
Sbjct  358   DPRVEGEFFYQTTFSVGLSMVKNFIKDIQQLIAFEPKALCGVELYNGILMRYVTASSAYL  417

Query  1436  GKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRK  1615
             GKQED++DFDITYY+SKDP+ PRLYED+LEEIEQMA+FKY ALPHWGKNRN+AF G I+K
Sbjct  418   GKQEDAVDFDITYYKSKDPLSPRLYEDVLEEIEQMALFKYNALPHWGKNRNLAFDGVIKK  477

Query  1616  YKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNK  1795
             YK A EFLKVK+ +DPLGLFSSEW+DQ+LGLK G+SIV+DGCALEGLCICSQD HCAP K
Sbjct  478   YKKAREFLKVKEMYDPLGLFSSEWTDQVLGLKEGVSIVRDGCALEGLCICSQDAHCAPKK  537

Query  1796  GYFCRAGKVYKDAKVCVKIN  1855
             GY+CR+GKVYK+AKVC +IN
Sbjct  538   GYYCRSGKVYKEAKVCTRIN  557



>ref|XP_007139011.1| hypothetical protein PHAVU_009G257400g [Phaseolus vulgaris]
 gb|ESW11005.1| hypothetical protein PHAVU_009G257400g [Phaseolus vulgaris]
Length=590

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/577 (61%), Positives = 450/577 (78%), Gaps = 7/577 (1%)
 Frame = +2

Query  128   MSINILITIYVQFLIFTVG--SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAV  301
             M   +L   +V   I   G  ++ PEDPI+C  NN        +YG FPDR +CRAA+ +
Sbjct  1     MREQVLKYAFVFLFICACGVIATPPEDPIRCASNNKNCTITN-TYGIFPDRSLCRAAEVI  59

Query  302   YPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNAS  481
             YP +E EL+S +A A+K KRK+KAATR+SHSI KLACP+G++GLLISTK LN+ L+++A 
Sbjct  60    YPTSEEELVSAVASASKNKRKVKAATRFSHSITKLACPDGENGLLISTKNLNKILKIDAK  119

Query  482   SMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDH  661
               TMTV+SG SLRQ+I  A +AGLALPY+PYWWGLT+GGLMGTG+HGS+LWG GS+VH++
Sbjct  120   KGTMTVQSGASLRQIISAAGEAGLALPYAPYWWGLTIGGLMGTGAHGSTLWGKGSAVHEY  179

Query  662   VIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFV  841
             V+ +RIVTPA E++GYA +RTL Q +S + AARVSLGVLGV+SQVT KL+P+FKRS+++V
Sbjct  180   VVELRIVTPAGEEDGYAKVRTLNQSHSSLDAARVSLGVLGVLSQVTLKLEPLFKRSVTYV  239

Query  842   VKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGT  1021
              K+D DLG E   FG +HEF D+ W P  +  VYR+DDRVS NTSGNGL+DFF  R+  +
Sbjct  240   SKDDSDLGDEVVSFGRKHEFGDVTWYPSQQKAVYRIDDRVSVNTSGNGLYDFFPFRSTLS  299

Query  1022  DCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHM  1201
               L  +R  EE QE+  DA+ KC    LI   +   + YGLTN+GV F GYP++G+ N M
Sbjct  300   AALAIVRSTEELQEATRDANGKCLGAKLITATLSG-IGYGLTNNGV-FLGYPIVGFSNRM  357

Query  1202  QSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC  1375
             Q+SGTCLDSLND L   CPWD R+ G FFHQT FSISL+ VK+FIEDVQKLV+LEPK+LC
Sbjct  358   QASGTCLDSLNDGLITACPWDSRIKGEFFHQTAFSISLSVVKNFIEDVQKLVELEPKALC  417

Query  1376  VLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKY  1555
              L   +GILMRYV AS+AYLGK ED +DFDITYYRSKDP+ PRL++DILEEIEQ+ +FKY
Sbjct  418   GLETANGILMRYVTASSAYLGKSEDGVDFDITYYRSKDPLAPRLFQDILEEIEQIGLFKY  477

Query  1556  GALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD  1735
             G  PHWGKNRN+AF G I+KY +A +FLKVK++FDP G+FSS+W+DQ+LGLK G+++ K+
Sbjct  478   GGSPHWGKNRNLAFLGVIKKYDNAEKFLKVKEEFDPEGVFSSQWTDQMLGLKEGVTVSKN  537

Query  1736  GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCV  1846
             GCA+EGLCICSQD+HCAP KGY CR G++YK+A+VC 
Sbjct  538   GCAMEGLCICSQDSHCAPKKGYLCRPGRIYKEARVCT  574



>ref|XP_006340105.1| PREDICTED: L-gulonolactone oxidase-like [Solanum tuberosum]
Length=590

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/564 (64%), Positives = 449/564 (80%), Gaps = 7/564 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             F+I+ V SS PEDPIKC+ +   NCTITN+YG FPDR +C+AA+AV+P TE E++SI+A 
Sbjct  14    FMIYLVNSSPPEDPIKCSYDTNFNCTITNTYGAFPDRTICKAAQAVFPTTEEEVISIVAN  73

Query  344   ATKQKRKMKAATRYSHSIPKLACPE-GD-DGLLISTKYLNRTLEVNASSMTMTVESGVSL  517
             AT++KRKMK  TR+S SIPKL C + GD DGLLISTK+LN+ ++++  +M +TVESGV+L
Sbjct  74    ATREKRKMKITTRFSSSIPKLVCLDNGDQDGLLISTKFLNKIIKIDQENMMITVESGVTL  133

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATE  697
             RQ+I EA KAGL LPY+PYWWGLT+GGL+GTG+HGSSLWG+GSSVHD+++ +RIVTPA  
Sbjct  134   RQLISEAGKAGLVLPYTPYWWGLTIGGLIGTGAHGSSLWGLGSSVHDYIVQLRIVTPADA  193

Query  698   KEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEAT  877
                YA +R L+ G+ D+ A RVSLGVLGV+SQVT KL+ +FKRSI+F  ++D +LG++A 
Sbjct  194   ANNYAKVRILENGSPDLNAVRVSLGVLGVVSQVTLKLERVFKRSITFSERDDSNLGEDAA  253

Query  878   KFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEH  1057
              FG QHEFAD  W P    V+YR+DDRVS +T GN L DF G R      L +LR  EE 
Sbjct  254   TFGRQHEFADFTWYPSQHKVIYRIDDRVSIDTPGNALNDFLGFRPTDQYLLASLRTLEEI  313

Query  1058  QESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
              ES  +AD KC +       ++  LSYG TN+G   +GYP++G+ + +Q+SGTCLDS ++
Sbjct  314   LESTNNADGKCLDA-TKTTGILKSLSYGWTNNG---TGYPMVGFHDRVQASGTCLDS-HE  368

Query  1238  NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
               TCPWD RV GLFFHQTTF+ISL+KVK FIEDVQ+LV LEPK+LCVL LY+GILMRYV 
Sbjct  369   GATCPWDHRVKGLFFHQTTFTISLSKVKGFIEDVQRLVALEPKALCVLDLYNGILMRYVT  428

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
              S AYLGKQEDS+DFDITYYRSKDPM PRL+ED LEEIEQ+A FKYGALPHWGKNRNVAF
Sbjct  429   TSNAYLGKQEDSLDFDITYYRSKDPMSPRLFEDFLEEIEQLAFFKYGALPHWGKNRNVAF  488

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              GAI KYK+  +FL+VK+ +D  GLFSSEW+DQ+LGLK GLSIVK+GCALEGLCICS+D 
Sbjct  489   IGAINKYKNVDKFLQVKQSYDHFGLFSSEWTDQVLGLKDGLSIVKEGCALEGLCICSKDI  548

Query  1778  HCAPNKGYFCRAGKVYKDAKVCVK  1849
             HCAPNKGYFCR G++YKDA+VC  
Sbjct  549   HCAPNKGYFCRPGRIYKDARVCTN  572



>ref|XP_002882088.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58347.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/589 (60%), Positives = 445/589 (76%), Gaps = 6/589 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PS+    A     I +   +  L+FT  S+ PEDP+KC   NT       SYG FPDR  
Sbjct  7     PSYGSQNAAFWRTIFVLHCISTLVFTTISTPPEDPVKCVSGNTNCTVTN-SYGVFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             CRAA   YP TEAEL+S++A ATK  RKM+  TRYSHSI KL C +G DGLLISTK+LN 
Sbjct  66    CRAANVAYPTTEAELISVVAAATKAGRKMRVTTRYSHSITKLVCTDGTDGLLISTKFLNH  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T+  +A +MT+TVESG++LRQ+I EAA+ G+ALPY+PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVRADAKAMTLTVESGMTLRQLIAEAAEIGMALPYAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVT KLQP
Sbjct  186   GSAVHDYVTEIRMVSPGSVIDGFAKVRVLSETETPNEFNAAKVSLGVLGVISQVTLKLQP  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+ +V+KND D G +A  FG +HEFAD  WLP    VVYR+DDRV+ NTSGNGL D
Sbjct  246   MFKRSLRYVMKNDSDFGDQAVTFGKKHEFADFIWLPSQGKVVYRMDDRVAVNTSGNGLLD  305

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             F   R+  +  L  +R  EE QE   DA+ KC+   LI+   ++  SYGLTN+G+ F+GY
Sbjct  306   FMSFRSQLSAALAIIRSSEETQERFRDANGKCAGATLISS-TLFATSYGLTNNGMIFTGY  364

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PVIG QN M SSG+CLDSL+D L   CPWD R+   FFHQTTFSI LT+VKSFI D++ L
Sbjct  365   PVIGSQNRMMSSGSCLDSLHDGLITACPWDSRIKSEFFHQTTFSIPLTQVKSFINDIKSL  424

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V +E KSLCVL LYDGILMRYV +S AYLGK+ +++DFD+TYYR+K+P+ PRLYED +EE
Sbjct  425   VKIESKSLCVLELYDGILMRYVTSSPAYLGKETEALDFDLTYYRAKNPLAPRLYEDFIEE  484

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A+FKY ALPHWGKNRN+AF G I+KYK+   F KVK+ +DP+GLFSSEW++QILG+
Sbjct  485   IEQIALFKYNALPHWGKNRNLAFDGVIKKYKNVPAFFKVKESYDPMGLFSSEWTNQILGI  544

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             K  ++I+KDGCALEGLCICS+D HCAP KGY CR GKVY +A+VC +++
Sbjct  545   KGNVTIIKDGCALEGLCICSEDAHCAPTKGYLCRPGKVYIEARVCTRVD  593



>emb|CAZ68129.1| FAD-binding domain-containing protein [Arabidopsis halleri subsp. 
halleri]
Length=603

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/570 (62%), Positives = 435/570 (76%), Gaps = 6/570 (1%)
 Frame = +2

Query  158   VQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSII  337
             +  L+FT  S+ PEDP+KC   NT       SYG FPDR  CRAA   YP TEAEL+S++
Sbjct  26    ISTLVFTTISTPPEDPVKCVSGNTNCTVTN-SYGVFPDRSTCRAANVAYPTTEAELISVV  84

Query  338   AGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSL  517
             A ATK  RKM+  TRYSHSI KL C +G DGLLIST +LN T+  +A +MT+TVESGV+L
Sbjct  85    AAATKAGRKMRVTTRYSHSITKLVCTDGTDGLLISTNFLNHTVRADAKAMTLTVESGVTL  144

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATE  697
             RQ+I EAAK G+ALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P + 
Sbjct  145   RQLIAEAAKIGMALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSV  204

Query  698   KEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKE  871
              +G+A +R L +  +  +  AA VSLGVLGVISQVT KLQPMFKRS+ +V+KND D G +
Sbjct  205   NDGFAKVRVLSETMTPNEFNAATVSLGVLGVISQVTLKLQPMFKRSLRYVMKNDSDFGDQ  264

Query  872   ATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKE  1051
             A  FG +HEFAD  WLP    VVYR+DDRV+ N SGNGL DF   R+  +  L  +R  E
Sbjct  265   AVTFGKKHEFADFIWLPSQGKVVYRMDDRVAVNISGNGLLDFMPFRSQLSAALAIIRSSE  324

Query  1052  EHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSL  1231
             E QE   DA+ KC+   LI+   ++  SYGLTN+G+ F+GYPVIG QN M SSG+CLDSL
Sbjct  325   ETQERFRDANGKCAGATLISS-TLFATSYGLTNNGIIFTGYPVIGSQNRMMSSGSCLDSL  383

Query  1232  NDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILM  1405
              D L   CPWD R+   FFHQTTFSI LT+VKSFI D++ LV +E KSLCVL LYDGILM
Sbjct  384   QDGLITACPWDSRIKSEFFHQTTFSIPLTQVKSFINDIKSLVKIESKSLCVLELYDGILM  443

Query  1406  RYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             RYV +S AYLGK+ +++DFD+TYYR+K+P+ PRLYED +EEIEQ+A+FKY ALPHWGKNR
Sbjct  444   RYVTSSPAYLGKETEALDFDLTYYRAKNPLAPRLYEDFIEEIEQIALFKYNALPHWGKNR  503

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF G I+KY     FLKVK+ +DP+GLFSSEW+DQILG+K  ++I+KDGCALEGLCIC
Sbjct  504   NLAFDGVIKKYNKMPAFLKVKESYDPMGLFSSEWTDQILGIKGNVTIIKDGCALEGLCIC  563

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  564   SEDAHCAPTKGYLCRPGKVYKEARVCTRVD  593



>gb|KFK37441.1| hypothetical protein AALP_AA4G257300 [Arabis alpina]
Length=603

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/566 (62%), Positives = 440/566 (78%), Gaps = 6/566 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+FT  S+ PEDP+KC   N+       SYG FPDR +CRAA   YP  EAEL+SI+A A
Sbjct  29    LVFTTISTPPEDPVKCVSGNSNCTVTN-SYGVFPDRSMCRAANVAYPTNEAELVSIVAAA  87

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             TK  RKM+  TRYSHS+ KLAC +G DGL ISTK+LN T++ +A +MT+TVESG++LRQ+
Sbjct  88    TKAGRKMRVTTRYSHSLTKLACTDGTDGLFISTKFLNHTVQADARTMTLTVESGMTLRQL  147

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAK GLALPY+PYWWGLTVGGLMGTG+HGSSLWG GS++HD+V  IR+V+PA+  +G
Sbjct  148   IAEAAKVGLALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAIHDYVTEIRMVSPASVNDG  207

Query  707   YATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             +A +R L +  +  +  AA+VSLGVLG ISQVTFKLQPMFKRS+++V++ND D G +A  
Sbjct  208   FAKVRVLSETTTPNEFNAAKVSLGVLGAISQVTFKLQPMFKRSLTYVMRNDSDFGDQAVT  267

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
             FG +HEFAD+ WLP    VVYR+DDRV+ NTSGNGLFDF   R+  +  L  +R  EE Q
Sbjct  268   FGKKHEFADLVWLPSQGKVVYRMDDRVAVNTSGNGLFDFLPFRSQLSAALAIIRTSEEAQ  327

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             E+  DA+ KC+   LI+   ++  +YGLTN+G+ F+GYPVIG QN M SSG+CLDSL D 
Sbjct  328   ETFRDANGKCAGATLISS-TLFATAYGLTNNGIIFTGYPVIGSQNRMMSSGSCLDSLQDG  386

Query  1241  L--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
             L   CPWD R+   FFHQTTFS+ LT+VK+FI D++ LV +E KSLC L LY GILMRYV
Sbjct  387   LITACPWDSRIKSEFFHQTTFSVPLTQVKNFINDIKSLVKIESKSLCGLELYYGILMRYV  446

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
              +S AYLGK+ +++DFD+TYYR+K+P+ PRLYED +EEIEQ+A+FKY ALPHWGKNRN+A
Sbjct  447   TSSPAYLGKETEALDFDLTYYRAKNPLTPRLYEDFIEEIEQIALFKYNALPHWGKNRNLA  506

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG++   +IVKDGCALEGLCICS+D
Sbjct  507   FDGVIKKYKNAPAFLKVKESYDPTGLFSSEWTDQILGIRGNATIVKDGCALEGLCICSED  566

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKI  1852
              HCAP KGY CR GKVY +A+VC ++
Sbjct  567   AHCAPTKGYLCRPGKVYIEARVCTRV  592



>ref|XP_006397866.1| hypothetical protein EUTSA_v10001364mg [Eutrema salsugineum]
 gb|ESQ39319.1| hypothetical protein EUTSA_v10001364mg [Eutrema salsugineum]
Length=603

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/587 (61%), Positives = 442/587 (75%), Gaps = 6/587 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PS     A     +L+   +  L+FT  S+ PEDP+KC   N+       SYG FPDR  
Sbjct  7     PSFISQNAAFWRTLLVLHCITTLVFTTISTPPEDPVKCVSGNSDCTVTN-SYGVFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             CRAA   YP TEAEL+SI+A ATK  RKM+  TRYSHSIPKLAC +G DGL ISTK+LN 
Sbjct  66    CRAANVAYPTTEAELVSIVAAATKAGRKMRVTTRYSHSIPKLACTDGTDGLFISTKFLNH  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T+  +A +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVRADAEAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVT KLQP
Sbjct  186   GSAVHDYVTEIRMVSPGSVNDGFAKVRVLSETTTPNEFSAAKVSLGVLGVISQVTLKLQP  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+ +V++ND D   +A  FG +HEFAD  WLP    VVYR+D RV+ NTSGNGLFD
Sbjct  246   MFKRSLRYVMRNDSDFEDQAVTFGKKHEFADFIWLPSQGKVVYRMDGRVAVNTSGNGLFD  305

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             F   R+  +  L  +R  EE QE+  DA+ KC    LI+   ++  S+GLTN+GV F+GY
Sbjct  306   FLPFRSQLSVALAIIRSSEETQETFRDANGKCVGATLISS-TLFASSFGLTNNGVIFTGY  364

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PVIG QN M SSG+CLDSL D L   CPWD R+   FFHQTTFS+ LT+V+SFI D++ L
Sbjct  365   PVIGNQNRMMSSGSCLDSLEDGLITACPWDSRIKSEFFHQTTFSVPLTQVQSFINDIKSL  424

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V +E KSLC L LY GILMRYV +S AYLGK+ +++DFD+TYYR+K+P+ PRLYED +EE
Sbjct  425   VKIEQKSLCGLELYYGILMRYVTSSPAYLGKETEALDFDLTYYRAKNPLTPRLYEDFIEE  484

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A+FKY ALPHWGKNRN+AF   I+KYK+A  FLKVK+ +DP+GLFSSEW+DQILG+
Sbjct  485   IEQIALFKYKALPHWGKNRNLAFDRVIKKYKNAPAFLKVKEIYDPMGLFSSEWTDQILGI  544

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             K  ++IVKDGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +
Sbjct  545   KGNVTIVKDGCALEGLCICSEDAHCAPTKGYLCRPGKVYKEARVCAR  591



>emb|CDX80044.1| BnaA05g01120D [Brassica napus]
Length=591

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/583 (61%), Positives = 437/583 (75%), Gaps = 6/583 (1%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             M  +    L+   +  L+FT  S+ P+DPIKC   N+       SYG FPDR  CRAA  
Sbjct  1     MNSLMSTFLLLQCISTLVFTAISTPPDDPIKCVSGNSDCTVTN-SYGAFPDRSTCRAADV  59

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNA  478
              YP TEAEL+SI+A ATK +RKM+  TRYSHSI KL C +G +GL ISTK+LN T+  + 
Sbjct  60    AYPTTEAELISIVAAATKARRKMRVTTRYSHSITKLVCTDGTEGLFISTKFLNHTVRADG  119

Query  479   SSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHD  658
              +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD
Sbjct  120   EAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHD  179

Query  659   HVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSI  832
             HV  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVTF LQPMFKRSI
Sbjct  180   HVTEIRMVSPGSVNDGFAKVRVLSKTTTPNEFNAAKVSLGVLGVISQVTFTLQPMFKRSI  239

Query  833   SFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRA  1012
              +V+KND D G +A  FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLFD    R+
Sbjct  240   RYVMKNDSDFGDQAVTFGKKHEFADFVWLPSQGKVVYRMDDRVPVNTSGNGLFDLLPFRS  299

Query  1013  VGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQ  1192
               +  L  +R  EE QE   DA+ KC    LI+   ++  S+GLTN+G+ F+GYPV G Q
Sbjct  300   QLSAALAIIRSSEETQERFRDANGKCVGATLISS-TLFASSFGLTNNGIIFTGYPVTGSQ  358

Query  1193  NHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPK  1366
             N M SSG+CLDSL D L   CPWD R+   FFHQTTFS+ LT+VKSFI D++ LV +E K
Sbjct  359   NRMMSSGSCLDSLQDGLITACPWDSRIKSEFFHQTTFSVPLTQVKSFITDIKSLVKIERK  418

Query  1367  SLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAM  1546
             SLC L LY GILMRYV +S AYLGK+ +++DFD+TYYR+KDP+ PRLYED +EEIEQ+A+
Sbjct  419   SLCGLELYYGILMRYVTSSPAYLGKETEALDFDLTYYRAKDPLTPRLYEDFIEEIEQIAL  478

Query  1547  FKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSI  1726
             FKY ALPHWGKNRN+AF G I+KYK+A  FLKVK+ +DP GLFS+EW+DQILG+K   +I
Sbjct  479   FKYNALPHWGKNRNLAFDGVIKKYKNAPAFLKVKESYDPTGLFSTEWTDQILGIKGNATI  538

Query  1727  VKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             VKDGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  539   VKDGCALEGLCICSEDAHCAPTKGYLCRPGKVYKEARVCTRVS  581



>ref|XP_009142608.1| PREDICTED: L-gulonolactone oxidase-like [Brassica rapa]
Length=591

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/583 (61%), Positives = 437/583 (75%), Gaps = 6/583 (1%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             M  +    L+   +  L+FT  S+ P+DPIKC   N+       SYG FPDR  CRAA  
Sbjct  1     MNSLMSTFLLLQCISTLVFTAISTPPDDPIKCVSGNSDCTVTN-SYGAFPDRSTCRAADV  59

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNA  478
              YP TEAEL+SI+A ATK +RKM+  TRYSHSI KL C +G +GL ISTK+LN T+  + 
Sbjct  60    AYPTTEAELISIVAAATKARRKMRVTTRYSHSITKLVCTDGTEGLFISTKFLNHTVRADG  119

Query  479   SSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHD  658
              +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD
Sbjct  120   EAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHD  179

Query  659   HVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSI  832
             HV  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVTF LQPMFKRSI
Sbjct  180   HVTEIRMVSPGSVNDGFAKVRVLSKTTTPNEFNAAKVSLGVLGVISQVTFTLQPMFKRSI  239

Query  833   SFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRA  1012
              +V+KND D G +A  FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLFD    R+
Sbjct  240   RYVMKNDSDFGDQAVTFGKKHEFADFVWLPSQGKVVYRMDDRVPVNTSGNGLFDLLPFRS  299

Query  1013  VGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQ  1192
               +  L  +R  EE QE   DA+ KC    LI+   ++  S+GLTN+G+ F+GYPV G Q
Sbjct  300   QLSAALAIIRSSEETQERFRDANGKCVGATLISS-TLFASSFGLTNNGIIFTGYPVTGSQ  358

Query  1193  NHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPK  1366
             N M SSG+CLDSL D L   CPWD R+   FFHQTTFS+ LT+VKSFI D++ LV +E K
Sbjct  359   NRMMSSGSCLDSLQDGLITACPWDSRIKSEFFHQTTFSVPLTQVKSFITDIKSLVKIERK  418

Query  1367  SLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAM  1546
             SLC L LY GILMRYV +S AYLGK+ +++DFD+TYYR+KDP+ PRLYED +EEIEQ+A+
Sbjct  419   SLCGLELYYGILMRYVTSSPAYLGKETEALDFDLTYYRAKDPLTPRLYEDFIEEIEQIAL  478

Query  1547  FKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSI  1726
             FKY ALPHWGKNRN+AF G I+KYK+A  FLKVK+ +DP GLFS+EW+DQILG+K   +I
Sbjct  479   FKYNALPHWGKNRNLAFDGVIKKYKNAPAFLKVKESYDPTGLFSTEWTDQILGIKGNATI  538

Query  1727  VKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             VKDGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  539   VKDGCALEGLCICSEDAHCAPTKGYLCRPGKVYKEARVCTRVS  581



>ref|XP_006280234.1| hypothetical protein CARUB_v10026149mg [Capsella rubella]
 gb|EOA13132.1| hypothetical protein CARUB_v10026149mg [Capsella rubella]
Length=577

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/570 (62%), Positives = 449/570 (79%), Gaps = 8/570 (1%)
 Frame = +2

Query  164   FLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F +FT  SS P +DP+KC   NT+      SYG+FPDR +C+AAK  YP+TE EL+S++A
Sbjct  9     FCLFTFASSTPPDDPVKCESGNTICTVTN-SYGSFPDRSICQAAKVEYPRTEEELVSVVA  67

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              AT+  +KM+  TRYSHS+PKL C +G DG+LISTK+LN  +  N  + T+TVESGV+LR
Sbjct  68    AATRAGQKMRVVTRYSHSLPKLVCTDGKDGVLISTKFLNNVVRTNREAKTLTVESGVTLR  127

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+IEEAAK  LALPY+PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+V+P    
Sbjct  128   QLIEEAAKLDLALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVTEIRLVSPGLAS  187

Query  701   EGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             +GY  +R L + N   + +AA+VSLGVLGVISQVTF+LQPMFKRS+++V+ +D D G +A
Sbjct  188   DGYVKVRVLSEANDPEEFRAAKVSLGVLGVISQVTFELQPMFKRSLTYVMIDDSDFGDQA  247

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
               FG +HEFAD  WLP    VVYR+DDRV  NTSG+GLF+F+  R+  +  L   R  EE
Sbjct  248   VTFGEKHEFADFIWLPSQGKVVYRIDDRVPVNTSGSGLFNFYPFRSQLSLALATDRSLEE  307

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
               ES+ DA+ KC    L++ +M + +SYGLTN+G+ F+GYPVIG QN M SSG+CLDS N
Sbjct  308   IDESLQDANIKCMRAELVSSFM-FSISYGLTNNGIIFTGYPVIGMQNRMMSSGSCLDSRN  366

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             D L   CPWDPR+ G FFHQTTFS+ LT+VKSFI D++ LV ++PKSLCVL   +GIL+R
Sbjct  367   DGLITACPWDPRIKGQFFHQTTFSVPLTRVKSFINDIKALVKIKPKSLCVLEGSNGILIR  426

Query  1409  YVKASTAYLGKQEDSIDFDITYYRS-KDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             YV +STA+LGK+E ++DFD+TYYR+ KDP+VPRLYED +EEIEQMAMFKY ALPHWGKNR
Sbjct  427   YVTSSTAFLGKEEKALDFDLTYYRNKKDPLVPRLYEDYIEEIEQMAMFKYNALPHWGKNR  486

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF GAIRKYK+A  FLKVK++FD LGLFS++W+DQILGLK  ++IVK GCALEGLCIC
Sbjct  487   NLAFDGAIRKYKNANTFLKVKERFDSLGLFSTQWTDQILGLKGNVTIVKQGCALEGLCIC  546

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D+HCAPNKGY CR GK+Y++++VC +++
Sbjct  547   SEDSHCAPNKGYLCRPGKIYRESRVCTRVS  576



>ref|XP_006604910.1| PREDICTED: L-gulonolactone oxidase-like [Glycine max]
 gb|KHN11380.1| L-gulonolactone oxidase [Glycine soja]
Length=589

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/584 (61%), Positives = 448/584 (77%), Gaps = 11/584 (2%)
 Frame = +2

Query  119   MAKMSI-NILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAK  295
             MA++   + L+ I+  FL F V    PEDPIKCT  NT       SYG FPDR +C A +
Sbjct  9     MAQLPFTHTLVLIF--FLCFYVALPTPEDPIKCTSKNTNCTITN-SYGIFPDRSICGAEQ  65

Query  296   AVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVN  475
               YP  E EL+ ++A A++ K+KMK ATR+SHSIPK  CPEG  G LISTKYLNR LE+ 
Sbjct  66    VFYPTEEEELVKVVASASQSKKKMKVATRFSHSIPKWVCPEGQKGWLISTKYLNRVLEIE  125

Query  476   ASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVH  655
             A   T+TV+SGV+L+Q+I+EAAKAGLALPY+PYWWGLT+GG++GTG+HGSSLWG GSSVH
Sbjct  126   AEKRTITVQSGVTLKQLIDEAAKAGLALPYAPYWWGLTIGGILGTGAHGSSLWGKGSSVH  185

Query  656   DHVIHIRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGVISQVTFKLQPMFKRS  829
             + V+ +RIV P   ++GYA + TL     D  + AA++SLG+LGVISQ+T KL+P+FKRS
Sbjct  186   EQVVELRIVRPTGPQDGYAKVHTLSHQEDDQHLNAAKLSLGLLGVISQITLKLEPLFKRS  245

Query  830   ISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLR  1009
             I+++ KND DLG +A  FG QHEFAD+ W P     VYRVDDRV  NTSGNG++DF   R
Sbjct  246   ITYLTKNDSDLGDQAAAFGQQHEFADIIWYPNQHKAVYRVDDRVPMNTSGNGVYDFIPFR  305

Query  1010  AVGTDCLNALREKEEHQESIGDADEKCS-NQWLINVWMVWFLSYGLTNDGVKFSGYPVIG  1186
             +  +  L  +R  E+ QES  DAD KC   +   N       +YGLTN+G+ F+G+PV+G
Sbjct  306   STPSLELALIRTTEDVQESTRDADGKCLLAKTTTNTLKA--TAYGLTNNGMIFTGFPVVG  363

Query  1187  YQNHMQSSGTCLD-SLNDNLT-CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLE  1360
             + NH+Q+SG+CL+  +N  +T CPWD RV G FFHQT FSI L+ VK+FIEDVQKLV+LE
Sbjct  364   FHNHLQASGSCLEIDMNAKITSCPWDFRVKGEFFHQTAFSIGLSVVKNFIEDVQKLVELE  423

Query  1361  PKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQM  1540
             PK  C + +Y+GILMRYVKAS+AYLGKQED+IDFDITYYRSKDPM PRLYEDI+EE+EQ+
Sbjct  424   PKRFCGIEIYNGILMRYVKASSAYLGKQEDAIDFDITYYRSKDPMTPRLYEDIIEEVEQL  483

Query  1541  AMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGL  1720
              +FKYG LPHWGKNRNVAF+G I KYK+AG+F KVK ++D  GLFSSEWSDQ+LGLK GL
Sbjct  484   GIFKYGGLPHWGKNRNVAFEGVINKYKNAGKFFKVKDEYDSQGLFSSEWSDQVLGLKEGL  543

Query  1721  SIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +I KDGCALEGLCICSQDNHCAP+KGYFCR GKVYK+A++C ++
Sbjct  544   TISKDGCALEGLCICSQDNHCAPSKGYFCRPGKVYKEARICTRL  587



>ref|XP_003521824.2| PREDICTED: D-arabinono-1,4-lactone oxidase-like [Glycine max]
Length=595

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/574 (61%), Positives = 449/574 (78%), Gaps = 6/574 (1%)
 Frame = +2

Query  137   NILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTE  316
             N  + ++V  +   V ++ PEDPI+C+  NT       +YG FPDR +C AA+ +YP TE
Sbjct  10    NSFLILFVFMICGGVIATPPEDPIQCSSKNTDCTITN-TYGVFPDRSICHAAEVIYPNTE  68

Query  317   AELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMT  496
              EL+S +A A+K KRK+KAATR+SHSIPKL CP+G+ GLLISTK LN+ L+++  + TMT
Sbjct  69    EELISAVASASKNKRKVKAATRFSHSIPKLVCPDGEKGLLISTKNLNKVLKIDKEARTMT  128

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
             V+SGVSLR++I ++A+AGLALPY+PYWWGLT+GGLMGTG+HGS+LWG GS+VH++V+ IR
Sbjct  129   VQSGVSLREIISKSAEAGLALPYTPYWWGLTIGGLMGTGAHGSTLWGKGSAVHEYVLQIR  188

Query  677   IVTPATEKEGYATIRTLKQGNSD-IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             IVTPA  ++GYA +R L + +   + AARVSLGVLGVISQVT  L+P+FKRS+++++K+D
Sbjct  189   IVTPAGPEDGYAKVRNLDESHQQHLNAARVSLGVLGVISQVTLNLEPLFKRSLTYLIKDD  248

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              DLG E   FG +HEFAD+ W P  +  VYR+DDRVS NTSGNGL+DFF  R   +  L 
Sbjct  249   SDLGDELASFGRKHEFADVTWYPSQQKAVYRIDDRVSVNTSGNGLYDFFPFRPTLSAALT  308

Query  1034  ALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSG  1213
              +R  EE QE+  DA+ KC    LI   +   + YGLT++G+ F GYP++G+ N MQ+SG
Sbjct  309   VVRATEELQEATRDANGKCVGAKLITATLSG-IGYGLTDNGI-FLGYPIVGFSNRMQASG  366

Query  1214  TCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGL  1387
             TCLDS ND L   CPWD R+ G FFHQT FSI L+ VK+FIEDVQKLV+LEPKSLC L  
Sbjct  367   TCLDSRNDGLFTACPWDSRIKGEFFHQTAFSIPLSVVKNFIEDVQKLVELEPKSLCGLET  426

Query  1388  YDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALP  1567
              +GILMRYV AS+AYLGK ED++DFDITYYRSKDP+ PRL++DILEEIEQ+ +FKYG LP
Sbjct  427   ANGILMRYVTASSAYLGKSEDAVDFDITYYRSKDPLAPRLFQDILEEIEQIGLFKYGGLP  486

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF GAI+KY +A +FLKVK+++DP GLFSS W+DQ+LGLK G++  KDGCAL
Sbjct  487   HWGKNRNLAFLGAIKKYHNADKFLKVKEEYDPQGLFSSLWTDQMLGLKEGVTTFKDGCAL  546

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             EG+CICSQD+HCAP KGYFCR G++Y +A+VC +
Sbjct  547   EGMCICSQDSHCAPKKGYFCRPGRIYTEARVCTR  580



>ref|XP_004308282.1| PREDICTED: L-gulono-1,4-lactone dehydrogenase-like [Fragaria 
vesca subsp. vesca]
Length=577

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/561 (63%), Positives = 443/561 (79%), Gaps = 3/561 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L F+V S+ PED IKC+ +N  +CTITN+YG FPDR VC+     YP +E EL+S +A  
Sbjct  16    LSFSVCSTSPEDHIKCSSSNNTDCTITNAYGIFPDRTVCKVRGVTYPNSEEELVSTVAYG  75

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             +K K  MKA+TRY+HSIPKLACP G++GL+ISTK LNR + +N   +TMTVESG++LRQV
Sbjct  76    SKYKIPMKASTRYAHSIPKLACPRGEEGLIISTKNLNRVVGINVQELTMTVESGMTLRQV  135

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAK GLALPY+PYWWG+++GGL+ TG+HGS+LWG GS VHD+V+ +RIV+P   ++G
Sbjct  136   IGEAAKVGLALPYTPYWWGVSLGGLLATGAHGSTLWGKGSGVHDYVVGLRIVSPGGPQDG  195

Query  707   YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFG  886
             YA +R L  G+ D+ AA+VSLGVLGVISQVT  LQPMFKRSI+++ + D DLG +A  FG
Sbjct  196   YAKVRILSHGDEDLNAAKVSLGVLGVISQVTLSLQPMFKRSITYLSEGDSDLGDQALNFG  255

Query  887   FQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQES  1066
              QHEFAD+ W P     VYR+DDRVS++TSG+GL+DF   R   +  L A+R  EE QES
Sbjct  256   KQHEFADIIWYPSQHRAVYRIDDRVSSDTSGDGLYDFIPFRPTPSLALAAIRTTEETQES  315

Query  1067  IGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--  1240
             + DA+ KC +  L+   ++   +YGLTNDG+ F+GYPVIGYQN +QSSGTCLDSL+D   
Sbjct  316   MNDANGKCYSAKLVTSGLLAS-AYGLTNDGLIFTGYPVIGYQNRIQSSGTCLDSLDDAKI  374

Query  1241  LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               CPWD  V G  FHQT  SISL+  K+FI+DVQKLV++ P+SLC   +Y+G LMRYV A
Sbjct  375   TACPWDSGVKGELFHQTAVSISLSLAKNFIQDVQKLVEIAPESLCGTEIYNGFLMRYVTA  434

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             STAYLGKQED++DFDITYYRS+DPM PRLYE ILEEIEQ+A+FKYGALPHWGKNRN+AF 
Sbjct  435   STAYLGKQEDALDFDITYYRSRDPMTPRLYEGILEEIEQLALFKYGALPHWGKNRNIAFD  494

Query  1601  GAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNH  1780
             G I+KYK   EFL+VK  +DP+GLFS+EWSDQ+LG+K G+++ K+GCALEGLCICS+D H
Sbjct  495   GVIKKYKKGEEFLRVKDVYDPIGLFSNEWSDQVLGIKGGVTVAKEGCALEGLCICSEDIH  554

Query  1781  CAPNKGYFCRAGKVYKDAKVC  1843
             CAP+KGYFCR GKV++DA+VC
Sbjct  555   CAPSKGYFCRPGKVFRDARVC  575



>ref|XP_010544874.1| PREDICTED: L-gulonolactone oxidase-like [Tarenaya hassleriana]
Length=598

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/564 (62%), Positives = 441/564 (78%), Gaps = 5/564 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+    S+ PEDP+KC   NT       SYG FPDR  CRAA   YP  EAEL+SI+A A
Sbjct  28    LLLVAVSTPPEDPVKCASGNTNCTVTN-SYGAFPDRSTCRAANVAYPTNEAELVSIVAAA  86

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             T+ +RKM+  TR+ HSIPKLAC +G DGLLISTK+LNRTL+ + +++T+TVESGVSLRQ+
Sbjct  87    TRAQRKMRVVTRFGHSIPKLACTDGKDGLLISTKFLNRTLKADPAALTLTVESGVSLRQL  146

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAKAG+ALPY+PYWWGLTVGGLMGTG+HGSSLWG GS++HD+V  I++V+P +  EG
Sbjct  147   IGEAAKAGMALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAIHDYVTEIQMVSPGSADEG  206

Query  707   YATIRTLKQGN-SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             +  +R L +   ++  AA+VSLGVLGVISQVTFKLQPMFKRS+++V+KND D G +A  F
Sbjct  207   FVRVRVLNESTLNEFNAAKVSLGVLGVISQVTFKLQPMFKRSLTYVMKNDSDFGDQAMTF  266

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G +HEFAD+ W P    VVYR+DDRV +NTSGNGL+DF   R+  +  L  +R  EE QE
Sbjct  267   GKKHEFADLLWYPTQGKVVYRIDDRVPSNTSGNGLYDFLPFRSQLSAALAIIRSTEETQE  326

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
             ++ DA+ KC    LI    ++  +YGLT++GV F+GYPV+G Q+ M SSGTCLDSL D +
Sbjct  327   ALRDANGKCIGAKLITS-TLFASAYGLTSNGVIFTGYPVVGNQSRMMSSGTCLDSLQDGM  385

Query  1244  --TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
                C WD R+ G FFHQTTFSI LT+VK FI DV+ L+ +EPKSLC L LY G LMRYV 
Sbjct  386   ITACAWDSRIKGEFFHQTTFSIPLTRVKDFINDVKALLKIEPKSLCGLELYYGFLMRYVT  445

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             AS AYLGK+ +++DFD+TYYRSKDP+ PRL+ED +EEIEQMA+FKY ALPHWGKNRNVAF
Sbjct  446   ASPAYLGKEVEALDFDLTYYRSKDPLTPRLFEDYIEEIEQMALFKYNALPHWGKNRNVAF  505

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              G I+KYK+A +FL+VK+K+DP GLFSSEW++QILGLK  ++IVK+ CALEGLCICS+D 
Sbjct  506   DGVIKKYKNAPDFLRVKEKYDPSGLFSSEWTNQILGLKGNVTIVKESCALEGLCICSEDI  565

Query  1778  HCAPNKGYFCRAGKVYKDAKVCVK  1849
             HCAP KGYFC++GKVYK+A+VC +
Sbjct  566   HCAPKKGYFCQSGKVYKEARVCAR  589



>ref|XP_006293869.1| hypothetical protein CARUB_v10022850mg [Capsella rubella]
 gb|EOA26767.1| hypothetical protein CARUB_v10022850mg [Capsella rubella]
Length=600

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/566 (62%), Positives = 435/566 (77%), Gaps = 6/566 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+FT  S+ PEDP+KC   NT       SYG FPDR  CRAA   YP +EAEL+S++A A
Sbjct  26    LVFTTISTPPEDPVKCVSGNTNCTVTN-SYGVFPDRSTCRAANVAYPTSEAELVSVVAAA  84

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             T+  +KM+  TRYSHSI KL C +G DGL ISTK+LN T+  +A SMT+TVESGV+LRQ+
Sbjct  85    TRAGQKMRVTTRYSHSITKLVCVDGTDGLFISTKFLNDTVRADADSMTLTVESGVTLRQL  144

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  +G
Sbjct  145   IAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSANDG  204

Query  707   YATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             +A +R L +  +  +  AA+VSLGVLGVISQVTFKLQPMFKRS+ +V++ND D G +A  
Sbjct  205   FAKVRVLNELTTPNEFNAAKVSLGVLGVISQVTFKLQPMFKRSLRYVMRNDSDFGDQAMT  264

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
             FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLFDF   R+  +  L  +R  EE Q
Sbjct  265   FGKEHEFADFIWLPSQGKVVYRLDDRVPVNTSGNGLFDFLPFRSQLSAALAIIRSSEETQ  324

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             E   DA+ KC+   LI+   ++  +YGLTN+G+ F+GYPVIG QN M SSG+CLDSL D 
Sbjct  325   ERFRDANGKCAGATLISS-TLFATAYGLTNNGIIFTGYPVIGSQNRMMSSGSCLDSLQDG  383

Query  1241  L--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
             L   CPWD R+   FFHQTTFS+ LT+VKSFI D++ LV +E KSLC L LY GILMRYV
Sbjct  384   LITACPWDSRIKSEFFHQTTFSVPLTQVKSFINDIKSLVKIESKSLCGLELYYGILMRYV  443

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
              +S A LGK+ +++DFD+TYYR+K+P+ PRLYED +EEIEQ+A+FKY ALPHWGKNRN+A
Sbjct  444   TSSPALLGKETEALDFDLTYYRAKNPLTPRLYEDFIEEIEQIALFKYNALPHWGKNRNLA  503

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCALEGLC+CS+D
Sbjct  504   FDGVIKKYKNASAFLKVKEMYDPTGLFSSEWTDQILGIKGDATIVKDGCALEGLCVCSKD  563

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +HCAP KGY CR GKVYK+A+VC ++
Sbjct  564   SHCAPTKGYMCRPGKVYKEARVCTRV  589



>ref|XP_009142609.1| PREDICTED: L-gulonolactone oxidase [Brassica rapa]
 emb|CDX80043.1| BnaA05g01130D [Brassica napus]
Length=603

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/590 (60%), Positives = 445/590 (75%), Gaps = 7/590 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRG  277
             PS+           L+ ++  F L+ T  S+ PEDP+KC   NT       SYG FPDR 
Sbjct  7     PSYGFPQNAAVWRTLLGLFCIFTLVLTAVSTPPEDPVKCVSGNTNCTVTN-SYGAFPDRS  65

Query  278   VCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLN  457
              CRAA   YP TE EL++I+A ATK  RKM+  TRYSHSI KL C +G +GL ISTK+LN
Sbjct  66    KCRAASVAYPTTEDELVAIVAAATKTGRKMRVTTRYSHSITKLVCTDGTNGLFISTKFLN  125

Query  458   RTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWG  637
              T++ +A +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG
Sbjct  126   HTVQSDAKAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWG  185

Query  638   VGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQ  811
              GS+VHD+V  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGV+SQVTFKLQ
Sbjct  186   KGSAVHDYVTEIRMVSPGSVSDGFAKVRVLSETTTPNEFNAAKVSLGVLGVVSQVTFKLQ  245

Query  812   PMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLF  991
             PMFKRS+++ ++ND D G++A  FG +HEFAD  WLP    VVYR DDRV+ NTSGNGL+
Sbjct  246   PMFKRSLTYTMRNDSDFGEQAVTFGKKHEFADFLWLPSQGKVVYRRDDRVAVNTSGNGLY  305

Query  992   DFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSG  1171
             DF   R+  +  +  +R  EE QE   DA+ KC    LI+   ++  SYGLTN+GV F+G
Sbjct  306   DFLPFRSQLSVAIAIIRSSEETQERFRDANGKCIGATLISS-TLFGTSYGLTNNGVIFTG  364

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG QN M SSG+CLDSL D L   C WD R+NG FFHQTTFS++LT+VKSFI D++ 
Sbjct  365   YPVIGSQNRMMSSGSCLDSLQDGLITACAWDSRINGEFFHQTTFSVALTQVKSFINDIKS  424

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L+ +EPKSLC L L+ GILMRYV +S AYLGK+ +++DFDITYYR+KDP+ PRLYED +E
Sbjct  425   LIKIEPKSLCGLELHYGILMRYVTSSPAYLGKETEALDFDITYYRAKDPLAPRLYEDFIE  484

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILG  1705
             EIEQ+A+FKY ALPHWGKNRN+AF G I+KYK+   FLKVK+ +DP GLFS+EW+DQILG
Sbjct  485   EIEQIALFKYNALPHWGKNRNLAFDGVIKKYKNVPAFLKVKESYDPTGLFSTEWTDQILG  544

Query  1706  LKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +K   +IVK+GCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  545   IKGNATIVKNGCALEGLCICSEDAHCAPTKGYLCRPGKVYKEARVCTRVS  594



>emb|CAZ68130.1| FAD-binding domain-containing protein [Arabidopsis halleri subsp. 
halleri]
Length=591

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/571 (61%), Positives = 437/571 (77%), Gaps = 6/571 (1%)
 Frame = +2

Query  155   YVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSI  334
             Y+  L+ T  S+ P+DP+KC   N        SYG FPDR  CRAA   YPKTEAEL+S+
Sbjct  17    YIFTLVHTAVSTPPDDPVKCVSGNMNCTVTN-SYGAFPDRSTCRAANVAYPKTEAELVSV  75

Query  335   IAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVS  514
             +A AT+  RKM+  TRYSHSI KL C +G DGL ISTK+LN T++ NA++MT+TVESG +
Sbjct  76    VAAATQAGRKMRVTTRYSHSITKLVCTDGTDGLFISTKFLNHTVQANATAMTLTVESGTT  135

Query  515   LRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPAT  694
             LRQ+I EAAK GLALPY+PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+V+P +
Sbjct  136   LRQLIAEAAKIGLALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGS  195

Query  695   EKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
               +G+A IR L +  +  + KAA+VSLGVLGVISQVTFKLQPMFKRS+++ ++ND D   
Sbjct  196   VNDGFAKIRVLSEITTPNEFKAAKVSLGVLGVISQVTFKLQPMFKRSLTYTMRNDWDFED  255

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             +A  FG +HEFAD  WLP    VVYR DDRV  NTSGNGLFDF   R+  +  +  +R  
Sbjct  256   QAVTFGKKHEFADFIWLPSQGKVVYRRDDRVPVNTSGNGLFDFLPFRSQLSAAIAIIRSS  315

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             EE QE+  D + KC    +I+   ++  SYGLTN+G+ F+GYPV+G Q+ M SSG+CLDS
Sbjct  316   EETQETFRDVNGKCVGATIISS-TLFATSYGLTNNGIIFTGYPVVGSQDRMMSSGSCLDS  374

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
             L D L   C WD R+ G FFHQTTFS+ LT+VKSFI D++ LV +EPKSLC L L+ GIL
Sbjct  375   LQDGLITACGWDSRIRGEFFHQTTFSVPLTQVKSFISDIKSLVKIEPKSLCGLELHYGIL  434

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             MRYV +S AYLGK+ +++DFDITYYRSKDP+ PRLYED +EEIEQ+A+FKY ALPHWGKN
Sbjct  435   MRYVTSSPAYLGKETEALDFDITYYRSKDPLTPRLYEDFIEEIEQIALFKYNALPHWGKN  494

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN+AF G I+KY +A  FLKVK+ +DP GLFSSEW+DQILG+K  ++I+KDGCALEGLCI
Sbjct  495   RNLAFDGVIQKYNNAPAFLKVKESYDPKGLFSSEWTDQILGIKGSVTIIKDGCALEGLCI  554

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             CS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  555   CSKDVHCAPAKGYLCRPGKVYKEARVCTRVD  585



>gb|KHN16407.1| L-gulonolactone oxidase [Glycine soja]
Length=594

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/574 (61%), Positives = 447/574 (78%), Gaps = 7/574 (1%)
 Frame = +2

Query  137   NILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTE  316
             N  + ++V  +   V ++ PEDPI+C+  NT       +YG FPDR +C AA+ +YP TE
Sbjct  10    NSFLILFVFMICGGVIATPPEDPIQCSSKNTDCTITN-TYGVFPDRSICHAAEVIYPNTE  68

Query  317   AELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMT  496
              EL+S +A A+K KRK+KAATR+SHSIPKL CP+G+ GLLISTK LN+ L+++  + TMT
Sbjct  69    EELISAVASASKNKRKVKAATRFSHSIPKLVCPDGEKGLLISTKNLNKVLKIDKEARTMT  128

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
             V+SGVSLR++I ++A+AGLALPY+PYWWGLT+GGLMGTG+HGS+LWG GS+VH++V+ IR
Sbjct  129   VQSGVSLREIISKSAEAGLALPYTPYWWGLTIGGLMGTGAHGSTLWGKGSAVHEYVLQIR  188

Query  677   IVTPATEKEGYATIRTLKQGNSD-IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             IVTPA  ++GYA +R L +     + AARVSLGVLGVISQVT  L+P+FKRS+++++K+D
Sbjct  189   IVTPAGPEDGYAKVRNLDESQQQHLNAARVSLGVLGVISQVTLNLEPLFKRSLTYLIKDD  248

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              DLG E   FG +HEFAD+ W P  +  VYR+DDRVS NTSGNGL+DFF  R      L 
Sbjct  249   SDLGDELASFGRKHEFADVTWYPSQQKAVYRIDDRVSVNTSGNGLYDFFPFRPTSA-ALT  307

Query  1034  ALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSG  1213
              +R  EE QE+  DA+ KC    LI   +   + YGLT++G+ F GYP++G+ N MQ+SG
Sbjct  308   VVRATEELQEATRDANGKCVGAKLITATLSG-IGYGLTDNGI-FLGYPIVGFSNRMQASG  365

Query  1214  TCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGL  1387
             TCLDS ND L   CPWD R+ G FFHQT FSI L+ VK+FIEDVQKLV+LEPKSLC L  
Sbjct  366   TCLDSRNDGLFTACPWDSRIKGEFFHQTAFSIPLSVVKNFIEDVQKLVELEPKSLCGLET  425

Query  1388  YDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALP  1567
              +GILMRYV AS+AYLGK ED++DFDITYYRSKDP+ PRL++DILEEIEQ+ +FKYG LP
Sbjct  426   ANGILMRYVTASSAYLGKSEDAVDFDITYYRSKDPLAPRLFQDILEEIEQIGLFKYGGLP  485

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF GAI+KY +A +FLKVK+++DP GLFSS W+DQ+LGLK G++  KDGCAL
Sbjct  486   HWGKNRNLAFLGAIKKYHNADKFLKVKEEYDPQGLFSSLWTDQMLGLKEGVTTFKDGCAL  545

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             EG+CICSQD+HCAP KGYFCR G++Y +A+VC +
Sbjct  546   EGMCICSQDSHCAPKKGYFCRPGRIYTEARVCTR  579



>ref|XP_006397865.1| hypothetical protein EUTSA_v10001763mg [Eutrema salsugineum]
 gb|ESQ39318.1| hypothetical protein EUTSA_v10001763mg [Eutrema salsugineum]
Length=597

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/589 (60%), Positives = 443/589 (75%), Gaps = 6/589 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PSH    A     +L    +  L+ T  S+ PEDP++C   NT       SYG FPDR  
Sbjct  7     PSHGFQNAAFWRIVLGIHCILTLVHTGLSTPPEDPVRCVAGNTDCIVTN-SYGVFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             CRAA   YP TEAEL+SI+A ATK  RKM+  TRYSHSIPKLAC +G DGL ISTK+LN 
Sbjct  66    CRAANVAYPTTEAELVSIVAAATKAGRKMRVTTRYSHSIPKLACTDGTDGLFISTKFLNH  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T+  +A +MTMTVESGV+LRQ+I EAAK GLALP++PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVRADAKAMTMTVESGVTLRQLISEAAKVGLALPHAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IR+V+P +  +GYA +R L +  +  +  AA+VSLGVLGVISQVTF LQ 
Sbjct  186   GSAVHDYVTEIRMVSPGSVNDGYAKVRVLSETTTPNEFNAAKVSLGVLGVISQVTFDLQL  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+ +V+++D D   +A  FG +HEFAD  WLP    VVYR+DDRV+ NTSGNGL+D
Sbjct  246   MFKRSLKYVMRDDLDFDDQALTFGRKHEFADFVWLPSQGKVVYRMDDRVAVNTSGNGLYD  305

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             +   R+  +  +  +R  EE QE++ DA+ KC+   +I+   ++  SYGLTN+GV F+GY
Sbjct  306   YLPFRSQPSAAIATIRSSEETQETVRDANGKCAGATVISS-TLFASSYGLTNNGVVFTGY  364

Query  1175  PVIGYQNHMQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PVIG QN M SSG+CLDSL D L+  C WD RV G FFHQT FSI LT+VKSFI D++ L
Sbjct  365   PVIGSQNSMMSSGSCLDSLQDGLSTACAWDSRVKGEFFHQTCFSIPLTQVKSFINDIKSL  424

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V ++PKSLC L LY+GILMRYV  S+AYLGK+ +++DFD+TYYR+KDP+ PRLYED +EE
Sbjct  425   VKIDPKSLCGLELYNGILMRYVTTSSAYLGKETEALDFDLTYYRAKDPLAPRLYEDFVEE  484

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A  KY ALPHWGKNRNVAF G I+KYK+A  FL+VK+ FDP GLFSSEW+DQILG+
Sbjct  485   IEQVAFLKYNALPHWGKNRNVAFDGVIKKYKNAPAFLEVKESFDPNGLFSSEWTDQILGI  544

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             K   +IV DGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  545   KGNPTIVNDGCALEGLCICSEDAHCAPTKGYLCRPGKVYKEARVCTRVS  593



>ref|NP_182197.1| D-arabinono-1,4-lactone oxidase-like protein [Arabidopsis thaliana]
 gb|AAC33493.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10747.1| D-arabinono-1,4-lactone oxidase-like protein [Arabidopsis thaliana]
Length=590

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/575 (62%), Positives = 438/575 (76%), Gaps = 7/575 (1%)
 Frame = +2

Query  143   LITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             L+ +Y  F L+ TV S+ PEDP+KC   NT       S G FPDR  CRAA   YP TEA
Sbjct  16    LLGLYCLFTLVHTVISTPPEDPVKCVSGNTNCIVTN-SLGAFPDRSTCRAANVAYPTTEA  74

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+SI+A ATK  RKM+  TRYSHSIPKL C +G+DGL ISTK+LN T++ +A +MT+TV
Sbjct  75    ELVSIVAAATKAGRKMRVTTRYSHSIPKLTCTDGNDGLFISTKFLNHTVQADAKAMTLTV  134

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESGV+LRQ+I EAAK GLALPY+PYWWG+TVGG+MGTG+HGSSLWG GS+VHD+V  IR+
Sbjct  135   ESGVTLRQLIAEAAKVGLALPYAPYWWGVTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRM  194

Query  680   VTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             V+P +  +G+A IR L +  +  +  AA+VSLGVLGVISQVTF+LQPMFKRS+ +V++ND
Sbjct  195   VSPGSVNDGFAKIRVLSETTTPNEFNAAKVSLGVLGVISQVTFELQPMFKRSLKYVMRND  254

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              D   EA  FG +HEFAD  WLP    VVYR+DDRV+ NT GNGL+DFF  R+  +  L 
Sbjct  255   LDFNDEALTFGKKHEFADFVWLPSQGKVVYRMDDRVAVNTLGNGLYDFFPFRSQLSAVLA  314

Query  1034  ALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSG  1213
               R  EE QE++ DA  KC     I+   ++  SYGLTN+G+ F+GYPVIG QN M SSG
Sbjct  315   TTRSSEETQETLRDAHGKCVTATTISS-TLFSTSYGLTNNGITFTGYPVIGSQNRMMSSG  373

Query  1214  TCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGL  1387
             +CLD L D LT  C WD RV G+F+HQTTFSI LT+VKSFI D++ L+ ++ KSLC L L
Sbjct  374   SCLDGLEDKLTSACAWDSRVKGVFYHQTTFSIPLTQVKSFINDIKSLLKIDSKSLCGLEL  433

Query  1388  YDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALP  1567
             Y GILMRYV +S AYLGK+ ++IDFDITYYR+ DP+ PRLYED +EEIEQ+A+ KY ALP
Sbjct  434   YYGILMRYVTSSPAYLGKETEAIDFDITYYRANDPLTPRLYEDFIEEIEQIALLKYNALP  493

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCAL
Sbjct  494   HWGKNRNLAFDGVIKKYKNAPAFLKVKESYDPNGLFSSEWTDQILGIKGNPTIVKDGCAL  553

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             EGLCICS D HCAP+KGY CR GKVYK+A+VC  +
Sbjct  554   EGLCICSDDAHCAPSKGYLCRPGKVYKEARVCTHV  588



>ref|XP_010512820.1| PREDICTED: LOW QUALITY PROTEIN: L-gulonolactone oxidase-like 
[Camelina sativa]
Length=586

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/581 (61%), Positives = 438/581 (75%), Gaps = 7/581 (1%)
 Frame = +2

Query  128   MSINILITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVY  304
             M+   L+ +Y  F L+    S+ PEDP+KC   NT       S G FPDR  C AA   Y
Sbjct  1     MACRTLLGLYCLFTLVQMANSTPPEDPVKCVSGNTNCAVTN-SLGAFPDRSTCEAANVAY  59

Query  305   PKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASS  484
             P TEAEL+SI+A ATK  RKM+  TRYSHSIPKL C +G+DGL ISTK+LN T+  +A +
Sbjct  60    PTTEAELVSIVASATKAGRKMRVTTRYSHSIPKLVCTDGNDGLFISTKFLNHTVRADAKA  119

Query  485   MTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHV  664
             MT+TVESGV+L+Q+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V
Sbjct  120   MTLTVESGVTLKQLIAEAAKLGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYV  179

Query  665   IHIRIVTPATEKEGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISF  838
               IR+V+P +  +G+A IR L +    S+  AA+VSLGVLGVISQVTF+LQPMFKRS+ +
Sbjct  180   TEIRMVSPGSVNDGFAKIRVLSEATTPSEFNAAKVSLGVLGVISQVTFELQPMFKRSLKY  239

Query  839   VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVG  1018
             V++ND D   +A  FG +HEFAD  WLP    VVYR+DDRV+ NT GNGL+DF   R+  
Sbjct  240   VMENDLDFDDQALTFGKKHEFADFVWLPSQGKVVYRIDDRVADNTFGNGLYDFLPFRSQP  299

Query  1019  TDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNH  1198
             +  +   R  EE QE++ DA  KC+    I+  + +  SYGLTN+G+ F+GYPVIG QN 
Sbjct  300   SVAVATTRSSEETQETLRDAHGKCAAATAISSAL-FSASYGLTNNGIIFTGYPVIGSQNR  358

Query  1199  MQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSL  1372
             M +SG+CLD L D LT  CPWD R+ G+ FHQT FSI L++VK+FI D++ L+ +EPKSL
Sbjct  359   MMASGSCLDGLEDGLTTACPWDSRIKGVSFHQTCFSIPLSQVKTFINDIKSLIKIEPKSL  418

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             C L LY GILMRYV +S AYLGK+ + IDFDITYYR+KDP+ PRLYED +EEIEQ+A+FK
Sbjct  419   CGLELYYGILMRYVTSSPAYLGKETEGIDFDITYYRAKDPLTPRLYEDFIEEIEQIALFK  478

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVK  1732
             Y ALPHWGKNRN+AF G I+KYK+A EFLKVK+ +DP GLFSSEW+DQILG+K   +IVK
Sbjct  479   YNALPHWGKNRNIAFDGVIKKYKNAPEFLKVKESYDPNGLFSSEWTDQILGIKGNTTIVK  538

Query  1733  DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             DGCALEGLCICS+D HCAP  GY CR GKVYK+A+VC  +N
Sbjct  539   DGCALEGLCICSEDAHCAPTNGYLCRPGKVYKEARVCTHVN  579



>ref|XP_006293871.1| hypothetical protein CARUB_v10022855mg [Capsella rubella]
 gb|EOA26769.1| hypothetical protein CARUB_v10022855mg [Capsella rubella]
Length=598

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/576 (61%), Positives = 439/576 (76%), Gaps = 7/576 (1%)
 Frame = +2

Query  143   LITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             LI +Y  F L+ T  S+ PEDP+KC   NT       SYG FPDR  C AA   YPKTEA
Sbjct  20    LIWLYYIFTLVHTAVSTPPEDPVKCVSGNTNCTVTN-SYGAFPDRSTCLAANVAYPKTEA  78

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+S++A AT+  RKM+  TRYSHSI KL C +G DGL ISTK+LN T++ +A++MT+TV
Sbjct  79    ELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTDGLFISTKFLNHTVQADATAMTLTV  138

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESG++LRQ+I EAAK GLALPY+PYWWGLT+GG+MGTG+HGSSLWG GS+VHD+V  IR+
Sbjct  139   ESGMTLRQLIAEAAKIGLALPYAPYWWGLTIGGMMGTGAHGSSLWGKGSAVHDYVTEIRM  198

Query  680   VTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             V+P +  +G+A IR L +  +  + KAA+VSLGVLGVISQVTFKLQPMFKRS+++ ++ND
Sbjct  199   VSPGSVNDGFAKIRVLSETTTPNEFKAAKVSLGVLGVISQVTFKLQPMFKRSLTYTMRND  258

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              D   +A  FG +HEFAD  WLP    VVYR DDRV  NTSGNGLFDF   R+  +  + 
Sbjct  259   SDFEDQAVTFGEKHEFADFIWLPSQGKVVYRRDDRVPFNTSGNGLFDFLPFRSQLSAAIA  318

Query  1034  ALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSG  1213
              +R  EE QE   DA+ KC    +I+   ++  SYGLTN+G+ F+GYPV+G QN M SSG
Sbjct  319   IIRSSEETQERFRDANGKCVGATIISS-TLFATSYGLTNNGIIFTGYPVVGSQNRMMSSG  377

Query  1214  TCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGL  1387
             +CLDSL D L   C WD R+ G FFHQTTFS+ LT+VKSFI+D++ LV +E KSLC L L
Sbjct  378   SCLDSLQDGLITACAWDSRIKGEFFHQTTFSVPLTQVKSFIKDIKSLVKIESKSLCGLEL  437

Query  1388  YDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALP  1567
             + GILMRYV +S AYLGK+ +++DFDITYYRSKDP+ PRLYED +EEIEQ+A+FKY ALP
Sbjct  438   HYGILMRYVTSSPAYLGKEIEALDFDITYYRSKDPLTPRLYEDFIEEIEQIALFKYNALP  497

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF G IRKY +A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCAL
Sbjct  498   HWGKNRNLAFDGVIRKYNNAPAFLKVKEVYDPKGLFSSEWTDQILGIKGNATIVKDGCAL  557

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             EGLCICS+D HCAP KGY CR GKVYK+A+VC ++ 
Sbjct  558   EGLCICSKDAHCAPAKGYMCRPGKVYKEARVCTRVT  593



>ref|XP_003554782.1| PREDICTED: D-arabinono-1,4-lactone oxidase-like [Glycine max]
Length=589

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/557 (62%), Positives = 441/557 (79%), Gaps = 7/557 (1%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             PEDPI+C+  NT       +YG FPDR +C A + +YP TE EL+S +A A+K KRK+KA
Sbjct  20    PEDPIRCSSKNTDCTITN-TYGVFPDRSICHAGEVMYPNTEEELISAVASASKNKRKVKA  78

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             ATR+SHSIPKL CP+G++GLLISTK LN+ L+++  + TMTV+SGVSLR++I + A+AGL
Sbjct  79    ATRFSHSIPKLVCPDGENGLLISTKNLNKILKIDKEARTMTVQSGVSLREIISKGAEAGL  138

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQ  733
             ALPY+PYWWGLT+GGLMGTG+HGS+LWG GS+VH++V+ +RIVTPA  ++GYA +R L +
Sbjct  139   ALPYTPYWWGLTIGGLMGTGAHGSTLWGKGSAVHEYVVELRIVTPAGPEDGYAKVRNLDE  198

Query  734   GNSD-IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADM  910
              +   + AARVSLGVLGVISQVT KL+P+FKRS++++ K+D DLG E   FG +HEFAD+
Sbjct  199   SHQQHLNAARVSLGVLGVISQVTLKLEPLFKRSLTYLTKDDSDLGDELVTFGRKHEFADV  258

Query  911   KWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKC  1090
              W P  +  VYR+DDRVS N SGNGL+DFF  R   +  L  +R  EE QE+  DA+ KC
Sbjct  259   TWYPSQQKAVYRIDDRVSINKSGNGLYDFFPFRPTLSAALTVVRATEELQEATRDANGKC  318

Query  1091  SNQWLINVWMVWFLSYGLTNDGVK--FSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
                 LI   +   + YGL+N+  K  F GYP++G+ N MQ+SGTCLDSLND L   CPWD
Sbjct  319   VGAKLITATLSG-IGYGLSNNDDKGIFLGYPIVGFSNRMQASGTCLDSLNDGLITACPWD  377

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
              R+ G FFHQT FSI L+ VK+FIEDVQKLV+LEPKSLC L   +GILMRYV AS+AYLG
Sbjct  378   SRIKGEFFHQTAFSIPLSAVKNFIEDVQKLVELEPKSLCGLETANGILMRYVTASSAYLG  437

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             K ED++DFDITYYRSKDP+ PRL++DILEEIEQ+ +FKYG LPHWGKNRN+AF GAI+KY
Sbjct  438   KSEDAVDFDITYYRSKDPLAPRLFQDILEEIEQIGLFKYGGLPHWGKNRNLAFLGAIKKY  497

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
              +A +FLKVK+++DP GLFSS W+DQ+LGL+ G++I+KDGCA+EG+CICSQD+HCAP KG
Sbjct  498   HNADKFLKVKEEYDPQGLFSSLWTDQMLGLQEGVTILKDGCAMEGMCICSQDSHCAPKKG  557

Query  1799  YFCRAGKVYKDAKVCVK  1849
             YFCR G++YK+A+VC +
Sbjct  558   YFCRPGRIYKEARVCTR  574



>ref|XP_009142611.1| PREDICTED: uncharacterized protein LOC103866439 [Brassica rapa]
Length=590

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/566 (62%), Positives = 433/566 (77%), Gaps = 6/566 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+ T  S+ PEDP++C   NT       SYG FPDR  CRAA   YP TEAEL+SI+A A
Sbjct  22    LVHTALSTPPEDPVRCVSGNTDCSVTN-SYGVFPDRSTCRAANVAYPTTEAELVSIVAAA  80

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             TK +RKM+  TRYSHSIPKLAC +G DGL ISTK+LN T++ +  +MT+TVESGV+LRQ+
Sbjct  81    TKARRKMRVTTRYSHSIPKLACTDGTDGLFISTKFLNHTVQADVGAMTLTVESGVTLRQL  140

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAK GLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VHD+V  I+IV+P +  +G
Sbjct  141   ITEAAKVGLALPYAPYWWGLTVGGMLGTGAHGSSLWGKGSAVHDYVTEIKIVSPGSVNDG  200

Query  707   YATIRTLKQGNSDIK--AARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             +A +R L +  + ++  AA+VSLGVLGVISQVTF LQPMFKRS+ +V+KND D   +   
Sbjct  201   FAKVRVLSESTTPVEFNAAKVSLGVLGVISQVTFGLQPMFKRSLKYVMKNDLDFDDQVLT  260

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
              G +HEFAD  WLP    VVYR+DDRV+ NT GNGL+DF   R+  +  L  +R  EE Q
Sbjct  261   LGEKHEFADFVWLPSQGKVVYRMDDRVAVNTPGNGLYDFLPFRSQPSAALAIIRSSEEKQ  320

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             E   DA  KC+   LI+   ++  SYGLTN+G+ F+GYPVIG QN M +SG+CLDSL D 
Sbjct  321   EIFRDATGKCTEATLISS-TLFSSSYGLTNNGIAFTGYPVIGSQNRMMTSGSCLDSLQDG  379

Query  1241  LT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
             LT  C WD R+ G F+HQT FSI LT+VKSFI D++ L+ ++ KSLC L LY+GILMRYV
Sbjct  380   LTTACAWDSRIKGEFYHQTCFSIPLTQVKSFITDIKSLIKIDQKSLCGLELYNGILMRYV  439

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
              AS AYLGK  ++IDFD+TYYR+KDP+ PRLYED +EEIEQ+A+FKY ALPHWGKNRNVA
Sbjct  440   TASPAYLGKDTEAIDFDLTYYRAKDPLTPRLYEDFIEEIEQIALFKYNALPHWGKNRNVA  499

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCALEGLCICS+D
Sbjct  500   FDGVIKKYKNASAFLKVKESYDPDGLFSSEWTDQILGIKGNATIVKDGCALEGLCICSED  559

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKI  1852
              HCAP KGY CR GKVYK+A+VC ++
Sbjct  560   AHCAPTKGYMCRPGKVYKEARVCTRV  585



>gb|KHN11381.1| D-arabinono-1,4-lactone oxidase [Glycine soja]
Length=580

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/557 (62%), Positives = 441/557 (79%), Gaps = 7/557 (1%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             PEDPI+C+  NT       +YG FPDR +C A + +YP TE EL+S +A A+K KRK+KA
Sbjct  11    PEDPIRCSSKNTDCTITN-TYGVFPDRSICHAGEVMYPNTEEELISAVASASKNKRKVKA  69

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             ATR+SHSIPKL CP+G++GLLISTK LN+ L+++  + TMTV+SGVSLR++I + A+AGL
Sbjct  70    ATRFSHSIPKLVCPDGENGLLISTKNLNKILKIDKEARTMTVQSGVSLREIISKGAEAGL  129

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQ  733
             ALPY+PYWWGLT+GGLMGTG+HGS+LWG GS+VH++V+ +RIVTPA  ++GYA +R L +
Sbjct  130   ALPYTPYWWGLTIGGLMGTGAHGSTLWGKGSAVHEYVVELRIVTPAGPEDGYAKVRNLDE  189

Query  734   GNSD-IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADM  910
              +   + AARVSLGVLGVISQVT KL+P+FKRS++++ K+D DLG E   FG +HEFAD+
Sbjct  190   SHQQHLNAARVSLGVLGVISQVTLKLEPLFKRSLTYLTKDDSDLGDELVTFGRKHEFADV  249

Query  911   KWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKC  1090
              W P  +  VYR+DDRVS N SGNGL+DFF  R   +  L  +R  EE QE+  DA+ KC
Sbjct  250   TWYPSQQKAVYRIDDRVSINKSGNGLYDFFPFRPTLSAALTVVRATEELQEATRDANGKC  309

Query  1091  SNQWLINVWMVWFLSYGLTNDGVK--FSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
                 LI   +   + YGL+N+  K  F GYP++G+ N MQ+SGTCLDSLND L   CPWD
Sbjct  310   VGAKLITATLSG-IGYGLSNNDDKGIFLGYPIVGFSNRMQASGTCLDSLNDGLITACPWD  368

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
              R+ G FFHQT FSI L+ VK+FIEDVQKLV+LEPKSLC L   +GILMRYV AS+AYLG
Sbjct  369   SRIKGEFFHQTAFSIPLSAVKNFIEDVQKLVELEPKSLCGLETANGILMRYVTASSAYLG  428

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             K ED++DFDITYYRSKDP+ PRL++DILEEIEQ+ +FKYG LPHWGKNRN+AF GAI+KY
Sbjct  429   KSEDAVDFDITYYRSKDPLAPRLFQDILEEIEQIGLFKYGGLPHWGKNRNLAFLGAIKKY  488

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
              +A +FLKVK+++DP GLFSS W+DQ+LGL+ G++I+KDGCA+EG+CICSQD+HCAP KG
Sbjct  489   HNADKFLKVKEEYDPQGLFSSLWTDQMLGLQEGVTILKDGCAMEGMCICSQDSHCAPKKG  548

Query  1799  YFCRAGKVYKDAKVCVK  1849
             YFCR G++YK+A+VC +
Sbjct  549   YFCRPGRIYKEARVCTR  565



>dbj|BAF01297.1| hypothetical protein [Arabidopsis thaliana]
Length=590

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/580 (61%), Positives = 439/580 (76%), Gaps = 7/580 (1%)
 Frame = +2

Query  131   SINILITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYP  307
             S   L+ +Y  F L+ T  S+ P+DP+KC   NT       SYG FPDR  CRAA   YP
Sbjct  8     SYRTLVGLYYIFTLMHTAVSTPPDDPVKCVSGNTNCTVTN-SYGAFPDRSTCRAANVAYP  66

Query  308   KTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSM  487
             KTEAEL+S++A AT+  RKM+  TRYSHSI KL C +G +GL ISTK+LN T++ +A++M
Sbjct  67    KTEAELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTEGLFISTKFLNHTVQADATAM  126

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
             TMTVESG++LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V 
Sbjct  127   TMTVESGMTLRQLIVEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVT  186

Query  668   HIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFV  841
              IR+V+P +  EG+A IR L +  +  +  AA+VSLGVLGVISQVTF+LQPMFKRS+++ 
Sbjct  187   EIRMVSPGSVNEGFAKIRILSETTTPNEFNAAKVSLGVLGVISQVTFELQPMFKRSLTYT  246

Query  842   VKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGT  1021
             ++ND D   +A  FG +HEFAD  WLP    VVYR DDRV+ NTSGNGLFDF   R+  +
Sbjct  247   MRNDSDFEDQAVTFGKKHEFADFIWLPSQGKVVYRRDDRVAVNTSGNGLFDFLPFRSQLS  306

Query  1022  DCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHM  1201
               +  +R  EE QE   DA+ KC    +I+   ++  SYGLTN+G+ F+GYPV+G QN M
Sbjct  307   AAIAIIRTSEETQERFRDANGKCVGATIISS-TLFAPSYGLTNNGIIFTGYPVVGSQNRM  365

Query  1202  QSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC  1375
              SSG+CLDSL D L   C WD R+ G FFHQTT S+ LT+VKSFI D++ LV +E KSLC
Sbjct  366   MSSGSCLDSLQDGLITACAWDSRIKGEFFHQTTLSVPLTQVKSFISDIKSLVKIEQKSLC  425

Query  1376  VLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKY  1555
              L L+ GILMRYV +S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EEIEQ+A+FKY
Sbjct  426   GLELHYGILMRYVTSSPAYLGKETEALDFDITYYRAKDPLTPRLYEDFIEEIEQIALFKY  485

Query  1556  GALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD  1735
              ALPHWGKNRN+AF G IRKY +A  FLKVK  +DP GLFSSEW+DQILG+K   SIVKD
Sbjct  486   NALPHWGKNRNLAFDGVIRKYNNAPAFLKVKDSYDPKGLFSSEWTDQILGIKGNASIVKD  545

Query  1736  GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             GCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  546   GCALEGLCICSKDAHCAPAKGYLCRPGKVYKEARVCTRVD  585



>ref|NP_182198.2| D-arabinono-1,4-lactone oxidase-like protein [Arabidopsis thaliana]
 gb|AAQ89618.1| At2g46750 [Arabidopsis thaliana]
 gb|AEC10748.1| D-arabinono-1,4-lactone oxidase-like protein [Arabidopsis thaliana]
Length=591

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/580 (61%), Positives = 439/580 (76%), Gaps = 7/580 (1%)
 Frame = +2

Query  131   SINILITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYP  307
             S   L+ +Y  F L+ T  S+ P+DP+KC   NT       SYG FPDR  CRAA   YP
Sbjct  8     SYRTLVGLYYIFTLMHTAVSTPPDDPVKCVSGNTNCTVTN-SYGAFPDRSTCRAANVAYP  66

Query  308   KTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSM  487
             KTEAEL+S++A AT+  RKM+  TRYSHSI KL C +G +GL ISTK+LN T++ +A++M
Sbjct  67    KTEAELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTEGLFISTKFLNHTVQADATAM  126

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
             TMTVESG++LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V 
Sbjct  127   TMTVESGMTLRQLIVEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVT  186

Query  668   HIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFV  841
              IR+V+P +  EG+A IR L +  +  +  AA+VSLGVLGVISQVTF+LQPMFKRS+++ 
Sbjct  187   EIRMVSPGSVNEGFAKIRILSETTTPNEFNAAKVSLGVLGVISQVTFELQPMFKRSLTYT  246

Query  842   VKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGT  1021
             ++ND D   +A  FG +HEFAD  WLP    VVYR DDRV+ NTSGNGLFDF   R+  +
Sbjct  247   MRNDSDFEDQAVTFGKKHEFADFIWLPSQGKVVYRRDDRVAVNTSGNGLFDFLPFRSQLS  306

Query  1022  DCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHM  1201
               +  +R  EE QE   DA+ KC    +I+   ++  SYGLTN+G+ F+GYPV+G QN M
Sbjct  307   AAIAIIRTSEETQERFRDANGKCVGATIISS-TLFAPSYGLTNNGIIFTGYPVVGSQNRM  365

Query  1202  QSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC  1375
              SSG+CLDSL D L   C WD R+ G FFHQTT S+ LT+VKSFI D++ LV +E KSLC
Sbjct  366   MSSGSCLDSLQDGLITACAWDSRIKGEFFHQTTLSVPLTQVKSFISDIKSLVKIEQKSLC  425

Query  1376  VLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKY  1555
              L L+ GILMRYV +S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EEIEQ+A+FKY
Sbjct  426   GLELHYGILMRYVTSSPAYLGKETEALDFDITYYRAKDPLTPRLYEDFIEEIEQIALFKY  485

Query  1556  GALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD  1735
              ALPHWGKNRN+AF G IRKY +A  FLKVK  +DP GLFSSEW+DQILG+K   SIVKD
Sbjct  486   NALPHWGKNRNLAFDGVIRKYNNAPAFLKVKDSYDPKGLFSSEWTDQILGIKGNASIVKD  545

Query  1736  GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             GCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  546   GCALEGLCICSKDAHCAPAKGYLCRPGKVYKEARVCTRVD  585



>ref|XP_010507976.1| PREDICTED: L-gulonolactone oxidase-like [Camelina sativa]
Length=604

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/591 (60%), Positives = 443/591 (75%), Gaps = 8/591 (1%)
 Frame = +2

Query  95    PWPSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDR  274
             PW  H    A     + I   +  L+FT  S+ PEDP+KC   NT       SYG FPDR
Sbjct  7     PW--HGSQNAAFWRTLFILHCISTLVFTTISTPPEDPVKCVSGNTNCTVTN-SYGVFPDR  63

Query  275   GVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYL  454
               CRAA   YP +EAEL+S++A AT+  +KM+  TRYSHSI KL C +G DGL ISTK+L
Sbjct  64    STCRAANVTYPTSEAELVSVVAAATQAGQKMRVTTRYSHSITKLVCTDGTDGLFISTKFL  123

Query  455   NRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLW  634
             N T+ V+A +MT+TVESGV+LRQ+I +AAK GLALPY+PYWWGLTVGG+MGTG+HGSSLW
Sbjct  124   NDTVRVDADAMTLTVESGVTLRQLIAKAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLW  183

Query  635   GVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKL  808
             G GS+VHD+V  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVTFKL
Sbjct  184   GNGSAVHDYVTEIRMVSPGSANDGFAKVRVLSEITTPNEFNAAKVSLGVLGVISQVTFKL  243

Query  809   QPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGL  988
             QPMFKRS+ +V++ND D G +A  FG +HEF+D  WLP    VVYR+DDRV+ NTSGNGL
Sbjct  244   QPMFKRSLRYVMRNDSDFGDQAITFGKKHEFSDFIWLPSQGKVVYRMDDRVAVNTSGNGL  303

Query  989   FDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFS  1168
             FDF   R+  +  L  +R  EE QE   D + KC+   LI+   ++  ++GLTN+G+ F+
Sbjct  304   FDFLPFRSQLSAALAIIRSSEETQERFRDGNGKCAGATLISS-TLFATAFGLTNNGIIFT  362

Query  1169  GYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQ  1342
             GYPVIG QN M SSG+CLDSL D L   CPWD R+   FFHQTTFS+ LT+VKSFI D++
Sbjct  363   GYPVIGSQNRMMSSGSCLDSLQDGLITACPWDSRIKSEFFHQTTFSVPLTQVKSFINDIK  422

Query  1343  KLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDIL  1522
              LV +  KSLC L LY GILMRYV +S A+LGK+ +++DFD+TYYR+K+P+ PRLYED +
Sbjct  423   SLVKINSKSLCGLELYYGILMRYVTSSPAFLGKETEALDFDLTYYRAKNPLTPRLYEDFI  482

Query  1523  EEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQIL  1702
             EEIEQ+A+FKY ALPHWGKNRN+AF G IRKYK+A  FLKVK+ +DP GLFSSEW+DQIL
Sbjct  483   EEIEQIALFKYNALPHWGKNRNLAFDGVIRKYKNAPAFLKVKEAYDPTGLFSSEWTDQIL  542

Query  1703  GLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             G+K   +IVKDGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC +++
Sbjct  543   GIKGNATIVKDGCALEGLCICSKDAHCAPAKGYLCRPGKVYKEARVCTRLD  593



>ref|XP_004494863.1| PREDICTED: L-gulono-1,4-lactone dehydrogenase-like [Cicer arietinum]
Length=588

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/562 (63%), Positives = 445/562 (79%), Gaps = 5/562 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             F+++ V SS P DPI+C+  NT       + G FPDR +C+  +  YP +EAEL+SI+A 
Sbjct  14    FIMYGVNSSPPSDPIQCSSKNTNCTITNAN-GMFPDRSICKVGEVKYPTSEAELISIVAL  72

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
             A+K  +KMK ATR+SHSIPKLACP+G +GLLISTK LN+ L+++A +MTMTVESGV+LRQ
Sbjct  73    ASKNNKKMKVATRFSHSIPKLACPDGQNGLLISTKNLNKVLKIDAEAMTMTVESGVTLRQ  132

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +I EAA+  +ALPY+PYWWGLT+GGLMGTG+HGS+LWG GS+VH++VI IRIV+PA  +E
Sbjct  133   IISEAARFEMALPYTPYWWGLTIGGLMGTGAHGSTLWGKGSAVHEYVIDIRIVSPAGPQE  192

Query  704   GYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             GYA +R L + +  + AARVSLGVLGVISQVT KL+P+FKRS++++ K+D DLG E   F
Sbjct  193   GYAKVRNLNESHQHLNAARVSLGVLGVISQVTLKLEPLFKRSVTYITKDDSDLGDELISF  252

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G +HEF D+ W P  +  +YRVDDR S NT GNGL+DF   R+  +  L  +R  EE QE
Sbjct  253   GRKHEFGDVSWYPSQQKAIYRVDDRASANTLGNGLYDFTPFRSTLSAALTVIRATEELQE  312

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
                DA+ KC    LI V  +    YGL+N+GV F GYPV+G  N MQSSGTCLDSLND +
Sbjct  313   EKRDANGKCIGAKLI-VATLEGTGYGLSNNGV-FLGYPVVGLNNRMQSSGTCLDSLNDQM  370

Query  1244  --TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
                CPWD R+ G F+HQTTFS+SL+ VK+FIED+QKLV+LEPK+LC L LY+GILMRYV 
Sbjct  371   ITACPWDSRIKGEFYHQTTFSVSLSVVKNFIEDIQKLVELEPKALCGLELYNGILMRYVT  430

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             AS+AYLGK ED++DFDITY+RSKDP+ PRL+EDI+EEIEQ+ +FKYG LPHWGKNRN+ F
Sbjct  431   ASSAYLGKTEDAVDFDITYFRSKDPLAPRLFEDIIEEIEQIGLFKYGGLPHWGKNRNLGF  490

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              GAI+KY  A EFLKVK+++DP GLFSSEW+DQ+LGLK G++I+KDGCALEGLCICSQD+
Sbjct  491   VGAIKKYNKADEFLKVKEEYDPKGLFSSEWTDQVLGLKEGVTILKDGCALEGLCICSQDS  550

Query  1778  HCAPNKGYFCRAGKVYKDAKVC  1843
             HCAPNK YFCR G+VYKDA+VC
Sbjct  551   HCAPNKSYFCRPGRVYKDARVC  572



>ref|XP_010507977.1| PREDICTED: L-gulonolactone oxidase isoform X1 [Camelina sativa]
Length=598

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/588 (60%), Positives = 443/588 (75%), Gaps = 6/588 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PS++   A     ++   Y+  L+ T  S+ PEDP+KC   NT       SYG FPDR  
Sbjct  7     PSYSSQNATYWRTLIGLYYIFTLVHTAVSTPPEDPVKCVSGNTNCTVTN-SYGAFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             C AA   YPKTEAEL+S++A AT+  RKM+  TRYSHSI KL C +G DGL ISTK+L+ 
Sbjct  66    CLAANVAYPKTEAELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTDGLFISTKFLDH  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T++ +A++MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVKADATAMTLTVESGVTLRQLIAEAAKIGLALPYAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IR+V+P +  +G+A IR L +  +  +  AA+VSLGVLGVISQVTFKLQP
Sbjct  186   GSAVHDYVTEIRMVSPGSVNDGFAKIRVLTETTTPNEFNAAKVSLGVLGVISQVTFKLQP  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+++ ++ND D   +A  FG +HEFAD  WLP    VVYR DDRV+ NTSGNGLFD
Sbjct  246   MFKRSLTYTMRNDSDFEDQAVTFGKKHEFADFIWLPSQGKVVYRRDDRVAVNTSGNGLFD  305

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
             F   R+  +  +  +R  EE QE+  DA+ KC    LI+   ++  SYGLTN+G+ F+GY
Sbjct  306   FLPFRSQLSAAIAIIRSAEETQETFRDANGKCVGATLISS-TLFATSYGLTNNGIIFTGY  364

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PV+G QN M SSG+CLDS  D L   C WD R+ G FFHQTTFS+ LT VKSFI D++ L
Sbjct  365   PVVGSQNRMMSSGSCLDSRQDGLITACAWDSRIKGEFFHQTTFSVPLTHVKSFINDIKSL  424

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V +E K+LC L L+ GILMRYVK+S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EE
Sbjct  425   VKIESKALCGLELHYGILMRYVKSSPAYLGKKIEALDFDITYYRAKDPLTPRLYEDFIEE  484

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A+FKY ALPHWGKNRN+AF G I+KY +A  FLKVK+ +DP GLFSSEW+DQILG+
Sbjct  485   IEQVALFKYNALPHWGKNRNLAFDGVIKKYNNALAFLKVKESYDPKGLFSSEWTDQILGI  544

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             K  ++IVKDGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC ++
Sbjct  545   KGNVTIVKDGCALEGLCICSKDAHCAPAKGYLCRPGKVYKEARVCTRV  592



>ref|XP_008437774.1| PREDICTED: L-gulonolactone oxidase-like [Cucumis melo]
Length=596

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/588 (60%), Positives = 447/588 (76%), Gaps = 13/588 (2%)
 Frame = +2

Query  98    WPSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIK---ctinntmnctitnSYGTFP  268
             W S+ + +   S   +      FL+     S PEDPIK    + N   NCTITNSYG FP
Sbjct  7     WSSYCVGICSTSAVFM------FLVLVSECSPPEDPIKCGSVSPNKYANCTITNSYGAFP  60

Query  269   DRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTK  448
             DR +CR A+ +YP TEAE++  +A AT+  RKMK  TR+SHSIPKLACPEG++G++ISTK
Sbjct  61    DRSICRVAEVIYPTTEAEVMLAVAAATRGLRKMKVGTRFSHSIPKLACPEGEEGVVISTK  120

Query  449   YLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSS  628
             YLNRT++V+   M+++VE G +LRQ+IE+AA AGLALP++PYWWGLT+GGL+ TG+HGSS
Sbjct  121   YLNRTVKVDVEGMSISVEGGATLRQIIEDAATAGLALPHTPYWWGLTIGGLLSTGAHGSS  180

Query  629   LWGVGSSVHDHVIHIRIVTPATEKEGYATIRT-LKQGNSDIKAARVSLGVLGVISQVTFK  805
             LWG GSSVHD+V+ +++V+P   ++GYA +RT L    + + AA+VSLGVLGVI+QVT K
Sbjct  181   LWGKGSSVHDYVVAVKMVSPGGSEDGYAKLRTILPDDQNHLNAAKVSLGVLGVITQVTLK  240

Query  806   LQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNG  985
             LQPMFKRSI+++ ++D+DLG E  +FG  +EF DM W P  R +VYR+D RV +NTSGNG
Sbjct  241   LQPMFKRSITYLKRDDKDLGDEVLRFGTHYEFGDMTWYPSHRKIVYRIDTRVPSNTSGNG  300

Query  986   LFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKF  1165
             ++DF   R   +  L  +R  EE QES  DA  KCS+  LI   +   L+YGLTN+G+ F
Sbjct  301   VYDFIPFRPTPSIGLALIRASEEEQESRRDAAAKCSSGNLITSTLS-LLAYGLTNNGITF  359

Query  1166  SGYPVIGYQNHMQSSGTCLDSLND--NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDV  1339
               YPVIGY N +QSSG+CLDSLND    TCPWDP + G FFHQT  SI LT VKSFIEDV
Sbjct  360   LKYPVIGYNNRLQSSGSCLDSLNDLRITTCPWDPSIKGEFFHQTAISIELTMVKSFIEDV  419

Query  1340  QKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDI  1519
             Q+L +LEP + C L LY+GILMRYV+ASTAYLGKQ+D +DFD TYYRS+DPM PRL+ED+
Sbjct  420   QRLAELEPMAFCGLELYNGILMRYVRASTAYLGKQQDGVDFDFTYYRSRDPMSPRLFEDV  479

Query  1520  LEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQI  1699
             +EE+EQMA+FKYG +PHWGKNRNVAF     KY+   +FLK+ K++DP GLFS+EW+DQI
Sbjct  480   IEEVEQMAVFKYGGIPHWGKNRNVAFHQVFHKYRDREKFLKIMKEYDPHGLFSNEWTDQI  539

Query  1700  LGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LG++  + I KDGCALEGLCICSQ NHCAP+KGYFCRAG++YKDA+VC
Sbjct  540   LGVEGTVIIYKDGCALEGLCICSQHNHCAPSKGYFCRAGRIYKDARVC  587



>ref|XP_010518352.1| PREDICTED: uncharacterized protein LOC104793653 isoform X1 [Camelina 
sativa]
Length=603

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/590 (59%), Positives = 442/590 (75%), Gaps = 7/590 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQ-FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRG  277
             PSH    A     + I   +   L+FT  S+ PEDP+KC   NT       SYG FPDR 
Sbjct  7     PSHGYQNAAFWRTLFILHCISTLLVFTTISTPPEDPVKCVSGNTNCTVTN-SYGVFPDRS  65

Query  278   VCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLN  457
              CRAA   YP +EAEL+S++A AT+  +KM+  TRYSHSI KL C +G DGL ISTK+LN
Sbjct  66    TCRAANVAYPTSEAELVSVVAAATQAGQKMRVTTRYSHSITKLVCTDGTDGLFISTKFLN  125

Query  458   RTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWG  637
              T+  +A +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG
Sbjct  126   DTVRADADAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWG  185

Query  638   VGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQ  811
              GS+VHD+V  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVTFKLQ
Sbjct  186   NGSAVHDYVTEIRMVSPGSANDGFAKVRVLSEITTPNEFNAAKVSLGVLGVISQVTFKLQ  245

Query  812   PMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLF  991
             PMFKRS+ +V++ND D G +A  FG +HEF+D  WLP    VVYR+DDRV+ NTSGNGLF
Sbjct  246   PMFKRSLRYVMRNDSDFGDQAITFGKKHEFSDFIWLPSQGKVVYRMDDRVAVNTSGNGLF  305

Query  992   DFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSG  1171
             DF   R+  +  L  +R  EE QE   D + KC+   LI+   ++  ++GLTN+G+ F+G
Sbjct  306   DFLPFRSQLSAALAIIRSSEETQERFRDGNGKCAGATLISS-TLFATAFGLTNNGIIFAG  364

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG QN M SSG+CLDSL D L   CPWD R+   FFHQTTFS+ LT++KSFI D++ 
Sbjct  365   YPVIGSQNRMMSSGSCLDSLQDGLITACPWDSRIKSEFFHQTTFSVPLTQIKSFINDIKS  424

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             LV +  KSLC L LY GILMRYV +S A+LGK+ +++DFD+TYYR+K+P+ PRLYED +E
Sbjct  425   LVQINSKSLCGLELYYGILMRYVTSSPAFLGKETEALDFDLTYYRAKNPLTPRLYEDFIE  484

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILG  1705
             EIEQ+A+FKY ALPHWGKNRN+AF G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG
Sbjct  485   EIEQIALFKYNALPHWGKNRNLAFDGVIKKYKNAPAFLKVKETYDPTGLFSSEWTDQILG  544

Query  1706  LKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +K   +IVKDGCALEGLCIC++D HCAP KGY CR GKVYK+A+VC +++
Sbjct  545   IKGKATIVKDGCALEGLCICAKDAHCAPTKGYLCRPGKVYKEARVCTRVD  594



>emb|CDY41552.1| BnaC04g00700D [Brassica napus]
Length=590

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/566 (62%), Positives = 433/566 (77%), Gaps = 6/566 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+ T  S+ PEDP++C   NT       SYG FPDR  CRAA   YP TEAEL+SI+A A
Sbjct  22    LVHTALSTPPEDPVRCVSGNTDCSVTN-SYGVFPDRSTCRAANVAYPTTEAELVSIVAAA  80

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             TK +RKM+  TRYSHSIPKLAC +G +GL ISTK+LN T++ +A +MT+TVESGV+LRQ+
Sbjct  81    TKARRKMRVTTRYSHSIPKLACTDGTNGLFISTKFLNHTVQADAGAMTLTVESGVTLRQL  140

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAK GLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VHD+V  I+IV+P +  +G
Sbjct  141   ITEAAKVGLALPYAPYWWGLTVGGMLGTGAHGSSLWGKGSAVHDYVTEIKIVSPGSVNDG  200

Query  707   YATIRTLKQGNSDIK--AARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             +A +R L +  + ++  AA+VSLGVLGVISQVTF LQPMFKRS+ +V+KND D   +   
Sbjct  201   FAKVRVLSESTTPVEFNAAKVSLGVLGVISQVTFGLQPMFKRSLKYVMKNDLDFDDQVLT  260

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
              G +HEFAD  WLP    VVYR+DDRV+ NT GNGL DF   R+  +  L  +R  EE Q
Sbjct  261   LGEKHEFADFVWLPSQGKVVYRMDDRVAVNTPGNGLCDFLPFRSQPSAALAIIRSSEEKQ  320

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             E   DA  KC+   LI+   ++  SYGLTN+G+ F+GYPVIG QN M +SG+CLDSL D 
Sbjct  321   EIFRDATGKCAEATLISS-TLFSTSYGLTNNGIAFTGYPVIGSQNRMMTSGSCLDSLQDG  379

Query  1241  LT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
             LT  C WD R+ G F+HQT FSI LT+VKSFI D++ LV ++ KSLC L LY+GILMRYV
Sbjct  380   LTTACAWDSRIKGEFYHQTCFSIPLTQVKSFITDIKSLVKIDQKSLCGLELYNGILMRYV  439

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
              AS AYLGK  ++IDFD+TYYR+KDP+ PRLYED +EEIEQ+A+FKY ALPHWGKNRNVA
Sbjct  440   TASPAYLGKDTEAIDFDLTYYRAKDPLTPRLYEDFIEEIEQIALFKYNALPHWGKNRNVA  499

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F G I+KYK+A  FL+VK+ +DP GLFSSEW+DQILG+K   +IVKDGCALEGLCICS+D
Sbjct  500   FDGVIKKYKNAPAFLRVKESYDPDGLFSSEWTDQILGIKGNATIVKDGCALEGLCICSED  559

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKI  1852
              HCAP KGY CR GKVYK+A+VC ++
Sbjct  560   AHCAPTKGYMCRPGKVYKEARVCTRV  585



>gb|AAC33494.1| unknown protein [Arabidopsis thaliana]
Length=570

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/566 (61%), Positives = 432/566 (76%), Gaps = 6/566 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             + T  S+ P+DP+KC   NT       SYG FPDR  CRAA   YPKTEAEL+S++A AT
Sbjct  1     MHTAVSTPPDDPVKCVSGNTNCTVTN-SYGAFPDRSTCRAANVAYPKTEAELVSVVAAAT  59

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             +  RKM+  TRYSHSI KL C +G +GL ISTK+LN T++ +A++MTMTVESG++LRQ+I
Sbjct  60    QAGRKMRVTTRYSHSITKLVCTDGTEGLFISTKFLNHTVQADATAMTMTVESGMTLRQLI  119

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
              EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  EG+
Sbjct  120   VEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSVNEGF  179

Query  710   ATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             A IR L +  +  +  AA+VSLGVLGVISQVTF+LQPMFKRS+++ ++ND D   +A  F
Sbjct  180   AKIRILSETTTPNEFNAAKVSLGVLGVISQVTFELQPMFKRSLTYTMRNDSDFEDQAVTF  239

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G +HEFAD  WLP    VVYR DDRV+ NTSGNGLFDF   R+  +  +  +R  EE QE
Sbjct  240   GKKHEFADFIWLPSQGKVVYRRDDRVAVNTSGNGLFDFLPFRSQLSAAIAIIRTSEETQE  299

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
                DA+ KC    +I+   ++  SYGLTN+G+ F+GYPV+G QN M SSG+CLDSL D L
Sbjct  300   RFRDANGKCVGATIISS-TLFAPSYGLTNNGIIFTGYPVVGSQNRMMSSGSCLDSLQDGL  358

Query  1244  --TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
                C WD R+ G FFHQTT S+ LT+VKSFI D++ LV +E KSLC L L+ GILMRYV 
Sbjct  359   ITACAWDSRIKGEFFHQTTLSVPLTQVKSFISDIKSLVKIEQKSLCGLELHYGILMRYVT  418

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             +S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EEIEQ+A+FKY ALPHWGKNRN+AF
Sbjct  419   SSPAYLGKETEALDFDITYYRAKDPLTPRLYEDFIEEIEQIALFKYNALPHWGKNRNLAF  478

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              G IRKY +A  FLKVK  +DP GLFSSEW+DQILG+K   SIVKDGCALEGLCICS+D 
Sbjct  479   DGVIRKYNNAPAFLKVKDSYDPKGLFSSEWTDQILGIKGNASIVKDGCALEGLCICSKDA  538

Query  1778  HCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             HCAP KGY CR GKVYK+A+VC +++
Sbjct  539   HCAPAKGYLCRPGKVYKEARVCTRVD  564



>ref|XP_010451223.1| PREDICTED: uncharacterized protein LOC104733335 isoform X1 [Camelina 
sativa]
Length=577

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/570 (61%), Positives = 441/570 (77%), Gaps = 8/570 (1%)
 Frame = +2

Query  164   FLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F  FT  SS P +DP+KC   NT+      SYG FPDR +C+AAK  YP++E EL+S++A
Sbjct  9     FCFFTFASSSPPDDPVKCESGNTVCTVTN-SYGAFPDRSICKAAKVEYPRSEEELVSVVA  67

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              AT+  +KM+  TRYSHSIPKL C +G DG+LISTK+LN  +  N  + TMT+ESGV+LR
Sbjct  68    AATRAGQKMRVVTRYSHSIPKLVCTDGKDGVLISTKFLNNVVRTNQEAKTMTIESGVTLR  127

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P    
Sbjct  128   QLIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRLVSPGLAS  187

Query  701   EGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             +GY  +R L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS+++ + ND D G +A
Sbjct  188   DGYVKVRVLNETTDPEEFRAAKVSLGVLGVISQVTFELQPMFKRSLTYDMINDSDFGDQA  247

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
               FG +HEFAD  WLP    VVYR+DDRV  NTSG GLF+FF  R   ++ L   R  EE
Sbjct  248   VSFGEKHEFADFIWLPSQGKVVYRIDDRVPLNTSGGGLFNFFPFRPQLSEALAIDRSIEE  307

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
               E+  +A+ KC    L+  ++ + +SYGLTN+G+ F+GYPVIG QN M SSG+CLDS  
Sbjct  308   SDEANENANMKCERAKLVTSFL-FSVSYGLTNNGLTFTGYPVIGLQNRMMSSGSCLDSRQ  366

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             D L   CPWDPR+ G FFHQTTFS+ LT+VKSFIED++ LV + PKSLCVL   +GIL+R
Sbjct  367   DGLITACPWDPRIKGQFFHQTTFSVPLTRVKSFIEDIKALVKINPKSLCVLEGSNGILIR  426

Query  1409  YVKASTAYLGKQEDSIDFDITYYRS-KDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             YV +STA+LGK+E ++DFD+TYYRS KDP+ PRLYED +EEIEQMA+FKY ALPHWGKNR
Sbjct  427   YVTSSTAFLGKEEKALDFDLTYYRSKKDPLAPRLYEDYIEEIEQMAIFKYNALPHWGKNR  486

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF GAIRKYK+A +FLKVK++FD LGLFS++W+DQILGLK  ++I+K GCALEGLCIC
Sbjct  487   NLAFDGAIRKYKNANDFLKVKERFDSLGLFSTQWTDQILGLKGNVTILKQGCALEGLCIC  546

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D+HCAPNKGY CR GKVY++A+VC +++
Sbjct  547   SEDSHCAPNKGYLCRPGKVYREARVCTRVS  576



>emb|CDX80042.1| BnaA05g01140D [Brassica napus]
Length=596

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/572 (61%), Positives = 434/572 (76%), Gaps = 12/572 (2%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+ T  S+ PEDP++C   NT       SYG FPDR  CRAA   YP TEAEL+SI+A A
Sbjct  22    LVHTALSTPPEDPVRCVSGNTDCSVTN-SYGVFPDRSTCRAANVAYPTTEAELVSIVAAA  80

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLL------ISTKYLNRTLEVNASSMTMTVESG  508
             TK +RKM+  TRYSHSIPKLAC +G DGL+      ISTK+LN T++ +  +MT+TVESG
Sbjct  81    TKARRKMRVTTRYSHSIPKLACTDGTDGLIFLVSLTISTKFLNHTVQADVGAMTLTVESG  140

Query  509   VSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTP  688
             V+LRQ+I EAAK GLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VHD+V  I+IV+P
Sbjct  141   VTLRQLITEAAKVGLALPYAPYWWGLTVGGMLGTGAHGSSLWGKGSAVHDYVTEIKIVSP  200

Query  689   ATEKEGYATIRTLKQGNSDIK--AARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDL  862
              +  +G+A +R L +  + ++  AA+VSLGVLGVISQVTF LQPMFKRS+ +V+KND D 
Sbjct  201   GSVNDGFAKVRVLSESTTPVEFNAAKVSLGVLGVISQVTFGLQPMFKRSLKYVMKNDLDF  260

Query  863   GKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALR  1042
               +    G +HEFAD  WLP    VVYR+DDRV+ NT GNGL+DF   R+  +  L  +R
Sbjct  261   DDQVLTLGEKHEFADFVWLPSQGKVVYRMDDRVAVNTPGNGLYDFLPFRSQPSAALAIIR  320

Query  1043  EKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL  1222
               EE QE   DA  KC+   LI+   ++  SYGLTN+G+ F+GYPVIG QN M +SG+CL
Sbjct  321   SSEEKQEIFRDATGKCTEATLISS-TLFSSSYGLTNNGIAFTGYPVIGSQNRMMTSGSCL  379

Query  1223  DSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDG  1396
             DSL D LT  C WD R+ G F+HQT FSI LT+VKSFI D++ L+ ++ KSLC L LY+G
Sbjct  380   DSLQDGLTTACAWDSRIKGEFYHQTCFSIPLTQVKSFITDIKSLIKIDQKSLCGLELYNG  439

Query  1397  ILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWG  1576
             ILMRYV AS AYLGK  ++IDFD+TYYR+KDP+ PRLYED +EEIEQ+A+FKY ALPHWG
Sbjct  440   ILMRYVTASPAYLGKDTEAIDFDLTYYRAKDPLTPRLYEDFIEEIEQIALFKYNALPHWG  499

Query  1577  KNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGL  1756
             KNRNVAF G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCALEGL
Sbjct  500   KNRNVAFDGVIKKYKNASAFLKVKESYDPDGLFSSEWTDQILGIKGNATIVKDGCALEGL  559

Query  1757  CICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CICS+D HCAP KGY CR GKVYK+A+VC ++
Sbjct  560   CICSEDAHCAPTKGYMCRPGKVYKEARVCTRV  591



>emb|CAZ68131.1| FAD-binding domain-containing protein [Arabidopsis halleri subsp. 
halleri]
Length=594

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/576 (61%), Positives = 437/576 (76%), Gaps = 7/576 (1%)
 Frame = +2

Query  143   LITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             L+ +Y  F L+ T  S+ PEDP+KC   NT       S G FPDR  C AA   +P TEA
Sbjct  20    LLGLYCLFTLVHTAISTPPEDPVKCVSGNTNCTVTN-SIGAFPDRSTCGAANVAFPTTEA  78

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+SI++ ATK  RKM+  TRYSHSIPKL C +G+DGL ISTK+LN T+  +A +MT+TV
Sbjct  79    ELVSIVSAATKAGRKMRVTTRYSHSIPKLVCIDGNDGLFISTKFLNHTVRADAKAMTLTV  138

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESG++LRQ+I EAAK GLALPY+PYWWG+TVGG+MGTG+HGSSLWG GS+VHD+V  IR+
Sbjct  139   ESGMTLRQLIAEAAKVGLALPYAPYWWGVTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRM  198

Query  680   VTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             V+P +  +G+A IR L +  +  +  AA+VSLGVLGVISQVTFKLQPMFKRS+ +V+KND
Sbjct  199   VSPGSLNDGFAKIRVLSETTTPNEFNAAKVSLGVLGVISQVTFKLQPMFKRSLKYVMKND  258

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              D   +A  FG +HEFAD  WLP    VVYR+DDRV+ NTSGNGL+DF   R+  +  + 
Sbjct  259   LDFNDQALTFGKKHEFADFVWLPSQGKVVYRMDDRVAVNTSGNGLYDFLPFRSQLSAVVA  318

Query  1034  ALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSG  1213
               R  EE QE++ DA  KC     I+   ++  SYGLT++G+ F+GYPVIG QNHM SSG
Sbjct  319   TTRSSEEKQETLRDAHGKCVAATTISS-TLFSTSYGLTSNGIIFTGYPVIGSQNHMMSSG  377

Query  1214  TCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGL  1387
             +CLD L D L  TC WD R+ G+FFHQT FS+ LT+VKSFI D++ LV ++ KSLC L L
Sbjct  378   SCLDGLEDGLISTCAWDSRIKGVFFHQTCFSVPLTQVKSFINDIKSLVKIDSKSLCGLEL  437

Query  1388  YDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALP  1567
             Y GILMRYV +S AYLGK+ ++IDFDITYYR+ DP+ PRLYED +EEIEQ+A+FKY ALP
Sbjct  438   YYGILMRYVTSSPAYLGKETEAIDFDITYYRANDPLTPRLYEDFIEEIEQIALFKYNALP  497

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF G I+KYK+A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCAL
Sbjct  498   HWGKNRNLAFDGVIKKYKNAPAFLKVKESYDPKGLFSSEWTDQILGIKGNPTIVKDGCAL  557

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             EGLCICS+D HCAP KGY CR GKVYK+A+VC+ + 
Sbjct  558   EGLCICSEDAHCAPTKGYLCRPGKVYKEARVCIHVT  593



>gb|KEH18585.1| D-arabinono-1,4-lactone oxidase-like protein [Medicago truncatula]
Length=582

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/576 (59%), Positives = 446/576 (77%), Gaps = 7/576 (1%)
 Frame = +2

Query  134   INILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKT  313
             I+IL+ I+   ++    S+ PEDPIKC+ +    CTITNSYG FPDR +C+A++  YP +
Sbjct  11    ISILVLIFSTVIVL---STPPEDPIKCSNSQNTTCTITNSYGMFPDRTICQASQVFYPTS  67

Query  314   EAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTM  493
             E EL+S++A A+++K K+K ATRYSHS+PKL CPE  +G+LISTKYLN+ ++++    T+
Sbjct  68    EQELVSMVASASREKIKVKVATRYSHSVPKLVCPEDSNGILISTKYLNKVVKIDVEEKTI  127

Query  494   TVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHI  673
             T+ESGV+L+Q+I EA+K GLALPY+PYW+GLT+GG++GTG+HGS+L G GS+VHD+V+ I
Sbjct  128   TLESGVTLKQIINEASKNGLALPYTPYWYGLTIGGMIGTGAHGSTLSGKGSAVHDYVVEI  187

Query  674   RIVTPATEKEGYATIRTL-KQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             RIV P+   +GYA +  L +Q N D  AA+VSLGVLGVISQVT KL+P+FKRSI++V K+
Sbjct  188   RIVRPSDSDDGYAKVEILNEQNNEDFNAAKVSLGVLGVISQVTLKLEPIFKRSITYVAKS  247

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D DLG +   FG +HEFAD+ W P     +YRVDDRV  NTSGNGL+DF   R   +  L
Sbjct  248   DSDLGDQVVSFGHEHEFADISWYPSQHKAMYRVDDRVPINTSGNGLYDFIPFRPTPSIAL  307

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
              A+R  E+  E  G+ D KC    L    +++  +YGLTN+G+ F+GYPVIG+ N +QSS
Sbjct  308   AAIRITEDLDEFTGNVDGKCRVAKL-TTNILFKSAYGLTNNGIIFTGYPVIGFHNRLQSS  366

Query  1211  GTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLG  1384
             G+CLDS  D    TC WD R+ G FF Q+TF +SL+KVK+FIED+QKLV L PK LC + 
Sbjct  367   GSCLDSHQDAKITTCAWDSRIKGEFFQQSTFRVSLSKVKNFIEDIQKLVQLVPKGLCGIE  426

Query  1385  LYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGAL  1564
              Y+GILMRYV AS+AYLG QED++DFDITYYRSKDPM PRLYEDILEEIEQ+ +FKYG L
Sbjct  427   QYNGILMRYVTASSAYLGNQEDALDFDITYYRSKDPMAPRLYEDILEEIEQIGIFKYGGL  486

Query  1565  PHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCA  1744
             PHWGKNRNVAF+G  +KYK   +FLKVK+K+D  GLFSS W+DQ+LG+K G++I+K+GCA
Sbjct  487   PHWGKNRNVAFEGVFKKYKDIEKFLKVKEKYDSQGLFSSTWTDQVLGIKEGVTILKNGCA  546

Query  1745  LEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             LEGLCICSQD+HC P+KGYFCR GK+YKDA+VC ++
Sbjct  547   LEGLCICSQDSHCNPSKGYFCRPGKIYKDARVCSRV  582



>ref|NP_200460.1| D-arabinono-1,4-lactone oxidase family protein [Arabidopsis thaliana]
 dbj|BAB11277.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96772.1| D-arabinono-1,4-lactone oxidase family protein [Arabidopsis thaliana]
Length=577

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/569 (62%), Positives = 439/569 (77%), Gaps = 6/569 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             F  FT  SS P D           CT+TNSYG FPDR +C+AAK  YP+TEAEL+SI+A 
Sbjct  9     FCFFTFASSSPPDDPVNCEFGNTMCTVTNSYGAFPDRSICKAAKVEYPRTEAELVSIVAA  68

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
             AT+  +KM+  TRYSHS PKL C +G DG LISTK+LN  +  N  + T+TVESGV+LRQ
Sbjct  69    ATRAGQKMRVVTRYSHSFPKLVCTDGKDGTLISTKFLNHVVTTNPEAKTLTVESGVTLRQ  128

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P    +
Sbjct  129   LIEEAAKFDLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRLVSPGLASD  188

Query  704   GYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEAT  877
             GY  ++ L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS+++V++ND D G +A 
Sbjct  189   GYVKVQVLSETIDPEEFRAAKVSLGVLGVISQVTFELQPMFKRSLNYVMRNDSDFGDQAV  248

Query  878   KFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEH  1057
              FG +HEFAD  WLP    VVYR+D RV  NTSG+GLF+FF  R+  +  L   R  EE 
Sbjct  249   SFGERHEFADFLWLPSQGKVVYRMDGRVPLNTSGDGLFEFFPFRSQLSLVLAIDRSLEES  308

Query  1058  QESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
             +ES+ DA+ KC    L++  M + +SYG+TN+G+ F+GYPVIG QNHM SSG+CLDS  D
Sbjct  309   EESLEDANMKCVRAKLVSSSM-FLMSYGVTNNGLIFTGYPVIGMQNHMMSSGSCLDSRQD  367

Query  1238  NL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRY  1411
              L   CPWDPR+ G FFHQTTFS+SLT VKSFI D++ LV +EPKSLCVL   +GIL+RY
Sbjct  368   GLITACPWDPRIKGQFFHQTTFSVSLTNVKSFINDIKALVKIEPKSLCVLEGSNGILIRY  427

Query  1412  VKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRN  1588
             V +S A+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+FKY ALPHWGKNRN
Sbjct  428   VTSSLAFLGKEEKALDFDLTYYRSKNDPLAPRLYEDYIEEIEQMAIFKYNALPHWGKNRN  487

Query  1589  VAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICS  1768
             +AF GAIRKYK+A  FLKVK+KFD LGLFS+EW+DQILGLK  ++IVK GCALEGLCICS
Sbjct  488   LAFDGAIRKYKNANAFLKVKEKFDSLGLFSTEWTDQILGLKGNVTIVKQGCALEGLCICS  547

Query  1769  QDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +D+HCAP KGY CR GKVY++A+VC +++
Sbjct  548   EDSHCAPTKGYLCRPGKVYREARVCTRVS  576



>ref|XP_004510622.1| PREDICTED: L-gulono-1,4-lactone dehydrogenase-like [Cicer arietinum]
Length=585

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/555 (61%), Positives = 432/555 (78%), Gaps = 4/555 (1%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             PEDPIKC+  NT       SYG FPDR  C+A++ +YP TE EL+SI++ AT++  K+K 
Sbjct  33    PEDPIKCSSQNTTCTITN-SYGMFPDRTTCQASQVLYPTTEQELVSIVSSATRKNSKIKV  91

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             AT YSHSIPKL CPEG  GLLISTKYLN+ ++++     +TVESGV+L+++I+EA+K GL
Sbjct  92    ATHYSHSIPKLVCPEGQKGLLISTKYLNKIVKIDVEEKLITVESGVTLKELIKEASKVGL  151

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQ  733
              LPY+PYW+GLT+GGL+GTG+HGS+LWG GS+VHD+V+ I+IV P+   +GYA +  L +
Sbjct  152   VLPYTPYWFGLTIGGLLGTGAHGSTLWGKGSAVHDYVVEIKIVRPSNFVDGYAKVEILDE  211

Query  734   GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMK  913
              N D+ AA+VSLGVLGVISQ+T KL+PMFKRSIS++ KND DLG++   FG +HEF D+ 
Sbjct  212   QNEDLNAAKVSLGVLGVISQITLKLEPMFKRSISYLAKNDSDLGEKVVIFGHEHEFGDIT  271

Query  914   WLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCS  1093
             W P  R  +YRVDDRV  N+SGNGL+DF   R   +  L+ +R  E+  ES  DAD KC 
Sbjct  272   WYPSQRKAIYRVDDRVPINSSGNGLYDFIPFRPTPSIALSIIRTTEDLHESTSDADGKCR  331

Query  1094  NQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRV  1267
                L    ++   +YGLTN+G+ F+GYPVIG+QN +QSSG+CLDSL D     C WD  +
Sbjct  332   VAKLTTDTLITS-AYGLTNNGIIFTGYPVIGFQNRLQSSGSCLDSLKDAKITACAWDSSI  390

Query  1268  NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE  1447
              G FFHQTTF ISL+KVK+FIEDVQKLV+LEPK LC +  Y+GILMRYV +S+AYLG QE
Sbjct  391   KGEFFHQTTFRISLSKVKNFIEDVQKLVELEPKGLCGIEQYNGILMRYVTSSSAYLGNQE  450

Query  1448  DSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA  1627
             D++DFD TYYRSKDPM PRLYEDILEEIEQ+ +FKYG LPHWGKNRN+AF+G I+KYK+ 
Sbjct  451   DALDFDFTYYRSKDPMSPRLYEDILEEIEQIGIFKYGGLPHWGKNRNLAFEGVIKKYKNV  510

Query  1628  GEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFC  1807
              +FLKVK ++D  GLFSS W+DQ+LGLK G++I+K+GCALEGLCICSQD+HC P+KGYFC
Sbjct  511   DKFLKVKDRYDSQGLFSSTWTDQMLGLKEGVTILKNGCALEGLCICSQDSHCNPSKGYFC  570

Query  1808  RAGKVYKDAKVCVKI  1852
             R GKVYK+A+VC  +
Sbjct  571   RQGKVYKEARVCTHV  585



>ref|XP_010443300.1| PREDICTED: uncharacterized protein LOC104726195 [Camelina sativa]
Length=585

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/570 (61%), Positives = 439/570 (77%), Gaps = 8/570 (1%)
 Frame = +2

Query  164   FLIFTVG-SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F  FT   SS P+DP+KC   +TM      SYG FPDR +C+AAK  YP++E EL+S++A
Sbjct  17    FCFFTFAFSSPPDDPVKCESGSTMCTVTN-SYGAFPDRSICKAAKVEYPRSEDELVSVVA  75

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              AT+  +KM+  TRYSHS+PKL C +G DG+LISTK+LN  +  +  + TMTVESGV+LR
Sbjct  76    AATRAGQKMRVETRYSHSLPKLVCTDGKDGVLISTKFLNNVVRTDREAKTMTVESGVTLR  135

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHDHV  IR+V+P    
Sbjct  136   QLIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDHVTDIRLVSPGLAS  195

Query  701   EGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             +GY  +R L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS+++V+ ND   G +A
Sbjct  196   DGYVKVRVLNETTYPEEFRAAKVSLGVLGVISQVTFELQPMFKRSLTYVMINDSGFGDQA  255

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
               FG +HEFAD  WLP    VVYR DDRV  NTSG GLF+FF  R   ++ L   R  EE
Sbjct  256   ETFGEKHEFADFIWLPSQGKVVYRTDDRVPLNTSGGGLFNFFPFRPQSSEALAIDRSIEE  315

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
               E+  DA+ KC    L+  ++ + +SYGLTN+G++F+GYPV+G QN M SSG+CLDS +
Sbjct  316   SDEANEDANMKCERAKLVTSFL-FSISYGLTNNGLQFTGYPVVGLQNRMMSSGSCLDSRH  374

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             D L   CPWDPR+ G FFHQT FS+ LT+VKSFI+DV+ LV + PKSLCVL   +GIL+R
Sbjct  375   DRLITACPWDPRIKGQFFHQTAFSVPLTRVKSFIDDVKALVKINPKSLCVLEGSNGILIR  434

Query  1409  YVKASTAYLGKQEDSIDFDITYYRS-KDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             YV +STA+LGK+E ++DFD+TYYRS KDP+ PRLYED +EEIEQMA+FKY ALPHWGKNR
Sbjct  435   YVTSSTAFLGKEEKALDFDLTYYRSKKDPLAPRLYEDYIEEIEQMAIFKYNALPHWGKNR  494

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF GAI KYK+A EFLKVK++ D LGLFS+EW+DQILGLK  ++I+K GCALEGLCIC
Sbjct  495   NLAFDGAIGKYKNAKEFLKVKERLDSLGLFSTEWTDQILGLKGNVTILKQGCALEGLCIC  554

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D+HCAPNKGY CR GKVY++A+VC +++
Sbjct  555   SEDSHCAPNKGYLCRPGKVYREARVCTRVS  584



>gb|AAO42132.1| unknown protein [Arabidopsis thaliana]
Length=577

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/569 (62%), Positives = 439/569 (77%), Gaps = 6/569 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             F  FT  SS P D           CT+TNSYG FPDR +C+AAK  YP+TEAEL+SI+A 
Sbjct  9     FCFFTFASSSPPDDPVNCEFGNTMCTVTNSYGAFPDRSICKAAKVEYPRTEAELVSIVAA  68

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
             AT+  +KM+  TRYSHS PKL C +G DG LISTK+LN  +  N  + T+TVESGV+LRQ
Sbjct  69    ATRAGQKMRVVTRYSHSFPKLVCTDGKDGTLISTKFLNHVVTTNPEAKTLTVESGVTLRQ  128

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P    +
Sbjct  129   LIEEAAKFDLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRLVSPGLVSD  188

Query  704   GYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEAT  877
             GY  ++ L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS+++V++ND D G +A 
Sbjct  189   GYVKVQVLSETIDPEEFRAAKVSLGVLGVISQVTFELQPMFKRSLNYVMRNDSDFGDQAV  248

Query  878   KFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEH  1057
              FG +HEFAD  WLP    VVYR+D RV  NTSG+GLF+FF  R+  +  L   R  EE 
Sbjct  249   SFGERHEFADFLWLPSQGKVVYRMDGRVPLNTSGDGLFEFFPFRSQLSLVLAIDRSLEES  308

Query  1058  QESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
             +ES+ DA+ KC    L++  M + +SYG+TN+G+ F+GYPVIG QNHM SSG+CLDS  D
Sbjct  309   EESLEDANMKCVRAKLVSSSM-FLMSYGVTNNGLIFTGYPVIGMQNHMMSSGSCLDSRQD  367

Query  1238  NL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRY  1411
              L   CPWDPR+ G FFHQTTFS+SLT VKSFI D++ LV +EPKSLCVL   +GIL+RY
Sbjct  368   GLITACPWDPRIKGQFFHQTTFSVSLTNVKSFINDIKALVKIEPKSLCVLEGSNGILIRY  427

Query  1412  VKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRN  1588
             V +S A+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+FKY ALPHWGKNRN
Sbjct  428   VTSSLAFLGKEEKALDFDLTYYRSKNDPLAPRLYEDYIEEIEQMAIFKYNALPHWGKNRN  487

Query  1589  VAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICS  1768
             +AF GAIRKYK+A  FLKVK+KFD LGLFS+EW+DQILGLK  ++IVK GCALEGLCICS
Sbjct  488   LAFDGAIRKYKNANAFLKVKEKFDSLGLFSTEWTDQILGLKGNVTIVKQGCALEGLCICS  547

Query  1769  QDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +D+HCAP KGY CR GKVY++A+VC +++
Sbjct  548   EDSHCAPTKGYLCRPGKVYREARVCTRVS  576



>gb|EYU32297.1| hypothetical protein MIMGU_mgv1a003073mg [Erythranthe guttata]
Length=610

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/577 (63%), Positives = 436/577 (76%), Gaps = 29/577 (5%)
 Frame = +2

Query  152   IYVQFLIFTVGSSL----PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             I+   ++ T G  +    PEDPIKCT  +              D   C     +    EA
Sbjct  25    IFFFLMMITCGHVVKCIPPEDPIKCTGGS--------------DYSNC----TITNSNEA  66

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+S +A +T  K+KMK ATRYSHSIPKL CP+GD G++ISTKYLNR L+++AS+MT+TV
Sbjct  67    ELISAVANSTMAKKKMKVATRYSHSIPKLVCPDGDQGVVISTKYLNRVLKIDASAMTITV  126

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESGV+LRQ+I E AKA LALPY+PYWWGLTVGG+MGTG+HGSSLWG+GS VHD+VI +RI
Sbjct  127   ESGVTLRQLINETAKAKLALPYAPYWWGLTVGGMMGTGAHGSSLWGLGSQVHDYVIQLRI  186

Query  680   VTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRD  859
             V+PA   +GYA +R L+ G+ D  AA+VSLGVLGVISQVT KL+ +FKRS++++ KND  
Sbjct  187   VSPAGPDDGYAKVRVLQTGDPDFDAAKVSLGVLGVISQVTLKLEALFKRSVTYITKNDSS  246

Query  860   LGKEAT-KFGFQHEFADMKWLPrdrhvvyrvddrvS-TNTS--GNGLFDFFGLRAVGTDC  1027
             LG EA   FG  HEFADM W P  + VVYR+DDRVS TN S   NGL DF G R+  +  
Sbjct  247   LGDEAAVSFGRAHEFADMIWHPSQKRVVYRIDDRVSITNASEASNGLNDFPGFRSTPSLV  306

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
             L ALR+ EE QES+GD D KC     I    +  ++YGLTN+G  F+GYPVIGYQN MQ+
Sbjct  307   LLALRKTEETQESLGDEDGKCITA-KITTTALKTVAYGLTNNGNLFTGYPVIGYQNRMQA  365

Query  1208  SGTCLDSLND--NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             SGTCLDS  D  N  CPWD RV GLF+HQT FSI L++VK FI D+QKLV LEPK+LC L
Sbjct  366   SGTCLDSSEDEKNTVCPWDSRVKGLFYHQTAFSIGLSQVKDFINDIQKLVSLEPKALCGL  425

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
              LY+GILMRYV ASTAYLGKQED+IDFDITYYRSK+   PRL++DILEEIEQ+ +FKY  
Sbjct  426   DLYNGILMRYVTASTAYLGKQEDAIDFDITYYRSKNASTPRLFQDILEEIEQIGVFKYNG  485

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGC  1741
             LPHWGKNRNVAFQGAI KYK A EF+K+K+K+DP+ LFSS+W+DQILGLK GLSI KDGC
Sbjct  486   LPHWGKNRNVAFQGAIDKYKKASEFIKIKQKYDPMALFSSDWTDQILGLKDGLSIFKDGC  545

Query  1742  ALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             ALEGLCICS+D HCAPNKGY CR GKVY+ A+VC K+
Sbjct  546   ALEGLCICSKDAHCAPNKGYLCRPGKVYEKARVCTKV  582



>ref|XP_009799012.1| PREDICTED: L-gulonolactone oxidase-like isoform X2 [Nicotiana 
sylvestris]
Length=502

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/501 (67%), Positives = 411/501 (82%), Gaps = 3/501 (1%)
 Frame = +2

Query  356   KRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KRKMK  TR+SHSIPKL CP+G+DGLLISTK+LN+ L V+  +M++TVESGV+L+Q+I E
Sbjct  3     KRKMKVTTRFSHSIPKLVCPDGEDGLLISTKFLNKILRVDQENMSITVESGVTLKQLISE  62

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             AAK+GL LPY+PYWWGLT+GGL+GTG+HGSSLWG+GSSVHD+++ +RIVTPA   + YA 
Sbjct  63    AAKSGLVLPYAPYWWGLTIGGLIGTGAHGSSLWGLGSSVHDYIVQLRIVTPAEAAQNYAQ  122

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             IRTL+ GN ++ AARVSLGVLGVISQ+T KL+P+FKR+I+   +ND DLG EA  FG +H
Sbjct  123   IRTLENGNPELDAARVSLGVLGVISQITLKLEPVFKRAITLSERNDSDLGDEAAVFGRKH  182

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EF D  W P  R VVYR+DDRV  NT GNGL DF G R+  +  L  LR  EE+QES  D
Sbjct  183   EFGDFTWYPSQRKVVYRIDDRVPANTPGNGLNDFPGFRSTASLVLAILRSSEENQESRND  242

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTC  1249
             +  KC++  L    +    +YGLTN+G  F+GYPV+G+ N +Q+SGTCL+SL D     C
Sbjct  243   SGGKCASAKLTTSTLK-IGAYGLTNNGFAFTGYPVVGFHNRVQASGTCLNSLEDARITAC  301

Query  1250  PWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTA  1429
             PWD RV GLFFHQTTFSI+L+KVK FI+DVQKLVDLEPK+LCVL LY+GILMRY+ AS A
Sbjct  302   PWDSRVKGLFFHQTTFSINLSKVKGFIQDVQKLVDLEPKALCVLDLYNGILMRYLTASNA  361

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLG+QED++DFDITYYRSKDPM PRL+ED LEE+EQ+A FKYGALPHWGKNRNVAF GAI
Sbjct  362   YLGEQEDALDFDITYYRSKDPMSPRLFEDFLEEVEQLAFFKYGALPHWGKNRNVAFIGAI  421

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
             +KY++AG+FLKVK+++D LGLFSSEW+DQ+LGLK GL IVK+GCALEGLCICS+D HCAP
Sbjct  422   KKYRNAGKFLKVKERYDKLGLFSSEWTDQVLGLKDGLIIVKEGCALEGLCICSEDIHCAP  481

Query  1790  NKGYFCRAGKVYKDAKVCVKI  1852
               GYFCR GK+YKDA+VC ++
Sbjct  482   KMGYFCRPGKIYKDARVCTRL  502



>ref|XP_010485184.1| PREDICTED: uncharacterized protein LOC104763519 [Camelina sativa]
Length=577

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/569 (61%), Positives = 438/569 (77%), Gaps = 8/569 (1%)
 Frame = +2

Query  164   FLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F  FT  SS P +DP+KC   NTM      SYG FPDR +C+AAK  YP++E EL+S++A
Sbjct  9     FCFFTFASSSPPDDPVKCESGNTMCTVTN-SYGAFPDRSICKAAKVEYPRSEEELVSVVA  67

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              AT+  +KM+  T+YSHS PKL C +G DG+LISTK+LN  +  N  + TMTVESGV+LR
Sbjct  68    AATRAGQKMRVVTQYSHSFPKLVCTDGRDGVLISTKFLNNVVRTNREARTMTVESGVTLR  127

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHDHV  IR+V+P    
Sbjct  128   QLIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDHVTEIRLVSPGLAS  187

Query  701   EGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             +GY  +R L +  +  + +AA+VSLGVLGVISQVTF+LQPMFKRS+++V+ ND D G +A
Sbjct  188   DGYVKVRVLNETTNPEEFRAAKVSLGVLGVISQVTFELQPMFKRSLTYVMINDSDFGDQA  247

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
               FG +HEFAD  WLP    VVYR+DDRV  NTSG+GLF+FF  R   +  L   R  EE
Sbjct  248   VSFGEKHEFADFIWLPSQGKVVYRIDDRVPLNTSGSGLFNFFPFRPQLSVALATDRSIEE  307

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
               ES  +A+ KC     ++ ++ + +SYGLTN+G+ F+GYPVIG QN M SSG+CLDS +
Sbjct  308   SYESYENANMKCVRAEQVSSFL-FSVSYGLTNNGLLFTGYPVIGLQNRMMSSGSCLDSRH  366

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             D L   C WDPR+ G FFHQT FS+ LT+VKSFIED++ LV + PKSLC L   +GIL+R
Sbjct  367   DGLITACLWDPRIKGQFFHQTAFSVPLTRVKSFIEDIKALVKINPKSLCALEGSNGILIR  426

Query  1409  YVKASTAYLGKQEDSIDFDITYYRS-KDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             YV +STA+LGK+E ++DFD+TYYRS KDP+ PRLYED +EEIEQMA+FKY ALPHWGKNR
Sbjct  427   YVTSSTAFLGKEEKALDFDLTYYRSKKDPLAPRLYEDYIEEIEQMAIFKYNALPHWGKNR  486

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF GAIRKYK+A EFLKVK++FD LGLFS++W+DQILGLK  ++I+K GCALEGLCIC
Sbjct  487   NLAFDGAIRKYKNANEFLKVKERFDSLGLFSTQWTDQILGLKGNVTILKQGCALEGLCIC  546

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             S+D+HCAPNKGY CR GKVYK+A+VC  +
Sbjct  547   SEDSHCAPNKGYLCRPGKVYKEARVCTYV  575



>emb|CDY41553.1| BnaC04g00690D [Brassica napus]
Length=1215

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/570 (62%), Positives = 436/570 (76%), Gaps = 6/570 (1%)
 Frame = +2

Query  158   VQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSII  337
             V  L+FT  S+ P+DP+KC   N+       SYG FPDR  CRAA+  YP TEAEL+SI+
Sbjct  14    VSTLVFTTISTPPDDPVKCVSGNSDCTVTN-SYGAFPDRSTCRAAEVTYPTTEAELISIV  72

Query  338   AGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSL  517
             A ATK  RKM+  TRYSHSI KL C +G DGL ISTK+LN T++ +A +MT+TVESGV+L
Sbjct  73    AAATKTGRKMRVTTRYSHSITKLVCVDGTDGLFISTKFLNHTVQADADAMTLTVESGVTL  132

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATE  697
             RQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHDHV  IR+V+P + 
Sbjct  133   RQLIAEAAKIGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDHVTEIRMVSPGSV  192

Query  698   KEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKE  871
              +G+A +R L +  +  +  AA+VSLGVLGVISQVTF LQPMFKRS+ +V+KND D G +
Sbjct  193   NDGFAKVRVLSETTTPNEFNAAKVSLGVLGVISQVTFTLQPMFKRSLRYVMKNDSDFGDQ  252

Query  872   ATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKE  1051
             A  FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLFD    R+  +  L  +R  E
Sbjct  253   AVTFGKKHEFADFIWLPSQGKVVYRMDDRVLVNTSGNGLFDILPFRSQLSAALAIIRSSE  312

Query  1052  EHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSL  1231
             E QE   DA+ KC    LI+   ++  SYGLTN+G+ F+GYPV G QN M SSG+CLDSL
Sbjct  313   ETQERFRDANGKCVGATLISS-TLFASSYGLTNNGIIFTGYPVTGSQNRMMSSGSCLDSL  371

Query  1232  NDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILM  1405
              D L   CPWD R+   FFHQTTFS+ LT+VKSFI+D++ LV +E KSLC L LY GILM
Sbjct  372   QDGLITACPWDSRIKSEFFHQTTFSVPLTQVKSFIDDIKSLVKIERKSLCGLELYYGILM  431

Query  1406  RYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             RYV +S AYLGK+ +++DFD+TYYR+KDP+ PR+YED +EEIEQ+A+FKY ALPHWGKNR
Sbjct  432   RYVTSSPAYLGKETEALDFDLTYYRAKDPLTPRIYEDFIEEIEQIALFKYNALPHWGKNR  491

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF G I+KYK+A  FLKVK+ FDP GLFS+EW+DQILG+K  ++IVKDGCALEGLCIC
Sbjct  492   NLAFDGVIKKYKNAPAFLKVKESFDPTGLFSTEWTDQILGIKGNVTIVKDGCALEGLCIC  551

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D HCAP K Y CR GKVYK+A+VC +++
Sbjct  552   SEDAHCAPTKRYLCRPGKVYKEARVCTRVS  581


 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/567 (61%), Positives = 435/567 (77%), Gaps = 6/567 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             L+ T  S+ PEDP+KC   N        SYG FPDR  CRAA   YP TE EL++I+A A
Sbjct  642   LVLTAVSTPPEDPVKCVSGNANCTVTN-SYGAFPDRSTCRAASVAYPTTEDELVAIVAAA  700

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             TK  +KM+  TRYSHSI KL C +G  GL ISTK+LN T++ +A +MT+TVESGV+LRQ+
Sbjct  701   TKTGQKMRVTTRYSHSITKLVCTDGTKGLFISTKFLNHTVQSDAKAMTLTVESGVTLRQL  760

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  +G
Sbjct  761   ISEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSVSDG  820

Query  707   YATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             +A +R L +  +  +  AA+VSLGVLGV+SQVTFKLQPMFKRS+++ ++ND D G++A  
Sbjct  821   FAKVRVLSETTTPNEFNAAKVSLGVLGVVSQVTFKLQPMFKRSLTYTMRNDSDFGEQAVT  880

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
             FG +HEFAD  WLP    VVYR DDRV+ NTSGNGL+DF   R+  +  +  +R  EE Q
Sbjct  881   FGKKHEFADFLWLPSQGKVVYRRDDRVAVNTSGNGLYDFLPFRSQLSVAIAIIRSSEETQ  940

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             E   DA+ KC    LI+   ++  SYGLTN+GV F+GYPVIG QN M SSG+CLDSL D 
Sbjct  941   ERFRDANGKCVGATLISS-TLFGTSYGLTNNGVIFTGYPVIGSQNRMMSSGSCLDSLQDG  999

Query  1241  L--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
             L   C WD R+NG FFHQTTFS+SLT+VKSFI D++ L+ +EPKSLC L L+ GILMRYV
Sbjct  1000  LITACAWDSRINGEFFHQTTFSVSLTQVKSFINDIKSLIKIEPKSLCGLELHYGILMRYV  1059

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
              +S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EEIEQ+A+FKY ALPHWGKNRN+A
Sbjct  1060  TSSPAYLGKETEALDFDITYYRAKDPLAPRLYEDFIEEIEQIALFKYNALPHWGKNRNLA  1119

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F G I+KYK+   FLKVK+ +DP GLFS+EW+DQILG+K   +IVK+GCALEGLCICS+D
Sbjct  1120  FDGVIKKYKNVPAFLKVKESYDPTGLFSTEWTDQILGIKGNATIVKNGCALEGLCICSED  1179

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
              HCAP KGY CR GKVYK+A+VC +++
Sbjct  1180  AHCAPTKGYLCRPGKVYKEARVCTRVS  1206



>ref|NP_564393.1| D-arabinono-1,4-lactone oxidase family protein [Arabidopsis thaliana]
 gb|AAG60168.1|AC084110_1 unknown protein [Arabidopsis thaliana]
 gb|AEE31461.1| D-arabinono-1,4-lactone oxidase family protein [Arabidopsis thaliana]
Length=595

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/575 (61%), Positives = 438/575 (76%), Gaps = 8/575 (1%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAE  322
             L  I+  F  F   S+ P+DP+KC   N M      SYG FPDR +C AAK  YPKTEAE
Sbjct  5     LSLIFFCFCTFA-SSTPPDDPVKCESGNNMCTVTN-SYGAFPDRSICEAAKVEYPKTEAE  62

Query  323   LLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVE  502
             L+SI+A AT+  +K++  TRY HSIPKL C +G DG+LISTK+LN  +  N  + T+TVE
Sbjct  63    LVSIVAAATRAGQKVRVVTRYVHSIPKLVCTDGKDGVLISTKFLNNVVGTNPEAKTLTVE  122

Query  503   SGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIV  682
             SGV+LRQ+I EAA+  LALP++PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+V
Sbjct  123   SGVTLRQLIGEAAELELALPHAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVSEIRMV  182

Query  683   TPATEKEGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             +P    +GY  +R L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS++FV++ND 
Sbjct  183   SPGLASDGYVKVRVLSETIDPDEFRAAKVSLGVLGVISQVTFQLQPMFKRSLTFVMQNDS  242

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             D G +A  FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLFDFF  R   +  L  
Sbjct  243   DFGDQAVTFGEKHEFADFLWLPSQGKVVYRMDDRVPVNTSGNGLFDFFPFRPQLSVALAI  302

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             +R  EE +ES GDA++KC+    I  ++ + +SYG+TN+G++F+GYPVIG QNHM SSGT
Sbjct  303   IRSLEESEESSGDANDKCARAEQITSFL-FSISYGVTNNGMEFTGYPVIGKQNHMMSSGT  361

Query  1217  CLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             CLDS  D L  +CPWDPR+ G FFHQT FSI LT+VK FI D++ LV +EPKSLC L   
Sbjct  362   CLDSHQDGLITSCPWDPRIKGQFFHQTAFSIPLTRVKGFINDIKALVKIEPKSLCALERS  421

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALP  1567
             +GIL+RYV +S A+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+FKY ALP
Sbjct  422   NGILIRYVTSSPAFLGKEEKALDFDLTYYRSKDDPLAPRLYEDFIEEIEQMAIFKYNALP  481

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF G IRKYK+A  FLKVK++FDPLGLFS+EW++QILGLK  ++IVK+GCAL
Sbjct  482   HWGKNRNLAFDGVIRKYKNANTFLKVKERFDPLGLFSTEWTNQILGLKGNVTIVKEGCAL  541

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             EGLC+CS D HCAP KGY CR GKVY  A+VC  +
Sbjct  542   EGLCVCSDDAHCAPKKGYLCRPGKVYTKARVCTHV  576



>ref|XP_006418589.1| hypothetical protein EUTSA_v10002834mg, partial [Eutrema salsugineum]
 gb|ESQ37025.1| hypothetical protein EUTSA_v10002834mg, partial [Eutrema salsugineum]
Length=602

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/566 (61%), Positives = 430/566 (76%), Gaps = 6/566 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             +FT  S+ PEDP+KC   NT       SYG FPDR  CRAA   YP TE EL++I+A AT
Sbjct  30    VFTTISTPPEDPVKCVSGNTNCTVTN-SYGAFPDRSTCRAANVAYPTTEDELVAIVAAAT  88

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             K  RKM+  TRYSHSI KL C +G DG+ ISTK LN T+  +A +MT+TVESGV+LRQ+I
Sbjct  89    KAGRKMRVTTRYSHSITKLMCTDGTDGMFISTKLLNHTVRADAKAMTLTVESGVTLRQLI  148

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
              EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  +G+
Sbjct  149   GEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSVNDGF  208

Query  710   ATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             A +R L +  +  +  AA+VSLGVLGVISQVT KLQPMFKRS+ +V++ND D G +A  F
Sbjct  209   AKVRVLSETTTPNEFNAAKVSLGVLGVISQVTLKLQPMFKRSLRYVMRNDSDFGDQAVTF  268

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G +HEFAD  WLP    VVYR+DDRV+ NTSGNGLFDF   R+  +  L  +R  EE QE
Sbjct  269   GKKHEFADFIWLPSQGKVVYRMDDRVAVNTSGNGLFDFLPFRSQLSVALAIIRSLEETQE  328

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
             +   A  KC    LI+   ++  ++GLTN+GV F+GYPVIG QN M SSG+CLDSL D L
Sbjct  329   TFRYAHGKCVAAKLISS-TLFATAFGLTNNGVIFTGYPVIGSQNRMMSSGSCLDSLQDGL  387

Query  1244  --TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
                C WD R+   FFHQT FSI LT+V+SFI D++ LV +E KSLC L LY GILMRYV 
Sbjct  388   ITACAWDSRIKSEFFHQTAFSIPLTQVQSFINDIKSLVKIERKSLCGLELYYGILMRYVT  447

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             +S AYLGK+ +++DFD+TYYR+K+P+ PRLYED +EEIEQ+A+FKY ALPHWGKNRN+AF
Sbjct  448   SSPAYLGKETEALDFDLTYYRAKNPLTPRLYEDFIEEIEQIALFKYKALPHWGKNRNLAF  507

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
                ++KYK+A  FLKVKK +DP+GLFSSEW+DQILG+K  ++I+KDGCALEGLCICS+D 
Sbjct  508   DRVVKKYKNAPAFLKVKKTYDPMGLFSSEWTDQILGIKGNVTIIKDGCALEGLCICSEDA  567

Query  1778  HCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             HCAP++GY CR GKVYK+A+VC + +
Sbjct  568   HCAPSEGYLCRPGKVYKEARVCERTD  593



>ref|XP_006306011.1| hypothetical protein CARUB_v10011305mg [Capsella rubella]
 gb|EOA38909.1| hypothetical protein CARUB_v10011305mg [Capsella rubella]
Length=579

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/575 (61%), Positives = 437/575 (76%), Gaps = 8/575 (1%)
 Frame = +2

Query  146   ITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAEL  325
             +  +  FL F    + P+DP+KC   N+M      SYG FPDR  C AAK  YPKTEAEL
Sbjct  7     LIFFFCFLTF-ASPTPPDDPVKCDSGNSMCSVTN-SYGAFPDRSTCEAAKVEYPKTEAEL  64

Query  326   LSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVES  505
             +SI+A ATK  +KM+  TRYSHSIPKLAC +G DG+LISTK+LN  +  N  + T+TVES
Sbjct  65    ISIVAAATKAGQKMRVVTRYSHSIPKLACTDGKDGVLISTKFLNNVVRTNRYAKTLTVES  124

Query  506   GVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVT  685
             GV+LRQ+IEEAAK  LALPY+PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+V+
Sbjct  125   GVTLRQLIEEAAKLELALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVSEIRMVS  184

Query  686   PATEKEGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRD  859
             P    +GY  +R L +     + +AA+VSLGVLGV+SQVTF+LQPMFKRS+++V++ND D
Sbjct  185   PGLASDGYVKVRVLSETKDPEEFRAAKVSLGVLGVVSQVTFELQPMFKRSLTYVMQNDSD  244

Query  860   LGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNAL  1039
                +A  FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLF+FF  R+  +  L  +
Sbjct  245   FEDQAVTFGEKHEFADFLWLPSQGKVVYRMDDRVPLNTSGNGLFEFFPFRSQLSATLAII  304

Query  1040  REKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTC  1219
             R  EE +ES GDA + C +   I  ++ + LSYGLTN+G  F+GYPVIG QN M SSGTC
Sbjct  305   RSLEESEESSGDATKTCVSAEGITSFL-FALSYGLTNNGTTFTGYPVIGRQNRMMSSGTC  363

Query  1220  LDSLND--NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYD  1393
             LDS  D  N +CPWDPRV G FFHQTTFS+ LT VKSFI D++ LV +EPK+LCVL   +
Sbjct  364   LDSHQDGLNTSCPWDPRVKGEFFHQTTFSVPLTFVKSFINDIKALVKIEPKALCVLERSN  423

Query  1394  GILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPH  1570
             GIL+RYV  STA+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+FKY ALPH
Sbjct  424   GILIRYVTYSTAFLGKEEKALDFDLTYYRSKDDPLAPRLYEDFIEEIEQMAIFKYNALPH  483

Query  1571  WGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALE  1750
             WGKNRN+AF G I KYK+A  FLKVK++FD LGLFS+ W++QILGLK  ++IVK+GCALE
Sbjct  484   WGKNRNIAFNGVIYKYKNANTFLKVKERFDSLGLFSTAWTNQILGLKGNVTIVKEGCALE  543

Query  1751  GLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             GLC+CS D HCAP+KGY CR GKVY  A+VC +++
Sbjct  544   GLCVCSDDAHCAPDKGYLCRPGKVYTKARVCTRVH  578



>emb|CDP05567.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/495 (67%), Positives = 406/495 (82%), Gaps = 3/495 (1%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK AT  SHSIPKLACP+G++GLLISTK L++T+ V+ SSMTMTV SG++LR++I +AA+
Sbjct  1     MKVATSTSHSIPKLACPDGENGLLISTKNLDQTINVDKSSMTMTVGSGMTLRELISKAAE  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
              GLALPY+PYWWGLTVGG++GTG+HGSSLWG+GS+VHD+++ +RIVTPA  +EGYA +R 
Sbjct  61    VGLALPYAPYWWGLTVGGMLGTGAHGSSLWGLGSAVHDYIVQLRIVTPAGPEEGYAKVRI  120

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L+  N ++ AA+VSLGVLGVISQVT KLQPMFKRSI+F+  ND  LG +A  FG+QHEFA
Sbjct  121   LESDNPELNAAKVSLGVLGVISQVTLKLQPMFKRSITFLEMNDSSLGDQALSFGYQHEFA  180

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P  + V+YRVDDRV+TN  GNGL DF G R+  +  + A+R  EE QES  DA+ 
Sbjct  181   DVSWHPSQKKVIYRVDDRVATNALGNGLNDFTGFRSTPSLVVAAVRSTEEIQESTNDANG  240

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
              C N     ++ +   +YG TNDG+ F GYP++GYQN +Q+SG+CL+ + D L   CPWD
Sbjct  241   ICLNA-ATTIFTLKATAYGYTNDGIIFKGYPIVGYQNRLQASGSCLNGIQDALLTACPWD  299

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PRV GLFFHQTTFSI  +KVK FIEDVQ LV+L PK+LC + +Y+GILMRYVKAS+AYLG
Sbjct  300   PRVKGLFFHQTTFSIGFSKVKGFIEDVQNLVNLVPKALCGIDIYNGILMRYVKASSAYLG  359

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQED IDFDITYYRSKDP  PRLYEDILEEIEQ+AMFKYG LPHWGKNRNVAF GA+++Y
Sbjct  360   KQEDGIDFDITYYRSKDPNKPRLYEDILEEIEQIAMFKYGGLPHWGKNRNVAFLGAVKEY  419

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
             ++A EF+KVK+ +DP GLFSSEW+DQ+LGLK G++I KDGCALEGLCICSQDNHCAP  G
Sbjct  420   RNAAEFMKVKENYDPNGLFSSEWTDQVLGLKNGITIDKDGCALEGLCICSQDNHCAPKLG  479

Query  1799  YFCRAGKVYKDAKVC  1843
             YFCR GK+YKDA+VC
Sbjct  480   YFCRPGKIYKDARVC  494



>emb|CDP05564.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/499 (67%), Positives = 405/499 (81%), Gaps = 3/499 (1%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK AT  SHSIPKL CP G++G++ISTKYLNRT+ V+ S+MT+TVE G +LRQ+I  +A 
Sbjct  1     MKVATTTSHSIPKLMCPGGENGIIISTKYLNRTVNVDKSAMTITVEPGATLRQLINASAA  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
             AGLALPY+PYWWGLTVGG++GTG+HGS+LWG+GS+VHD+VI IRIVTPA   EGYA +RT
Sbjct  61    AGLALPYAPYWWGLTVGGMLGTGAHGSTLWGLGSAVHDYVIQIRIVTPAGPDEGYAKVRT  120

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L+ G+ ++ AARVSLGVLGVISQVT +LQP+FKRSI++V KND D G +A+ FG QHEFA
Sbjct  121   LRNGDPELNAARVSLGVLGVISQVTLQLQPLFKRSITYVQKNDSDFGDQASTFGRQHEFA  180

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D  W P    VVYR+DDRV +NT+GNGL+DF G R+  +  L  +R  EE QESI DA  
Sbjct  181   DFTWYPSQHKVVYRIDDRVPSNTTGNGLYDFMGFRSTPSLFLALIRTAEETQESIRDAVG  240

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
             KC N   I   ++   +YGLTNDG  F GYPV+GY N +QSSG+CLDS  D L   CPWD
Sbjct  241   KCINGG-ITTSILTNAAYGLTNDGSMFKGYPVVGYNNRLQSSGSCLDSPQDGLITACPWD  299

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PRV GL++ Q  FSI L+KV  FI+DVQKLV L+P++LC + LYDG L+RYV AS+AYLG
Sbjct  300   PRVKGLYYFQNGFSIGLSKVTDFIQDVQKLVALQPRALCGVDLYDGFLIRYVTASSAYLG  359

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQED++DFDITYYRSKDPM PRLYEDILEEIEQMA+ KYG LPHWGKNRN+AF GAI KY
Sbjct  360   KQEDALDFDITYYRSKDPMAPRLYEDILEEIEQMAVIKYGGLPHWGKNRNLAFVGAINKY  419

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
             ++A EFLKVK+ +DPLGLFS+EW+DQILG+K G++++KDGCALEGLCICSQD+HCAP KG
Sbjct  420   QNATEFLKVKQLYDPLGLFSNEWTDQILGIKDGITLMKDGCALEGLCICSQDSHCAPQKG  479

Query  1799  YFCRAGKVYKDAKVCVKIN  1855
             YFCR GKVY DA+VC +++
Sbjct  480   YFCRPGKVYTDARVCTRLS  498



>gb|KDO69088.1| hypothetical protein CISIN_1g009245mg [Citrus sinensis]
Length=539

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/538 (64%), Positives = 426/538 (79%), Gaps = 4/538 (1%)
 Frame = +2

Query  104   SHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVC  283
             ++T+  A+        I++  L   V  S PEDPIKC+ NN  +CTITNSYG FPDR VC
Sbjct  2     AYTVCTARSLFRSKCVIFL-LLFIAVNGSPPEDPIKCSSNNNSSCTITNSYGMFPDRSVC  60

Query  284   RAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRT  463
             +AA   YP +E EL+SI+A A   K ++K ATR+SHSIPKL CP G +GLLISTK+LNR 
Sbjct  61    KAANVAYPASEQELISIVAAAAMTKTRIKVATRFSHSIPKLVCPAGQEGLLISTKHLNRV  120

Query  464   LEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVG  643
             L+++  +MT+TVESGV+LRQVIEE+AKAGLALPY PYWWGLTVGG++GTG+HGSSLWG G
Sbjct  121   LKLDVQAMTVTVESGVTLRQVIEESAKAGLALPYGPYWWGLTVGGMLGTGAHGSSLWGRG  180

Query  644   SSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFK  823
             SSVHD+ + IRIVTP   +E +  +R L + + D  AA+VSLGVLGVISQVT KL+P+FK
Sbjct  181   SSVHDYAVEIRIVTPGNPEEEFVNVRVLNESHQDFYAAKVSLGVLGVISQVTLKLEPLFK  240

Query  824   RSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFG  1003
             RSI++V K+D DLG +A  FG +HEFAD+ W P  R   YRVDDR+S+NTSGNGL++FF 
Sbjct  241   RSIAYVQKSDSDLGDQAAIFGHRHEFADITWYPSQRKAAYRVDDRISSNTSGNGLYNFFP  300

Query  1004  LRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVI  1183
              R + +  +  +R  EE+QES+ DAD KC    L+   +  F ++GLTNDGV F+GYPVI
Sbjct  301   FRPMLSVAMAVVRATEENQESLRDADGKCIGGKLVTSTLNAF-AFGLTNDGVVFAGYPVI  359

Query  1184  GYQNHMQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL  1357
             GYQN +QSSGTCLDS  D++   C WDPR+NG FFHQTTFS++L+ VK+FI+D+QKLV +
Sbjct  360   GYQNRLQSSGTCLDSAEDSMITGCGWDPRINGEFFHQTTFSVALSVVKNFIQDIQKLVQM  419

Query  1358  EPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQ  1537
             EPK+LC L LY+GI+MRYVKAS AYLGKQEDS+DFDI YYRSKDPM PRLYED+LEEIEQ
Sbjct  420   EPKALCGLELYNGIIMRYVKASNAYLGKQEDSLDFDIMYYRSKDPMAPRLYEDVLEEIEQ  479

Query  1538  MAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLK  1711
             +A+FKYG LPHWGKNRN+ F G I+KYK+AGEFLKVK+KFDPLGLFSSEW+DQ+LGLK
Sbjct  480   LAVFKYGGLPHWGKNRNLVFDGVIKKYKNAGEFLKVKQKFDPLGLFSSEWTDQMLGLK  537



>ref|XP_002864457.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40716.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=578

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/570 (61%), Positives = 433/570 (76%), Gaps = 8/570 (1%)
 Frame = +2

Query  164   FLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F  FT  SS P  DP+KC   NT+   +  SYG FPDR +C AAK  YPKTEAEL+S++A
Sbjct  9     FCFFTFASSTPPHDPVKCESGNTVCTVMN-SYGAFPDRSLCEAAKVEYPKTEAELVSVVA  67

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              ATK  +KM+  TRYSHSIPKL C +G DG+LISTK+L+  +  N  + T+TVESGV+LR
Sbjct  68    AATKAGQKMRVVTRYSHSIPKLVCTDGKDGILISTKFLDHVVRTNPDAKTLTVESGVTLR  127

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  
Sbjct  128   QLIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSVS  187

Query  701   EGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             EGY  +R L +     +  AA+VSLGVLGVISQVTFKLQPMFKRS+++ +KND D G +A
Sbjct  188   EGYVKVRDLSEVMNPEEFNAAKVSLGVLGVISQVTFKLQPMFKRSLTYEMKNDTDFGDQA  247

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
               FG +HEFAD  WLP    VVYR+DDRV  N SGNGLF+FF  R+  +  +   R  EE
Sbjct  248   VTFGEKHEFADFLWLPSQGKVVYRIDDRVPANVSGNGLFNFFPFRSQLSVAVAISRSIEE  307

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
             ++ES G+A++KC     +  ++ + +SYG+TN+GV F+GYPVIG Q+ M SSG CLDS  
Sbjct  308   NEESSGEANKKCVRAKRLASFL-FVISYGVTNNGVIFTGYPVIGSQDRMMSSGACLDSHR  366

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             + L  +CPWDPR+ G FF+QT  S+ LT VK FI D++ LV +EPKSLC L L  G+L+R
Sbjct  367   NGLITSCPWDPRIRGEFFYQTALSVPLTHVKDFINDIKALVKIEPKSLCGLELNYGVLIR  426

Query  1409  YVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             YV +S AYLGK+E S+DFD+TYYRSK DP+ PRLYED +EEIEQMA+ KY ALPHWGKNR
Sbjct  427   YVTSSPAYLGKEEKSLDFDLTYYRSKDDPLTPRLYEDYMEEIEQMAILKYNALPHWGKNR  486

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N+AF GAIRKYK+A  FLKVK + DP  LFS+EW+DQILGLK  ++IVK GCALEGLCIC
Sbjct  487   NLAFDGAIRKYKNANAFLKVKDRLDPSRLFSTEWTDQILGLKGNVTIVKQGCALEGLCIC  546

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D+HCAPNKGY CR GKVY++A+VC  ++
Sbjct  547   SEDSHCAPNKGYMCRPGKVYREARVCTLVS  576



>ref|XP_004134280.1| PREDICTED: L-gulono-1,4-lactone dehydrogenase-like [Cucumis sativus]
 ref|XP_004155265.1| PREDICTED: L-gulono-1,4-lactone dehydrogenase-like [Cucumis sativus]
Length=595

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/571 (60%), Positives = 439/571 (77%), Gaps = 7/571 (1%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinn---tmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             ++   FL+     S P DPIKC   +     NCTITN YG+FPDR +CR A+ +YP TEA
Sbjct  17    SVVFMFLVLVSECSPPGDPIKCVSVSPNKYANCTITNFYGSFPDRSICRVAEVIYPTTEA  76

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             E++  +A AT+  RKMK  TR+SHSIPKLACPEG++G++ISTKYLNRT++V+   M+++V
Sbjct  77    EVMLAVAAATRGLRKMKVGTRFSHSIPKLACPEGEEGVVISTKYLNRTVKVDVEGMSISV  136

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             E G +LRQ+IE+AA AGLALP +PYWWGLT+GGL+ TG+HGSSLWG GS+VHD+V+ +++
Sbjct  137   EGGATLRQIIEDAATAGLALPSTPYWWGLTIGGLLSTGAHGSSLWGKGSAVHDYVVAVQM  196

Query  680   VTPATEKEGYATIRT-LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             V+P   ++GYA  RT L    + + AA+VSLGVLGVI+QVT KLQPMFKRSI+++ ++D+
Sbjct  197   VSPGGPEDGYAKQRTILPDDQNHLNAAKVSLGVLGVITQVTLKLQPMFKRSITYLKRDDK  256

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             DLG E  +FG  +EF DM W P  R VVYR+D RV +NTSGNGL+DF   R   +  L  
Sbjct  257   DLGDEVIRFGKSYEFGDMSWYPSQRKVVYRIDTRVPSNTSGNGLYDFIPFRPTLSVELAL  316

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             LR  EE QES  DA  KC +  LI   +   L+YGLTN+G+ F  YPVIGY N +QSSG+
Sbjct  317   LRASEEEQESRRDAAAKCLSGNLITSTLS-LLAYGLTNNGITFLKYPVIGYNNRLQSSGS  375

Query  1217  CLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             CLDSLND     CPWDP + G FF++T+ SI LT VKSFIEDVQKL +LEP + C L LY
Sbjct  376   CLDSLNDFRITACPWDPSIKGEFFYETSVSIELTVVKSFIEDVQKLAELEPMAFCGLELY  435

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPH  1570
             +GILMRYV ASTAYLGKQ+DS++FD+TYYRSKDPM PRL+ED++EE+EQMA+FKYG +PH
Sbjct  436   NGILMRYVTASTAYLGKQQDSVEFDLTYYRSKDPMSPRLFEDVIEEVEQMAVFKYGGIPH  495

Query  1571  WGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALE  1750
             WGKNRNVAF     KY++  +FLK+ K++DP  LFS+EW+DQILG++  ++I KDGCALE
Sbjct  496   WGKNRNVAFHQVFHKYRNIEKFLKIMKEYDPHRLFSNEWTDQILGVEGTVNIYKDGCALE  555

Query  1751  GLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             GLCICS+  HCAP+KGYFCRAGK+YKDA+VC
Sbjct  556   GLCICSKHTHCAPSKGYFCRAGKIYKDARVC  586



>ref|XP_006846581.1| hypothetical protein AMTR_s00018p00252240 [Amborella trichopoda]
 gb|ERN08256.1| hypothetical protein AMTR_s00018p00252240 [Amborella trichopoda]
Length=579

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/564 (62%), Positives = 426/564 (76%), Gaps = 3/564 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             ++     S P+D +KC    T NCT+T+SYGTFPDR VCRAA+ VYP +E EL++ +A A
Sbjct  17    MVLRARGSPPDDIVKCMSGTTQNCTVTSSYGTFPDRSVCRAAEVVYPTSEQELVAAVAMA  76

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
              K  +K+K  TRYSHSIPKL CP+G+ GL+IST +LN T+ V+ ++M M VESGV+LR+V
Sbjct  77    VKNNQKVKVVTRYSHSIPKLVCPDGNTGLVISTLFLNTTIRVDPTTMLMMVESGVTLREV  136

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I+EAA AGLALPY+PYWWGLTVGG++GTG+HGSSLW  GS+VHD+V+ +R+VTPA+ +EG
Sbjct  137   IQEAATAGLALPYTPYWWGLTVGGMLGTGAHGSSLWDKGSAVHDYVVGMRLVTPASPQEG  196

Query  707   YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFG  886
             YA IR+L   N  + A +VSLGVLGVISQVT KLQP+F RSI+  +++D DL    + FG
Sbjct  197   YAKIRSLNLDNPQMNAVKVSLGVLGVISQVTLKLQPLFMRSITNSLRSDLDLEDMVSSFG  256

Query  887   FQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQES  1066
              QHEF D+ W P  R V+Y+VDDRV+ N SG G  DF G R+  T  L  LR  EE QE 
Sbjct  257   TQHEFGDITWYPSQRKVLYKVDDRVTMNASGIGNIDFMGFRSTLTLELVLLRSSEETQEL  316

Query  1067  IGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
               DAD KC+   L  V  +     G  N+ V F+ YPVIG  + +Q+SG CLDS  D L 
Sbjct  317   TRDADTKCTMAKL-QVATLVNTGLGYKNNDVSFTSYPVIGSHHRLQASGGCLDSPRDALL  375

Query  1244  -TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               CPWDPRV G FFHQTT SI L+  K FI DV+ L D+ PK LC + LY+GILMRYVKA
Sbjct  376   SACPWDPRVKGEFFHQTTISIGLSNAKDFIIDVKMLRDMVPKGLCGVELYNGILMRYVKA  435

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             S+AYLGKQED+ID DITYYRSKDPM PRLYED++EEIEQMA+FKYG LPHWGKNRN+AF 
Sbjct  436   SSAYLGKQEDAIDVDITYYRSKDPMKPRLYEDVVEEIEQMALFKYGGLPHWGKNRNLAFD  495

Query  1601  GAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNH  1780
             G +RKY   GEFLKVKK +DP+GLFSSEW+DQ+LG+  G+S+VK+GCALEGLCICSQD H
Sbjct  496   GVMRKYAMGGEFLKVKKNYDPMGLFSSEWTDQVLGINGGVSVVKEGCALEGLCICSQDIH  555

Query  1781  CAPNKGYFCRAGKVYKDAKVCVKI  1852
             CAP K YFCR GKVYKDA+VC +I
Sbjct  556   CAPAKQYFCRPGKVYKDARVCTRI  579



>ref|XP_010554522.1| PREDICTED: D-arabinono-1,4-lactone oxidase-like [Tarenaya hassleriana]
Length=563

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/558 (61%), Positives = 421/558 (75%), Gaps = 7/558 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S+ PEDPIKC   NT       SYG FPDR  CRAA   YP TE+E  S    ATK +RK
Sbjct  4     STPPEDPIKCVSGNTNCTVTN-SYGAFPDRSTCRAAGVAYPTTESEXXSFFPAATKARRK  62

Query  365   MKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             M+  TR+SHSIPKLAC + D  +GLLISTK+LNRT+  + SS+T+TVESGV+LRQ+I+EA
Sbjct  63    MRVVTRFSHSIPKLACTDDDASNGLLISTKFLNRTVSSDVSSLTLTVESGVTLRQLIDEA  122

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A   +ALPY PYWWG+TVGG+MGTG+HGSSLWG GS+VHDHV  IR+V+P T +EG+  +
Sbjct  123   AAVRMALPYGPYWWGVTVGGMMGTGAHGSSLWGRGSAVHDHVTEIRMVSPGTAEEGFVNV  182

Query  719   RTLKQGNSD-IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             R L +   D   AA+VSLGVLGVISQVTFKLQPMFKRSI++ +++D +LG EAT+FG +H
Sbjct  183   RVLNESTEDEFNAAKVSLGVLGVISQVTFKLQPMFKRSITYEMRDDWNLGDEATEFGHKH  242

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EFAD  W P    VVYR+DDRV T  SGNGL+D    R+  +  L   R  EE QES+ D
Sbjct  243   EFADFVWYPSHGKVVYRIDDRVPTAVSGNGLYDSVLFRSQFSATLAVARSIEETQESLRD  302

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TC  1249
              D KC     ++   ++  +YGL ++G+ F GYPVIG QNH+ SSGTCLDSL D L   C
Sbjct  303   VDGKCRGAKALSS-TLFATAYGLKSNGITFKGYPVIGQQNHLMSSGTCLDSLEDGLITAC  361

Query  1250  PWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTA  1429
             PWD R+ G FFHQT  S+ L ++  FI+D++ LV +EPKSLC L LY G+LMRYV AS A
Sbjct  362   PWDSRIKGEFFHQTAISVPLVRITDFIDDIKALVRIEPKSLCGLELYYGVLMRYVAASPA  421

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLGK+ D+IDFD+TYYRSKDP+ PRLYED +EEIEQ+A+FKY  LPHWGKNRN+AF G I
Sbjct  422   YLGKEADAIDFDLTYYRSKDPLTPRLYEDFVEEIEQIALFKYNGLPHWGKNRNIAFDGVI  481

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
              KY  A EFLKVK+++DPLGLFSS+W+DQILGL+   +IV++GCALEGLCICS D HCAP
Sbjct  482   DKYGKASEFLKVKERYDPLGLFSSKWTDQILGLEGNATIVEEGCALEGLCICSDDLHCAP  541

Query  1790  NKGYFCRAGKVYKDAKVC  1843
             NKGY+CR GKVYK+A+VC
Sbjct  542   NKGYYCRPGKVYKEARVC  559



>ref|XP_010690463.1| PREDICTED: L-gulonolactone oxidase-like [Beta vulgaris subsp. 
vulgaris]
Length=591

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/583 (60%), Positives = 449/583 (77%), Gaps = 7/583 (1%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSL--PEDPIKctinntmnctitnSYGTFPDRGVCRAA  292
             ++K    +L++ +V     TV      PE+PIKC   ++       S G FPDR VCRAA
Sbjct  5     VSKCCFLLLVSYFVLQWCCTVTCDCIPPEEPIKCFSGDSNCTITN-SQGAFPDRSVCRAA  63

Query  293   KAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEV  472
              AVYP TEAEL+S +A AT +KRKMK ATRYSHSIPKL CP+G+D LLISTK LN  ++V
Sbjct  64    DAVYPTTEAELISAVATATMKKRKMKVATRYSHSIPKLVCPDGEDSLLISTKKLNNIVKV  123

Query  473   NASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSV  652
             +  +  +TV+SG++L+Q+I+EAAKA LALP++PYWWGLT GG++GTG+HGSS W  GS+V
Sbjct  124   DKQAKEITVQSGITLKQLIKEAAKAKLALPHTPYWWGLTAGGMLGTGAHGSSWWQKGSAV  183

Query  653   HDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSI  832
             HD+V+ +RI++P   K+GY   +TLK G++D+ AA+VSLGVLGVISQVTFKL+ +FKRSI
Sbjct  184   HDYVVELRIISPGQAKDGYYKNQTLKDGDTDLDAAKVSLGVLGVISQVTFKLESLFKRSI  243

Query  833   SFVVK-NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLR  1009
             ++  K ND DLG++A  FG +HEFAD+ W P  R V+YR+DDRV + T GNG+  F   R
Sbjct  244   TYGAKDNDNDLGEQALSFGNKHEFADITWYPSQRQVLYRIDDRVPSTTPGNGVNHFLPFR  303

Query  1010  AVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGY  1189
             +     L A R+ EE  E+ G AD KC     I    +  +++GLTN+G  F+GYPVIGY
Sbjct  304   SNAASVLRANRKIEESAEAFGYADLKCFWGNAITS-TLEAIAFGLTNNGKVFTGYPVIGY  362

Query  1190  QNHMQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEP  1363
             QN +QS+G C++  +  L   C WDPR+NG FF  + FSI +++VK+FI++VQKLV+LEP
Sbjct  363   QNKLQSAGGCINQGSCLLKSYCAWDPRINGQFFFISGFSIGISRVKNFIQEVQKLVELEP  422

Query  1364  KSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMA  1543
             KSLC+L LY+GILMRYV ASTAYLGK ED IDFDITYYRSKDP+ P++++DILEEIEQMA
Sbjct  423   KSLCILELYNGILMRYVTASTAYLGKDEDGIDFDITYYRSKDPLAPKMFQDILEEIEQMA  482

Query  1544  MFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLS  1723
             MFKYG +PHWGKNRN+AF+GAI+KYK   +FL VK+++DPLGLFS+EW+DQILG+K GLS
Sbjct  483   MFKYGGMPHWGKNRNIAFEGAIKKYKDGEKFLDVKQRYDPLGLFSNEWTDQILGVKEGLS  542

Query  1724  IVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             I K+GCALEGLCICS+D HCAPNKGYFC+AG+VYK+AKVC K+
Sbjct  543   IYKEGCALEGLCICSEDIHCAPNKGYFCKAGRVYKEAKVCRKV  585



>ref|XP_008776218.1| PREDICTED: LOW QUALITY PROTEIN: L-gulonolactone oxidase-like 
[Phoenix dactylifera]
Length=578

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/554 (62%), Positives = 415/554 (75%), Gaps = 5/554 (1%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             P DPIKC+            YGTFPDR +C AA AVYP +E EL+  +A AT  KRKMK 
Sbjct  27    PPDPIKCSPGTGKCTITNI-YGTFPDRSICGAAAAVYPTSEQELVEAVAKATAGKRKMKV  85

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             ATRYS SIPKLACP GDDGL++ST+YLN  +    S M +TVESGV+L ++I+ AAKAGL
Sbjct  86    ATRYSSSIPKLACPGGDDGLIVSTRYLNGIVSTEVSRMRITVESGVTLEELIKVAAKAGL  145

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQ  733
             ALPY+PYWWG+TVGG++ TG+HGSSL G GS+VH++V+ +R+VTPA+  EGYA IR L  
Sbjct  146   ALPYAPYWWGVTVGGMLSTGAHGSSLRGKGSAVHEYVVGLRLVTPASASEGYAKIRELDV  205

Query  734   GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMK  913
             G+ D+ AA+VSLGVLGVISQVT  LQP+FKRSI+F+  +D DL   A   G QHEFADM 
Sbjct  206   GDPDLDAAKVSLGVLGVISQVTLALQPLFKRSITFLKGDDSDLASMAVTLGDQHEFADMS  265

Query  914   WLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCS  1093
             W P    V+YR+DDRV +   GNGL DF G R+  T  L   R  EE  E+ G+AD KC+
Sbjct  266   WYPGHGKVIYRIDDRVPSKLPGNGLNDFVGFRSTATLLLGINRLAEETLEATGNADGKCT  325

Query  1094  NQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV  1267
             +  L     +   +YG TNDGV F GYPV+G+QN +QSSG+CLD   D+L   CPWDPRV
Sbjct  326   DSKLTTT-TIAIDNYGFTNDGVWFRGYPVVGFQNRLQSSGSCLDGPKDDLLTACPWDPRV  384

Query  1268  NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE  1447
              G FFHQTTFSI L+K K FI DVQKL DL PK+LC + LY+GILMR+VKAS+AYLGKQE
Sbjct  385   KGEFFHQTTFSIGLSKAKDFILDVQKLRDLNPKALCGVELYNGILMRFVKASSAYLGKQE  444

Query  1448  DSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA  1627
             DS+DFD+TYYRS DPM PRL+ED+LEEIEQM +FKYG LPHWGKNRN+AF G I KY   
Sbjct  445   DSLDFDVTYYRSHDPMAPRLHEDLLEEIEQMGLFKYGGLPHWGKNRNIAFDGVIDKYAKG  504

Query  1628  GEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFC  1807
              EFL++K+ +DP GLFSS+W+DQ+LG+    SI+K  CALEGLCICS+D HCAP KGYFC
Sbjct  505   REFLRIKRLYDPDGLFSSQWTDQVLGVNGTTSIIKX-CALEGLCICSEDIHCAPEKGYFC  563

Query  1808  RAGKVYKDAKVCVK  1849
             R GKVYKDA+VC K
Sbjct  564   RPGKVYKDARVCTK  577



>emb|CDY20720.1| BnaA02g08600D [Brassica napus]
Length=577

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/540 (61%), Positives = 420/540 (78%), Gaps = 6/540 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG FPDR +C AAK  YPKTEAEL+S++A AT+  +KM+  TRYSHSIPKL C +G DG
Sbjct  38    SYGAFPDRSICEAAKVEYPKTEAELVSVVAAATRAGQKMRVVTRYSHSIPKLVCTDGKDG  97

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             +LISTK+LN  +  +  + T+TVESGV+LRQ+I EAAK  LALPY+PYWWGLTVGG+MGT
Sbjct  98    ILISTKFLNNVVRADREAKTLTVESGVTLRQLIGEAAKLELALPYAPYWWGLTVGGIMGT  157

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGV  784
             G+HGSSLWG GS+VHD+V  IRIV+P +  +GY  +R L +  +    +AA+VSLGVLGV
Sbjct  158   GAHGSSLWGKGSAVHDYVTEIRIVSPGSVSDGYVKVRVLSESMNPEAFQAAKVSLGVLGV  217

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             ISQVTF LQPMFKRS+++V++ D D G +A  FG +HEFAD  WLP    VVYR+DDRV 
Sbjct  218   ISQVTFVLQPMFKRSLTYVMRKDSDFGDQAVTFGEKHEFADFIWLPSQGRVVYRMDDRVP  277

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              NTSG+GLF+FF  R   +  L   R  EE +E+  D++ +C      + ++ + +SYG+
Sbjct  278   FNTSGDGLFEFFPFRPQLSTALAVNRLVEESEEASADSNRRCVRTEETSSFL-FSISYGV  336

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKV  1318
             TN+G+ F+GYPVIG Q+ M SSG+CLDS+ D L   CPWDPR+NG FFHQTT S+ LT V
Sbjct  337   TNNGLIFTGYPVIGSQDRMMSSGSCLDSIQDGLITACPWDPRINGEFFHQTTLSVPLTHV  396

Query  1319  KSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPM  1495
             K FI D++ LV +EPKSLCVL   +GILMRYV +S A+LGK++ ++DFD+TYYRSK DP+
Sbjct  397   KDFINDIKALVKIEPKSLCVLEGSNGILMRYVTSSPAFLGKEKKALDFDLTYYRSKDDPL  456

Query  1496  VPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLF  1675
              PRLYED +EEIEQMA+ KY ALPHWGKNRN+AF G IRKYK+A  FLKVK++ DPLGLF
Sbjct  457   TPRLYEDYVEEIEQMALLKYEALPHWGKNRNIAFDGVIRKYKNANAFLKVKERLDPLGLF  516

Query  1676  SSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+EW+DQILGLK  ++IVK GCALEGLCICS+D+HCAPNKGY CR GKVY++A+VC ++ 
Sbjct  517   STEWTDQILGLKGNVTIVKQGCALEGLCICSEDSHCAPNKGYMCRPGKVYREARVCTRVT  576



>emb|CDY41810.1| BnaC02g12210D [Brassica napus]
Length=578

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/579 (60%), Positives = 441/579 (76%), Gaps = 9/579 (2%)
 Frame = +2

Query  140   ILITIYVQFLIFT-VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTE  316
             +++ + V F +FT V S+  +DP+KC   NTM      SYG FPDR +C AAK  YPKTE
Sbjct  1     MIVWLSVIFCLFTFVSSTSSDDPVKCEFGNTMCTVTN-SYGAFPDRSICEAAKVEYPKTE  59

Query  317   AELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMT  496
             AEL+S++A AT+  RKM+  +RYSHSIPKL C +G DG+LISTK+LN  +  +  + T+T
Sbjct  60    AELVSVVAAATRAGRKMRVVSRYSHSIPKLVCTDGKDGILISTKFLNNVVRADREAKTLT  119

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
             VESGV+LRQ+I EAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR
Sbjct  120   VESGVTLRQLIGEAAKLELALPYAPYWWGLTVGGIMGTGAHGSSLWGKGSAVHDYVTEIR  179

Query  677   IVTPATEKEGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             IV+P +  +GY  +R L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS+++V++ 
Sbjct  180   IVSPGSVSDGYVKVRVLSETVNPEEFRAAKVSLGVLGVISQVTFQLQPMFKRSLTYVMRK  239

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D D G +A  FG +HEFAD  WLP    VVYR+DDRV  NTSG+GLFDFF  R   +  L
Sbjct  240   DSDFGDQAVTFGEKHEFADFIWLPSQGKVVYRMDDRVPFNTSGDGLFDFFPFRPQLSTAL  299

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
                R  EE +E+  DA+ +C      + ++ + +SYG+TN+G  F+GYPVIG Q+ M SS
Sbjct  300   AVNRLVEESEEASADANRRCVRTEETSSFL-FSISYGVTNNGFIFTGYPVIGSQDRMMSS  358

Query  1211  GTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLG  1384
             G+CLDS+ D L   CPWDPR+NG FF QTT SI LT VK FI D++ LV +EPKSLCVL 
Sbjct  359   GSCLDSIQDGLITACPWDPRINGEFFLQTTLSIPLTHVKDFINDIKALVKIEPKSLCVLE  418

Query  1385  LYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAM-FKYG  1558
               +GILMRYV +S A+LGK++ ++DFD+TYYRSK DP+ PRLYED +EEIEQ+A+  KY 
Sbjct  419   GSNGILMRYVTSSPAFLGKEKKALDFDLTYYRSKDDPLTPRLYEDYVEEIEQIAIVLKYE  478

Query  1559  ALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
             ALPHWGKNRN+AF G IRKYK+A  FLKVK++ DPLGLFS+EW+DQILGLK  ++IVK G
Sbjct  479   ALPHWGKNRNIAFDGVIRKYKNANAFLKVKERLDPLGLFSTEWTDQILGLKGNVTIVKQG  538

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             CALEGLCICS+D+HCAPNKGY C+ GKVY++A+VC +++
Sbjct  539   CALEGLCICSEDSHCAPNKGYMCQPGKVYREARVCTRVS  577



>ref|XP_009126937.1| PREDICTED: uncharacterized protein LOC103851822 [Brassica rapa]
Length=577

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/540 (61%), Positives = 419/540 (78%), Gaps = 6/540 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG FPDR +C AAK  YPKTEAEL+S++A AT+  +KM+  TRYSHSIPKL C +G DG
Sbjct  38    SYGAFPDRSICEAAKVEYPKTEAELVSVVAAATRAGQKMRVVTRYSHSIPKLVCTDGKDG  97

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             +LISTK+LN  +  +  + T+TVESGV+LRQ+I EAAK  LALPY+PYWWGLTVGG+MGT
Sbjct  98    ILISTKFLNNVVRADREAKTLTVESGVTLRQLIGEAAKLELALPYAPYWWGLTVGGIMGT  157

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGV  784
             G+HGSSLWG GS VHD+V  IRIV+P +  +GY  +R L +  +    +AA+VSLGVLGV
Sbjct  158   GAHGSSLWGKGSVVHDYVTEIRIVSPGSVSDGYVKVRVLSESMNPEAFQAAKVSLGVLGV  217

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             ISQVTF LQPMFKRS+++V++ D D G +A  FG  HEFAD  WLP    VVYR+DDRV 
Sbjct  218   ISQVTFVLQPMFKRSLTYVMRKDSDFGDQAVTFGENHEFADFIWLPSQGRVVYRMDDRVP  277

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              NTSG+GLF+FF  R   +  L   R  EE +E+  D++ +C      + ++ + +SYG+
Sbjct  278   FNTSGDGLFEFFPFRPQLSTALAVNRLVEESEEASADSNRRCVRTEETSSFL-FSISYGV  336

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKV  1318
             TN+G+ F+GYPVIG Q+ M SSG+CLDS+ D L   CPWDPR+NG FFHQTT S+ LT V
Sbjct  337   TNNGLIFTGYPVIGSQDRMMSSGSCLDSIQDGLITACPWDPRINGEFFHQTTLSVPLTHV  396

Query  1319  KSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPM  1495
             K FI D++ LV +EPKSLCVL   +GILMRYV +S A+LGK++ ++DFD+TYYRSK DP+
Sbjct  397   KDFINDIKALVKIEPKSLCVLEGSNGILMRYVTSSPAFLGKEKKALDFDLTYYRSKDDPL  456

Query  1496  VPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLF  1675
              PRLYED +EEIEQMA+ KY ALPHWGKNRN+AF G IRKYK+A  FLKVK++ DPLGLF
Sbjct  457   TPRLYEDYVEEIEQMALLKYEALPHWGKNRNIAFDGVIRKYKNANAFLKVKERLDPLGLF  516

Query  1676  SSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+EW+DQILGLK  ++IVK GCALEGLCICS+D+HCAPNKGY CR GKVY++A+VC +++
Sbjct  517   STEWTDQILGLKGNVTIVKQGCALEGLCICSEDSHCAPNKGYMCRPGKVYREARVCTRVS  576



>ref|XP_009120161.1| PREDICTED: L-gulonolactone oxidase-like [Brassica rapa]
Length=587

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/572 (59%), Positives = 434/572 (76%), Gaps = 8/572 (1%)
 Frame = +2

Query  158   VQFLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSI  334
             V F +F   SS P +DP+KC   NT+      SYG FPDR +C AAK  YP+TEAEL+S+
Sbjct  17    VIFCLFAFASSTPPDDPVKCESGNTICTVTN-SYGAFPDRSICEAAKVEYPRTEAELVSV  75

Query  335   IAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVS  514
             +A AT+  +KM+  TRYSHSIPKL C +G DG+LISTK+LN  +  +  + T+TVESGV+
Sbjct  76    VAAATRAGQKMRVVTRYSHSIPKLVCTDGKDGILISTKFLNHVVRTDPKAETLTVESGVT  135

Query  515   LRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPAT  694
             LR++IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD++  IR+V+P +
Sbjct  136   LRELIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYLTEIRLVSPGS  195

Query  695   EKEGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
               +GY  +R L +     +  AA VSLG+LGVISQVTFKL+PMFKRS+++V+KND D G 
Sbjct  196   VSDGYVKVRVLSETMNPEEFNAATVSLGLLGVISQVTFKLEPMFKRSLTYVMKNDSDFGD  255

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             +A  FG QHEFAD  WLP    VVYR+DDRV TN SG+G+F FF  R+  +  +  +R  
Sbjct  256   QALTFGKQHEFADFLWLPSQGKVVYRIDDRVPTNASGDGVFSFFPFRSQVSVVVAFVRSL  315

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             EE  E  GDA+ KC+    I+ ++ + +S+G+TN+G  F+GYP +G Q+ M SSG+CLDS
Sbjct  316   EESDELSGDANRKCARARRISSFL-FGISFGVTNNGFIFTGYPAVGSQDRMMSSGSCLDS  374

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
               + L   CPWDPR+ G F HQTTFSI LT VK FI DV+ LV +EPKSLCVL L +GIL
Sbjct  375   HQNGLITACPWDPRIKGEFVHQTTFSIPLTHVKDFISDVKALVKIEPKSLCVLELNNGIL  434

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGK  1579
             MRYV +S A+LGK+E +++FD+TYYRSK DP+ PRLYED +EEIEQMA+ KY ALPHWGK
Sbjct  435   MRYVTSSPAFLGKEEKALEFDLTYYRSKDDPLTPRLYEDYIEEIEQMALLKYNALPHWGK  494

Query  1580  NRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLC  1759
             NRN+AF G I+KYK+A  FLKVK++ DP GLFS+EW+DQILGLK  +++VK GCALEGLC
Sbjct  495   NRNIAFDGVIKKYKNANLFLKVKERLDPSGLFSTEWTDQILGLKGNVTVVKQGCALEGLC  554

Query  1760  ICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             ICS+D+HCAPNKGY CR GKVY  A+VC +++
Sbjct  555   ICSEDSHCAPNKGYLCRPGKVYSAARVCTRVS  586



>emb|CDY32777.1| BnaA10g10720D [Brassica napus]
Length=587

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/572 (59%), Positives = 437/572 (76%), Gaps = 8/572 (1%)
 Frame = +2

Query  158   VQFLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSI  334
             V F +F   SS P +DP+KC   NT+      SYG FPDR +C AAK  YP+TEAEL+S+
Sbjct  17    VIFCLFAFASSTPPDDPVKCESGNTICTVTN-SYGAFPDRSICEAAKVEYPRTEAELVSV  75

Query  335   IAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVS  514
             +A AT+  +KM+  TRYSHSIPKL C +G DG+LISTK+LN  +  +  + T+TVESGV+
Sbjct  76    VAAATRAGQKMRVVTRYSHSIPKLVCTDGKDGILISTKFLNHVVRTDPKAETLTVESGVT  135

Query  515   LRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPAT  694
             LR++IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +
Sbjct  136   LRELIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGNGSAVHDYVTEIRLVSPGS  195

Query  695   EKEGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
               +GY  +R L +     +  AA VSLG+LGVISQVTFKL+PMFKRS+++VV+ND D+  
Sbjct  196   VSDGYVKVRVLSETMNPEEFNAATVSLGLLGVISQVTFKLEPMFKRSLTYVVRNDTDMED  255

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             +A  FG QHEFAD+ WLP    VVYR+DDRV TN SG+G+F FF  R+  +  L  +R  
Sbjct  256   QALTFGRQHEFADLLWLPSQGKVVYRIDDRVPTNVSGDGVFSFFPFRSQVSLILAFVRSL  315

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             EE  E  G+A+ KC     ++ +++  +++G+TN+G  F+GYP +G Q+ M SSG+CLDS
Sbjct  316   EESDELSGEANGKCVRARQLSSFLLR-IAFGVTNNGFIFTGYPAVGSQDRMMSSGSCLDS  374

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
               + L   CPWDPR+ G FFHQTTFS+ L +VK+FI+D++ LV +EPKSLCVL L +GIL
Sbjct  375   HQNGLITACPWDPRIKGQFFHQTTFSVPLARVKAFIKDIKALVKIEPKSLCVLELNNGIL  434

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGK  1579
             MRYV +S A+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+ KY ALPHWGK
Sbjct  435   MRYVTSSPAFLGKEEKALDFDLTYYRSKDDPLTPRLYEDYIEEIEQMALLKYDALPHWGK  494

Query  1580  NRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLC  1759
             NRN+AF G I+KYK+A  FLKVK++ DP GLFS+EW+DQILGLK  +++VK GCALEGLC
Sbjct  495   NRNIAFDGVIKKYKNANLFLKVKERLDPSGLFSTEWTDQILGLKGNVTVVKQGCALEGLC  554

Query  1760  ICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             ICS+D+HCAPNKGY CR GKVY  A+VC +++
Sbjct  555   ICSEDSHCAPNKGYLCRPGKVYSAARVCTRVS  586



>ref|XP_002882086.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58345.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=594

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/572 (60%), Positives = 425/572 (74%), Gaps = 7/572 (1%)
 Frame = +2

Query  152   IYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELL  328
             +Y  F L+ T  S+ PEDP+KC   NT       S G FPDR  CRAA   YP +EAEL+
Sbjct  23    LYCLFTLVNTAISTPPEDPVKCVSGNTNCTVTN-SLGAFPDRSTCRAANVAYPTSEAELV  81

Query  329   SIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESG  508
             SI+A ATK  RKM+  TRYSHS PKL C +G DGL ISTK+LN T+  +A +MT+TVESG
Sbjct  82    SIVAAATKAGRKMRVTTRYSHSSPKLVCTDGKDGLFISTKFLNHTVRADAKAMTLTVESG  141

Query  509   VSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTP  688
             ++LRQ+I EAAK GLALPY+PYWWG+TVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P
Sbjct  142   MTLRQLIAEAAKVGLALPYAPYWWGVTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSP  201

Query  689   ATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDL  862
             ++  + ++ IR L +  +  +  AA+VSLGVLGVISQVTF LQPMFKRSI +V++ND D 
Sbjct  202   SSVNDEFSKIRVLSETTTPNEFNAAKVSLGVLGVISQVTFALQPMFKRSIKYVMRNDLDF  261

Query  863   GKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALR  1042
               +   FG +HEFAD  WLP    VVYR+DDRV+ NTSGNGL+DF   R+  +  +   R
Sbjct  262   NDQVLTFGKKHEFADFVWLPSQGKVVYRMDDRVAINTSGNGLYDFLPFRSQLSPIVATTR  321

Query  1043  EKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL  1222
               EE QE + DA  KC     I    ++  SYGLTN+G+ F+GYPVIG QN M SSG+CL
Sbjct  322   SSEETQEKLRDAYGKCVAATTITS-TLFATSYGLTNNGIIFTGYPVIGSQNRMMSSGSCL  380

Query  1223  DSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDG  1396
             DSL D L  TC WD R+ G+F + T FS+ LT+V SFI D++ LV ++ KSLC L LY G
Sbjct  381   DSLEDKLISTCAWDSRIKGVFIYSTGFSVPLTQVNSFINDIKSLVKIDSKSLCGLELYYG  440

Query  1397  ILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWG  1576
             ILMRYV +S AYLGK+ ++IDFDITYYR+ DP+ PRLYED +EEIEQ+A+ KY ALPHWG
Sbjct  441   ILMRYVTSSPAYLGKETEAIDFDITYYRANDPLTPRLYEDFIEEIEQIALLKYNALPHWG  500

Query  1577  KNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGL  1756
             KNRN+AF G IRKYK+A  FLKVK+ +DP GLFSSEW+DQILG+K   +IVKDGCALEGL
Sbjct  501   KNRNLAFDGVIRKYKNAPAFLKVKESYDPKGLFSSEWTDQILGIKGNPTIVKDGCALEGL  560

Query  1757  CICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CICS+D HCAP KGY CR GKVYK+A+VC  +
Sbjct  561   CICSEDAHCAPTKGYLCRPGKVYKEARVCTHV  592



>ref|XP_010507978.1| PREDICTED: L-gulonolactone oxidase isoform X2 [Camelina sativa]
Length=576

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/588 (59%), Positives = 432/588 (73%), Gaps = 28/588 (5%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGV  280
             PS++   A     ++   Y+  L+ T  S+ PEDP+KC   NT       SYG FPDR  
Sbjct  7     PSYSSQNATYWRTLIGLYYIFTLVHTAVSTPPEDPVKCVSGNTNCTVTN-SYGAFPDRST  65

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNR  460
             C AA   YPKTEAEL+S++A AT+  RKM+  TRYSHSI KL C +G DGL ISTK+L+ 
Sbjct  66    CLAANVAYPKTEAELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTDGLFISTKFLDH  125

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
             T++ +A++MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG 
Sbjct  126   TVKADATAMTLTVESGVTLRQLIAEAAKIGLALPYAPYWWGLTVGGMMGTGAHGSSLWGK  185

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQP  814
             GS+VHD+V  IR+V+P +  +G+A IR L +  +  +  AA+VSLGVLGVISQVTFKLQP
Sbjct  186   GSAVHDYVTEIRMVSPGSVNDGFAKIRVLTETTTPNEFNAAKVSLGVLGVISQVTFKLQP  245

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             MFKRS+++ ++ND D   +A  FG +HEFAD  WLP    VVYR DDRV+ NTSGN    
Sbjct  246   MFKRSLTYTMRNDSDFEDQAVTFGKKHEFADFIWLPSQGKVVYRRDDRVAVNTSGN----  301

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGY  1174
                               EE QE+  DA+ KC    LI+   ++  SYGLTN+G+ F+GY
Sbjct  302   ------------------EETQETFRDANGKCVGATLISS-TLFATSYGLTNNGIIFTGY  342

Query  1175  PVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKL  1348
             PV+G QN M SSG+CLDS  D L   C WD R+ G FFHQTTFS+ LT VKSFI D++ L
Sbjct  343   PVVGSQNRMMSSGSCLDSRQDGLITACAWDSRIKGEFFHQTTFSVPLTHVKSFINDIKSL  402

Query  1349  VDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             V +E K+LC L L+ GILMRYVK+S AYLGK+ +++DFDITYYR+KDP+ PRLYED +EE
Sbjct  403   VKIESKALCGLELHYGILMRYVKSSPAYLGKKIEALDFDITYYRAKDPLTPRLYEDFIEE  462

Query  1529  IEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             IEQ+A+FKY ALPHWGKNRN+AF G I+KY +A  FLKVK+ +DP GLFSSEW+DQILG+
Sbjct  463   IEQVALFKYNALPHWGKNRNLAFDGVIKKYNNALAFLKVKESYDPKGLFSSEWTDQILGI  522

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             K  ++IVKDGCALEGLCICS+D HCAP KGY CR GKVYK+A+VC ++
Sbjct  523   KGNVTIVKDGCALEGLCICSKDAHCAPAKGYLCRPGKVYKEARVCTRV  570



>ref|XP_010451193.1| PREDICTED: L-gulonolactone oxidase-like [Camelina sativa]
Length=577

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/570 (60%), Positives = 429/570 (75%), Gaps = 8/570 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPE-DPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F  F   SS P  DP+KC   NT+      SY  FPDR +C AAK  YP+TEAEL+ ++A
Sbjct  9     FCFFAFASSTPPPDPVKCESGNTICTVTN-SYEAFPDRSICEAAKVAYPRTEAELVFVVA  67

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              ATK  +KM+  TRYSHSIPKL C +G DG+LISTK+LN  +  N  + T+TVESGV+LR
Sbjct  68    AATKAGQKMRVVTRYSHSIPKLVCTDGKDGILISTKFLNNVVRTNPDAKTLTVESGVTLR  127

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  
Sbjct  128   QLIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSVS  187

Query  701   EGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             EGYA +  L +  +  +  AA+VSLGVLGVISQVTFKLQPMFKRS+++V+ +D D G++A
Sbjct  188   EGYAKVWVLSEAMNPEEFNAAKVSLGVLGVISQVTFKLQPMFKRSLTYVMIDDTDFGEQA  247

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
               FG +HEF+D  WLP    V+YR+DDRV  N SGNGLF+FF  R+  +  L   R  EE
Sbjct  248   VTFGEKHEFSDFIWLPSQGKVLYRIDDRVPGNVSGNGLFNFFPFRSQVSLALAFTRSLEE  307

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
               ES G+A+ KC    ++   +++ +SYGLTN+G  F+GYPVIG Q+ M SSG CLDS  
Sbjct  308   SDESSGEANNKCVRAKIVTS-LLFRISYGLTNNGFLFTGYPVIGSQDRMMSSGACLDSHQ  366

Query  1235  DNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMR  1408
             + L   CPWDPR+ G FF+QT  S+ LT VK FI D++ LV +EPKSLC L L +G+L+R
Sbjct  367   NGLITACPWDPRIKGEFFYQTALSVPLTHVKDFINDIKALVKIEPKSLCGLELNNGVLVR  426

Query  1409  YVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             YV +STAYLGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQ+A+ KY ALPHWGKNR
Sbjct  427   YVTSSTAYLGKEEKALDFDLTYYRSKDDPLTPRLYEDYMEEIEQIAILKYNALPHWGKNR  486

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             NVAF GAIRKYK+A  FLK+K++ DP GLFS+EW+DQI GLK  ++IVK GCALEGLCIC
Sbjct  487   NVAFDGAIRKYKNANAFLKIKERLDPSGLFSTEWTDQIFGLKGNVTIVKPGCALEGLCIC  546

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+D+HCAPNK Y CR GKVY++A+VC  ++
Sbjct  547   SEDSHCAPNKNYLCRPGKVYREARVCTLVS  576



>gb|KGN56343.1| hypothetical protein Csa_3G116800 [Cucumis sativus]
Length=612

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/588 (59%), Positives = 439/588 (75%), Gaps = 24/588 (4%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinn---tmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             ++   FL+     S P DPIKC   +     NCTITN YG+FPDR +CR A+ +YP TEA
Sbjct  17    SVVFMFLVLVSECSPPGDPIKCVSVSPNKYANCTITNFYGSFPDRSICRVAEVIYPTTEA  76

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             E++  +A AT+  RKMK  TR+SHSIPKLACPEG++G++ISTKYLNRT++V+   M+++V
Sbjct  77    EVMLAVAAATRGLRKMKVGTRFSHSIPKLACPEGEEGVVISTKYLNRTVKVDVEGMSISV  136

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             E G +LRQ+IE+AA AGLALP +PYWWGLT+GGL+ TG+HGSSLWG GS+VHD+V+ +++
Sbjct  137   EGGATLRQIIEDAATAGLALPSTPYWWGLTIGGLLSTGAHGSSLWGKGSAVHDYVVAVQM  196

Query  680   VTPATEKEGYATIRT-LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             V+P   ++GYA  RT L    + + AA+VSLGVLGVI+QVT KLQPMFKRSI+++ ++D+
Sbjct  197   VSPGGPEDGYAKQRTILPDDQNHLNAAKVSLGVLGVITQVTLKLQPMFKRSITYLKRDDK  256

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             DLG E  +FG  +EF DM W P  R VVYR+D RV +NTSGNGL+DF   R   +  L  
Sbjct  257   DLGDEVIRFGKSYEFGDMSWYPSQRKVVYRIDTRVPSNTSGNGLYDFIPFRPTLSVELAL  316

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTND-----------------GVKF  1165
             LR  EE QES  DA  KC +  LI   +   L+YGLTN+                 G+ F
Sbjct  317   LRASEEEQESRRDAAAKCLSGNLITSTLS-LLAYGLTNNVILNKMYNIYMSYINIVGITF  375

Query  1166  SGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDV  1339
               YPVIGY N +QSSG+CLDSLND     CPWDP + G FF++T+ SI LT VKSFIEDV
Sbjct  376   LKYPVIGYNNRLQSSGSCLDSLNDFRITACPWDPSIKGEFFYETSVSIELTVVKSFIEDV  435

Query  1340  QKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDI  1519
             QKL +LEP + C L LY+GILMRYV ASTAYLGKQ+DS++FD+TYYRSKDPM PRL+ED+
Sbjct  436   QKLAELEPMAFCGLELYNGILMRYVTASTAYLGKQQDSVEFDLTYYRSKDPMSPRLFEDV  495

Query  1520  LEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQI  1699
             +EE+EQMA+FKYG +PHWGKNRNVAF     KY++  +FLK+ K++DP  LFS+EW+DQI
Sbjct  496   IEEVEQMAVFKYGGIPHWGKNRNVAFHQVFHKYRNIEKFLKIMKEYDPHRLFSNEWTDQI  555

Query  1700  LGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LG++  ++I KDGCALEGLCICS+  HCAP+KGYFCRAGK+YKDA+VC
Sbjct  556   LGVEGTVNIYKDGCALEGLCICSKHTHCAPSKGYFCRAGKIYKDARVC  603



>ref|XP_009396582.1| PREDICTED: uncharacterized protein LOC103981555 [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/564 (60%), Positives = 426/564 (76%), Gaps = 4/564 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I+ V SS P DP++C+   +       +YG FPDR VC A    YP +EAEL+  +A A 
Sbjct  21    IYLVNSSPPPDPVQCSSGTSDCTVTN-AYGAFPDRSVCSAGDVAYPTSEAELVEAVAEAA  79

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
               KRKMK ATR++HSIPKLACP G DGL+IST+ LNR +  + ++MT+TVESGV L  +I
Sbjct  80    ASKRKMKVATRFAHSIPKLACPGGSDGLIISTRDLNRIVSTDVAAMTITVESGVVLEDLI  139

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
             + AA +GLALPY+PYWWGLT+GGL+ TGSHGSS WG GS+VH++V+ IR+VTPA+  EGY
Sbjct  140   KAAAASGLALPYTPYWWGLTIGGLLSTGSHGSSAWGNGSAVHEYVVGIRLVTPASAAEGY  199

Query  710   ATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGF  889
             A +R L+ G+ D++AA+VSLGVLGVISQVT  LQP+FKRSI+F   +D DL + A  FG 
Sbjct  200   AMVRKLEVGHPDMEAAKVSLGVLGVISQVTLALQPLFKRSITFSKYDDADLAEMAVTFGN  259

Query  890   QHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESI  1069
             +HEFADM W P    V+YR+DDRV +N SGNGLFDF G R+  T  +   R  EE  E+ 
Sbjct  260   RHEFADMAWYPGHSKVIYRIDDRVPSNASGNGLFDFTGFRSTVTLAIEVNRFAEEKLEAK  319

Query  1070  GDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--  1243
             G+A  KC +  L    ++    YGLTNDG+ F+GYPVIG QN +QSSG+C+ S  D L  
Sbjct  320   GNALGKCLDSKLTTS-VISLGGYGLTNDGLSFTGYPVIGNQNRLQSSGSCIRSPRDALLT  378

Query  1244  TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAS  1423
              CPWD R+ G FFHQT  SI L+K K FI DVQKL D+ PK+LC + LYDGILMRYVKAS
Sbjct  379   ACPWDSRLKGEFFHQTAVSIGLSKAKDFILDVQKLRDMNPKALCGVELYDGILMRYVKAS  438

Query  1424  TAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQG  1603
             TAYLGKQED+IDFDITYYRS DPM PRL+ED+LEEIEQMA+FKYG LPHWGKNRN+AF G
Sbjct  439   TAYLGKQEDAIDFDITYYRSHDPMTPRLHEDVLEEIEQMALFKYGGLPHWGKNRNLAFDG  498

Query  1604  AIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHC  1783
              I KY  A +FL+VK  +DP  LFSSEW+DQ+LG++   +IV++GCALEGLCICS+D+HC
Sbjct  499   VINKYAKAQDFLRVKDAYDPQELFSSEWTDQVLGVRGTTTIVREGCALEGLCICSEDSHC  558

Query  1784  APNKGYFCRAGKVYKDAKVCVKIN  1855
             AP+KGY+CR GKVY+DA+VC +++
Sbjct  559   APDKGYYCRPGKVYEDARVCTRLS  582



>ref|XP_002890980.1| hypothetical protein ARALYDRAFT_313803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67239.1| hypothetical protein ARALYDRAFT_313803 [Arabidopsis lyrata subsp. 
lyrata]
Length=636

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/547 (63%), Positives = 427/547 (78%), Gaps = 7/547 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S+ P+DP+KC   N M      SYG FPDR +C AAK  YPKTEAEL+SI+A AT+  +K
Sbjct  19    STPPDDPVKCESGNNMCTVTN-SYGAFPDRSICEAAKVEYPKTEAELVSIVAAATRAGQK  77

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             M+  TRYSHSIPKL C +G DG+LISTK+LN  +  N  + T+TVESGV+LRQ+I EAA+
Sbjct  78    MRVVTRYSHSIPKLVCTDGKDGVLISTKFLNNVVGTNPEAKTLTVESGVTLRQLIGEAAE  137

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
               LALPY+PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+V+P    +GY  +R 
Sbjct  138   LELALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVSEIRMVSPGLASDGYVKVRV  197

Query  725   LKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             L +     +  AA+VSLGVLGVISQVTF+LQPMFKRS+++V++ND D G +A  FG +HE
Sbjct  198   LSETMDPDEFCAAKVSLGVLGVISQVTFQLQPMFKRSLTYVMQNDSDFGDQAVTFGEKHE  257

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FAD  WLP    VVYR+DDRV  NTSGNGLFDFF  R   +  L  +R  EE +ES GDA
Sbjct  258   FADFLWLPSQGKVVYRMDDRVPLNTSGNGLFDFFPFRPQLSVALAIIRSLEESEESSGDA  317

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
             ++KC     ++ ++ + +SYG+TN+G++F+GYPVIG QN M SSGTCLDS  D L  +CP
Sbjct  318   NKKCVRAEQLSSFL-FSISYGVTNNGMEFTGYPVIGKQNRMMSSGTCLDSHWDGLITSCP  376

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPR+ G FFHQT FS+ LT+VK FI+D++ LV +EPK+LCVL   +GIL+RYV +S A+
Sbjct  377   WDPRIKGQFFHQTAFSVPLTRVKGFIDDIKALVKIEPKALCVLERSNGILIRYVTSSPAF  436

Query  1433  LGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+FKY ALPHWGKNRN+AF GAI
Sbjct  437   LGKEEKALDFDLTYYRSKDDPLTPRLYEDFIEEIEQMAIFKYNALPHWGKNRNLAFDGAI  496

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
             RKYK+A  FLKVK++FDPLGLFS+EW+DQILGLK  ++IVK+GCALEGLC+CS D HCAP
Sbjct  497   RKYKNANAFLKVKERFDPLGLFSTEWTDQILGLKGNVTIVKEGCALEGLCVCSDDAHCAP  556

Query  1790  NKGYFCR  1810
             NKGY CR
Sbjct  557   NKGYLCR  563



>ref|XP_010523835.1| PREDICTED: LOW QUALITY PROTEIN: L-gulonolactone oxidase-like 
[Tarenaya hassleriana]
Length=589

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/563 (60%), Positives = 427/563 (76%), Gaps = 6/563 (1%)
 Frame = +2

Query  167   LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             ++F   SS PEDP+    +   +CT+TNSY TFPDR  C+AA+  YP TE+EL+SI+A  
Sbjct  28    ILFIAFSSPPEDPV-TCASGNKHCTVTNSYRTFPDRSTCQAAEVAYPTTESELISIVAAG  86

Query  347   TKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
              + KRKM+A TR+ HSIPKLAC +G DG+LISTK+LNRT+ V+ ++MT+TV+SGV L+Q+
Sbjct  87    ARAKRKMRAVTRFGHSIPKLACTDGKDGILISTKFLNRTVRVDVAAMTLTVQSGVLLQQL  146

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I EAAKA + LPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IRIV+P     G
Sbjct  147   ISEAAKARMVLPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRIVSPGPADSG  206

Query  707   YATIRTLKQGN-SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             +  IR L + N ++  AA+VSLGVLGVISQVTFKLQPMFKRSI++V+KNDRD+G EA  F
Sbjct  207   FVNIRVLNESNHNEFNAAKVSLGVLGVISQVTFKLQPMFKRSITYVMKNDRDIGDEAMSF  266

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G +HEFAD  W P    VVYRVDDRV   TS NGL D    RA+ +  L   R  EE QE
Sbjct  267   GRKHEFADFVWYPSQGKVVYRVDDRVKPTTSENGLNDASAFRAMPSSALALGRSTEERQE  326

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
             ++ +A  KCS+    +    +  +YGLTNDGV F+GYPVIG Q+ M SSG+CLDS  D +
Sbjct  327   ALRNASGKCSDAKQ-STSSGFAAAYGLTNDGVNFTGYPVIGDQSRMMSSGSCLDSPEDGV  385

Query  1244  --TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
                C WDPR+ G F+H T  SI LT  K FI+D + L+ +EPKSLC L LYDGI MRY+ 
Sbjct  386   KSACAWDPRIKGSFYHHTALSIPLTSAKDFIDDAKALLKIEPKSLCGLDLYDGIRMRYMT  445

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
              S+A+LGK+ DS++FD+ YYRSKDP+ PRL++D +EEIEQMA+FKY ALPHWGKNRN+AF
Sbjct  446   GSSAFLGKEVDSLEFDMIYYRSKDPLAPRLFQDYMEEIEQMALFKYNALPHWGKNRNIAF  505

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              G I+K+K+A EFLKV++ +DPLGLFS+EW+DQIL  K  + +V+ GCALEGLCICS+  
Sbjct  506   DGVIKKFKNASEFLKVRETYDPLGLFSNEWTDQIL-XKGNIGMVRKGCALEGLCICSEHV  564

Query  1778  HCAPNKGYFCRAGKVYKDAKVCV  1846
             HCAP+KGYFCR GK+YKDA+VC 
Sbjct  565   HCAPSKGYFCRTGKIYKDARVCA  587



>gb|AAF81326.1|AC007767_6 Strong similarity to an unknown protein F19D11.4 gi|7485759 from 
Arabidopsis thaliana BAC F19D11 gb|AC005310. EST gb|AV535485 
comes from this gene [Arabidopsis thaliana]
Length=647

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/561 (61%), Positives = 429/561 (76%), Gaps = 8/561 (1%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAE  322
             L  I+  F  F   S+ P+DP+KC   N M      SYG FPDR +C AAK  YPKTEAE
Sbjct  5     LSLIFFCFCTFA-SSTPPDDPVKCESGNNMCTVTN-SYGAFPDRSICEAAKVEYPKTEAE  62

Query  323   LLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVE  502
             L+SI+A AT+  +K++  TRY HSIPKL C +G DG+LISTK+LN  +  N  + T+TVE
Sbjct  63    LVSIVAAATRAGQKVRVVTRYVHSIPKLVCTDGKDGVLISTKFLNNVVGTNPEAKTLTVE  122

Query  503   SGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIV  682
             SGV+LRQ+I EAA+  LALP++PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+V
Sbjct  123   SGVTLRQLIGEAAELELALPHAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVSEIRMV  182

Query  683   TPATEKEGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             +P    +GY  +R L +     + +AA+VSLGVLGVISQVTF+LQPMFKRS++FV++ND 
Sbjct  183   SPGLASDGYVKVRVLSETIDPDEFRAAKVSLGVLGVISQVTFQLQPMFKRSLTFVMQNDS  242

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             D G +A  FG +HEFAD  WLP    VVYR+DDRV  NTSGNGLFDFF  R   +  L  
Sbjct  243   DFGDQAVTFGEKHEFADFLWLPSQGKVVYRMDDRVPVNTSGNGLFDFFPFRPQLSVALAI  302

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             +R  EE +ES GDA++KC+    I  ++ + +SYG+TN+G++F+GYPVIG QNHM SSGT
Sbjct  303   IRSLEESEESSGDANDKCARAEQITSFL-FSISYGVTNNGMEFTGYPVIGKQNHMMSSGT  361

Query  1217  CLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             CLDS  D L  +CPWDPR+ G FFHQT FSI LT+VK FI D++ LV +EPKSLC L   
Sbjct  362   CLDSHQDGLITSCPWDPRIKGQFFHQTAFSIPLTRVKGFINDIKALVKIEPKSLCALERS  421

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALP  1567
             +GIL+RYV +S A+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+FKY ALP
Sbjct  422   NGILIRYVTSSPAFLGKEEKALDFDLTYYRSKDDPLAPRLYEDFIEEIEQMAIFKYNALP  481

Query  1568  HWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCAL  1747
             HWGKNRN+AF G IRKYK+A  FLKVK++FDPLGLFS+EW++QILGLK  ++IVK+GCAL
Sbjct  482   HWGKNRNLAFDGVIRKYKNANTFLKVKERFDPLGLFSTEWTNQILGLKGNVTIVKEGCAL  541

Query  1748  EGLCICSQDNHCAPNKGYFCR  1810
             EGLC+CS D HCAP KGY CR
Sbjct  542   EGLCVCSDDAHCAPKKGYLCR  562



>ref|XP_010940852.1| PREDICTED: L-gulonolactone oxidase-like [Elaeis guineensis]
Length=579

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/557 (61%), Positives = 417/557 (75%), Gaps = 4/557 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             SS P DPI+C+            YGTFPDR  C+AA AVYP +E EL++ +A A   KRK
Sbjct  24    SSAPPDPIRCSPGTGKCNITNI-YGTFPDRSTCQAAAAVYPTSEQELVAAVAKAAAGKRK  82

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK ATRYS+SIPKL CP GD+G++IST+YLN  +  +     +TVESGV+L ++IE AAK
Sbjct  83    MKVATRYSNSIPKLVCPGGDEGVIISTRYLNGIVSTDVEMKRITVESGVTLEELIEAAAK  142

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
             AGLALPY+PYWWG+TVGG++ TG+HGSS  G GS+VH++V+ +R+VTPA+  EGYA +R 
Sbjct  143   AGLALPYAPYWWGVTVGGMLSTGAHGSSWRGKGSAVHEYVVGVRLVTPASAGEGYAKVRV  202

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L  G+ ++ AA+VSLGVLGVISQVT +LQP+FKRSI+F+ ++D DL ++    G QHEFA
Sbjct  203   LDAGDPEMDAAKVSLGVLGVISQVTLELQPLFKRSITFLKRDDSDLAEKTATLGNQHEFA  262

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             DM W P    V+YR+DDRV +N SGNGL DF G R+  T  L   R  EE  E+ G+A+ 
Sbjct  263   DMSWYPGHGKVIYRIDDRVPSNFSGNGLNDFIGFRSTATLLLGINRLAEETLEATGNAEG  322

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
             KC +  L     +   +YG  NDGV F+GYPV+GYQN +QSSG+CLD   D L   CPWD
Sbjct  323   KCIDSKLTTT-TISIDNYGFKNDGVSFTGYPVVGYQNRLQSSGSCLDGPEDALLTACPWD  381

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
              RV G FFHQTTFSI L++VK FI DVQKL DL PK+LC + LY+GILMR+VKAS+A LG
Sbjct  382   RRVRGEFFHQTTFSIGLSRVKDFILDVQKLRDLNPKALCGVELYNGILMRFVKASSACLG  441

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             K+EDS+DFDITYYRS DPM PRL+ED+LEEIEQMA FK+G LPHWGKNRN+AF G I KY
Sbjct  442   KEEDSLDFDITYYRSHDPMAPRLHEDLLEEIEQMAFFKHGGLPHWGKNRNIAFDGVIDKY  501

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
                GEFL++K  +DP GLFSSEW+DQ+LG+     I+K GCALEGLCICS+D HCAP KG
Sbjct  502   AKGGEFLRIKSLYDPEGLFSSEWTDQVLGVNGTTRIIKKGCALEGLCICSEDIHCAPEKG  561

Query  1799  YFCRAGKVYKDAKVCVK  1849
             YFCR GKVYKDA+VC K
Sbjct  562   YFCRPGKVYKDARVCTK  578



>emb|CDY68110.1| BnaCnng57660D [Brassica napus]
Length=587

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/572 (58%), Positives = 432/572 (76%), Gaps = 8/572 (1%)
 Frame = +2

Query  158   VQFLIFTVGSSLP-EDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSI  334
             V F + T  SS P +DP+KC   NT+      SYG FPDR +C AAK  YP+TEAEL+S+
Sbjct  17    VIFCLVTFASSTPPDDPVKCKSRNTICTVTN-SYGAFPDRSICEAAKVEYPRTEAELVSV  75

Query  335   IAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVS  514
             +A AT+  +KM+  TRYSHSIPKL C +  DG+LISTK+LN  +  +  + T+TVESGV+
Sbjct  76    VAAATRAGQKMRVVTRYSHSIPKLVCTDVKDGILISTKFLNHVVRTDPKAKTLTVESGVT  135

Query  515   LRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPAT  694
             LR++IEEAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  I IV+P +
Sbjct  136   LRELIEEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGNGSAVHDYVTEISIVSPGS  195

Query  695   EKEGYATIRTLKQ--GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGK  868
               +GY  +R L +        AA VSLGVLGVISQVTFKL+PMFKRS+++VV+ND D+  
Sbjct  196   VSDGYVKVRVLSETMNPEGFNAATVSLGVLGVISQVTFKLEPMFKRSLTYVVRNDTDMED  255

Query  869   EATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREK  1048
             +A  FG QHEFAD+ WLP    VVYR+DDRV T  SG+G+F FF  R+  +  +  +R  
Sbjct  256   QALTFGRQHEFADLLWLPSQGKVVYRIDDRVPTKVSGDGVFSFFPFRSQVSLIVAFVRSL  315

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             EE  E  G+A+ KC     ++ +++  +++G+TN+G  F+GYP +G Q+ M SSG+CLDS
Sbjct  316   EESDELSGEANGKCVRARQLSSFLLR-IAFGVTNNGFIFTGYPAVGSQDRMMSSGSCLDS  374

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
               + L   CPWDPR+ G FFHQTTFS+ L +VK+FI+D++ LV +EPKSLCVL L +GIL
Sbjct  375   HQNGLITACPWDPRIKGQFFHQTTFSVPLARVKAFIKDIKALVKIEPKSLCVLELNNGIL  434

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGK  1579
             MRYV +S A+LGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQMA+ KY ALPHWGK
Sbjct  435   MRYVTSSPAFLGKEEKALDFDLTYYRSKDDPLTPRLYEDYIEEIEQMALLKYNALPHWGK  494

Query  1580  NRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLC  1759
             NRN+AF G I+KYK+A  FLKVK++ DP GLFS+EW+DQILGLK  +++VK GCALEGLC
Sbjct  495   NRNIAFDGVIKKYKNANLFLKVKERLDPSGLFSTEWTDQILGLKGNVTVVKQGCALEGLC  554

Query  1760  ICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             ICS+D+ CAPNKGY CR GKVY  A+VC +++
Sbjct  555   ICSEDSQCAPNKGYLCRPGKVYSAARVCTRVS  586



>ref|XP_010451207.1| PREDICTED: uncharacterized protein LOC104733318 [Camelina sativa]
Length=579

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/572 (59%), Positives = 430/572 (75%), Gaps = 10/572 (2%)
 Frame = +2

Query  164   FLIFT-VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIA  340
             F  FT V S+ P DP+ C   NT+      SYG FPDR  C AAK  YP+TEAEL+S++A
Sbjct  9     FCFFTFVFSTPPHDPVNCESGNTICTVTN-SYGAFPDRSTCEAAKVEYPRTEAELVSVVA  67

Query  341   GATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLR  520
              AT+  +KM+  TRYSHSIPKL C +G DG+LISTK+LN  +  N  + T+TVESGV+LR
Sbjct  68    AATRGGQKMRVVTRYSHSIPKLVCTDGKDGILISTKFLNNVVRTNPDAKTLTVESGVTLR  127

Query  521   QVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEK  700
             Q+I+EAAK  LALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR+V+P +  
Sbjct  128   QLIKEAAKLELALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIRMVSPGSVS  187

Query  701   EGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA  874
             EGYA +  L +  +  +  AA+VSLGVLGVISQVTFKLQPMFKRS+++V+ ND D G++A
Sbjct  188   EGYAKVWVLSEAMNPEEFNAAKVSLGVLGVISQVTFKLQPMFKRSLTYVMINDTDFGEQA  247

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTN--TSGNGLFDFFGLRAVGTDCLNALREK  1048
               FG +HEFAD  WLP    V+YR+DDR+  N   SGNGLF FF  R+  +  L   R  
Sbjct  248   VTFGEKHEFADFIWLPSQGKVLYRIDDRIPANVCVSGNGLFKFFPFRSELSLILAFTRIL  307

Query  1049  EEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDS  1228
             EE  ES G+A  KC+    +  ++ + ++YGLTN+G  F+GYPVIG Q+ M SSG CLDS
Sbjct  308   EERDESSGEAHNKCARAKTLTSFL-FKIAYGLTNNGYLFTGYPVIGRQDRMMSSGACLDS  366

Query  1229  LNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
              ++ L   CPWD R+ G FF+QT  S+SLT VK FI D++ LV +EPKSLC L L +G+L
Sbjct  367   YHNGLITACPWDSRIKGDFFYQTALSVSLTHVKDFINDIKALVKIEPKSLCGLELNNGVL  426

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAMFKYGALPHWGK  1579
             +RYV +STAYLGK+E ++DFD+TYYRSK DP+ PRLYED +EEIEQ+A+ KY ALPHWGK
Sbjct  427   VRYVTSSTAYLGKEEKALDFDLTYYRSKDDPLTPRLYEDYMEEIEQIAILKYNALPHWGK  486

Query  1580  NRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLC  1759
             NRNVAF GAIRKYK+A  FLK+K++ DP GLFS+EW+DQI GLK  ++IVK GCALEGLC
Sbjct  487   NRNVAFDGAIRKYKNANAFLKIKERLDPSGLFSTEWTDQIFGLKGNVTIVKPGCALEGLC  546

Query  1760  ICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             ICS+D+HCAPNK Y CR GKVY++A+VC  ++
Sbjct  547   ICSEDSHCAPNKNYLCRPGKVYREARVCTLVS  578



>gb|AES93614.2| D-arabinono-1,4-lactone oxidase-like protein [Medicago truncatula]
Length=580

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/578 (60%), Positives = 445/578 (77%), Gaps = 7/578 (1%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             M K+     I I++ F+I+ V S+ P DPI+C+ NNT       S G FPDR +CRA++ 
Sbjct  1     MRKLEFKSTIFIFL-FIIYGVISTPPADPIQCSSNNTNCTITN-SNGVFPDRSICRASEV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNA  478
             +YP TEAEL+SI+A A+K  RK+K ATR+SHSIPKLACP+ D+GLLISTK LNR L+V+ 
Sbjct  59    MYPTTEAELISIVALASKNNRKVKVATRFSHSIPKLACPD-DNGLLISTKNLNRVLKVDV  117

Query  479   SSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHD  658
               + MTVESGV+LR++I EAA+  +ALP +PYWWGLT+GGL+ TG+HGS+LWG GS+VH+
Sbjct  118   KLLRMTVESGVTLREIISEAARFEMALPNTPYWWGLTIGGLISTGAHGSTLWGKGSAVHE  177

Query  659   HVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISF  838
             +V HIRIV+PA  ++GYA +R L + + D+ AARVSLGVLGVISQVT +L+P+FKRS+++
Sbjct  178   YVTHIRIVSPAGCEDGYAKVRNLNESHQDLNAARVSLGVLGVISQVTLQLEPLFKRSLTY  237

Query  839   VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST-NTSGNGLFDFFGLRAV  1015
             + KND DLG E   FG +HEFAD+ W P  + V+YR+DDRVS+ NT GNGL+D  GLR+ 
Sbjct  238   LTKNDSDLGDELITFGKKHEFADVTWYPSQQKVLYRIDDRVSSVNTFGNGLYDSIGLRST  297

Query  1016  GTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQN  1195
              +  L   R  EE QE+  D + KC N  L    +   ++YGL+N+   F GYPV+G+ N
Sbjct  298   PSSTLTLSRTTEELQEATHDTNGKCINGKLTTETLAG-IAYGLSNNNGTFIGYPVVGFNN  356

Query  1196  HMQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKS  1369
              +QSSGTCLDSL+D ++  C WD R+ G F + T FSI L+ VK FIEDV+KLV LEPK+
Sbjct  357   RIQSSGTCLDSLDDQMSTACIWDSRIKGPFNYDTAFSIPLSIVKYFIEDVKKLVQLEPKA  416

Query  1370  LCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMF  1549
             LC L LY+GILMRYV  S+AYLGK ED+++FDI YYRSKDP+ PRLYEDI+EEIEQ+ +F
Sbjct  417   LCGLDLYNGILMRYVTTSSAYLGKTEDAVEFDIIYYRSKDPLTPRLYEDIIEEIEQIGLF  476

Query  1550  KYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIV  1729
             KYG LPHWGKNRN+ F GAI+KY  A  FLKVKKK+DP  LFSS+W+DQ+LGLK G++I+
Sbjct  477   KYGGLPHWGKNRNIGFVGAIKKYNKANRFLKVKKKYDPKRLFSSDWTDQVLGLKEGVTIL  536

Query  1730  KDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             KDGCALEGLCICS+D+HC+P K YFCR G++YKDA+VC
Sbjct  537   KDGCALEGLCICSKDSHCSPKKNYFCRPGRIYKDARVC  574



>emb|CDP05563.1| unnamed protein product [Coffea canephora]
Length=934

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/608 (58%), Positives = 439/608 (72%), Gaps = 42/608 (7%)
 Frame = +2

Query  92    FPWPSHTISMAKMSIN------------------ILITIYVQFLIFTVGSSLPEDPIKct  217
             FP PS + S+AK  +                   I +T  +   I  V  + PE+ IKC+
Sbjct  348   FPCPSLSQSLAKEKLQNFMSTFKTMPKIQSEKGLITLTFGICLTISLVRCTPPEEHIKCS  407

Query  218   inntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSI  397
               NT       +YG+FPDR +CRAA+AVYP++E EL++I+A AT  KRKMK  T  SHS+
Sbjct  408   SGNTDCTISN-AYGSFPDRSICRAAEAVYPRSEEELIAIVANATMLKRKMKVVTTTSHSV  466

Query  398   PKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYW  577
             PKL CP+G++GL+ISTKYLNR L                    I+E+A AGLA+PY PYW
Sbjct  467   PKLTCPDGENGLVISTKYLNRIL--------------------IDESAMAGLAIPYVPYW  506

Query  578   WGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAA  757
             WGLT+GGL+ TG+HGS+LWG+G +VHD+VI +RI+TP+   EGYA +RTLK G+ ++ AA
Sbjct  507   WGLTIGGLLSTGAHGSTLWGLGPAVHDYVIQLRILTPSGAGEGYAKVRTLKTGDPELNAA  566

Query  758   RVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhv  937
             RVSLGVLGVISQVT +LQP+FKRSI++  K+D +L  + + FG QHEFAD  W P    V
Sbjct  567   RVSLGVLGVISQVTLQLQPLFKRSITYEEKSDSELEDQVSTFGKQHEFADFNWYPSQHKV  626

Query  938   vyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVW  1117
             VYR+DDRV ++T GNG+FD  GLR   +  L  LR  E+ QE  G AD KC++  + +  
Sbjct  627   VYRIDDRVPSSTPGNGVFDSTGLRPAASLALATLRGTEDSQEFTGYADGKCASA-VASTS  685

Query  1118  MVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQT  1291
             +    ++GLTNDG+ F GYPV+GY N MQS+G+CL SL DNL   CPWDPRV+GLFF  +
Sbjct  686   LFKTTAFGLTNDGILFEGYPVVGYNNRMQSAGSCLYSLEDNLLTVCPWDPRVDGLFFFSS  745

Query  1292  TFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDIT  1471
               SIS++K K FI DV++LV L+P  LC L LY+GIL+RYV AS+AYLGK+EDS+D DIT
Sbjct  746   GISISVSKAKDFIRDVKQLVALQPNGLCGLDLYNGILIRYVTASSAYLGKEEDSLDIDIT  805

Query  1472  YYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKK  1651
             YYRSKDPM PR+YEDILEEIEQMA+FKYG LPHWGKNRN+AF   I+KYK+A EFLKVK+
Sbjct  806   YYRSKDPMAPRIYEDILEEIEQMAVFKYGGLPHWGKNRNLAFLNVIKKYKNAKEFLKVKQ  865

Query  1652  KFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKD  1831
              +DPL LFSSEWSDQILGLK G++IVK+GCALEGLCICS+D HCAP KGYFCR GKVYKD
Sbjct  866   LYDPLALFSSEWSDQILGLKDGITIVKEGCALEGLCICSEDLHCAPKKGYFCRPGKVYKD  925

Query  1832  AKVCVKIN  1855
             A VCV + 
Sbjct  926   AWVCVHLT  933


 Score =   334 bits (857),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 228/310 (74%), Gaps = 12/310 (4%)
 Frame = +2

Query  92    FPWPSHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPD  271
             FPW           + +L+       IF VG    ED IKC+  N         Y +FPD
Sbjct  4     FPW-----------LPLLLYFICLTTIFLVGYIPHEDHIKCSSGNANCTISNV-YRSFPD  51

Query  272   RGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKY  451
             R +CRA++  YP TE ELLSI+A AT  ++KM+ AT  S+SIPKL CP+G++GL+ISTKY
Sbjct  52    RSICRASEVAYPTTEEELLSIVANATFLQKKMRIATSLSNSIPKLMCPDGENGLIISTKY  111

Query  452   LNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSL  631
             LNR + ++ S+MT+TVE+G++LRQ+I E+A AGLALPY+PYWWG+T+GG++GTG+HGS+L
Sbjct  112   LNRRVGLDESAMTITVETGMTLRQLINESAMAGLALPYAPYWWGVTIGGILGTGAHGSTL  171

Query  632   WGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQ  811
             W +G +VHD+VI +RIVTPA   EGYA +RTLK G+ ++ AARVSLGVLGVISQVT +LQ
Sbjct  172   WDLGPAVHDYVIELRIVTPAGPDEGYAKVRTLKIGDPELDAARVSLGVLGVISQVTLQLQ  231

Query  812   PMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLF  991
             P+FKRSI+F+ K+D DLG + + FG QHEFAD  W P  + V+YR+DDRV  NT+GNG+F
Sbjct  232   PLFKRSITFLEKDDSDLGAQISTFGNQHEFADFTWFPSQKKVLYRIDDRVPYNTTGNGVF  291

Query  992   DFFGLRAVGT  1021
             DFFGL  V +
Sbjct  292   DFFGLSPVSS  301



>ref|XP_007139013.1| hypothetical protein PHAVU_009G257600g [Phaseolus vulgaris]
 gb|ESW11007.1| hypothetical protein PHAVU_009G257600g [Phaseolus vulgaris]
Length=573

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/561 (59%), Positives = 422/561 (75%), Gaps = 7/561 (1%)
 Frame = +2

Query  173   FTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATK  352
             F V  S PEDPIKC+  NT       SY TFPDR +C A +  YP  E ++L ++A AT+
Sbjct  11    FHVAVSTPEDPIKCSSQNTNCTITN-SYATFPDRSICEAEEVFYPTQEEDVLRVVAAATR  69

Query  353   QKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIE  532
               +KMK ATR+SHS+PK  CPEG++G LISTK LNR LE++A   T+ V+SGV+L+Q++E
Sbjct  70    NGKKMKVATRFSHSVPKWVCPEGNNGWLISTKDLNRVLEIDAEKRTVRVQSGVTLKQLVE  129

Query  533   EAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYA  712
             EAA AGL L Y+PYW GLTVGG++GTG+HGSSLWG GS+VH+ V+  RIVTPA+ + GYA
Sbjct  130   EAATAGLGLQYTPYWLGLTVGGILGTGAHGSSLWGKGSAVHEQVVEFRIVTPASPQHGYA  189

Query  713   TIRTLK-QGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGF  889
              + TL  + +    AA++SLG+LGVIS++T KL+P+FKRSI+++ +ND +L  +   FG 
Sbjct  190   QVHTLSHEQDQHFNAAKLSLGLLGVISEITLKLEPLFKRSITYLTENDANLEGQIITFGQ  249

Query  890   QHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESI  1069
             QHEFAD+ W P     VYRVDDRV  NTSGNG++DF   R+     L  LR  EE +E  
Sbjct  250   QHEFADIIWYPHQHKAVYRVDDRVPINTSGNGVYDFIPFRSTPAIELELLRTTEELEELT  309

Query  1070  GDADEKCS-NQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLT  1246
             G+A  KC   +   N  M    +YGLTN+G+ F+G+PV+G+ N +Q+SG+CL S  +  T
Sbjct  310   GNAVGKCFLAKRTTNALMA--TAYGLTNNGLIFTGFPVVGFHNQIQASGSCLGSDMNTKT  367

Query  1247  --CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               CPWD R+ G FFHQT FSI L+ VK+FIEDV+KLV+LE K+ C + +Y+GILMRYVKA
Sbjct  368   RLCPWDSRIKGEFFHQTAFSIGLSVVKNFIEDVKKLVELEAKAFCGIEIYNGILMRYVKA  427

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             S+AYLGKQEDSIDFDITYYRSKDPM PRL+EDI+EE+EQ+ +FKYG LPHWGKNRNVAF+
Sbjct  428   SSAYLGKQEDSIDFDITYYRSKDPMAPRLHEDIIEEVEQIGIFKYGGLPHWGKNRNVAFE  487

Query  1601  GAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNH  1780
             G + KYK+A +FLKVK ++DP  LFSSEW+DQ+ GLK GL I KDGCALEGLC+CS  NH
Sbjct  488   GVMNKYKNADKFLKVKDEYDPQRLFSSEWTDQVFGLKEGLMISKDGCALEGLCLCSHHNH  547

Query  1781  CAPNKGYFCRAGKVYKDAKVC  1843
             CAP KGYFCR GKVYK+AK+C
Sbjct  548   CAPTKGYFCRPGKVYKEAKIC  568



>gb|AAV31183.1| Putative FAD binding domain containing protein, identical [Solanum 
tuberosum]
Length=510

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 398/495 (80%), Gaps = 7/495 (1%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPE-GD-DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             MK ATR+SHSIPKL C + GD DGLLISTK+LN+ + ++  +M +TVESGV+LRQ+I EA
Sbjct  1     MKIATRFSHSIPKLVCLDNGDQDGLLISTKFLNKIIRIDEENMMITVESGVTLRQLISEA  60

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
              KAGL LPY+PYWWGLT+GGL+GTG+HGSSLWG+GSSVHD+++ +RIVTPA     YA +
Sbjct  61    GKAGLVLPYTPYWWGLTIGGLIGTGAHGSSLWGLGSSVHDYIVQLRIVTPADAANNYAKV  120

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L+ G+ D+ A RVSLGVLGV+SQVT KL+ +FKRSI+F  ++D +LG++A  FG QHE
Sbjct  121   RILENGSPDLNAVRVSLGVLGVVSQVTLKLERVFKRSITFSERDDSNLGEDAVTFGRQHE  180

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FAD  W P  R V+YR+DDRV   T GN L DF G R    + L   R  EE QES  DA
Sbjct  181   FADFTWYPSQRKVIYRIDDRVPNGTPGNALNDFLGFRPTDQNLLAIFRTLEEIQESTNDA  240

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWD  1258
               KC+   +I+  ++ +LSYG  N+G   +GYP++G+QN +Q+SGTCLDSL +  TCPWD
Sbjct  241   GGKCAVA-IISTSILKYLSYGWRNNG---TGYPMVGFQNQVQASGTCLDSL-EGATCPWD  295

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
              RV GLFFHQTTF+ISL+KVK FIEDVQ+LV LEPK+LCVL LY+GILMRYV  S AYLG
Sbjct  296   HRVKGLFFHQTTFTISLSKVKGFIEDVQRLVALEPKALCVLDLYNGILMRYVTTSNAYLG  355

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQEDS+DFDITYYRSKDPM PRL+ED LEEIEQ+A FKYGALPHWGKNRNVAF GAI KY
Sbjct  356   KQEDSLDFDITYYRSKDPMSPRLFEDFLEEIEQLAFFKYGALPHWGKNRNVAFIGAINKY  415

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
             K+  +FL+VK+ +D LGLFSSEW+DQ+LGLK GLSIVK+GCALEGLCICS+D HCAPNKG
Sbjct  416   KNVDKFLQVKQSYDHLGLFSSEWTDQVLGLKDGLSIVKEGCALEGLCICSKDIHCAPNKG  475

Query  1799  YFCRAGKVYKDAKVC  1843
             YFCR G++YKDA+VC
Sbjct  476   YFCRPGRIYKDARVC  490



>ref|XP_003610656.1| hypothetical protein MTR_5g005540 [Medicago truncatula]
Length=621

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/619 (56%), Positives = 446/619 (72%), Gaps = 48/619 (8%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             M K+     I I++ F+I+ V S+ P DPI+C+ NNT       S G FPDR +CRA++ 
Sbjct  1     MRKLEFKSTIFIFL-FIIYGVISTPPADPIQCSSNNTNCTITN-SNGVFPDRSICRASEV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNA  478
             +YP TEAEL+SI+A A+K  RK+K ATR+SHSIPKLACP+ D+GLLISTK LNR L+V+ 
Sbjct  59    MYPTTEAELISIVALASKNNRKVKVATRFSHSIPKLACPD-DNGLLISTKNLNRVLKVDV  117

Query  479   SSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHD  658
               + MTVESGV+LR++I EAA+  +ALP +PYWWGLT+GGL+ TG+HGS+LWG GS+VH+
Sbjct  118   KLLRMTVESGVTLREIISEAARFEMALPNTPYWWGLTIGGLISTGAHGSTLWGKGSAVHE  177

Query  659   HVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISF  838
             +V HIRIV+PA  ++GYA +R L + + D+ AARVSLGVLGVISQVT +L+P+FKRS+++
Sbjct  178   YVTHIRIVSPAGCEDGYAKVRNLNESHQDLNAARVSLGVLGVISQVTLQLEPLFKRSLTY  237

Query  839   VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST-NTSGNGLFDFFGLRAV  1015
             + KND DLG E   FG +HEFAD+ W P  + V+YR+DDRVS+ NT GNGL+D  GLR+ 
Sbjct  238   LTKNDSDLGDELITFGKKHEFADVTWYPSQQKVLYRIDDRVSSVNTFGNGLYDSIGLRST  297

Query  1016  GTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVK-----------  1162
              +  L   R  EE QE+  D + KC N  L    +   ++YGL+N+ V            
Sbjct  298   PSSTLTLSRTTEELQEATHDTNGKCINGKLTTETLAG-IAYGLSNNNVSRPVNRLSGQVR  356

Query  1163  ------------------------------FSGYPVIGYQNHMQSSGTCLDSLNDNLT--  1246
                                           F GYPV+G+ N +QSSGTCLDSL+D ++  
Sbjct  357   LLNRPGQAIGQAQACKFFRRPGLGLSKPGTFIGYPVVGFNNRIQSSGTCLDSLDDQMSTA  416

Query  1247  CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAST  1426
             C WD R+ G F + T FSI L+ VK FIEDV+KLV LEPK+LC L LY+GILMRYV  S+
Sbjct  417   CIWDSRIKGPFNYDTAFSIPLSIVKYFIEDVKKLVQLEPKALCGLDLYNGILMRYVTTSS  476

Query  1427  AYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGA  1606
             AYLGK ED+++FDI YYRSKDP+ PRLYEDI+EEIEQ+ +FKYG LPHWGKNRN+ F GA
Sbjct  477   AYLGKTEDAVEFDIIYYRSKDPLTPRLYEDIIEEIEQIGLFKYGGLPHWGKNRNIGFVGA  536

Query  1607  IRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCA  1786
             I+KY  A  FLKVKKK+DP  LFSS+W+DQ+LGLK G++I+KDGCALEGLCICS+D+HC+
Sbjct  537   IKKYNKANRFLKVKKKYDPKRLFSSDWTDQVLGLKEGVTILKDGCALEGLCICSKDSHCS  596

Query  1787  PNKGYFCRAGKVYKDAKVC  1843
             P K YFCR G++YKDA+VC
Sbjct  597   PKKNYFCRPGRIYKDARVC  615



>emb|CBI38702.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/558 (58%), Positives = 394/558 (71%), Gaps = 57/558 (10%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              G S PEDPIKC   NT       SYG FPDR  CRA+   YP TE EL+S++A A   +
Sbjct  20    AGCSPPEDPIKCASKNTNCTITN-SYGAFPDRSRCRASAVAYPTTEEELISVVAKAAMDR  78

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
              KMKA TR+SHSIPKL C +G+DGLLIST                   +G +LRQVI+EA
Sbjct  79    TKMKAVTRFSHSIPKLVCTDGEDGLLIST-------------------NGATLRQVIDEA  119

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             AKAGLALPY+PYWWGLT+GGL+ +G+HGSSLW  GSSVH++V  +RI+TPA  + GY  +
Sbjct  120   AKAGLALPYAPYWWGLTIGGLLSSGAHGSSLWSKGSSVHEYVEQLRIITPAGRENGYVQV  179

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             RTL   + D+ AA+VS+GVLGVISQ T +LQP+FKRSI +  KND DL  +A  FG +HE
Sbjct  180   RTLDTSHEDLNAAKVSIGVLGVISQATLRLQPLFKRSIDYTTKNDSDLADQAATFGSRHE  239

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FAD+ W P     VYR+DDRV +NTSGNGL DF G R+  +  L  LR  EE+QE  G+A
Sbjct  240   FADITWYPSQGKAVYRIDDRVPSNTSGNGLNDFTGFRSTSSLALALLRTTEENQELKGNA  299

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCP  1252
             D KC+   L  + +    +YGLTN+G+ F+GYPVIGY N +Q+SGTCLDS+ D     CP
Sbjct  300   DGKCTAAKLTTLALS-RAAYGLTNNGIIFTGYPVIGYHNRLQASGTCLDSIEDARITACP  358

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPRV G FFHQTTFSI+L+                                  +ASTAY
Sbjct  359   WDPRVKGQFFHQTTFSIALS----------------------------------RASTAY  384

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGKQED++DFDIT+YRSKDPM PRLYEDILEE+EQM +FKYG LPHW KNRN+AF GAI+
Sbjct  385   LGKQEDALDFDITHYRSKDPMTPRLYEDILEEVEQMGLFKYGGLPHWAKNRNLAFDGAIK  444

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KYK+A +FLKVK+++DPLGLFSSEW+DQ+LGLK G++I K GCALEGLCICS+D+HCAP 
Sbjct  445   KYKNAWKFLKVKERYDPLGLFSSEWTDQVLGLKKGVTIFKKGCALEGLCICSEDSHCAPE  504

Query  1793  KGYFCRAGKVYKDAKVCV  1846
             KGYFCR GKVYKDA+VC 
Sbjct  505   KGYFCRPGKVYKDARVCT  522



>emb|CDP05566.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/537 (60%), Positives = 398/537 (74%), Gaps = 43/537 (8%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK AT  SHSIPKL CPEG++GL+ISTK LNRTL ++ S+MT+TVE G+ LRQ+I E+A 
Sbjct  1     MKVATSTSHSIPKLICPEGENGLIISTKDLNRTLNIDKSAMTITVEPGMLLRQLINESAM  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWG-VGSSVHDHVIHIRIVTPATEKEGYATIR  721
             AGLA+PY PYWWG+TVGG++GTG+HGSSLWG  GS+VHD VI +RIVTP    EGYA +R
Sbjct  61    AGLAIPYVPYWWGVTVGGILGTGAHGSSLWGESGSAVHDFVIQLRIVTPVGPDEGYAKVR  120

Query  722   TLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEF  901
             TL+ G+ ++ AARVSLGVLGVISQVT +LQPMFKRSI+ + KND DL  + + FG QHEF
Sbjct  121   TLQNGDPELDAARVSLGVLGVISQVTLQLQPMFKRSITLLEKNDSDLADQVSTFGRQHEF  180

Query  902   ADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRA----------------------V  1015
             AD+ W P    VVYR+DDRVS+ T GNG++DF   R+                      V
Sbjct  181   ADLTWYPSQSKVVYRIDDRVSSGTPGNGVYDFAAFRSAPSQYLAMARSLEESQESRGTSV  240

Query  1016  GTDCLNA-------------LREKEEHQESIGDADEKC--SNQWLINVWMVWFLSYGLTN  1150
             G +C+               L    E QES  D   KC  + Q L  + +    +YGLTN
Sbjct  241   GGECVTGSVCTSPMEMAAYGLTRNGESQESTSDVVGKCVTAAQTLSQLAVA---AYGLTN  297

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             DG+ F+GYPV+GY N +QSSGTCLDSL D L  +CPWDPR+ GL+F  T  SISL+K K 
Sbjct  298   DGMAFNGYPVVGYNNQLQSSGTCLDSLEDALATSCPWDPRIKGLYFFYTAISISLSKTKD  357

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FIEDV+KLV L+P++ C L LY GILMRYV ASTAYLGK ED ++FD+ YYRSKDP  PR
Sbjct  358   FIEDVKKLVALQPEAFCGLDLYIGILMRYVTASTAYLGKDEDVVEFDMIYYRSKDPKSPR  417

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             +Y+DILEEIEQ+A+FKYG LPHWGKN+N+AF GAI+KYKSA EFLKVK+ +DPLGLFS+E
Sbjct  418   IYQDILEEIEQIALFKYGGLPHWGKNKNMAFIGAIKKYKSASEFLKVKRLYDPLGLFSNE  477

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             W+DQIL +K G+SIVK+ CALEGLCICS+D HCAP KGYFCR GKVY++A+VCV ++
Sbjct  478   WTDQILEVKDGISIVKENCALEGLCICSEDVHCAPQKGYFCRPGKVYQEARVCVHLS  534



>ref|NP_001050492.1| Os03g0563100 [Oryza sativa Japonica Group]
 gb|ABF97126.1| FAD-binding domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12406.1| Os03g0563100 [Oryza sativa Japonica Group]
 dbj|BAG98790.1| unnamed protein product [Oryza sativa Japonica Group]
Length=604

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 402/549 (73%), Gaps = 17/549 (3%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP-EGD-  424
             +YG FPDR  CRAA AVYP TE EL+  +A AT    KMK ATRYSHSIP+LACP +GD 
Sbjct  58    AYGVFPDRSTCRAAAAVYPSTEEELVRAVANATASGTKMKVATRYSHSIPQLACPGDGDG  117

Query  425   DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
             +GL+IST+ LNR + V+A  M +TVESG+SLR++I EA KAG+ALPY+PYWWGLTVGG++
Sbjct  118   EGLVISTRRLNRVVAVDAGRMEVTVESGISLRELIAEAGKAGMALPYAPYWWGLTVGGML  177

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
             GTG+HGSSLWG GS+VH++V+ +RIVTPA   +GYA +R L   + ++ AA+VSLGVLGV
Sbjct  178   GTGAHGSSLWGKGSAVHEYVVGMRIVTPAPAADGYAKVRVLTAADPELDAAKVSLGVLGV  237

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             ISQVT  LQP+FKRS++F+ ++D DL  + TKFG+QHEFAD+ W P     VYRVDDR+ 
Sbjct  238   ISQVTLALQPLFKRSVTFMERDDDDLADQVTKFGYQHEFADIAWYPGIGRAVYRVDDRLP  297

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              N SG G+ DF G RA     +   R  EE  E  G+ + KC    + +  +     YGL
Sbjct  298   MNASGEGVLDFIGFRATPRLLIRTNRLAEELFERAGNGNGKCVTSRVTHAALS-SAGYGL  356

Query  1145  T-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNG-LFFHQTTFSISLT  1312
                 G  F+GYPV+G Q+ MQ+SG C+    D L   CPWDPRV G  FFHQTTFS+ ++
Sbjct  357   MRRSGGLFTGYPVVGPQHLMQASGGCITGPEDALLTACPWDPRVRGSSFFHQTTFSLPVS  416

Query  1313  KVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGK-------QEDSIDFDIT  1471
             +  +F+E+V++L D+ PK+LC + LYDGIL+RYVKASTA+LGK        +D +DFD+T
Sbjct  417   RAGAFVEEVRRLRDMNPKALCGVELYDGILIRYVKASTAHLGKPAAGGGQSDDMVDFDMT  476

Query  1472  YYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKK  1651
             YYRS+DP   RL+ED+LEEIEQM +FKYG LPHWGKNRN+AF GA RKY   GEFL++K 
Sbjct  477   YYRSRDPNRARLFEDVLEEIEQMGVFKYGGLPHWGKNRNLAFVGAARKYPRIGEFLRIKD  536

Query  1652  KFDPLGLFSSEWSDQILGLKTGLSIVKD--GCALEGLCICSQDNHCAPNKGYFCRAGKVY  1825
              +DP GLFSS+WSD +LG+  G +  +D  GCALEG+C+CSQD HCAP +GY CR GKVY
Sbjct  537   AYDPDGLFSSDWSDMMLGIG-GRAPTRDAPGCALEGMCVCSQDAHCAPEQGYVCRPGKVY  595

Query  1826  KDAKVCVKI  1852
             KDA+VC K+
Sbjct  596   KDARVCTKV  604



>ref|NP_001152512.1| FAD binding domain containing protein [Zea mays]
 gb|ACG47987.1| FAD binding domain containing protein [Zea mays]
Length=614

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/604 (53%), Positives = 417/604 (69%), Gaps = 27/604 (4%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVG--------SSLPEDPIKctinntmnctitnS-YGTFPD  271
             + ++  ++L+ + +   +  VG        +S P +P++C+          +S YG FPD
Sbjct  12    VVRVKQSMLLVLVIVTSVLVVGPTADRGAFASPPPEPVQCSSGGGTANCTVSSAYGVFPD  71

Query  272   RGVCRAAKAVYPKTEAELLSIIAGATKQK-RKMKAATRYSHSIPKLACPEGD--DGLLIS  442
             R  CRAA AV+P +E EL+  +A A      KMK ATRYSHSIPKLACP     +GL+IS
Sbjct  72    RSTCRAAAAVFPASEDELVRAVAAAAAASGTKMKVATRYSHSIPKLACPGNGTGEGLVIS  131

Query  443   TKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHG  622
             T+ L+R + V+A++  +TVESGV+LRQ+I EAAKAGLALPY+PYWWGLTVGG++GTG+HG
Sbjct  132   TRRLDRVVSVDAATGHVTVESGVTLRQLIAEAAKAGLALPYAPYWWGLTVGGMLGTGAHG  191

Query  623   SSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTF  802
             SSLWG GS+VH++V+ +RIVTPA   EGYA +R L  GN D+ AA+VSLGVLG ISQVT 
Sbjct  192   SSLWGNGSAVHEYVVGMRIVTPAPAAEGYAKVRVLTAGNPDLDAAKVSLGVLGAISQVTL  251

Query  803   KLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGN  982
              LQP+FKRS++F  ++D DL ++  KFG+QHEFAD+ W P     VYR+DDR+    SG 
Sbjct  252   ALQPLFKRSVTFTERDDDDLAEQVAKFGYQHEFADISWFPGHGRAVYRIDDRLPLAASGE  311

Query  983   GLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT-NDGV  1159
             G  DF G RA  T  + A R  E+  E  G+   KC    + +  +     YGL    G 
Sbjct  312   GAMDFIGFRATPTVVIQASRLAEDLFERAGNGSGKCLTSRVTHAALS-VAGYGLQRRSGG  370

Query  1160  KFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFI  1330
              F+GYPV+G Q+ MQ+SG C+    + L   CPWDPRV  G+FFHQTTFS+ L +  +F+
Sbjct  371   LFTGYPVVGPQHRMQASGGCVTGPENALLTACPWDPRVPAGIFFHQTTFSLPLRRAAAFV  430

Query  1331  EDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE-------DSIDFDITYYRSKD  1489
              +V++L DLEP++LC + LYDGILMRYVKASTA+LGK         D +DFDITYYRS+D
Sbjct  431   TEVRRLRDLEPQALCGVELYDGILMRYVKASTAHLGKPAPRGEPSGDMVDFDITYYRSRD  490

Query  1490  PMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLG  1669
             P   RL+ED+LEEIEQM +FKYG LPHWGKNRN+AF GA RKY     FL+VK  +DP G
Sbjct  491   PGRARLFEDVLEEIEQMGIFKYGGLPHWGKNRNLAFVGAARKYPGLPHFLRVKDAYDPDG  550

Query  1670  LFSSEWSDQILGLKTGLSIVKD--GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LFSS+WSD +LG+  G S   D  GCALEG+C+CS+D HCAP +GY CR GKVYKDA+VC
Sbjct  551   LFSSDWSDTMLGIG-GRSPTTDAPGCALEGMCVCSRDEHCAPEQGYVCRPGKVYKDARVC  609

Query  1844  VKIN  1855
              +++
Sbjct  610   TRVS  613



>ref|XP_002466918.1| hypothetical protein SORBIDRAFT_01g016650 [Sorghum bicolor]
 gb|EER93916.1| hypothetical protein SORBIDRAFT_01g016650 [Sorghum bicolor]
Length=626

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/575 (55%), Positives = 403/575 (70%), Gaps = 21/575 (4%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnS-YGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKR  361
             +S P DP++C+     +    +S YG FPDR  CRAA A +P +E EL+  +A       
Sbjct  52    ASPPPDPVQCSSGGGTSDCTVSSAYGVFPDRSTCRAAGAAFPTSEDELVRAVARGAASGT  111

Query  362   KMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KMKAATRYSHSIP LACP   DG  L+IST+ L+R + V+A+S  +TVESGV+LRQ++ E
Sbjct  112   KMKAATRYSHSIPPLACPGAGDGQGLVISTRRLDRVVSVDAASGHVTVESGVTLRQLVAE  171

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             AAKAGLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VH++V+ +RIVTPA   EGYA 
Sbjct  172   AAKAGLALPYAPYWWGLTVGGMLGTGAHGSSLWGNGSAVHEYVVGMRIVTPAPAAEGYAK  231

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             +R L  G+ ++ AA+VSLGVLGVISQVT  LQP+FKRS++F  ++D DL ++  KFG+QH
Sbjct  232   VRVLTAGDPELDAAKVSLGVLGVISQVTLALQPLFKRSVTFTERDDDDLAEQVAKFGYQH  291

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EFAD+ W P  R  VYR+DDR+     G+G  DF G RA     + A R  E+  E  G+
Sbjct  292   EFADISWFPGHRRAVYRIDDRLPLTAPGDGAMDFIGFRATPALVIQATRLAEDLFERAGN  351

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDG---VKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
                KC    + +  +     YGL         F+GYPV+G Q+ MQ+SG C+    D L 
Sbjct  352   GSGKCLTSRVTHAALS-AAGYGLQRRSGGLFTFTGYPVVGAQHRMQASGGCVTGPEDALL  410

Query  1244  -TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKSLCVLGLYDGILMRYV  1414
               CPWDPRV  G FFHQTTFS+ L +  +F+ +V++L D+ +P++LC + LYDGILMRYV
Sbjct  411   TACPWDPRVRGGTFFHQTTFSLPLRRAAAFVAEVKRLRDMADPRALCGVELYDGILMRYV  470

Query  1415  KASTAYLGKQE-------DSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHW  1573
             KASTA+LGK         D +DFDITYYRS+DP   RL+ED+LEEIEQM +FKYG LPHW
Sbjct  471   KASTAHLGKPPPPSSSSGDMVDFDITYYRSRDPARARLFEDVLEEIEQMGVFKYGGLPHW  530

Query  1574  GKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD--GCAL  1747
             GKNRN+AF GA RKY    +FL+VK  +DP GLFSS+WSD +LG+  G S   D  GCAL
Sbjct  531   GKNRNLAFVGAARKYPGLPQFLRVKDAYDPDGLFSSDWSDMMLGIG-GRSPTTDAPGCAL  589

Query  1748  EGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             EG+C+CS+D HCAP +GY CR GKVYKDA+VC ++
Sbjct  590   EGMCVCSRDEHCAPEQGYVCRPGKVYKDARVCTRV  624



>tpg|DAA49257.1| TPA: FAD binding domain containing protein [Zea mays]
Length=622

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/604 (53%), Positives = 416/604 (69%), Gaps = 27/604 (4%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVG--------SSLPEDPIKctinntmnctitnS-YGTFPD  271
             + ++  ++L+ + +   +  VG        +S P +P++C+          +S YG FPD
Sbjct  20    VVRVKQSMLLVLVIVTSVLVVGPTADRGAFASPPPEPVQCSSGGGTANCTVSSAYGVFPD  79

Query  272   RGVCRAAKAVYPKTEAELLSIIAGATKQK-RKMKAATRYSHSIPKLACPEGD--DGLLIS  442
             R  CRAA AV+P +E EL+  +A A      KMK ATRYSHSIPKLACP     +GL+IS
Sbjct  80    RSTCRAAAAVFPASEDELVRAVAAAAAASGTKMKVATRYSHSIPKLACPGNGTGEGLVIS  139

Query  443   TKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHG  622
             T+ L+R + V+A++  +TVESGV+LRQ+I EAAKAGLALPY+PYWWGLTVGG++GTG+HG
Sbjct  140   TRRLDRVVSVDAATGHVTVESGVTLRQLIAEAAKAGLALPYAPYWWGLTVGGMLGTGAHG  199

Query  623   SSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTF  802
             SSLWG GS+VH++V+ +RIVTPA   EGYA +R L  GN D+ AA+VSLGVLG ISQVT 
Sbjct  200   SSLWGNGSAVHEYVVGMRIVTPAPAAEGYAKVRVLTAGNPDLDAAKVSLGVLGAISQVTL  259

Query  803   KLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGN  982
              LQP+FKRS++F  ++D DL ++  KFG+QHEFAD+ W P     VYR+DDR+    SG 
Sbjct  260   ALQPLFKRSVTFTERDDDDLAEQVAKFGYQHEFADISWFPGHGRAVYRIDDRLPLAASGE  319

Query  983   GLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT-NDGV  1159
             G  DF G RA  T  + A R  E+  E  G+   KC    + +  +     YGL    G 
Sbjct  320   GAMDFIGFRATPTVVIQASRLAEDLFERAGNGSGKCLTSRVTHAALS-VAGYGLQRRSGG  378

Query  1160  KFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFI  1330
              F+GYPV+G Q+ MQ+SG C+    + L   CPWDPRV  G FFHQTTFS+ L +  +F+
Sbjct  379   LFTGYPVVGPQHRMQASGGCVTGPENALLTACPWDPRVPAGTFFHQTTFSLPLRRAAAFV  438

Query  1331  EDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE-------DSIDFDITYYRSKD  1489
              +V++L DLEP++LC + LYDGILMRYVKASTA+LGK         D +DFDITYYRS+D
Sbjct  439   TEVRRLRDLEPQALCGVELYDGILMRYVKASTAHLGKPAPRGEPSGDMVDFDITYYRSRD  498

Query  1490  PMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLG  1669
             P   RL+ED+LEEIEQM +FKYG LPHWGKNRN+AF GA RKY     FL+VK  +DP G
Sbjct  499   PGRARLFEDVLEEIEQMGIFKYGGLPHWGKNRNLAFVGAARKYPGLPHFLRVKDAYDPDG  558

Query  1670  LFSSEWSDQILGLKTGLSIVKD--GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LFSS+WSD +LG+  G S   D  GCALEG+C+CS+D HCAP +GY CR GKVYKDA+VC
Sbjct  559   LFSSDWSDTMLGIG-GRSPTTDAPGCALEGMCVCSRDEHCAPEQGYVCRPGKVYKDARVC  617

Query  1844  VKIN  1855
              +++
Sbjct  618   TRVS  621



>ref|XP_004982560.1| PREDICTED: uncharacterized protein LOC101777017 [Setaria italica]
Length=686

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/600 (53%), Positives = 414/600 (69%), Gaps = 19/600 (3%)
 Frame = +2

Query  107   HTISMAKMSINILITIYVQ-FLIFTVGSSLPEDPIKctinntmnctitnS-YGTFPDRGV  280
             H I + +  +  L+ + V   LI    +S P DP++C+          +S YG FPDR  
Sbjct  88    HLIKVKQTMLRRLLVLTVATILIGPAVASPPPDPVQCSSGGNDGGCTVSSAYGVFPDRST  147

Query  281   CRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPE--GDDGLLISTKYL  454
             CRAA   YP TE EL+  +A A     KMK  TRYSHSIP+LACP   G +GL IST+ L
Sbjct  148   CRAAAVAYPSTEGELVRAVARAVASGTKMKVTTRYSHSIPQLACPGSGGGEGLAISTRRL  207

Query  455   NRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLW  634
             +R + V+A+   M VESG++LR ++ EAA+AGLALPY+PYWWGLTVGG++GTG+HGSSLW
Sbjct  208   DRVVSVDAARGRMAVESGLTLRDLVAEAARAGLALPYAPYWWGLTVGGMLGTGAHGSSLW  267

Query  635   GVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQP  814
             G GS+VH++V+ +RIVTPA  +EGYA +R L +G+  + AA+VSLGVLGVISQVT +LQP
Sbjct  268   GNGSAVHEYVVGMRIVTPAPAEEGYAKVRVLAEGDPVLDAAKVSLGVLGVISQVTLQLQP  327

Query  815   MFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFD  994
             +FKRS++F  ++D DL ++  KFG+QHEFAD+ W P  R  VYR+DDR+  +  G+G+ D
Sbjct  328   LFKRSVTFDERDDGDLEEQLAKFGYQHEFADIAWYPGHRRAVYRIDDRLPLSAPGDGVLD  387

Query  995   FFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT-NDGVKFSG  1171
             F G RA  T  + A R  E+  E  G+   KC    L +  +     YGL    G  F+G
Sbjct  388   FIGFRATPTLGIQANRLAEDLLERAGNGTGKCVASRLTHAALS-VAGYGLMRRSGGVFTG  446

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNG-LFFHQTTFSISLTKVKSFIEDVQ  1342
             YPV+G Q+ MQ+SG C+    D L   CPWDPRV    FFHQTTFS+ L +  +F+ DV+
Sbjct  447   YPVVGPQHRMQASGGCVAGPEDALLTACPWDPRVRASSFFHQTTFSLPLARAAAFVADVR  506

Query  1343  KLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE-------DSIDFDITYYRSKDPMVP  1501
             +L +L P++LC + LYDGILMRYVKASTA+LGK         D +DFD+TYYRS+DP   
Sbjct  507   RLRELNPRALCGVELYDGILMRYVKASTAHLGKPPSAGSGGGDMVDFDMTYYRSRDPRRA  566

Query  1502  RLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             RL+ED++EEIEQM +FKYG LPHWGKNRN+AF GA  KY    EFL+VK  +DP GLFSS
Sbjct  567   RLFEDVMEEIEQMGIFKYGGLPHWGKNRNLAFAGAAAKYPGMAEFLRVKDAYDPDGLFSS  626

Query  1682  EWSDQILGLKTGLSIVKD--GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +WSD +LG+  G S  +D  GCALEG+C+CS+D HCAP +GY CR GKVYK+A+VC K++
Sbjct  627   DWSDVVLGVGGG-SPTRDAPGCALEGMCVCSRDEHCAPEQGYVCRPGKVYKEARVCTKVS  685



>ref|XP_008680953.1| PREDICTED: FAD binding domain containing protein isoform X1 [Zea 
mays]
Length=645

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/604 (53%), Positives = 416/604 (69%), Gaps = 27/604 (4%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVG--------SSLPEDPIKctinntmnctitnS-YGTFPD  271
             + ++  ++L+ + +   +  VG        +S P +P++C+          +S YG FPD
Sbjct  43    VVRVKQSMLLVLVIVTSVLVVGPTADRGAFASPPPEPVQCSSGGGTANCTVSSAYGVFPD  102

Query  272   RGVCRAAKAVYPKTEAELLSIIAGATKQK-RKMKAATRYSHSIPKLACPEGD--DGLLIS  442
             R  CRAA AV+P +E EL+  +A A      KMK ATRYSHSIPKLACP     +GL+IS
Sbjct  103   RSTCRAAAAVFPASEDELVRAVAAAAAASGTKMKVATRYSHSIPKLACPGNGTGEGLVIS  162

Query  443   TKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHG  622
             T+ L+R + V+A++  +TVESGV+LRQ+I EAAKAGLALPY+PYWWGLTVGG++GTG+HG
Sbjct  163   TRRLDRVVSVDAATGHVTVESGVTLRQLIAEAAKAGLALPYAPYWWGLTVGGMLGTGAHG  222

Query  623   SSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTF  802
             SSLWG GS+VH++V+ +RIVTPA   EGYA +R L  GN D+ AA+VSLGVLG ISQVT 
Sbjct  223   SSLWGNGSAVHEYVVGMRIVTPAPAAEGYAKVRVLTAGNPDLDAAKVSLGVLGAISQVTL  282

Query  803   KLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGN  982
              LQP+FKRS++F  ++D DL ++  KFG+QHEFAD+ W P     VYR+DDR+    SG 
Sbjct  283   ALQPLFKRSVTFTERDDDDLAEQVAKFGYQHEFADISWFPGHGRAVYRIDDRLPLAASGE  342

Query  983   GLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT-NDGV  1159
             G  DF G RA  T  + A R  E+  E  G+   KC    + +  +     YGL    G 
Sbjct  343   GAMDFIGFRATPTVVIQASRLAEDLFERAGNGSGKCLTSRVTHAALS-VAGYGLQRRSGG  401

Query  1160  KFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFI  1330
              F+GYPV+G Q+ MQ+SG C+    + L   CPWDPRV  G FFHQTTFS+ L +  +F+
Sbjct  402   LFTGYPVVGPQHRMQASGGCVTGPENALLTACPWDPRVPAGTFFHQTTFSLPLRRAAAFV  461

Query  1331  EDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE-------DSIDFDITYYRSKD  1489
              +V++L DLEP++LC + LYDGILMRYVKASTA+LGK         D +DFDITYYRS+D
Sbjct  462   TEVRRLRDLEPQALCGVELYDGILMRYVKASTAHLGKPAPRGEPSGDMVDFDITYYRSRD  521

Query  1490  PMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLG  1669
             P   RL+ED+LEEIEQM +FKYG LPHWGKNRN+AF GA RKY     FL+VK  +DP G
Sbjct  522   PGRARLFEDVLEEIEQMGIFKYGGLPHWGKNRNLAFVGAARKYPGLPHFLRVKDAYDPDG  581

Query  1670  LFSSEWSDQILGLKTGLSIVKD--GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LFSS+WSD +LG+  G S   D  GCALEG+C+CS+D HCAP +GY CR GKVYKDA+VC
Sbjct  582   LFSSDWSDTMLGIG-GRSPTTDAPGCALEGMCVCSRDEHCAPEQGYVCRPGKVYKDARVC  640

Query  1844  VKIN  1855
              +++
Sbjct  641   TRVS  644



>gb|ACF84587.1| unknown [Zea mays]
Length=596

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/574 (55%), Positives = 404/574 (70%), Gaps = 19/574 (3%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnS-YGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK-  358
             +S P +P++C+          +S YG FPDR  CRAA AV+P +E EL+  +A A     
Sbjct  24    ASPPPEPVQCSSGGGTANCTVSSAYGVFPDRSTCRAAAAVFPASEDELVRAVAAAAAASG  83

Query  359   RKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIE  532
              KMK ATRYSHSIPKLACP     +GL+IST+ L+R + V+A++  +TVESGV+LRQ+I 
Sbjct  84    TKMKVATRYSHSIPKLACPGNGTGEGLVISTRRLDRVVSVDAATGHVTVESGVTLRQLIA  143

Query  533   EAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYA  712
             EAAKAGLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VH++V+ +RIVTPA   EGYA
Sbjct  144   EAAKAGLALPYAPYWWGLTVGGMLGTGAHGSSLWGNGSAVHEYVVGMRIVTPAPAAEGYA  203

Query  713   TIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQ  892
              +R L  GN D+ AA+VSLGVLG ISQVT  LQP+FKRS++F  ++D DL ++  KFG+Q
Sbjct  204   KVRVLTAGNPDLDAAKVSLGVLGAISQVTLALQPLFKRSVTFTERDDDDLAEQVAKFGYQ  263

Query  893   HEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIG  1072
             HEFAD+ W P     VYR+DDR+    SG G  DF G RA  T  + A R  E+  E  G
Sbjct  264   HEFADISWFPGHGRAVYRIDDRLPLAASGEGAMDFIGFRATPTVVIQASRLAEDLFERAG  323

Query  1073  DADEKCSNQWLINVWMVWFLSYGLT-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--  1243
             +   KC    + +  +     YGL    G  F+GYPV+G Q+ MQ+SG C+    + L  
Sbjct  324   NGSGKCLTSRVTHAALS-VAGYGLQRRSGGLFTGYPVVGPQHRMQASGGCVTGPENALLT  382

Query  1244  TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
              CPWDPRV  G FFHQTTFS+ L +  +F+ +V++L DLEP++LC + LYDGILMRYVKA
Sbjct  383   ACPWDPRVPAGTFFHQTTFSLPLRRAAAFVTEVRRLRDLEPQALCGVELYDGILMRYVKA  442

Query  1421  STAYLGKQE-------DSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGK  1579
             STA+LGK         D +DFDITYYRS+DP   RL+ED+LEEIEQM +FKYG LPHWGK
Sbjct  443   STAHLGKPAPRGEPSGDMVDFDITYYRSRDPGRARLFEDVLEEIEQMGIFKYGGLPHWGK  502

Query  1580  NRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD--GCALEG  1753
             NRN+AF GA RKY     FL+VK  +DP GLFSS+WSD +LG+  G S   D  GCALEG
Sbjct  503   NRNLAFVGAARKYPGLPHFLRVKDAYDPDGLFSSDWSDTMLGIG-GRSPTTDAPGCALEG  561

Query  1754  LCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +C+CS+D HCAP +GY CR GKVYKDA+VC +++
Sbjct  562   MCVCSRDEHCAPEQGYVCRPGKVYKDARVCTRVS  595



>ref|XP_008678317.1| PREDICTED: L-gulonolactone oxidase-like [Zea mays]
 gb|AFW61387.1| hypothetical protein ZEAMMB73_581123 [Zea mays]
Length=598

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/558 (54%), Positives = 402/558 (72%), Gaps = 4/558 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              G S P +P+ C    +     + +YG+FPDR VCRAA A +P+TE EL++ +A A   +
Sbjct  31    TGGSPPPEPVSCARGTSDCTVTS-TYGSFPDRAVCRAANATFPRTEKELVAAVAAAAASR  89

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RK+K AT +SHS PKLACP G DG +IST+ LNRT+ V+A+   +TVESG+ LR ++  A
Sbjct  90    RKVKVATSHSHSFPKLACPGGRDGTIISTERLNRTVRVDAARRLLTVESGMLLRDLVRAA  149

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A AGLALP+SPYW+GLTVGGL+ TG+HGSSLWG GS+VH++V+ +RIVTPA   +G+A +
Sbjct  150   ADAGLALPHSPYWYGLTVGGLLATGAHGSSLWGKGSAVHEYVVALRIVTPAPASQGFAVV  209

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L  G+ D+ AA+VSLGVLGVISQVTF+LQP FKRS++FV ++D+D+ ++ + +G  HE
Sbjct  210   RELVAGDPDLDAAKVSLGVLGVISQVTFELQPQFKRSVTFVTRDDKDMAEKLSVWGGLHE  269

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F D+ WLPR    +YR DDRV  +T GNGL ++ G RA  T  L   R+ EE  E  G  
Sbjct  270   FGDVSWLPRQGKAIYREDDRVDVSTPGNGLNNYIGFRAQPTLGLLTARKAEERLEENGTD  329

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C    L         +YG TNDG  F+GYPV+G+Q+ +Q+SGTC++  +D L   C 
Sbjct  330   VARCLAARLPAA-TFELQAYGFTNDGFFFTGYPVVGFQHRIQASGTCINGADDGLLSACT  388

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WD RV G FF+Q+ FS+++ KV +F+ D+Q+L DL P++ C +    G+LMRYV+AS+AY
Sbjct  389   WDSRVRGPFFYQSGFSVAMPKVPAFVADMQRLRDLNPRAFCGMDAKMGVLMRYVRASSAY  448

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGK EDS+DFD+TYYRS D   PR + D+ +E+EQMA+ KYGALPHWGKNRN AF G I 
Sbjct  449   LGKAEDSLDFDVTYYRSYDEGTPRKHADVFDELEQMALRKYGALPHWGKNRNFAFDGVIA  508

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             +Y +A  FL+VK ++DP G+FSSEWSDQ+LG++   ++V  GCA+EGLC+CS D HCAP 
Sbjct  509   RYPAAARFLEVKDRYDPDGIFSSEWSDQVLGIRGSPNVVGPGCAIEGLCVCSDDLHCAPE  568

Query  1793  KGYFCRAGKVYKDAKVCV  1846
             +GYFCR GKVY DA+VC 
Sbjct  569   QGYFCRPGKVYTDARVCA  586



>ref|XP_006646815.1| PREDICTED: uncharacterized protein LOC102715368 [Oryza brachyantha]
Length=598

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/583 (53%), Positives = 403/583 (69%), Gaps = 13/583 (2%)
 Frame = +2

Query  137   NILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTE  316
              +L+   V   +   G S P DP++C    T       +YG FPDR  C AA A YP +E
Sbjct  14    GLLVAAVVLRCLPPAGGSPPPDPVQCASGTTDCTVTN-AYGVFPDRSTCCAAAAAYPASE  72

Query  317   AELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMT  490
              ELL ++AGA   + KMK ATRY HS+PKLACP G DG  L+IST  LNR + V+A  M 
Sbjct  73    KELLRVVAGAAASRTKMKVATRYGHSVPKLACPGGGDGHGLVISTNALNRVVAVDAKRMV  132

Query  491   MTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIH  670
             +TVESGV L Q+I+ AA+AGLALP+SPYW G+TVGGL+ TG+HGSS+WG GS+VH++V+ 
Sbjct  133   ITVESGVMLAQLIDAAAEAGLALPHSPYWLGVTVGGLLSTGAHGSSVWGKGSAVHEYVVG  192

Query  671   IRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             +RIVTPA   EGYA +R L  G+ ++ AA+VSLGVLGVISQVT  LQPMFKRS++F  ++
Sbjct  193   MRIVTPAPASEGYAKVRVLNAGDPELDAAKVSLGVLGVISQVTLALQPMFKRSVAFRQRD  252

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D DL +    F  +HEFAD+ W P     VYR+DDRV  +T G+G++DF G R+     +
Sbjct  253   DGDLAERVAAFAGEHEFADVLWYPAHGKAVYRIDDRVPNDTIGDGVYDFIGFRSTPALAI  312

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDG---VKFSGYPVIGYQNHM  1201
              A R  E+  E+ G+A  KC         ++   +YGLT  G       G PV+GYQN +
Sbjct  313   QANRLAEDALEATGNAAGKCLTASATKT-ILAARNYGLTRHGGLLAPLPGTPVVGYQNRI  371

Query  1202  QSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSL  1372
             Q+SG+CL   +D L   CPWDPRV +G F+ Q  FS+ +++  +FI DVQ+L DL P +L
Sbjct  372   QASGSCLSGADDALLTACPWDPRVEHGTFYFQAGFSVPMSRAAAFIRDVQRLRDLNPAAL  431

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             C + LYDG+LMRYV+ASTAYLGK EDS+DFD+TYYRS+DP  PRL  D +EE+ QMA+ K
Sbjct  432   CGVELYDGVLMRYVRASTAYLGKTEDSVDFDMTYYRSRDPAAPRLDGDAVEEVVQMALRK  491

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSA--GEFLKVKKKFDPLGLFSSEWSDQILGLKTG-LS  1723
             YG LPHWGKN+N AF+GA+ KY  A     ++ K   DP GLFSS WSD++LG+  G +S
Sbjct  492   YGGLPHWGKNQNAAFEGAVAKYGGARGAAVMRGKGGDDPDGLFSSGWSDRVLGVAGGAVS  551

Query  1724  IVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +V+DGCALEGLC+CS+D HCAP KGY CR G+VY+DA+VC ++
Sbjct  552   VVRDGCALEGLCVCSKDAHCAPEKGYLCRRGRVYRDARVCRRV  594



>emb|CDM86624.1| unnamed protein product [Triticum aestivum]
Length=594

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/570 (55%), Positives = 401/570 (70%), Gaps = 15/570 (3%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnS-YGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKR  361
             +S P DP++C+  +       +S YG FPDR  CRA+  VYP +E EL+  +A AT  K 
Sbjct  26    ASPPPDPVQCSSGDGKADCTVSSAYGVFPDRSTCRASAVVYPSSEEELVCAVANATASKT  85

Query  362   KMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KMK  TR+SHS+PKLACP   DG  L IST++LNR + V+A+ M MTVESGV+LR++I  
Sbjct  86    KMKVTTRFSHSMPKLACPGAGDGRGLAISTRWLNRVVGVDAARMEMTVESGVTLRELIAA  145

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             AA AGLALPYSPYWWGLTVGG++GTG+HGSSLWG GS+VH++++ +RIVTPA   +GYAT
Sbjct  146   AADAGLALPYSPYWWGLTVGGMLGTGAHGSSLWGKGSAVHEYIVGMRIVTPAPATDGYAT  205

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             +R L   + ++ AA+VSLGVLGVISQVT  LQP+FKRS +F+ ++D DL +   +FG++H
Sbjct  206   VRVLTSADPEMDAAKVSLGVLGVISQVTLALQPLFKRSTTFIERDDDDLAERVPEFGYEH  265

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EFAD+ W P     VYR DDR+  N SG G+FDF G R   T  + A R  EE  E  G+
Sbjct  266   EFADIAWYPGLGRAVYRKDDRLPMNASGEGVFDFIGFRPTSTILIRANRLVEELSEQEGN  325

Query  1076  ADEKCSNQWLINVWMVWFLSYGLT-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--T  1246
              + KC    +I   +     YGL    G  F+GYPV+G Q+ MQ+SG CL +  D L  T
Sbjct  326   GNSKCLTSRVIRTTLS-AAGYGLARRSGWPFTGYPVVGRQDRMQASGGCLTAPEDGLRTT  384

Query  1247  CPWDPRVNGL-FFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAS  1423
             CPWDPRV    FFHQT FS+ ++  ++FI++V++L D+ P SLC + LY+GILMRYVK+S
Sbjct  385   CPWDPRVRVTGFFHQTAFSMPVSHARAFIKEVRRLHDINPGSLCGIDLYNGILMRYVKSS  444

Query  1424  TAYLGK------QEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             TAYLGK        D ++FD+TYYRS+DP   RLYED+LEEIEQM +FKYG LPHWGKNR
Sbjct  445   TAYLGKSAVRGESADMVEFDMTYYRSRDPRRARLYEDVLEEIEQMGVFKYGGLPHWGKNR  504

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSI-VKDGCALEGLCI  1762
             NVAF GA RKY    +FL VK  +DP GLFSS+WSD +LG+       +  GCALEG+C+
Sbjct  505   NVAFVGASRKYPKMRDFLLVKDAYDPDGLFSSDWSDMMLGIGGDTPTNIAPGCALEGMCV  564

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             CSQD HCAP +GY CR G+VY +A+VC K+
Sbjct  565   CSQDVHCAPEQGYICRPGRVYMNARVCTKV  594



>ref|XP_010676589.1| PREDICTED: L-gulonolactone oxidase-like [Beta vulgaris subsp. 
vulgaris]
Length=603

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/575 (53%), Positives = 410/575 (71%), Gaps = 9/575 (2%)
 Frame = +2

Query  140   ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             IL++ ++ +    V  + PE+PIKC+  N+        YG+FPDR +CRAA  VYP+ E 
Sbjct  21    ILVSYFILYWSDVVTCNPPEEPIKCSSGNSDCTITN-GYGSFPDRSICRAANVVYPENED  79

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             +L+S +  AT  KRK+K AT++ HS PKL CP+G+DGLLISTK LN+ + VN +  TMTV
Sbjct  80    QLISYVKDATTNKRKIKVATKHGHSYPKLVCPDGEDGLLISTKNLNKIINVNMTEETMTV  139

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESGV+L+Q+I+EAAK  LAL  SPYW G+TVGG++GTG+HGSSLWG GS+VHD V+ ++I
Sbjct  140   ESGVTLQQLIDEAAKVNLALTSSPYWAGVTVGGMLGTGAHGSSLWGRGSAVHDFVVGLKI  199

Query  680   VTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRD  859
             V+P   ++ Y  +RTL  G+ D+ AA+VSLGVLGVISQVTFKL+P+FKRSI+++ ++D D
Sbjct  200   VSPGNPEDDYVKVRTLTVGDEDLDAAKVSLGVLGVISQVTFKLEPLFKRSITYITRDDGD  259

Query  860   LGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNAL  1039
             L  +A +FG QHEFAD+ WLP     +YRVDDRV   T G+G++D+   R+   + L + 
Sbjct  260   LEVQALEFGLQHEFADITWLPSQHKAIYRVDDRVPATTLGDGVYDYILFRSAPQELLEST  319

Query  1040  REKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTC  1219
             R+ ++ +ES G A  KC+    I       +++GLTNDGV+F+GYPVIGYQN MQ SGTC
Sbjct  320   RKIDDFEESNGCAGLKCNRTKAITA-NYNEMAFGLTNDGVQFNGYPVIGYQNKMQCSGTC  378

Query  1220  LDSLNDNLT---CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             L S  +N +   C WDPR+ G+F      S+ + KV +FI+D++K   LEP SLC +  Y
Sbjct  379   LVSHPNNASTSYCAWDPRIKGIFVDDDASSVPMNKVNNFIQDIKKFFSLEPTSLCGVEPY  438

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPH  1570
              GILMRYVKAS+AYLGK ED I FDI +YR+++    RL+ DI +EIEQ+  FKYG +PH
Sbjct  439   FGILMRYVKASSAYLGKDEDGIQFDIVHYRAREASGHRLHSDIYDEIEQITAFKYGGMPH  498

Query  1571  WGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD--GCA  1744
             WGKNRNVAF+G I KYK  G+FL+VK+++DPL LFSS+W+  ILGLK GLS +    GCA
Sbjct  499   WGKNRNVAFEGVINKYKDGGKFLRVKERYDPLELFSSDWTKYILGLKEGLSTINKQVGCA  558

Query  1745  LEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
              EGLCICS +  C   +GY C  G+VY +AKVC +
Sbjct  559   REGLCICSTNKDCG--RGYTCENGRVYMEAKVCRR  591



>gb|KFK37440.1| hypothetical protein AALP_AA4G257200 [Arabis alpina]
Length=1758

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/576 (56%), Positives = 403/576 (70%), Gaps = 33/576 (6%)
 Frame = +2

Query  134   INILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKT  313
             I +++      L+FT  S+ PEDP+KC   NT       + G FPDR +CRAA   +P T
Sbjct  1207  IFLVLHCIFTLLVFTAVSTPPEDPVKCVSGNTDCTVTNAA-GIFPDRSICRAANVAHPTT  1265

Query  314   EAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTM  493
             EAEL+SI+A ATK  RKM+  TRY+HS  KL C +G DGLLIST +LN  +  +  +MT+
Sbjct  1266  EAELVSIVAAATKAGRKMRVTTRYAHSYTKLVCTDGTDGLLISTNFLNHMVRSDVKAMTL  1325

Query  494   TVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHI  673
             TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  I
Sbjct  1326  TVESGVTLRQLITEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEI  1385

Query  674   RIVTPATEKEGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
             R+V+P +  +G+A +R L +    S+  AA+VSLGVLGVISQVTFKLQPMFKRSI++ ++
Sbjct  1386  RMVSPGSVNDGFAKVRVLSETTTPSEFNAAKVSLGVLGVISQVTFKLQPMFKRSITYFME  1445

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             +D D G +A  FG +HEFAD  W P    VVYR DDRV+ NT GNGL+DF   R+  +  
Sbjct  1446  SDSDFGDQAMDFGKKHEFADFVWYPSQGKVVYRKDDRVAVNTPGNGLYDFLPFRSQLSTI  1505

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
             L   R  EE QE   DA+ KC    L +   ++  SYGLTN+G+ F+GYPVIGYQN M S
Sbjct  1506  LAIRRTSEEMQEKFEDANGKCVAAKLASS-ALFATSYGLTNNGIIFTGYPVIGYQNRMMS  1564

Query  1208  SGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             SG+C+DS  D L   C WD                             LV ++ K+LC +
Sbjct  1565  SGSCVDSFQDGLITACGWD---------------------------SPLVKIDSKALCGI  1597

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
              LY G LMRYV +S+AYLG+  +++ FD+TYYRSKDP+ PRLYED LEEIEQ+A+FKY  
Sbjct  1598  DLYIGFLMRYVTSSSAYLGRDTEALSFDMTYYRSKDPLAPRLYEDFLEEIEQIALFKYYG  1657

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGC  1741
             LPHW KNRN+AF G IRKYK+A  FLK+++ +DP GLFSSEW+DQILGLK   +I+KDGC
Sbjct  1658  LPHWSKNRNLAFDGVIRKYKNASAFLKIRESYDPTGLFSSEWTDQILGLKGNATILKDGC  1717

Query  1742  ALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             ALEGLCICS+D HCAP KGY CR GKVYK+A+VC +
Sbjct  1718  ALEGLCICSEDAHCAPTKGYLCRPGKVYKEARVCTR  1753


 Score =   531 bits (1369),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 265/451 (59%), Positives = 331/451 (73%), Gaps = 10/451 (2%)
 Frame = +2

Query  272   RGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKY  451
             R +C+AA   YP TEAEL+SI+A ATK  RKM+  TRYSHS+ KL C +G DGLLIST +
Sbjct  755   RSICQAANVAYPATEAELVSIVAAATKVGRKMRVTTRYSHSVTKLVCTDGRDGLLISTNF  814

Query  452   LNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSL  631
             LN T+  +A +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWG+TVGG+MGTG+HGSSL
Sbjct  815   LNHTVRSDAKAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGITVGGMMGTGAHGSSL  874

Query  632   WGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFK  805
             WG GS+V+D+V  IR+V+P +  +G+A +R L +    S+  AA+VSLGVLGVI QVTFK
Sbjct  875   WGKGSAVYDYVTEIRMVSPGSVNDGFAKVRVLSEATTPSEFHAAKVSLGVLGVIYQVTFK  934

Query  806   LQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNG  985
             LQPMFKRSI++V+KND D G +A  FG +HEFAD  WLP    VVYR DDRV+ NTSGNG
Sbjct  935   LQPMFKRSITYVMKNDSDFGDQAVTFGKKHEFADFIWLPSQGKVVYRKDDRVAVNTSGNG  994

Query  986   LFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKF  1165
             L+DF   R+         R  EE QE   DA+ KC    L +   ++  SYGLTNDG+ F
Sbjct  995   LYDFLPFRSQLAAISAIRRTSEETQEKFEDANGKCVAAKLTSS-ALFATSYGLTNDGIIF  1053

Query  1166  SGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDV  1339
             +GYPVIGYQN M SSG+CLDSL D L   C  D R+ G +FH+T  S+ LT +KSFI+DV
Sbjct  1054  TGYPVIGYQNRMMSSGSCLDSLQDGLITACASDSRIKGEYFHETAVSVPLTHIKSFIDDV  1113

Query  1340  QKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDI  1519
             + LV +E K+LC + LY G LMRYV +S+AYLGK  +++ FD+TYYRSKDP+ PRLYED 
Sbjct  1114  KALVKMESKALCGIDLYIGFLMRYVTSSSAYLGKDTEALSFDMTYYRSKDPLAPRLYEDF  1173

Query  1520  LEEIEQMAMFKYGALPHWGK-----NRNVAF  1597
              EEIEQ+A+FKY  LPHWG      ++N AF
Sbjct  1174  FEEIEQIALFKYNGLPHWGSFPSYGSQNAAF  1204


 Score =   406 bits (1044),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 214/375 (57%), Positives = 268/375 (71%), Gaps = 5/375 (1%)
 Frame = +2

Query  140   ILITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTE  316
             IL+ ++  F L+ T  S+ PEDP+KC   NT       S G FPD   CRAA A YP TE
Sbjct  382   ILLGLHCIFTLVHTTLSTPPEDPVKCVSGNTDCTVTN-SLGAFPDWSTCRAANAAYPTTE  440

Query  317   AELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMT  496
              EL+SI+  ATK  RKM+  TRYSHSIPKL C +G +GLLIST +LNRT+  N   MT+T
Sbjct  441   DELVSIVGAATKGGRKMRVTTRYSHSIPKLVCTDGREGLLISTNFLNRTVRSNVKDMTLT  500

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
             VESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR
Sbjct  501   VESGVTLRQLIVEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIR  560

Query  677   IVTPATEKEGYATIRTLKQGN--SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             +V+P +  +G+A +R L +    S+  AA+VSLGVLGVISQVTFKLQPMFKRS+++ +++
Sbjct  561   MVSPGSVNDGFAKVRVLSETTSPSEFNAAKVSLGVLGVISQVTFKLQPMFKRSLTYTMRH  620

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D DL  +A  FG +HEFAD  WLP    VVYR DDRV+ NTSGNGL+DF G R+  +  +
Sbjct  621   DLDLEDQAETFGKKHEFADFVWLPSQGKVVYRRDDRVAVNTSGNGLYDFLGFRSQPSAAV  680

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
               +R  EE QE++ DA  KC    L+    ++  SYGLTN+G+ F+GYPVIG QN M SS
Sbjct  681   AVVRSSEETQETLKDATGKCVEAALVTS-TLFASSYGLTNNGITFTGYPVIGSQNRMMSS  739

Query  1211  GTCLDSLNDNLTCPW  1255
             G+CLDSL D L   +
Sbjct  740   GSCLDSLQDGLITAY  754


 Score =   395 bits (1016),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 209/360 (58%), Positives = 263/360 (73%), Gaps = 5/360 (1%)
 Frame = +2

Query  140   ILITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTE  316
             IL  ++  F L+ T  SS P+DP+KC   NT       SYGTFPDR  CRAA   YP TE
Sbjct  21    ILFGLHCIFTLVHTTLSSPPDDPVKCVSGNTNCTVTN-SYGTFPDRSTCRAANVAYPTTE  79

Query  317   AELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMT  496
             AEL+SI+  ATK  RKM+  TRYSHSI KLAC +G DGL ISTK+LN T++ +A +MT+T
Sbjct  80    AELVSIVTAATKAGRKMRVTTRYSHSITKLACTDGTDGLFISTKFLNHTVQADAIAMTVT  139

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
             VESGV+LRQ+I EAAK GLALPYSPYWWGLTVGG+MGTG+HGSSLWG GS+VHD+V  IR
Sbjct  140   VESGVTLRQLIAEAAKVGLALPYSPYWWGLTVGGMMGTGAHGSSLWGKGSAVHDYVTEIR  199

Query  677   IVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKN  850
             +V+P +  EG+A +R L +  +  +  AA+VSLGVLGVISQVTFKLQPMFKRS+++ ++N
Sbjct  200   MVSPGSVNEGFAKVRVLSETTTPNEFNAAKVSLGVLGVISQVTFKLQPMFKRSLTYTMRN  259

Query  851   DRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCL  1030
             D D   +A  FG +HEFAD+ WLP    VVYR DDRV+ NTSGNGL+DF   R+  +  +
Sbjct  260   DSDFADQALTFGKKHEFADLLWLPSQGKVVYRRDDRVAVNTSGNGLYDFLPFRSQLSVGI  319

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
               +R  EE QE+  DA  KC    LI+   ++  SYGLTN+GV F+GYPVIG+QNH +++
Sbjct  320   AIIRSLEETQETFRDAIGKCVAATLISS-TLFATSYGLTNNGVIFTGYPVIGFQNHQKAA  378



>ref|XP_003559677.1| PREDICTED: uncharacterized protein LOC100839560 [Brachypodium 
distachyon]
Length=595

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/576 (54%), Positives = 406/576 (70%), Gaps = 25/576 (4%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGV-CRAAKAVYPKTEAELLSIIAGATKQ  355
             V +S P DP++C  +     +   +YG FPDR   CRAA   YP TEAEL+  +A AT  
Sbjct  27    VSASPPPDPVQCGTSGCTVSS---AYGVFPDRSTTCRAAAVAYPSTEAELVRAVANATAT  83

Query  356   KRKMKAATRYSHSIPKLACPEGD---DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             K KMK  TRYSHS+P LACP GD   +G+ IST++L+R + V+A+   +TVESG++LR++
Sbjct  84    KTKMKVTTRYSHSMPPLACP-GDGNGNGIAISTRWLDRVVSVDAARTEITVESGITLREL  142

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             +  AA AG+ALPY+PYWWGLTVGG++GTG+HGSSLWG G +VH++V+ +RIVTPA   +G
Sbjct  143   VAAAAGAGMALPYAPYWWGLTVGGMLGTGAHGSSLWGRGGAVHEYVVGMRIVTPAPANQG  202

Query  707   YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFG  886
             YA +R L  G+ D+ AA+VSLGVLGVISQVT KLQP+FKRS +F  ++D DL  + TKFG
Sbjct  203   YARVRVLTAGDPDLDAAKVSLGVLGVISQVTLKLQPLFKRSTTFAERDDSDLADQVTKFG  262

Query  887   FQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQES  1066
             ++HEFAD+ W P     VYR+DDR+  N SG+G+ DF G RA  T  + A R  EE  E 
Sbjct  263   YEHEFADIAWYPGLGRAVYRMDDRMPMNASGDGVLDFIGFRATSTLLIRANRLAEELSER  322

Query  1067  IGDADEKCSNQWLINVWMVWFLSYGLTND-GVKFSGYPVIGYQNHMQSSGTCLDSLNDNL  1243
              G+   KC    + +  +     YGL    G+ F+GYPV+G Q+ MQ+SG CL    D+L
Sbjct  323   AGNG--KCLASRVTHAALS-AAGYGLARKAGLLFTGYPVVGPQHRMQASGGCLSGPEDSL  379

Query  1244  --TCPWDPRVNGL-FFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
                C WDPRV G  FFHQTTFS+ +++  +F+ +VQ+L DL PKSLC + LYDGILMRYV
Sbjct  380   QTACAWDPRVRGASFFHQTTFSLPVSRAGAFVAEVQRLRDLNPKSLCGVELYDGILMRYV  439

Query  1415  KASTAYLGK-------QEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHW  1573
             K+S+A+LGK         D +DFD+TYYRS+DP   R++ED++EEIEQM +FKYG LPHW
Sbjct  440   KSSSAHLGKPPARGEISTDMVDFDMTYYRSRDPSKARVHEDVMEEIEQMGLFKYGGLPHW  499

Query  1574  GKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL-KTGLSIVKD--GCA  1744
             GKNRN+AF  A  KY     FL+VK  +DP GLFSS+WSD +LG+     ++ KD  GCA
Sbjct  500   GKNRNLAFADAAGKYPGMRRFLRVKDAYDPDGLFSSDWSDMMLGIGGVAAALTKDAPGCA  559

Query  1745  LEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             LEG+C+CSQD HCAP++GY CR GK+YKDA+VC K+
Sbjct  560   LEGMCVCSQDAHCAPDQGYLCRPGKIYKDARVCTKV  595



>ref|NP_001045739.1| Os02g0124600 [Oryza sativa Japonica Group]
 dbj|BAF07653.1| Os02g0124600 [Oryza sativa Japonica Group]
 gb|EAZ21569.1| hypothetical protein OsJ_05197 [Oryza sativa Japonica Group]
Length=599

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/594 (53%), Positives = 417/594 (70%), Gaps = 15/594 (3%)
 Frame = +2

Query  110   TISMAKMSIN-ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCR  286
             ++  A+ +++ IL+ + V   +   G+S P DP+ C            +Y  FPDR  CR
Sbjct  4     SVVTARRAVHGILVAVVVVQRLLAAGASPPADPVHCASGTARCTVTN-AYAAFPDRSTCR  62

Query  287   AAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNR  460
             AA A YP +E ELL ++A A     KMKAATRY HS+PKL+CP   DG  L IST  LNR
Sbjct  63    AAAAAYPASEEELLRVVAAAAASGTKMKAATRYGHSVPKLSCPGAGDGRGLAISTSALNR  122

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
              + V+A+ M +TVESGV+L ++I+ AA AGLALP+SPYW G+TVGGL+ TG+HGSS+WG 
Sbjct  123   VVAVDAAGMAITVESGVTLAELIDAAAGAGLALPHSPYWLGVTVGGLLSTGAHGSSVWGN  182

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMF  820
             GS+VH++V  +RIVTPA  +EGYA +R L  G+ ++ AA+VSLGVLGVISQVT KLQPMF
Sbjct  183   GSAVHEYVNGMRIVTPAPAREGYAKVRVLAAGDPELDAAKVSLGVLGVISQVTLKLQPMF  242

Query  821   KRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFF  1000
             KRS++F    D DL +    F  +HEFAD+ W P     VYR+DDRV +NT G+G++DF 
Sbjct  243   KRSVAFQHCGDGDLAERVVAFAGEHEFADILWYPGHGKAVYRIDDRVPSNTPGDGVYDFV  302

Query  1001  GLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYP-  1177
             G RA  T  + A R  E+  E+ G+A  KC      N  ++   +YGLT +G     +P 
Sbjct  303   GFRATPTLAIQAKRLVEDGLEATGNAAGKCLAASTTNS-ILAARNYGLTRNGQLLGAFPG  361

Query  1178  --VIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQ  1342
               V+GYQN +QSSG+CL   +D L   CPWDPRV +G FF Q+  S+ L++  +FI DVQ
Sbjct  362   TAVVGYQNRIQSSGSCLAGADDGLLTACPWDPRVEHGTFFFQSGISVPLSRAAAFIRDVQ  421

Query  1343  KLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDIL  1522
             +L DL P +LC + LYDG+LMRYV+AS A+LGK EDS+DFD+TYYRS+DP  P L+ED++
Sbjct  422   RLRDLNPDALCGVELYDGVLMRYVRASAAHLGKPEDSVDFDLTYYRSRDPATPLLHEDVV  481

Query  1523  EEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY--KSAGEFLKVKKKFDPLGLFSSEWSDQ  1696
             EE+EQMA+ KYG +PHWGKN+N AF+GA  KY    A  F++VK+ +DP GLFSSEWSD+
Sbjct  482   EEVEQMALRKYGGVPHWGKNQNAAFEGAAAKYGGARAAAFMRVKRAYDPEGLFSSEWSDK  541

Query  1697  ILGL--KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +LG+    G+S+V+DGCALEGLC+CS+D HC+P KGY CR G+VYK+A+VC ++
Sbjct  542   VLGVAGAGGVSVVRDGCALEGLCVCSEDAHCSPEKGYLCRPGRVYKEARVCRRV  595



>ref|XP_004973024.1| PREDICTED: L-gulonolactone oxidase-like [Setaria italica]
Length=584

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/557 (54%), Positives = 400/557 (72%), Gaps = 4/557 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              GSS P DP+ C    +     + +YG+FPDR +CRAA A +P+TE EL++ +A A   K
Sbjct  19    AGSSPPPDPVSCARGTSDCTVTS-TYGSFPDRTICRAANATFPRTEQELVAAVAAAAAAK  77

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RK+K AT +SHS PKLACP G DG +IST+ LNRT+ V+ +   +TVESG+ LR +I+ A
Sbjct  78    RKVKVATSHSHSFPKLACPGGRDGTIISTERLNRTVSVDKARRLLTVESGMLLRDLIKVA  137

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A AGLALP+SPYW+GLTVGG++ TG+HGSSLWG GS+VH++V+ +RIVTPA   +G+A +
Sbjct  138   AGAGLALPHSPYWYGLTVGGMLATGAHGSSLWGKGSAVHEYVVGLRIVTPAPASQGFAVV  197

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L  G+ D+ AA+VSLGVLGVISQVT +LQP FKRS++FV ++D+D+  +   +G  HE
Sbjct  198   RELAAGDPDLDAAKVSLGVLGVISQVTLELQPQFKRSVTFVTRDDKDMAAKLAAWGGLHE  257

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F D+ WLPR    +YR D+RV  +T GNGL ++ G RA  T  L   R  EE  E  G  
Sbjct  258   FGDVSWLPRQGKAIYREDNRVDVSTPGNGLNNYIGFRAQPTLGLLTARAAEERLEENGTD  317

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C    L         +YG TNDGV F+GYPV+G+Q+ +Q+SGTC+D  +D L   C 
Sbjct  318   IARCLAARLPAA-TFELQAYGFTNDGVFFTGYPVVGFQHRIQASGTCIDGRDDALLSACT  376

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WD R+ G FF+Q+ FS++++KV +F+ DVQ+L DL P++ C +    G+LMRYVKAS+AY
Sbjct  377   WDSRIRGPFFYQSGFSVAVSKVPAFVADVQRLRDLNPRAFCGMDAKMGVLMRYVKASSAY  436

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGK EDS+DFD+TYYRS     PR + D+ +E+EQMA+ KYGA+PHWGKNRN AF GAI 
Sbjct  437   LGKAEDSLDFDVTYYRSYAEGAPRAHADVYDELEQMALRKYGAMPHWGKNRNFAFDGAIA  496

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KY  A EF+KVK ++DP G+FSSEWSDQ+LG+    ++V   CA+EGLC+CS D+HCAP 
Sbjct  497   KYPKAAEFIKVKDRYDPDGIFSSEWSDQVLGINGSPNVVGARCAIEGLCVCSDDSHCAPE  556

Query  1793  KGYFCRAGKVYKDAKVC  1843
             +GYFCR GKVY +A+VC
Sbjct  557   QGYFCRPGKVYTEARVC  573



>dbj|BAJ89636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/573 (53%), Positives = 396/573 (69%), Gaps = 18/573 (3%)
 Frame = +2

Query  185   SSLPEDPIKctinntmncti-tnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKR  361
             +S P DP++C+          + +YG FPDR  CRAA   YP TEAEL+  +A AT  K 
Sbjct  27    ASPPADPVQCSSGGGTADCTFSTAYGVFPDRSTCRAAAVAYPTTEAELVRAVANATAAKT  86

Query  362   KMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KMK  TRY+HS+P LACP   DG  L IST++LNR + V+A+   + VESGV+LR+++  
Sbjct  87    KMKVTTRYAHSMPPLACPGSGDGRGLAISTRWLNRVVAVDAARSEIKVESGVTLRELVAA  146

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             A  AGLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VH++V+ +RIVTPA   EGYA 
Sbjct  147   AGAAGLALPYAPYWWGLTVGGMLGTGAHGSSLWGKGSAVHEYVVGMRIVTPAPAAEGYAK  206

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             +R L   + ++ AA+VSLGVLGV+SQVT  LQP+FKRS ++  ++D DL ++ TKFG+QH
Sbjct  207   VRVLAAADPELDAAKVSLGVLGVVSQVTLALQPLFKRSTTYTERDDNDLAEQVTKFGYQH  266

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EFAD+ W P     VYR+DDR+  N SG+G+ DF G R   +  + A R  EE  E +G+
Sbjct  267   EFADIAWYPGHGRAVYRIDDRLPMNASGDGVLDFIGFRPTSSAVIQANRLAEELSERVGN  326

Query  1076  ADE--KCSNQWLINVWMVWFLSYGLT-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
                  KC    + +  +     YGL    G  F+GYPV+G Q+ MQ+SG CL +  D L 
Sbjct  327   GGSGGKCLTARVTHAALS-VAGYGLARRSGGLFTGYPVVGRQDRMQASGGCLTAPEDALQ  385

Query  1244  -TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
               C WDPRV +  FFHQTTFS+ L++  +F++DVQ+L D+ PK+LC L LYDGIL+RYVK
Sbjct  386   TACAWDPRVRDSSFFHQTTFSLPLSRAGAFVQDVQRLRDVNPKALCGLELYDGILIRYVK  445

Query  1418  ASTAYLGK--------QEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHW  1573
             +STA+LGK         +D +DFD+TYYRS+DP   RL+ED LEE+EQM +FKYG LPHW
Sbjct  446   SSTAHLGKPAAAAAGEPDDMVDFDMTYYRSRDPRRARLHEDFLEEMEQMGLFKYGGLPHW  505

Query  1574  GKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEG  1753
             GKNRN+AF G   KY     FL+VK  +DP GLFSS WSD +LG+    +    GCALEG
Sbjct  506   GKNRNLAFAGVASKYPGMRRFLRVKNAYDPDGLFSSGWSDMMLGVGGAPTRDAPGCALEG  565

Query  1754  LCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +C+CS+D HCAP +GY CR GKVYKDA+VC K+
Sbjct  566   MCVCSRDAHCAPEQGYVCRPGKVYKDARVCTKV  598



>dbj|BAJ94691.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/573 (53%), Positives = 396/573 (69%), Gaps = 18/573 (3%)
 Frame = +2

Query  185   SSLPEDPIKctinntmncti-tnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKR  361
             +S P DP++C+          + +YG FPDR  CRAA   YP TEAEL+  +A AT  K 
Sbjct  27    ASPPADPVQCSSGGGTADCTFSTAYGVFPDRSTCRAAAVAYPTTEAELVRAVANATAAKT  86

Query  362   KMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KMK  TRY+HS+P LACP   DG  L IST++LNR + V+A+   + VESGV+LR+++  
Sbjct  87    KMKVTTRYAHSMPPLACPGSGDGRGLAISTQWLNRVVAVDAARSEIKVESGVTLRELVAA  146

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             A  AGLALPY+PYWWGLTVGG++GTG+HGSSLWG GS+VH++V+ +RIVTPA   EGYA 
Sbjct  147   AGAAGLALPYAPYWWGLTVGGMLGTGAHGSSLWGKGSAVHEYVVGMRIVTPAPAAEGYAK  206

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             +R L   + ++ AA+VSLGVLGV+SQVT  LQP+FKRS ++  ++D DL ++ TKFG+QH
Sbjct  207   VRVLAAADPELDAAKVSLGVLGVVSQVTLALQPLFKRSTTYTERDDNDLAEQVTKFGYQH  266

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EFAD+ W P     VYR+DDR+  N SG+G+ DF G R   +  + A R  EE  E +G+
Sbjct  267   EFADIAWYPGHGRAVYRIDDRLPMNASGDGVLDFIGFRPTSSAVIQANRLAEELSERVGN  326

Query  1076  ADE--KCSNQWLINVWMVWFLSYGLT-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
                  KC    + +  +     YGL    G  F+GYPV+G Q+ MQ+SG CL +  D L 
Sbjct  327   GGSGGKCLTARVTHAALS-VAGYGLARRSGGLFTGYPVVGRQDRMQASGGCLTAPEDALQ  385

Query  1244  -TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
               C WDPRV +  FFHQTTFS+ L++  +F++DVQ+L D+ PK+LC L LYDGIL+RYVK
Sbjct  386   TACAWDPRVRDSSFFHQTTFSLPLSRAGAFVQDVQRLRDVNPKALCGLELYDGILIRYVK  445

Query  1418  ASTAYLGK--------QEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHW  1573
             +STA+LGK         +D +DFD+TYYRS+DP   RL+ED LEE+EQM +FKYG LPHW
Sbjct  446   SSTAHLGKPAAAAAGEPDDMVDFDMTYYRSRDPRRARLHEDFLEEMEQMGLFKYGGLPHW  505

Query  1574  GKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEG  1753
             GKNRN+AF G   KY     FL+VK  +DP GLFSS WSD +LG+    +    GCALEG
Sbjct  506   GKNRNLAFAGVASKYPGMRRFLRVKNAYDPDGLFSSGWSDMMLGVGGAPTRDAPGCALEG  565

Query  1754  LCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +C+CS+D HCAP +GY CR GKVYKDA+VC K+
Sbjct  566   MCVCSRDAHCAPEQGYVCRPGKVYKDARVCTKV  598



>ref|XP_010676977.1| PREDICTED: uncharacterized protein LOC104892687 [Beta vulgaris 
subsp. vulgaris]
Length=605

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/555 (54%), Positives = 396/555 (71%), Gaps = 9/555 (2%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             PE+PIKC+  N+        YG+FPDR +CRAA AVYP+ E EL+S +  AT  KRK+K 
Sbjct  39    PEEPIKCSSGNSDCTITN-GYGSFPDRSICRAANAVYPENEDELISYVKDATMNKRKIKV  97

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             ATR+ HS PKL CP+G+DGLLISTK LN+ + +N +  TMTV SG++L+Q+I+EA K  L
Sbjct  98    ATRHGHSFPKLVCPDGNDGLLISTKNLNKIININMAEETMTVGSGMTLQQLIDEATKVNL  157

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQ  733
             AL  SPYW G+TVGG++GTG+HGSSLWG GS+VHD V+ ++IV+P   ++ Y  +RTL  
Sbjct  158   ALTNSPYWVGVTVGGMLGTGAHGSSLWGRGSAVHDFVVGLKIVSPGNPEDDYVKVRTLTV  217

Query  734   GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMK  913
             G+ D+ AA+VSLGVLGVISQVTFKL+P+FKR IS++ + D DL  +A  FG QHEFAD+ 
Sbjct  218   GDEDLDAAKVSLGVLGVISQVTFKLEPLFKRRISYITRKDDDLEVQALTFGLQHEFADIT  277

Query  914   WLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCS  1093
             WLP     +YRVDDRV T  +G+G++D+   RA   D   ++R+ ++ +ES G    KC 
Sbjct  278   WLPSRFEALYRVDDRVPTTENGDGVYDYALFRAAPKDSFESVRKIDDFEESNGCDTLKCI  337

Query  1094  NQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNG  1273
             +  +I       + +GL NDG++F+GYPVIGYQN MQ SG+CL   N    C WDPR+ G
Sbjct  338   STKIITTGYE-LMGFGLMNDGLQFTGYPVIGYQNKMQCSGSCL--YNAIGYCGWDPRIKG  394

Query  1274  LFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDS  1453
             LF +    S+ + KVK FI+D++KL+ +EP SLC +  Y GIL+RYVKAS+AYLGK ED 
Sbjct  395   LFINNNALSLPMNKVKDFIQDIKKLISIEPTSLCGVDPYFGILLRYVKASSAYLGKDEDG  454

Query  1454  IDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGE  1633
             I FDI +YR+++    RLY DI +EIEQM +FKYG +PHWGKNR++ F+G I KYK  G+
Sbjct  455   IQFDIIHYRAREASDHRLYSDIFDEIEQMMVFKYGGMPHWGKNRDIVFEGVINKYKDGGK  514

Query  1634  FLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD---GCALEGLCICSQDNHCAPNKGYF  1804
             FL+V++++DPL LFSSEW+  ILGLK GLS   D   GCA EGLCICS +N C    GY 
Sbjct  515   FLRVRERYDPLELFSSEWTKYILGLKEGLSTTIDKHVGCAREGLCICSNNNDCG--LGYT  572

Query  1805  CRAGKVYKDAKVCVK  1849
             C  G+VY +AKVC +
Sbjct  573   CENGRVYIEAKVCRR  587



>ref|XP_003571315.1| PREDICTED: uncharacterized protein LOC100846108 [Brachypodium 
distachyon]
Length=589

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/574 (54%), Positives = 411/574 (72%), Gaps = 8/574 (1%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSL-----PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYP  307
             LI ++   L+  + + L     P +P+ CT     +CT+TN+YG+FPDR +CRAA A +P
Sbjct  3     LIGMHKPLLLLIIMAGLASGSPPPEPVACTGRGNTDCTVTNTYGSFPDRTICRAANATFP  62

Query  308   KTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSM  487
              TEAEL++ +A A   KRK+K AT++SHS PKLACP G  G +IST+ LNRT+ V+A+  
Sbjct  63    TTEAELVAAVASAAASKRKVKVATKHSHSFPKLACPGGRSGTIISTERLNRTVSVDAAKG  122

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
              MTVESG+ LR +I+ AA AGLALP+SPYW+G+T+GGL+ TG+HGS LWG GS+VH++V+
Sbjct  123   LMTVESGMVLRDLIKAAAAAGLALPHSPYWYGITIGGLLATGAHGSGLWGKGSAVHEYVV  182

Query  668   HIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
              +RIVTPA   EG+A +R L   + D+ A +VSLGVLGV+SQVT  LQPMFKRS++F  +
Sbjct  183   GMRIVTPAPASEGWAVVRELGVDHPDLDAVKVSLGVLGVVSQVTLALQPMFKRSVTFEKR  242

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             +D D   ++  +G  HEF DM WLPR   V+YR DDR+  +T GNGL D+ G RA  T  
Sbjct  243   DDTDFAAQSAVWGGLHEFGDMAWLPRQGKVIYRKDDRIPVSTPGNGLNDYIGFRANPTLA  302

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
             L   R  EEH E  GD   +C +  +    +    +YG TNDG  F+GYPV+G+QN +Q+
Sbjct  303   LITARATEEHLEKDGDDIARCLSARVPGA-LFELQAYGFTNDGSFFTGYPVVGFQNRIQA  361

Query  1208  SGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             SGTC+ S  D L  +C WDPR+   FF+Q+ FS++L+K  +FI D+QKL DL P++ C L
Sbjct  362   SGTCIGSREDGLLSSCTWDPRIRSPFFYQSGFSVALSKTPAFIADMQKLRDLNPRAFCGL  421

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
                 GIL+RYVKAS+AYLGK EDS+DFD+TYYRS      R + D+++E+EQ+A  KYGA
Sbjct  422   DAKLGILLRYVKASSAYLGKSEDSLDFDVTYYRSYTEGETRAHSDVIDELEQLAFGKYGA  481

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGC  1741
             +PHWGKNRN AF GAI KY  AGEFLKVK ++DP G+FSSEWSDQ+LG+K   ++V  GC
Sbjct  482   VPHWGKNRNFAFTGAITKYPKAGEFLKVKDRYDPDGIFSSEWSDQVLGIKGSPNVVGKGC  541

Query  1742  ALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             A+EGLC+CS D+HCAP KGYFCR G VY+ ++VC
Sbjct  542   AIEGLCVCSDDSHCAPEKGYFCRPGLVYQKSRVC  575



>ref|XP_010695317.1| PREDICTED: uncharacterized protein LOC104907984 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/554 (55%), Positives = 398/554 (72%), Gaps = 6/554 (1%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             PEDPIKC+  N+       SYG FPDR  CRAA AVYP+ E +L+S +  ATK+KRK+K 
Sbjct  43    PEDPIKCSFGNSDCVITN-SYGIFPDRSTCRAANAVYPENEHQLISYVRDATKKKRKIKV  101

Query  374   ATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGL  553
             AT Y HS  KL CP G+DGL+ISTK LN+ L VN +  TMTVESG++L+Q+I+EAAK  L
Sbjct  102   ATIYGHSSTKLVCPNGEDGLIISTKNLNKVLNVNMTEETMTVESGMTLKQLIDEAAKVNL  161

Query  554   ALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQ  733
             ALP SPYWWG+TVGG++GTG+HGSSLWG GS+VHD+V+ +++V+P   ++ Y  +RTL  
Sbjct  162   ALPNSPYWWGVTVGGMLGTGAHGSSLWGRGSAVHDYVVSLKMVSPGEIEDDYCKLRTLSV  221

Query  734   GNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMK  913
             G+ D+ AA+VSLGVLGVISQVT KL+P+FKR+I++V + D DL  +AT FG QHEFA + 
Sbjct  222   GDEDLDAAKVSLGVLGVISQVTLKLEPIFKRNITYVTREDNDLEIQATTFGLQHEFAHIS  281

Query  914   WLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCS  1093
             WLP     +YR+DDRV T T GNG +D    R+     +    + EE +ES G    +C 
Sbjct  282   WLPAQHKAIYRIDDRVPTTTPGNGSYDQLLFRSTPRVAIELAGKTEEIEESNGCNKLRCI  341

Query  1094  NQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLT--CPWDPRV  1267
                  +  + +  ++GLTNDG+ F+GYP+IGYQN MQSSG CL++ +  +   C WDPR+
Sbjct  342   IA-TTSTTLAFENAFGLTNDGISFTGYPIIGYQNKMQSSGGCLNNQSKIVDGYCVWDPRL  400

Query  1268  NGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQE  1447
              G       F++ ++KV SFIED++KLV +EP SLC + +Y GILMRYVKAS+AYLGK +
Sbjct  401   KGPLSWSNGFTLPMSKVSSFIEDIKKLVIIEPTSLCGIEVYFGILMRYVKASSAYLGKDD  460

Query  1448  DSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA  1627
             D IDFDI YYR KD    RL  DI++EIEQ+A+ KYG +PHWGKNRNVAF+G I K+K  
Sbjct  461   DGIDFDIAYYRPKDASGDRLNGDIIDEIEQIAILKYGGVPHWGKNRNVAFEGVINKFKDG  520

Query  1628  GEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFC  1807
              +FL+VK+++D L LFSS+W+DQ+LGLK GLSI + GCA EGLCIC  ++ C     Y+C
Sbjct  521   EKFLRVKERYDSLELFSSDWTDQVLGLKQGLSINRMGCAREGLCICDSNDDCGSE--YYC  578

Query  1808  RAGKVYKDAKVCVK  1849
               G+VY +AKVC K
Sbjct  579   GTGRVYVEAKVCKK  592



>ref|XP_006648261.1| PREDICTED: uncharacterized protein LOC102714071 [Oryza brachyantha]
Length=747

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/585 (54%), Positives = 416/585 (71%), Gaps = 16/585 (3%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSLPEDPIKctinntmnc-titnSYGTFPDRGVCRAAKAVYPKTEA  319
             L+ + V  + F  G+S P  P++C   +     T+TN+YG FPDR  CRAA   YP +E 
Sbjct  162   LVALCVDSVRF-AGASPPAGPVRCAPASGTANCTLTNAYGAFPDRSTCRAAAVAYPASEQ  220

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPE--GDDGLLISTKYLNRTLEVNASSMTM  493
             ELL ++AGA + + +MK ATRY HS+PKLACP   G  GLLIST  LNR + V+A  M +
Sbjct  221   ELLRVVAGAVESRTRMKVATRYGHSVPKLACPGDGGGAGLLISTDALNRVVSVDAGRMEI  280

Query  494   TVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHI  673
             TVESGV L ++I+ AA+A LALP SPYW GLTVGGL+ TG+HGSSLWG GS+ H++V+ +
Sbjct  281   TVESGVLLSELIDAAAEARLALPNSPYWLGLTVGGLLSTGAHGSSLWGKGSAAHENVVAM  340

Query  674   RIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             RIVTPA   EGYA +R L  G+ ++ AA+VSLGVLGVISQ+T  LQPMF RS++F  ++D
Sbjct  341   RIVTPAPASEGYAKVRVLGAGDPELDAAKVSLGVLGVISQITLALQPMFMRSVAFRQRDD  400

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNG-LFDFFGLRAVGTDCL  1030
              DL +    F  +HEFAD+ WL   R  VYRVDDRV  +T+ +G ++D    RA  T  +
Sbjct  401   GDLAERVVAFAGEHEFADILWLLSQRKTVYRVDDRVPNSTTDDGAVYDLVTFRATPTPTI  460

Query  1031  NALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGV--KFSGYPVIGYQNHMQ  1204
              A R  E+  E+ G+A  KC         +V   +YG+T  G+   F G PV+GYQN +Q
Sbjct  461   QASRLGEDALEATGNAAGKCLAGSATTANLVAG-NYGVTKRGMLAPFPGTPVVGYQNRIQ  519

Query  1205  SS-GTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKS  1369
             SS G+CL S +D L   C WDPRV +  FF Q+  S+ L+K  +FI DVQ+L DL +P +
Sbjct  520   SSRGSCLTSADDGLLTACTWDPRVEHHAFFFQSGLSVPLSKAAAFIRDVQRLRDLSDPDA  579

Query  1370  LCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK-DPMVPRLYEDILEEIEQMAM  1546
             LC L +Y G+L+R+V ASTA+LGK EDS++FDITYYRS+ DP  PRL+ED+LEEIEQMA+
Sbjct  580   LCGLDIYYGVLLRFVGASTAHLGKPEDSVEFDITYYRSRDDPAAPRLHEDVLEEIEQMAL  639

Query  1547  FKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL--KTGL  1720
              KYG +PHWGKNRNVAF GAI +Y +AGEFLKVK  +DP GLFSSEWSDQ+LG+    G+
Sbjct  640   RKYGGVPHWGKNRNVAFDGAIARYPNAGEFLKVKGTYDPDGLFSSEWSDQVLGVAGAGGV  699

Query  1721  SIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             S+V++GCALEGLC+CS+D HC+P KGY CR+G+VY++A+VC ++ 
Sbjct  700   SVVRNGCALEGLCVCSEDAHCSPEKGYLCRSGRVYEEARVCRRVT  744



>gb|EAY84285.1| hypothetical protein OsI_05664 [Oryza sativa Indica Group]
Length=611

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/589 (52%), Positives = 406/589 (69%), Gaps = 24/589 (4%)
 Frame = +2

Query  131   SINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPK  310
             ++ +L+   V+F     G+S P  P++C            +YG FPDR  CRAA A YP 
Sbjct  28    AVAVLLCASVRF----AGASPPPGPVRCASGTANCTVTN-AYGAFPDRSTCRAAAAAYPA  82

Query  311   TEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG----LLISTKYLNRTLEVNA  478
             +E ELL ++AGA   + KMK ATRY HS+PKLACP    G    L+IST  LNR + V+A
Sbjct  83    SERELLRVVAGAAASRTKMKVATRYGHSVPKLACPGDGGGGGGGLVISTDALNRVVAVDA  142

Query  479   SSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHD  658
               M +TVESGV+L ++I+ AA  GLALP+SPYW GLTVGGL+ TG+HGSS+WG G +VH+
Sbjct  143   GRMEITVESGVTLAELIDAAAGGGLALPHSPYWLGLTVGGLLSTGAHGSSVWGKGGAVHE  202

Query  659   HVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISF  838
             +V+ +RIVTPA   EG+A +R L  G+ ++ AA+VSLGVLGVISQVT KLQPMFKRS++F
Sbjct  203   YVVGMRIVTPAPASEGHAKVRVLAAGDPELDAAKVSLGVLGVISQVTLKLQPMFKRSVAF  262

Query  839   VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNG-LFDFFGLRAV  1015
               ++D DL +    F  +HEFAD+ WLP     VYR+DDRV   TSG+G ++D    ++ 
Sbjct  263   RRRDDDDLAERVAAFAGEHEFADILWLPSQGKAVYRIDDRVPNTTSGDGAVYDLVVFQSS  322

Query  1016  GTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLS---YGLTNDGV--KFSGYPV  1180
              T  + A R  E+  E+  ++  KC    L     +  L+   YG+T  GV     G  V
Sbjct  323   PTVAIQANRIGEDALEATANSAGKC----LAGSATIARLAAGNYGVTRRGVLPPPPGAAV  378

Query  1181  IGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQKLV  1351
             +GYQN +QSSG+CL   +D L   C WDPRV +  FF Q+  S+ L+   +FI DVQ+L 
Sbjct  379   VGYQNRIQSSGSCLSGADDGLLTACTWDPRVRHNSFFFQSGISVPLSGAAAFIRDVQRLR  438

Query  1352  DLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEI  1531
             DL P +LC L +Y G+L+RYV+ASTA+LGK EDS++ D+TYYRS+DP  PRL+ED +EEI
Sbjct  439   DLNPDALCGLEVYYGVLLRYVRASTAHLGKPEDSVELDLTYYRSRDPAAPRLHEDAVEEI  498

Query  1532  EQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGL-  1708
             EQMA+ KYG +PHWGKNRN AF GAI KY  +GEFLKVK  +DP GLFSSEWSD++LG+ 
Sbjct  499   EQMALRKYGGVPHWGKNRNAAFDGAIAKYPKSGEFLKVKGSYDPEGLFSSEWSDKVLGVA  558

Query  1709  -KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
                G+S+V+DGCALEGLC+CS+D HC+P KGY CR G+VYK+A+VC ++
Sbjct  559   GAGGVSVVRDGCALEGLCVCSEDAHCSPEKGYLCRPGRVYKEARVCRRV  607



>ref|XP_010496265.1| PREDICTED: L-gulonolactone oxidase-like [Camelina sativa]
Length=558

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/539 (55%), Positives = 388/539 (72%), Gaps = 6/539 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG F DR +CRA+   YP TE ELL ++A  T++++KM+  TR+SHS  KLAC +G+DG
Sbjct  21    SYGAFSDRAICRASAVAYPTTEKELLQVVAAGTRERQKMRVVTRFSHSTTKLACVDGEDG  80

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              LIST+ LN TL V+  +MT+TVESGVSLRQ+I +AAK GLAL  +P+WWGLTVGG+M T
Sbjct  81    RLISTELLNHTLNVDRDAMTITVESGVSLRQLIGDAAKVGLALRMAPHWWGLTVGGMMST  140

Query  611   GSHGSSLWGV--GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGN-SDIKAARVSLGVLG  781
             G+HGSS  G   G++ HD+VI +R+VT A   +GY+ +R  KQ N +++ AARVSLGV G
Sbjct  141   GAHGSSWDGEHGGTAFHDYVIEMRMVTSAPPDQGYSMVRIFKQSNFTELDAARVSLGVFG  200

Query  782   VISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrv  961
             VISQVT +L+ MFKRSIS++   D DL +   K G ++EF D+ W P    V YR+DDRV
Sbjct  201   VISQVTVQLELMFKRSISYMTIKDSDLVEMVEKHGSRYEFPDIMWYPSKGEVTYRMDDRV  260

Query  962   STNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYG  1141
             S +  G+G +D     A  +  L   R +EE  E   ++++ C+    I+ +    LSYG
Sbjct  261   SVDIPGSGSYDSLLFAAKNSKLLAFQRSREEGLELERNSEKICTVAEGISAYFNS-LSYG  319

Query  1142  LTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLT--CPWDPRVNGLFFHQTTFSISLTK  1315
             L+NDG+ +SGYPVIG  + M SSG CLDS  D L   CPWD R++G FFHQTTF+I L  
Sbjct  320   LSNDGMNYSGYPVIGNHSDMMSSGGCLDSKEDALATACPWDSRIHGQFFHQTTFTIPLRN  379

Query  1316  VKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPM  1495
             VK+FI D+Q LV +EPK+LC L LY+G+L+RYV+ S AYLG + + ++F+ TYYRS+DP+
Sbjct  380   VKAFISDIQSLVKIEPKALCGLDLYNGVLIRYVQPSFAYLGIEFEGMEFEFTYYRSRDPL  439

Query  1496  VPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLF  1675
             +PR+YED  EEIEQM +FKY  LPHWGKNRNVAF  AI KY+ A  FL +K+ FDPLGLF
Sbjct  440   MPRMYEDFFEEIEQMGLFKYEGLPHWGKNRNVAFINAIDKYQDAAFFLMMKQMFDPLGLF  499

Query  1676  SSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             SS+W+D +LGL   L++  +GCALEGLCICS+D HC+P  GYFCR GK+YK A+VC  +
Sbjct  500   SSKWTDAVLGLGGDLTVDTEGCALEGLCICSKDVHCSPTNGYFCRPGKIYKAARVCAHL  558



>ref|XP_003573784.1| PREDICTED: uncharacterized protein LOC100831264 [Brachypodium 
distachyon]
Length=589

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/534 (54%), Positives = 384/534 (72%), Gaps = 4/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG+F DR VC AA   YP TE EL++ +A     KRK K ATR+SHSIPKLACP G DG
Sbjct  41    TYGSFTDRTVCHAANVTYPSTEEELVAAVAAVASAKRKAKVATRHSHSIPKLACPGGSDG  100

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              +IST  LNRT+ ++ +   MTVESGV LR +I  AA+AGL+LP+SPYW+GLT+GGL+ T
Sbjct  101   TIISTARLNRTVRIDVAKRLMTVESGVVLRDLITAAAEAGLSLPHSPYWYGLTIGGLLAT  160

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG G +VH++V+ +RIVTPA   +G+A +R L   + D+ AA+VS+GVLGV+S
Sbjct  161   GAHGSSLWGKGGAVHEYVVGLRIVTPAPASQGFAVVRELGADHPDLDAAKVSIGVLGVVS  220

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  LQP+FKRS++FV ++D DL  +A  +G  HEF DM W P++  V+YR DDRV  +
Sbjct  221   QVTLALQPLFKRSVTFVKRDDSDLANQAVVWGRLHEFGDMTWRPQEGKVLYRQDDRVDIS  280

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             + GNGL D    R   T  L   R  EE  +  G     C+            L+YG TN
Sbjct  281   SPGNGLNDLIIFRPRPTRGLIDARAAEERLQENGTDKAYCA-AVRAQAATTEQLAYGFTN  339

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             DG+ F+G+PV+GYQ+ +Q+SGTCL+   D L  +C WDPR+ G F++ + FS++L+K  +
Sbjct  340   DGISFTGFPVVGYQHRIQASGTCLNGPEDGLLTSCTWDPRIRGSFYYNSGFSVALSKAPA  399

Query  1325  FIEDVQKLVDLEPKSLCV-LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVP  1501
             FI D+Q+L D+ P + C  +    G+++RY+KAS+AYLGK EDSIDFD+ +YRS     P
Sbjct  400   FIADMQRLRDINPDAFCAGIDARVGVVLRYIKASSAYLGKPEDSIDFDVVFYRSHTEGEP  459

Query  1502  RLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             R++ D+++EIEQ+A+ KYG LPHWGKNRN AF GAIRKY  A EFL++K+++DP G+FSS
Sbjct  460   RVHGDVVDEIEQIALLKYGGLPHWGKNRNFAFDGAIRKYPKAAEFLRMKERYDPDGIFSS  519

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             EWSDQ+LG+    +IVK GCA+EGLCICS+D+HCAP++GYFCR GKVY  A+VC
Sbjct  520   EWSDQVLGISGSTNIVKKGCAVEGLCICSEDSHCAPDQGYFCRPGKVYTKARVC  573



>gb|ABK24821.1| unknown [Picea sitchensis]
Length=500

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/496 (57%), Positives = 374/496 (75%), Gaps = 4/496 (1%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             M+  TRY+HSIPKL CP GD GL+IST+ LN  + V+  SM MT +SGV+L+ +I+ AA+
Sbjct  1     MRVVTRYAHSIPKLVCPGGDSGLIISTRDLNYVVSVDKPSMRMTFQSGVTLKNLIDVAAR  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
              GLALP+ PYW G+T+GG++GTG+HGSSL+G GS+VH++V+ +R+V PA+  EGYA + +
Sbjct  61    EGLALPHCPYWLGVTLGGMLGTGAHGSSLFGKGSAVHEYVVGMRLVVPASPVEGYAKVVS  120

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L + + D+ AA+VSLGV+GVISQVT +LQP+FKRSI+ V K+D DL     +FG +HEF 
Sbjct  121   LTEADEDLNAAKVSLGVIGVISQVTLQLQPLFKRSITNVQKDDSDLESMIVQFGLEHEFG  180

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P  R VVYRVDDRVS N+ G+G+ DF G R   T  +   RE EE +E+  +AD 
Sbjct  181   DVTWYPSQRKVVYRVDDRVSVNSYGDGVNDFIGFRPTSTALIAITREAEEVEEATDNADS  240

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
             KC +  +  V ++     GL N+ V + GYPVIGYQN+MQ++G+CL S  D L   CPWD
Sbjct  241   KCVSS-MAQVSIILTSGTGLQNNDVLYLGYPVIGYQNNMQAAGSCLSSPEDELRTACPWD  299

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PR+ GLFF Q+  SISL+K+  F+ DV+KL D  P SLC + LY+G LMRYVKAS+AYLG
Sbjct  300   PRIKGLFFFQSGLSISLSKIGQFLSDVRKLRDTIPSSLCGVELYNGFLMRYVKASSAYLG  359

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQEDS+D +ITYYR+KDP  PRLYED+LEEIEQMA+ KYGALPHWGKNRN+AF G ++KY
Sbjct  360   KQEDSVDIEITYYRAKDPSSPRLYEDVLEEIEQMALMKYGALPHWGKNRNIAFDGVMKKY  419

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGL-KTGLSIVKDGCALEGLCICSQDNHCAPNK  1795
                  FL VK ++DP GL S++W+D +LG+ + G+ I KDGCALEGLC+CS+D+HCAP +
Sbjct  420   MKYDGFLSVKNQYDPNGLLSNDWTDDVLGIGEAGVIIWKDGCALEGLCVCSEDSHCAPTE  479

Query  1796  GYFCRAGKVYKDAKVC  1843
             GYFC+ G++Y +A+VC
Sbjct  480   GYFCKPGRIYSEARVC  495



>ref|XP_002444922.1| hypothetical protein SORBIDRAFT_07g001500 [Sorghum bicolor]
 gb|EES14417.1| hypothetical protein SORBIDRAFT_07g001500 [Sorghum bicolor]
Length=601

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/562 (53%), Positives = 402/562 (72%), Gaps = 8/562 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              G S P DP+ CT   +     + +YG+FPDR +CRAA A +P+TE EL++ +A A   +
Sbjct  31    AGGSPPPDPVSCTRGTSDCTVTS-TYGSFPDRTICRAANATFPRTEQELVAAVASAAAAR  89

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RK+K AT +SHS PKLACP G DG +IST+ LN T+ V+A+   +TVESG+ LR +++ A
Sbjct  90    RKVKVATSHSHSFPKLACPGGRDGTIISTERLNATVRVDAARRLLTVESGMLLRDLVKVA  149

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A  GLALP+SPYW+GLTVGG++ TG+HGSSLWG GS+VH++V+ IRIVTPA   +G+A +
Sbjct  150   ADNGLALPHSPYWYGLTVGGMLATGAHGSSLWGKGSAVHEYVVGIRIVTPAPASQGFAVV  209

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L  G+ D+ A +VSLGVLGVISQVTF+LQP FKRS+ FV ++D D+ ++   +G  HE
Sbjct  210   RELAAGDPDLDAVKVSLGVLGVISQVTFELQPQFKRSVKFVTRDDEDMAEKLAVWGDLHE  269

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F D+ WLPR    +YR DDRV  +T GNGL ++ G RA  T  L A RE EE  E  G  
Sbjct  270   FGDVAWLPRQGKAIYREDDRVDVSTPGNGLNNYVGFRAQPTLVLLAAREAEERLEENGTD  329

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-----  1243
               +C    L         +YG TNDGV F+GYPV+G+Q+ +Q+SGTC++  +D+      
Sbjct  330   IARCLAARLPAA-TFELQAYGFTNDGVFFTGYPVVGFQHRIQASGTCINGDDDDGGGLLL  388

Query  1244  -TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               C WD R+ G FF+Q+ FS++++KV +F+ D+Q+L DL P++ C +    G+LMRYV++
Sbjct  389   SACTWDSRIRGPFFYQSGFSVAMSKVPAFVADMQRLRDLNPRAFCGVDAKMGVLMRYVRS  448

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             S+AYLGK EDS+DFD+TYYRS D  VPR + D+ +E+EQMA+ KYGALPHWGKNRN AF 
Sbjct  449   SSAYLGKAEDSLDFDVTYYRSYDEGVPRAHADVYDELEQMALRKYGALPHWGKNRNFAFD  508

Query  1601  GAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNH  1780
             GAI +Y  A  F++VK ++DP G+FSSEWSDQ+LG++   ++V   CA+EGLC+CS D H
Sbjct  509   GAIARYPGAARFMEVKDRYDPDGIFSSEWSDQVLGIRGSPNVVGPRCAIEGLCVCSDDEH  568

Query  1781  CAPNKGYFCRAGKVYKDAKVCV  1846
             CAP +GYFCR GKVY DA+VCV
Sbjct  569   CAPEQGYFCRPGKVYADARVCV  590



>dbj|BAJ98506.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/577 (53%), Positives = 407/577 (71%), Gaps = 5/577 (1%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             M + S     ++ V FL   V SS P +P++C    +        YG+FPDR +CRAA A
Sbjct  1     MTERSRAFTFSLLVLFLGLAV-SSPPPEPVECARGTSDCTVTNV-YGSFPDRTICRAANA  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNA  478
              +P+TE EL++ +A A   KRK+K ATR+SHS  KLACP G DG +IST+ LN+T+ V+A
Sbjct  59    TFPRTEKELVAAVAAAAASKRKVKVATRHSHSFTKLACPGGRDGTIISTERLNKTVSVDA  118

Query  479   SSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHD  658
             +   MTVESG+ L+ +I+ AA AGLALP+SPYW+GLT+GGL+ TG+HGSSL G GS+VH+
Sbjct  119   AKGLMTVESGMVLKDLIQAAAAAGLALPHSPYWYGLTIGGLLATGAHGSSLRGKGSAVHE  178

Query  659   HVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISF  838
             +V+ +RIVTPA   +G+A +R L  G+ D+ A +VSLGVLGV+SQVT  LQPMFKRS++F
Sbjct  179   YVVGMRIVTPAPASQGFAVVRELSIGDPDLDAVKVSLGVLGVVSQVTLALQPMFKRSVTF  238

Query  839   VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVG  1018
               ++D D   +A  +G  +EF DM WLPR   V+YR DDRV  +T GNGL D+ G R+  
Sbjct  239   EKRDDTDFASQAAMWGGLYEFGDMAWLPRQGKVIYRKDDRVPVSTKGNGLNDYLGFRSNP  298

Query  1019  TDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNH  1198
             T  L   R  EEH +  G    +C      +V +    +YG TNDG  F+G+PV+G+QN 
Sbjct  299   TLALITARATEEHLQKDGSNIARCLAARAPSV-LFELQAYGFTNDGSFFTGWPVVGFQNR  357

Query  1199  MQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSL  1372
             +Q+SGTC+ S  D L  +C WDPR+   FF+ + FS++L+K  +FI ++QKL DL+P++ 
Sbjct  358   IQASGTCISSPEDGLLSSCTWDPRIRSPFFYNSGFSVALSKAPAFIAEMQKLRDLKPRAF  417

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             C L    G+L+RYV+AS+AYLGK EDSIDFD+TYYRS     PR   D+++EIEQ+A+ K
Sbjct  418   CGLDAKLGVLLRYVRASSAYLGKSEDSIDFDVTYYRSYTEGEPRADSDVVDEIEQLALRK  477

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVK  1732
             YGA+PHWGKNRN  F G I KY  A EFLKVK ++DP G+FSSEWSDQ+LG+K   +IV+
Sbjct  478   YGAVPHWGKNRNFVFDGVIAKYPKAAEFLKVKARYDPDGIFSSEWSDQVLGVKGSPNIVQ  537

Query  1733  DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
              GCA+EGLC+CS+D+HCAP KGYFCR G V+ +A+VC
Sbjct  538   KGCAIEGLCVCSEDSHCAPEKGYFCRPGTVFPEARVC  574



>ref|XP_004980737.1| PREDICTED: uncharacterized protein LOC101758891 [Setaria italica]
Length=596

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/543 (55%), Positives = 397/543 (73%), Gaps = 11/543 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG FPDR  CRAA A +P +E ELL+++A AT    +MK  TR+SHS+PKLACP GD G
Sbjct  51    AYGAFPDRSTCRAAAAAFPASERELLAVVANATAAGTRMKVTTRFSHSVPKLACPAGDRG  110

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+IST  L+R + V+A    +TVE+GV+L Q+I+ AA+AGLA+PY+PYW GLTVGGL+ T
Sbjct  111   LIISTDSLSRVVAVHAGRREITVEAGVTLGQLIDAAAEAGLAVPYTPYWLGLTVGGLLST  170

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG G++VH++V+ +R+VTPA   EGYA +R L  G+ ++ AA+VSLGVLGVIS
Sbjct  171   GAHGSSLWGKGAAVHEYVVGMRVVTPAPASEGYAKVRVLAAGDPELDAAKVSLGVLGVIS  230

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  LQPMFKRS+ F   +D DL +    F  +HEF D+ W P     VYR+DDRV+ N
Sbjct  231   QVTLSLQPMFKRSVRFEEHDDSDLAERVVAFASEHEFGDILWYPGHGKAVYRIDDRVAVN  290

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             TSG+G+ DF G +   T  + A+R  EE  E+  ++   C +  L+   ++   +YG+T 
Sbjct  291   TSGDGVCDFVGFQPTPTIAIQAVRLTEEGMETAKNSSGMC-DMALVTSAIMSAGNYGVTE  349

Query  1151  DGVK--FSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTK  1315
              GV     G PV+GYQN +QSSG CL   +D L   CPWDPRV +G FF +   S+SL++
Sbjct  350   HGVTALLPGRPVVGYQNRLQSSGRCLAGPDDALRTACPWDPRVSHGTFFFEAGVSVSLSR  409

Query  1316  VKSFIEDVQKLVDL-EPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDP  1492
               +FI DVQ+L  L  P++LC + +Y G+LMRYV+ASTA+LGK EDS++FD+TYYRS+DP
Sbjct  410   TAAFIHDVQRLRGLVGPRALCGVEVYSGVLMRYVRASTAHLGKVEDSVEFDLTYYRSRDP  469

Query  1493  MVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA--GEFLKVKKKFDPL  1666
               PRLY+ ++EEI+QMA+ KYGALPHWGKN+N AF+GA+ KY ++    F+ VK  +DP 
Sbjct  470   AAPRLYQGVVEEIQQMALRKYGALPHWGKNQNAAFEGAVGKYGASRVAAFMAVKDAYDPD  529

Query  1667  GLFSSEWSDQ--ILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKV  1840
             GLFSSEWS+Q   +G   G+S+V+DGCALEGLC+CSQD+HCAP+KGYFCR G+VYK+A+V
Sbjct  530   GLFSSEWSNQVLGIGGGGGVSVVRDGCALEGLCVCSQDSHCAPSKGYFCRPGRVYKEARV  589

Query  1841  CVK  1849
             C +
Sbjct  590   CRR  592



>gb|EMT27466.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=579

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/557 (53%), Positives = 409/557 (73%), Gaps = 4/557 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              GSS P +P+    + T +CT++ +YG+FPDR VCRAA A +P+TE EL++ +A A   K
Sbjct  20    AGSSPPPEPV-VCAHGTSDCTVSTAYGSFPDRTVCRAASATFPRTEKELVAAVAAAAAAK  78

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RK+K AT++SHS P LACP G DG +IST+ LNR + V+ +   MTVESG+ LR +I+ A
Sbjct  79    RKVKGATKHSHSFPTLACPGGRDGTIISTERLNRVVSVDVAKGLMTVESGMVLRDLIQAA  138

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A+AGLALP+SPYW GLT+GGL+ TG+HGSSL G G +VH++V+ +RIVTPA   +G+A +
Sbjct  139   AEAGLALPHSPYWSGLTIGGLLATGAHGSSLKGKGGAVHEYVVGMRIVTPAPRSQGFAVV  198

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L   + D+ AA+VSLGVLGV+SQVT  L+PMFKRS++FV+++D D+ ++A  +G  HE
Sbjct  199   RELCADHPDLDAAKVSLGVLGVVSQVTLALEPMFKRSVTFVIRDDSDMAEQAVVWGDLHE  258

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F DM WLP+ R+V+YR DDR +  ++GNGL D+   R+  T  L + R  +E  E   + 
Sbjct  259   FGDMVWLPQQRNVIYRKDDRGAITSAGNGLNDYLAFRSSSTADLISGRVMQELLEKKNNT  318

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C  +   +V +    +YG TN+G  F GYPV+G+Q+H+Q+S +CLDS  D L  TCP
Sbjct  319   VARC-KEAPTSVSLFEKAAYGFTNNGSLFMGYPVVGFQHHIQASSSCLDSPEDTLLTTCP  377

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPR+ G+FF+   +SI+L++V +FI D++KL +  PK+ C +    GIL+RY+KAS+AY
Sbjct  378   WDPRIRGIFFYNNAYSIALSRVSAFIADMKKLRNSNPKAFCGIDAGLGILLRYIKASSAY  437

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGK EDSIDFDITYYRS     P  Y  +L+E++QMA+ KYGA+PHWGKNRN AF+G I 
Sbjct  438   LGKSEDSIDFDITYYRSYTKGEPNPYSGVLDELQQMALRKYGAIPHWGKNRNFAFEGVIA  497

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KY  AG+FL+VK ++DP G+FSSEWS+Q+LG+     IV+ GCA+EGLC+CS+D+HCAP 
Sbjct  498   KYPEAGKFLEVKGRYDPDGIFSSEWSNQVLGINGSPIIVEKGCAIEGLCVCSEDSHCAPE  557

Query  1793  KGYFCRAGKVYKDAKVC  1843
             +GY+CR GKVY +A+VC
Sbjct  558   QGYYCRPGKVYTEARVC  574



>gb|EAY93710.1| hypothetical protein OsI_15502 [Oryza sativa Indica Group]
 gb|EAZ30370.1| hypothetical protein OsJ_14422 [Oryza sativa Japonica Group]
Length=612

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 400/575 (70%), Gaps = 8/575 (1%)
 Frame = +2

Query  140   ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             +L+ + +  +    G   P  P+ C  N T  CT+TN YG+F DR +CRAA   YP+TE 
Sbjct  16    LLVILALWIVSHLAGDRPPPGPVVCAANGTSGCTLTNIYGSFSDRAICRAANVTYPRTEE  75

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL++ +A A    RK+K ATRYS+S P+LACP G+DG +IST++L+R + V+A+   MTV
Sbjct  76    ELVAAVAAAVAAGRKVKVATRYSNSFPRLACPGGEDGTVISTRWLDRAVRVDAARRLMTV  135

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESG+ +R +I EAA AGLALP+SPYW GLT+GG++ TG+HGSSLWG GS+VH++V+ +RI
Sbjct  136   ESGMVMRDLIREAAAAGLALPHSPYWSGLTIGGVLATGAHGSSLWGKGSAVHEYVVGMRI  195

Query  680   VTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRD  859
             VTPA   EG+A +R L  G+ D+ AA+VSLGVLG ISQVT +LQP+FKRS++FV +ND D
Sbjct  196   VTPAPASEGFAAVRELAAGDPDLDAAKVSLGVLGAISQVTLELQPLFKRSVAFVTRNDSD  255

Query  860   LGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNAL  1039
             +      +G  HEF D+ WLPR R  VYR DDRV   T G+G  D+   R   T  L A 
Sbjct  256   VADTVAAWGRLHEFGDVAWLPRRRVAVYREDDRVDVATPGDGRSDYPAFRPTPTLPLVAS  315

Query  1040  REKEE-HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             R  EE  +E  G    +C+   ++    +  L+YGLTNDG  F+GYPV+GYQ+ +Q+S  
Sbjct  316   RLAEEWLEERSGSDAARCAASRVMPA-TLEHLNYGLTNDGEAFTGYPVVGYQHRIQASSL  374

Query  1217  CLDSLNDN-----LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             C  ++ D+      TC W+ R+ G  F+ + FSI+L++  +F+ DV +L DL P + C +
Sbjct  375   CTGAMEDDGHIPTSTCLWNGRLRGHLFYNSGFSIALSRAPAFVADVARLRDLNPAAFCQI  434

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
                 G+LMRYV AS+AYLGK EDS+DFD+TYYRS     PR + D+ +E+EQMA+ K+G 
Sbjct  435   DSKMGLLMRYVAASSAYLGKAEDSVDFDVTYYRSYARGAPRAHADVFDEVEQMALRKHGG  494

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLS-IVKDG  1738
             +PHWGKNRN AF GAI +Y +AG+F++VK +FDP G+FSSEWSDQ+LG+      IV DG
Sbjct  495   VPHWGKNRNYAFDGAIARYPNAGKFMRVKDRFDPDGVFSSEWSDQVLGVGGASPVIVGDG  554

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CA+EGLC+CS D+HCAP KGYFCR GKV+  A+VC
Sbjct  555   CAMEGLCVCSDDSHCAPEKGYFCRPGKVFTAARVC  589



>ref|NP_001060850.1| Os08g0114300 [Oryza sativa Japonica Group]
 dbj|BAD10557.1| putative oxidase-like [Oryza sativa Japonica Group]
 dbj|BAF22764.1| Os08g0114300 [Oryza sativa Japonica Group]
 dbj|BAG97402.1| unnamed protein product [Oryza sativa Japonica Group]
Length=589

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/577 (54%), Positives = 408/577 (71%), Gaps = 6/577 (1%)
 Frame = +2

Query  125   KMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVY  304
             +  + +L+ + V   +   G+S P  P+ CT   T        YG+FPDR +CRAA A +
Sbjct  2     RTMLPLLVILVVGLRL--AGASPPPQPVACTKGTTDCTVTNV-YGSFPDRTICRAADASF  58

Query  305   PKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASS  484
             P+TEAEL++ +A A    RK KAATR+SHS PKLACP G DG +IST++LNRT+ V+A++
Sbjct  59    PRTEAELVAAVAAAAAAGRKAKAATRHSHSFPKLACPGGRDGTIISTRFLNRTVAVDAAA  118

Query  485   MTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHV  664
               +TVESGV LR +I  AA AGLALP+SPYW+GLTVGGL+ TG+HGSSLWG GS+VH++V
Sbjct  119   RRITVESGVVLRDLIRAAAAAGLALPHSPYWYGLTVGGLLATGAHGSSLWGKGSAVHEYV  178

Query  665   IHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVV  844
             + +RIVTPA   +G+A +R L  G+ D+ AA+VSLGVLGVISQVTF+LQP FKRS+ FV 
Sbjct  179   VGLRIVTPAPASQGFAVVRELVAGDPDLDAAKVSLGVLGVISQVTFELQPQFKRSVRFVT  238

Query  845   KNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTD  1024
             ++D D  ++   +G  HEF DM WLPR   V+YR DDRV   T GNGL D+ G RA  T 
Sbjct  239   RDDSDFAEKVAVWGGAHEFGDMAWLPRQGKVIYREDDRVDVATPGNGLNDYLGFRAQPTL  298

Query  1025  CLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQ  1204
              L   R  EE  E  G    +C    L    +    +YG TNDGV F+G+PV+G+Q+ +Q
Sbjct  299   GLITARAAEERLERNGTDIARCLAARLPPS-LFELQAYGFTNDGVFFTGWPVVGFQHRIQ  357

Query  1205  SSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCV  1378
             +SGTC+ S  D L  +C WDPR+ G F + + FSI+L +  +F+ D+ +L DL P++ C 
Sbjct  358   ASGTCISSPEDGLLSSCTWDPRIRGPFLYNSGFSIALPRAAAFVADMMRLRDLNPRAFCD  417

Query  1379  LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYG  1558
             +    GILMRYVKAS+AYLGK ED +DFD+TYYRS D   PR + D+ +E+EQMA+ KYG
Sbjct  418   IDAKLGILMRYVKASSAYLGKPEDCVDFDVTYYRSYDDGEPRPHSDVFDELEQMALRKYG  477

Query  1559  ALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
             A+PHWGKNRN AF GA  KY ++GEF+KVK+++DP G+FSSEWSDQ+LG+    +IV   
Sbjct  478   AVPHWGKNRNFAFDGAAAKYPNSGEFIKVKERYDPDGIFSSEWSDQVLGISGSPNIVDKR  537

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             CA+EGLC+CS D+HCAP  GYFCR GK++K+A+VC K
Sbjct  538   CAIEGLCVCSDDSHCAPELGYFCRPGKLFKEARVCSK  574



>gb|EAZ41305.1| hypothetical protein OsJ_25816 [Oryza sativa Japonica Group]
Length=589

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/577 (54%), Positives = 409/577 (71%), Gaps = 6/577 (1%)
 Frame = +2

Query  125   KMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVY  304
             +  + +L+ + V   +   G+S P  P+ CT   T        YG+FPDR +CRAA A +
Sbjct  2     RTMLPLLVILVVGLRL--AGASPPPQPVACTKGTTDCTVTNV-YGSFPDRTICRAADASF  58

Query  305   PKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASS  484
             P+TEAEL++ +A A    RK KAATR+SHS PKLACP G DG +IST++LNRT+ V+A++
Sbjct  59    PRTEAELVAAVAAAAAAGRKAKAATRHSHSFPKLACPGGRDGTIISTRFLNRTVAVDAAA  118

Query  485   MTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHV  664
               +TVESGV LR +I  AA AGLALP+SPYW+GLTVGGL+ TG+HGSSLWG GS+VH++V
Sbjct  119   RRITVESGVVLRDLIRAAAAAGLALPHSPYWYGLTVGGLLATGAHGSSLWGKGSAVHEYV  178

Query  665   IHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVV  844
             + +RIVTPA   +G+A +R L  G+ D+ AA+VSLGVLGVISQVTF+LQP FKRS+ FV 
Sbjct  179   VGLRIVTPAPASQGFAVVRELVAGDPDLDAAKVSLGVLGVISQVTFELQPQFKRSVRFVT  238

Query  845   KNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTD  1024
             ++D D  ++   +G  HEF DM WLPR   V+YR DDRV   T GNGL D+ G RA  T 
Sbjct  239   RDDSDFAEKVAVWGGAHEFGDMAWLPRQGKVIYREDDRVDVATPGNGLNDYLGFRAQPTL  298

Query  1025  CLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQ  1204
              L   R  EE  E  G    +C    L    +    +YG TNDGV F+G+PV+G+Q+ +Q
Sbjct  299   GLITARAAEERLERNGTDIARCLAARLPPS-LFELQAYGFTNDGVFFTGWPVVGFQHRIQ  357

Query  1205  SSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCV  1378
             +SGTC+ S  D L  +C WDPR+ G F++ + FSI+L +  +F+ D+ +L DL P++ C 
Sbjct  358   ASGTCISSPEDGLLSSCTWDPRIRGPFWYNSGFSIALPRAAAFVADMMRLRDLNPRAFCD  417

Query  1379  LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYG  1558
             +    GILMRYVKAS+AYLGK ED +DFD+TYYRS D   PR + D+ +E+EQMA+ KYG
Sbjct  418   IDAKLGILMRYVKASSAYLGKPEDCVDFDVTYYRSYDDGEPRPHSDVFDELEQMALRKYG  477

Query  1559  ALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
             A+PHWGKNRN AF GA  KY ++GEF+KVK+++DP G+FSSEWSDQ+LG+    +IV   
Sbjct  478   AVPHWGKNRNFAFDGAAAKYPNSGEFIKVKERYDPDGIFSSEWSDQVLGISGSPNIVDKR  537

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             CA+EGLC+CS D+HCAP  GYFCR GK++K+A+VC K
Sbjct  538   CAIEGLCVCSDDSHCAPELGYFCRPGKLFKEARVCSK  574



>gb|ADE76308.1| unknown [Picea sitchensis]
Length=542

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/498 (57%), Positives = 368/498 (74%), Gaps = 4/498 (1%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             M+  TRY+HSIPKL CP G+ GL+IST +L+R + V+  SM MT+ESGV+L+ +I+ AA 
Sbjct  1     MRVVTRYAHSIPKLVCPGGESGLIISTLHLDRVVSVDKRSMRMTLESGVTLKNLIDAAAN  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
              GLALP+SPYW GLTVGG++GTG+HGSSL+G GS+VH+ V+ +R+V PA++ EGYA +  
Sbjct  61    EGLALPHSPYWLGLTVGGILGTGAHGSSLFGKGSAVHEFVVGMRLVVPASQDEGYAKVVC  120

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L +   D+ A +VSLGVLGVISQVT +LQPMFKRSI+ V ++D DL     +FG +HEFA
Sbjct  121   LTEAEEDLNALKVSLGVLGVISQVTLQLQPMFKRSITNVQQDDFDLENRIAQFGLEHEFA  180

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             D+ W P  R VVYRVDDRV  NTSGNG+ DF G R   +  L   R  EE +ES    + 
Sbjct  181   DVTWHPAQRKVVYRVDDRVPVNTSGNGVNDFIGFRPTFSPLLATARIAEEIEESHNGTNS  240

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
             KC+  + + V  +  L  GL N+ ++F GYPVIGYQN+MQ++G+CL S  D L   C WD
Sbjct  241   KCALSF-VRVSSILQLGTGLKNNDLQFHGYPVIGYQNNMQAAGSCLSSPEDGLQTACGWD  299

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PR+ GLFF Q   SIS++K+  F+ DV+KL D+ P SLC + LY G LMRYVKAS+AYLG
Sbjct  300   PRIKGLFFFQNGISISVSKIGQFLSDVRKLRDMIPNSLCGVELYYGFLMRYVKASSAYLG  359

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             KQEDS+D ++TYYR+ DP  PRLYED+LEEIEQMA+ KYG +PHWGKNRN+AF G ++KY
Sbjct  360   KQEDSVDIEMTYYRANDPNTPRLYEDVLEEIEQMALVKYGGMPHWGKNRNIAFDGVMKKY  419

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGL-KTGLSIVKDGCALEGLCICSQDNHCAPNK  1795
                  FL  K K+D  G FS+EW+D +LG+ K G+ I KDGCALEGLC+CS+D HCAP+K
Sbjct  420   SKYKAFLAAKTKYDSNGHFSNEWTDGVLGIEKEGVIIKKDGCALEGLCVCSEDAHCAPDK  479

Query  1796  GYFCRAGKVYKDAKVCVK  1849
             GYFC+ G+VY +A+VC +
Sbjct  480   GYFCKPGRVYTEARVCRR  497



>ref|XP_008661463.1| PREDICTED: uncharacterized protein LOC103640501 [Zea mays]
Length=584

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/537 (55%), Positives = 383/537 (71%), Gaps = 4/537 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG+FPDR VCRAA AVYP+TE EL++ +A     K K K ATR+SHS  KLACP G DG
Sbjct  49    SYGSFPDRTVCRAAAAVYPQTEKELVAAVAAVAAAKGKAKVATRHSHSFTKLACPGGRDG  108

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              +IST++LNRT+ V+     +TVE G+ LR ++  AA+AGLALP+SPYW GLTVGGL+ T
Sbjct  109   TVISTRWLNRTVRVDVGRRLLTVEGGMVLRDLVRVAAEAGLALPHSPYWSGLTVGGLLAT  168

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG GS+VH++V+ +RIVTPA   +G+A +R L   + D+ A +VSLGVLGVIS
Sbjct  169   GAHGSSLWGKGSAVHEYVVGMRIVTPAPASQGFAVVRELGADHPDLDATKVSLGVLGVIS  228

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  LQPMFKRS++FV ++D D+ +  + +G  HEF DM WLP  R VVYR DDRV   
Sbjct  229   QVTLALQPMFKRSVTFVTRDDSDMAETVSVWGHLHEFGDMTWLPYQRKVVYRQDDRVDVA  288

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             T G+G  DF G R      + A R  +   E   D D        + +W V   +YG +N
Sbjct  289   TGGDGHNDFLGFRFYSKPGVMAARLLDTWLEE-KDVDTARCLMARLPMWKVQREAYGFSN  347

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL---TCPWDPRVNGLFFHQTTFSISLTKVK  1321
             DGV F+GYPV+G+Q+ +Q+SG+CLD     L    C WDPR+ G  F+ + FS+ L+KV 
Sbjct  348   DGVSFTGYPVVGFQHRIQASGSCLDDGGGGLLLSACTWDPRLRGGLFYSSGFSVGLSKVA  407

Query  1322  SFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVP  1501
             +F+ DVQ+L D+ P++ C L    G+ MRYVKAS+A+LGK EDS+D DI YYRS      
Sbjct  408   AFVADVQRLRDINPRAFCGLEGKLGVFMRYVKASSAFLGKPEDSVDLDIVYYRSHVEGTL  467

Query  1502  RLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             R + D+++E+EQMA+ KYGA+PHWGKNRN AF GAI KY  A EFL+VK  +DP G+FSS
Sbjct  468   RRHADVVDEMEQMALHKYGAIPHWGKNRNFAFDGAIDKYPRAHEFLRVKNTYDPDGIFSS  527

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             EWSDQ+LG+K   SIV+DGCA+EGLC+CS D+HC P+KGYFCR GKVYK+A+VCV++
Sbjct  528   EWSDQVLGVKGSPSIVRDGCAIEGLCVCSGDSHCMPDKGYFCRPGKVYKEARVCVRV  584



>tpg|DAA47285.1| TPA: hypothetical protein ZEAMMB73_182931 [Zea mays]
Length=602

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/537 (55%), Positives = 383/537 (71%), Gaps = 4/537 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG+FPDR VCRAA AVYP+TE EL++ +A     K K K ATR+SHS  KLACP G DG
Sbjct  67    SYGSFPDRTVCRAAAAVYPQTEKELVAAVAAVAAAKGKAKVATRHSHSFTKLACPGGRDG  126

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              +IST++LNRT+ V+     +TVE G+ LR ++  AA+AGLALP+SPYW GLTVGGL+ T
Sbjct  127   TVISTRWLNRTVRVDVGRRLLTVEGGMVLRDLVRVAAEAGLALPHSPYWSGLTVGGLLAT  186

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG GS+VH++V+ +RIVTPA   +G+A +R L   + D+ A +VSLGVLGVIS
Sbjct  187   GAHGSSLWGKGSAVHEYVVGMRIVTPAPASQGFAVVRELGADHPDLDATKVSLGVLGVIS  246

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  LQPMFKRS++FV ++D D+ +  + +G  HEF DM WLP  R VVYR DDRV   
Sbjct  247   QVTLALQPMFKRSVTFVTRDDSDMAETVSVWGHLHEFGDMTWLPYQRKVVYRQDDRVDVA  306

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             T G+G  DF G R      + A R  +   E   D D        + +W V   +YG +N
Sbjct  307   TGGDGHNDFLGFRFYSKPGVMAARLLDTWLEE-KDVDTARCLMARLPMWKVQREAYGFSN  365

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL---TCPWDPRVNGLFFHQTTFSISLTKVK  1321
             DGV F+GYPV+G+Q+ +Q+SG+CLD     L    C WDPR+ G  F+ + FS+ L+KV 
Sbjct  366   DGVSFTGYPVVGFQHRIQASGSCLDDGGGGLLLSACTWDPRLRGGLFYSSGFSVGLSKVA  425

Query  1322  SFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVP  1501
             +F+ DVQ+L D+ P++ C L    G+ MRYVKAS+A+LGK EDS+D DI YYRS      
Sbjct  426   AFVADVQRLRDINPRAFCGLEGKLGVFMRYVKASSAFLGKPEDSVDLDIVYYRSHVEGTL  485

Query  1502  RLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             R + D+++E+EQMA+ KYGA+PHWGKNRN AF GAI KY  A EFL+VK  +DP G+FSS
Sbjct  486   RRHADVVDEMEQMALHKYGAIPHWGKNRNFAFDGAIDKYPRAHEFLRVKNTYDPDGIFSS  545

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             EWSDQ+LG+K   SIV+DGCA+EGLC+CS D+HC P+KGYFCR GKVYK+A+VCV++
Sbjct  546   EWSDQVLGVKGSPSIVRDGCAIEGLCVCSGDSHCMPDKGYFCRPGKVYKEARVCVRV  602



>ref|XP_002442412.1| hypothetical protein SORBIDRAFT_08g019590 [Sorghum bicolor]
 gb|EES16250.1| hypothetical protein SORBIDRAFT_08g019590 [Sorghum bicolor]
Length=604

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/540 (54%), Positives = 391/540 (72%), Gaps = 9/540 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPE--GD  424
             S G+FPDR +CRAA AVYP+TEAEL++ +A A   KRK+K AT +SHS  KLACP   G 
Sbjct  49    SIGSFPDRTICRAATAVYPRTEAELVAAVAAAAAAKRKVKVATTHSHSFTKLACPGDGGG  108

Query  425   DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
             DG +IST++LNRT+ ++     +TVESG+ LR ++E AA+AGLALP+SPYW GLTVGGL+
Sbjct  109   DGTVISTRWLNRTVRIDVGRRLLTVESGMLLRDLVEVAAEAGLALPHSPYWSGLTVGGLL  168

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSSLWG GS+VH++V+ +RIVTPA   +G+A +R L   + D+ AA+VSLGVLGV
Sbjct  169   ATGAHGSSLWGKGSAVHEYVVGMRIVTPAPASQGFAVVRELGADHPDLDAAKVSLGVLGV  228

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             ISQVT  LQPMFKRS++F+ ++D D+ ++ + +G  HEF D+ WLP  R VVYR DDRV 
Sbjct  229   ISQVTLALQPMFKRSVTFLTRDDSDMTEKVSIWGRLHEFGDVTWLPYQRKVVYRQDDRVD  288

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
               T G+ + DF G R+         R  +E  E + DAD        + +W V   +YG 
Sbjct  289   VATPGDAINDFLGFRSQAKLSQVTARLLDEWFEEM-DADTARCQMARLTMWKVQREAYGF  347

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL------TCPWDPRVNGLFFHQTTFSIS  1306
             TNDGV F+GYP++G+Q+ +Q+S +CLD+ + +       TC WD RV G  F+ + FS++
Sbjct  348   TNDGVSFTGYPMVGFQHRIQASSSCLDTASKHAGGLLQPTCMWDARVRGALFYSSGFSVA  407

Query  1307  LTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK  1486
             L++  +F+ D+Q+L DL P + C L    G+ MRYVKAS+A+LGK EDS+DFD+ YYRS 
Sbjct  408   LSRAPAFVADMQRLRDLNPPAFCGLEGKLGVFMRYVKASSAFLGKAEDSLDFDVVYYRSS  467

Query  1487  DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPL  1666
                  R + D+++E+EQMA+ KYGA+PHWGKNRN AF GAI KY  AGEFL+VK++FDP 
Sbjct  468   TGGALRRHADVVDELEQMALRKYGAVPHWGKNRNFAFDGAIAKYPRAGEFLRVKERFDPE  527

Query  1667  GLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCV  1846
             G+FSSEWSDQ+LG++   SIV+ GCA+EGLC+CS D+HCAP KGYFCR GKVY +A+VCV
Sbjct  528   GIFSSEWSDQVLGVEGSPSIVRKGCAIEGLCVCSDDSHCAPEKGYFCRPGKVYMEARVCV  587



>ref|XP_004980739.1| PREDICTED: uncharacterized protein LOC101760109 [Setaria italica]
Length=599

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/543 (54%), Positives = 391/543 (72%), Gaps = 11/543 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG FPDR  CRAA A +P +E ELL+++A AT    +MK ATR+SHS+PKLACP  D G
Sbjct  54    AYGAFPDRSTCRAAAAAFPASERELLAVVANATAAGTRMKVATRFSHSVPKLACPARDRG  113

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+IST+ L+R + V+A  M + VE GV+L Q+I+ AA+AGLA+PY+PYW GLTVGG++ T
Sbjct  114   LIISTESLSRVVAVDAGRMEVIVEGGVTLGQLIDAAAEAGLAIPYTPYWLGLTVGGMLTT  173

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG G++VH++V+ +R+VTPA   EGYA +R L  G+ ++ AA+VSLGVLGVIS
Sbjct  174   GAHGSSLWGKGAAVHEYVVGMRVVTPAPASEGYAKVRVLAAGDPELDAAKVSLGVLGVIS  233

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  LQPMFKRS+ F   +D DL +    F  +HEFAD+ W P  R  +YRVDDRV  N
Sbjct  234   QVTLALQPMFKRSVRFEEHDDSDLAERVVAFASEHEFADIVWYPGHRKAIYRVDDRVPVN  293

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             TSG+G+ DF G R   T  +   R  EE  E+  D   +C+   L    +    +YGL  
Sbjct  294   TSGDGVNDFVGFRPTPTFVIETARLDEERIEAKNDTTGRCA-MALATRALFSARNYGLME  352

Query  1151  DGVK--FSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTK  1315
              G++    G PV+G+QN +QSSG CL + ND L   CPWDPRV +G F+ ++  S+ L  
Sbjct  353   HGLQTPLPGRPVVGFQNRIQSSGRCLAAANDTLLTVCPWDPRVSHGTFYFESGISVPLRS  412

Query  1316  VKSFIEDVQKLVDLE-PKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDP  1492
               +F+ DVQ+L DL  P +LC + +Y G+LMRYV+ASTA+LGK EDS++FD+TYYRS+DP
Sbjct  413   AAAFVRDVQQLRDLAGPGALCGVEVYYGVLMRYVRASTAHLGKVEDSVEFDLTYYRSRDP  472

Query  1493  MVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA--GEFLKVKKKFDPL  1666
               PRLY+ ++EEI+QMA+ KYG LPHWGKN+N AF+GA+ KY ++    F+ VK  +DP 
Sbjct  473   AAPRLYQGVVEEIQQMALRKYGGLPHWGKNQNAAFEGAVGKYGASRVAAFMAVKDAYDPD  532

Query  1667  GLFSSEWSDQ--ILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKV  1840
             GLFSSEWS+Q   +G   G+S+V+DGCALEGLC+CSQD+HCAP+KGYFCR G+VYK A+V
Sbjct  533   GLFSSEWSNQVLGIGGGGGVSVVRDGCALEGLCVCSQDSHCAPSKGYFCRPGRVYKVARV  592

Query  1841  CVK  1849
             C +
Sbjct  593   CRR  595



>dbj|BAJ94779.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00170.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/558 (52%), Positives = 389/558 (70%), Gaps = 6/558 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              G S P DP+    + T NCTITN+YG+F DR +CRAAK  YP+TE EL++ +A     K
Sbjct  25    AGCSPPPDPV-MCTHGTSNCTITNTYGSFTDRTICRAAKVTYPRTEQELVAAVAAVASTK  83

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             +K++ AT++SHSIPKLACP GDDG +IST  LNRT+ ++A+   MTVESG+ LR ++E A
Sbjct  84    QKVRVATKHSHSIPKLACPGGDDGTIISTARLNRTVCIDAAKRLMTVESGMLLRDLVEAA  143

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A AGL+LP+SPYW GLT+GGL+ TG+HGSSLWG G   H++V+ +RIVTPA   +G+A +
Sbjct  144   AAAGLSLPHSPYWHGLTIGGLLSTGAHGSSLWGKGGGAHEYVVGLRIVTPAPASQGFAVV  203

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L   + D+ AA+VSLGVLGVIS VT  +QP+FKRS++ V ++D D  ++  ++G  HE
Sbjct  204   RELGADHPDLDAAKVSLGVLGVISHVTLTMQPLFKRSVTLVKRDDSDFQEQVVRWGHLHE  263

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             + DM WLP    V+YR DDRV  +T GNGL+D    R   T  L   R  EE  +  G  
Sbjct  264   YGDMTWLPHQGKVIYRQDDRVDVSTPGNGLYDLPLFRISPTRELIDARAAEERLQENGTD  323

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C               +  TNDGV F+GYPV+GYQ+ +Q+SGTCL+S  D L  +C 
Sbjct  324   TARCEAAQQQQAATERLNVF--TNDGVSFTGYPVVGYQHRIQASGTCLNSPEDGLLTSCA  381

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC-VLGLYDGILMRYVKASTA  1429
             WDPR+ G FF  + FSI L++  +F+ D+++L DL+P   C  +    G+L+RY+KAS+A
Sbjct  382   WDPRIRGSFFDNSGFSIPLSRAPAFVADMKRLRDLKPDLFCSAVDARIGVLLRYLKASSA  441

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLGK EDSI  DI YYRS    +PR + D+++EIEQMA+ KYG +PHWGK+RN AF GAI
Sbjct  442   YLGKPEDSIGVDIIYYRSHTEGMPRAHADVVDEIEQMALRKYGGVPHWGKSRNFAFDGAI  501

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
              KY    EFL+VK ++DP GLFS+EW+DQ+LG+    SI+K  CA+EGLC+CS ++HCAP
Sbjct  502   AKYPKVHEFLRVKHRYDPEGLFSNEWTDQVLGINGSPSIIKKRCAIEGLCVCSNNSHCAP  561

Query  1790  NKGYFCRAGKVYKDAKVC  1843
              +GYFCR GKVYK+A+VC
Sbjct  562   EQGYFCRPGKVYKEARVC  579



>dbj|BAJ92688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=618

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 404/588 (69%), Gaps = 12/588 (2%)
 Frame = +2

Query  110   TISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRA  289
             T + A MS  +     +  L+   GSS P D + C    +        YG+FPD   C A
Sbjct  17    TSTEAGMSSFLPAAFVLILLLSPAGSSPPPDSVSCARGTSDCTLANV-YGSFPDHTACHA  75

Query  290   AKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLE  469
             A A +P TEAELL+ +A A   KRK+KAA R+SHS PKLACP G DG +IST  LNRT+ 
Sbjct  76    ADAAFPTTEAELLAAVAAAAAAKRKVKAAPRHSHSFPKLACPGGRDGTIISTARLNRTVS  135

Query  470   VNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSS  649
             V+A+   MTVE G+ LR +I +AA AGLALP+SPYW+G+T+GGL+ TG+HGSSLWG GS+
Sbjct  136   VDAARGLMTVEGGMVLRDLIRDAAAAGLALPHSPYWYGVTIGGLLATGAHGSSLWGKGSA  195

Query  650   VHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRS  829
             VH++V+ +RIVTPA   +G+  +R L   + D+ AA+VSLGVLGV+SQVT +LQPMFKRS
Sbjct  196   VHEYVVGMRIVTPAPASQGFTVVRVLGAQHPDLDAAKVSLGVLGVVSQVTLELQPMFKRS  255

Query  830   ISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLR  1009
             ++F+ ++D DL  E   +G QHEF DM WLPR   V+YR DDRV  ++ G+GL D+ G R
Sbjct  256   VTFLERDDSDLAAEVAVWGHQHEFGDMTWLPRLGKVIYREDDRVHVSSPGDGLNDYIGFR  315

Query  1010  AVGTDCLNALREKEEH--QESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVI  1183
             +  T  L   R  EEH  ++S  +   +C    ++        +YG TNDG  F+GYPV+
Sbjct  316   SFPTLGLFIARVAEEHLQEDSTSNDMARCLAAGVLPP-AFQSRAYGFTNDGSSFTGYPVV  374

Query  1184  GYQNHMQSSGTCLD--------SLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDV  1339
             GYQ+ MQ+SG C+D         L  + +CPWDPRV  LFF+ + FS++L+K  + + D+
Sbjct  375   GYQHRMQASGGCVDGKERNNNNLLLLSSSCPWDPRVRSLFFYNSGFSVALSKAPALVADM  434

Query  1340  QKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDI  1519
             Q+L DL P+++C L    G+L+RYV AS+AYLGK EDS++FD TYYRS     PR + D+
Sbjct  435   QRLRDLNPRAMCSLDAKMGVLIRYVGASSAYLGKTEDSVEFDFTYYRSHVHGRPRAHSDV  494

Query  1520  LEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQI  1699
             ++E+EQMA+ KYGA+PHWGKNRN AF GA  K+  A EFL+VK+++DP G+FSSEWSDQ+
Sbjct  495   IDELEQMALRKYGAVPHWGKNRNFAFHGAAGKHAKASEFLRVKERYDPDGIFSSEWSDQV  554

Query  1700  LGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LG+    ++   GCA++GLC+CS D+HCAP +GYFCR GKVY +A+VC
Sbjct  555   LGVDGSPNMAHKGCAIDGLCVCSHDSHCAPEQGYFCRPGKVYTEARVC  602



>ref|XP_010518353.1| PREDICTED: uncharacterized protein LOC104793653 isoform X2 [Camelina 
sativa]
Length=507

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/496 (57%), Positives = 362/496 (73%), Gaps = 7/496 (1%)
 Frame = +2

Query  101   PSHTISMAKMSINILITIYVQ-FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRG  277
             PSH    A     + I   +   L+FT  S+ PEDP+KC   NT       SYG FPDR 
Sbjct  7     PSHGYQNAAFWRTLFILHCISTLLVFTTISTPPEDPVKCVSGNTNCTVTN-SYGVFPDRS  65

Query  278   VCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLN  457
              CRAA   YP +EAEL+S++A AT+  +KM+  TRYSHSI KL C +G DGL ISTK+LN
Sbjct  66    TCRAANVAYPTSEAELVSVVAAATQAGQKMRVTTRYSHSITKLVCTDGTDGLFISTKFLN  125

Query  458   RTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWG  637
              T+  +A +MT+TVESGV+LRQ+I EAAK GLALPY+PYWWGLTVGG+MGTG+HGSSLWG
Sbjct  126   DTVRADADAMTLTVESGVTLRQLIAEAAKVGLALPYAPYWWGLTVGGMMGTGAHGSSLWG  185

Query  638   VGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQ  811
              GS+VHD+V  IR+V+P +  +G+A +R L +  +  +  AA+VSLGVLGVISQVTFKLQ
Sbjct  186   NGSAVHDYVTEIRMVSPGSANDGFAKVRVLSEITTPNEFNAAKVSLGVLGVISQVTFKLQ  245

Query  812   PMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLF  991
             PMFKRS+ +V++ND D G +A  FG +HEF+D  WLP    VVYR+DDRV+ NTSGNGLF
Sbjct  246   PMFKRSLRYVMRNDSDFGDQAITFGKKHEFSDFIWLPSQGKVVYRMDDRVAVNTSGNGLF  305

Query  992   DFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSG  1171
             DF   R+  +  L  +R  EE QE   D + KC+   LI+   ++  ++GLTN+G+ F+G
Sbjct  306   DFLPFRSQLSAALAIIRSSEETQERFRDGNGKCAGATLISS-TLFATAFGLTNNGIIFAG  364

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG QN M SSG+CLDSL D L   CPWD R+   FFHQTTFS+ LT++KSFI D++ 
Sbjct  365   YPVIGSQNRMMSSGSCLDSLQDGLITACPWDSRIKSEFFHQTTFSVPLTQIKSFINDIKS  424

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             LV +  KSLC L LY GILMRYV +S A+LGK+ +++DFD+TYYR+K+P+ PRLYED +E
Sbjct  425   LVQINSKSLCGLELYYGILMRYVTSSPAFLGKETEALDFDLTYYRAKNPLTPRLYEDFIE  484

Query  1526  EIEQMAMFKYGALPHW  1573
             EIEQ+A+FKY ALPHW
Sbjct  485   EIEQIALFKYNALPHW  500



>ref|XP_003573563.1| PREDICTED: L-gulonolactone oxidase-like [Brachypodium distachyon]
Length=589

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/534 (52%), Positives = 374/534 (70%), Gaps = 3/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG F DR +CRAA   YP+TE E+++ +A A   KRK+K AT++SHSIPKLACP G DG
Sbjct  41    AYGAFTDRTLCRAASVTYPRTEEEVIATVAAAASAKRKLKVATKHSHSIPKLACPGGHDG  100

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              ++ST  LNRT+ V+A+S  MTVESG+ LR + E AA AGL+LP+SPY++GLT+GGL+ T
Sbjct  101   AVVSTARLNRTVRVDAASRLMTVESGMLLRDLTEAAAAAGLSLPHSPYFYGLTIGGLLST  160

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG G + H++V+ +RIVTPA   +G+A +R L  G+ D+ AA+VS+GVLGV++
Sbjct  161   GAHGSSLWGKGGAAHEYVVGMRIVTPAPASKGFAMVRELVAGDPDLDAAKVSIGVLGVVT  220

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             Q+T  LQP FKRS+SFV +ND D  ++   +G  HEF D+ W P    V YR DDRV  +
Sbjct  221   QITLSLQPAFKRSVSFVKRNDTDFPEQVATWGRLHEFGDITWTPALGVVAYRQDDRVDVS  280

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
               GNG+ +    R+  T      R  EE  +     D                L  G TN
Sbjct  281   VPGNGVNELLLFRSTPTLEAIKARALEERLQQGNATDMARCEAVRREAATAERLGNGFTN  340

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             DGV F+G+PV+G+Q+ MQ+SG CLDS  D L   C WDPRV G F++ T FS+ L+K  +
Sbjct  341   DGVSFTGFPVVGHQHRMQASGACLDSPEDGLATACVWDPRVRGTFYYNTAFSVPLSKAPA  400

Query  1325  FIEDVQKLVDLEPKSLC-VLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVP  1501
             F+ ++QKL DL P + C  +    G+L+RYVKASTAYLGK  DS+ FDI YYRS+   +P
Sbjct  401   FVAEMQKLRDLNPAAFCTAVDPRLGVLLRYVKASTAYLGKPVDSVVFDIIYYRSRTDGMP  460

Query  1502  RLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             R++ D+++E+EQ+A+ KYG LPHWGKNR+ AF GAI KY +AG+FLKVK ++DP GLFS+
Sbjct  461   RVHADVVDELEQLALNKYGGLPHWGKNRDFAFDGAIAKYPNAGKFLKVKGRYDPEGLFSN  520

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             EW+D++LG+    S+V+  CA+EGLC+CS+D+HCAP  GYFCR GK+YK A+VC
Sbjct  521   EWTDKVLGVNGTPSVVEKHCAIEGLCVCSEDSHCAPELGYFCRPGKMYKKARVC  574



>gb|EEC72386.1| hypothetical protein OsI_05665 [Oryza sativa Indica Group]
Length=583

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/594 (51%), Positives = 403/594 (68%), Gaps = 31/594 (5%)
 Frame = +2

Query  110   TISMAKMSIN-ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCR  286
             ++  A+ +++ IL+ + V   +   G+S P DP+ C            +Y  FPDR  CR
Sbjct  4     SVVTARRAVHGILVAVVVVQRLLAAGASPPADPVHCASGTARCTVTN-AYAAFPDRSTCR  62

Query  287   AAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNR  460
             AA A YP +E ELL ++A A     KMKAATRY HS+PKL+CP   DG  L IST  LNR
Sbjct  63    AAAAAYPASEEELLRVVAAAAASGTKMKAATRYGHSVPKLSCPGAGDGRGLAISTSALNR  122

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
              + V+A+ M +TVESGV+L ++I+ AA AGLALP+SPYW G+TVGGL+ TG+HGSS+WG 
Sbjct  123   VVAVDAAGMAITVESGVTLAELIDAAAGAGLALPHSPYWLGVTVGGLLSTGAHGSSVWGN  182

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMF  820
             GS+VH++V  +RIVTPA  +EGYA +R L  G+ ++ AA+VSLGVLGVISQ         
Sbjct  183   GSAVHEYVNGMRIVTPAPAREGYAKVRVLAAGDPELDAAKVSLGVLGVISQHC-------  235

Query  821   KRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFF  1000
                       D DL +    F  +HEFAD+ W P     VYR+DDRV +NT G+G++DF 
Sbjct  236   ---------GDGDLAERVVAFAGEHEFADILWYPGHGKAVYRIDDRVPSNTPGDGVYDFV  286

Query  1001  GLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYP-  1177
             G RA  T  + A R  E+  E+ G+A  KC      N  ++   +YGLT +G     +P 
Sbjct  287   GFRATPTLAIQAKRLVEDGLEATGNAAGKCLAASTTNS-ILAARNYGLTRNGQLLGAFPG  345

Query  1178  --VIGYQNHMQSSGTCLDSLNDNL--TCPWDPRV-NGLFFHQTTFSISLTKVKSFIEDVQ  1342
               V+GYQN +QSSG+CL   +D L   CPWDPRV +G FF Q+  S+ L++  +FI DVQ
Sbjct  346   TAVVGYQNRIQSSGSCLAGADDGLLTACPWDPRVEHGTFFFQSGISVPLSRAAAFIRDVQ  405

Query  1343  KLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDIL  1522
             +L DL P +LC + LYDG+LMRYV+AS A+LGK EDS+DFD+TYYRS+DP  P L+ED++
Sbjct  406   RLRDLNPDALCGVELYDGVLMRYVRASAAHLGKPEDSVDFDLTYYRSRDPATPLLHEDVV  465

Query  1523  EEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY--KSAGEFLKVKKKFDPLGLFSSEWSDQ  1696
             EE+EQMA+ KYG +PHWGKN+N AF+GA  KY    A  F++VK+ +DP GLFSSEWSD+
Sbjct  466   EEVEQMALRKYGGVPHWGKNQNAAFEGAAAKYGGARAAAFMRVKRAYDPEGLFSSEWSDK  525

Query  1697  ILGL--KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             +LG+    G+S+V+DGCALEGLC+CS+D HC+P KGY CR G+VYK+A+VC ++
Sbjct  526   VLGVAGAGGVSVVRDGCALEGLCVCSEDAHCSPEKGYLCRPGRVYKEARVCRRV  579



>ref|XP_002962083.1| hypothetical protein SELMODRAFT_77373 [Selaginella moellendorffii]
 gb|EFJ37343.1| hypothetical protein SELMODRAFT_77373 [Selaginella moellendorffii]
Length=573

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/532 (51%), Positives = 363/532 (68%), Gaps = 2/532 (0%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YGT+PDR  C+AA+  YP +E +++  +A   +   KMK  TR SHSIPKL CP GD G
Sbjct  34    TYGTWPDRSTCKAAQVFYPASEQQIVDAVAFGVRNNMKMKVVTRLSHSIPKLVCPGGDQG  93

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+ISTK  +R + ++ ++MT+TV+SGV LR  ++  A + LA P S YW G+T+GGL+ T
Sbjct  94    LVISTKNYSRGIVIDRAAMTVTVDSGVELRNFVDTLASSQLAFPQSSYWSGVTIGGLLST  153

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSL  +GS+VH++V  IR+V PA+  EGYA + T  Q + D+ A +VSLGVLGV+S
Sbjct  154   GAHGSSLRDLGSAVHEYVTSIRLVVPASPAEGYAKVLTFTQASEDLDAVKVSLGVLGVLS  213

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             ++T K++PMFKRS++  +++D DL  +   F   +++ D+ W P     VYR+D RV + 
Sbjct  214   KITLKVEPMFKRSVTNTMRSDSDLEDQVATFANGNDYGDITWYPSMNQAVYRIDQRVPSI  273

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
               GNG+ DF G +        A R  E   E   D    C N+  +  + +W   YGL N
Sbjct  274   VPGNGVNDFIGFQPTAVLISQATRTTERVFEFTRDTQGTC-NRARLQAFTLWTTGYGLKN  332

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFI  1330
             +GV F+GYP+IG QN +Q+SGTC +S +   TCPWDP ++GLFFHQTT SI+L + + FI
Sbjct  333   NGVLFTGYPLIGNQNRIQTSGTCYNSSSSLFTCPWDPSIDGLFFHQTTISIALERSRDFI  392

Query  1331  EDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLY  1510
              DV++L +     LC    Y G LMRYVK S+AYLGK EDS+D D+TYYR+ D   PRL 
Sbjct  393   LDVKRLRNATLNGLCGPDGYSGSLMRYVKKSSAYLGKPEDSVDIDVTYYRADDANTPRLN  452

Query  1511  EDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWS  1690
             ED+LEE+EQMA+FKY   PHWGKNRNVAF  A RKY +  +FL  KK+ DP GLFSSEWS
Sbjct  453   EDVLEELEQMAVFKYQGTPHWGKNRNVAFVNASRKYPNLPKFLDAKKRLDPNGLFSSEWS  512

Query  1691  DQILGLKT-GLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             D +LG+ T GL+  KD CALEGLCICS D HCAP +GYFCR G+V++ A+VC
Sbjct  513   DLVLGVTTAGLTSDKDHCALEGLCICSSDRHCAPERGYFCRPGRVFQQARVC  564



>gb|EMT18657.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=574

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/558 (51%), Positives = 388/558 (70%), Gaps = 9/558 (2%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              G S P DP+    + T NCTITN+YG+F DR +CRAAK  YP+TE EL++ +A     K
Sbjct  17    AGCSPPPDPV-MCTHGTSNCTITNTYGSFTDRTICRAAKVTYPRTEQELVAAVAAVASTK  75

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             +K++ AT++SHSIPKLACP GDDG +IST  LNRT+ V+A+   MTVESG+ LR ++E A
Sbjct  76    QKVRVATKHSHSIPKLACPGGDDGTIISTAQLNRTVRVDAAKRLMTVESGMLLRDLVEAA  135

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A AGL+LP+SPYW GLT+GGL+ TG+HGSSLWG G + H++V+ +RIVTPA   +G+A +
Sbjct  136   AAAGLSLPHSPYWHGLTIGGLLSTGAHGSSLWGKGGAAHEYVVGLRIVTPAPASQGFAVV  195

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L   + D+ AA+VSLGVLGVIS VT  +QP+FKRS++ V ++D D  ++   +G  HE
Sbjct  196   RELGADHPDLDAAKVSLGVLGVISHVTLAMQPLFKRSVTLVKRDDSDFQEQVALWGHLHE  255

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             + DM WLP    V+YR DDRV  +T GNGL+D   +R   T  L   R  EE  +  G  
Sbjct  256   YGDMTWLPHQGKVIYRQDDRVDVSTPGNGLYDLPLIR---TRELIDARAAEERLQENGTD  312

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C               +  TNDGV F+GYPV+GYQ+ +Q+ GTC +S  D L  +C 
Sbjct  313   TARCEAAQQQAAASERLNVF--TNDGVSFTGYPVVGYQHRIQAFGTCFNSPEDGLLTSCA  370

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC-VLGLYDGILMRYVKASTA  1429
             WDPR+ G F + + FS+ L+K  +F+ D+Q+L +L P S C  +    G+L+RYVKAS+A
Sbjct  371   WDPRIRGFFNYNSGFSVPLSKAPAFVADMQRLRNLNPDSFCSSVDPSIGVLLRYVKASSA  430

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLGK EDSI  DI +YRS    +PR + D+++EIEQ+A+ KYG +PHWGK+RN AF GAI
Sbjct  431   YLGKPEDSIGVDIIFYRSHTEGMPRAHADVVDEIEQLALHKYGGIPHWGKSRNFAFDGAI  490

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
              KY    EFL+VK ++DP GLFS+EW+D++LG+    +I+K  CA+EGLC+CS ++HCAP
Sbjct  491   TKYPKVHEFLRVKDRYDPKGLFSNEWTDKVLGINGSPNIIKKRCAIEGLCVCSNNSHCAP  550

Query  1790  NKGYFCRAGKVYKDAKVC  1843
              +GYFCR GKVYK+A+VC
Sbjct  551   EQGYFCRPGKVYKEARVC  568



>gb|EMT25480.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=575

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/533 (53%), Positives = 385/533 (72%), Gaps = 3/533 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             ++G+F DR VCRAA A +P+TE EL++ +A A+  KRK+K AT++SHS PKLACP G D 
Sbjct  38    AFGSFLDRTVCRAAHATFPRTEKELVAAVAAASAAKRKVKVATKHSHSFPKLACPGGSDA  97

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              +IST+ LNR + V+ +   MTVESG+ LR +I+ AA  GLALP+SPYW GLT+GGL+ T
Sbjct  98    TIISTERLNRVVSVDVAKGLMTVESGMVLRDLIQAAAAKGLALPHSPYWSGLTIGGLLAT  157

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSLWG G +VH++V+ +RIVTPA   +G+A +R L   + D+ AA+VSLGVLGV+S
Sbjct  158   GAHGSSLWGKGGAVHEYVVGMRIVTPAPASQGFAVVRELCADHPDLNAAKVSLGVLGVVS  217

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  LQPMFKRS++FV ++D D+ ++A ++G  HEF DM WLP+ R V+YR DDRV+  
Sbjct  218   QVTLALQPMFKRSVTFVTRDDSDMAEKAARWGDLHEFGDMAWLPQLRKVIYREDDRVAIK  277

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             T G+GL D  G R+  T  L + R   E  E   +A  +C       V +   ++YG TN
Sbjct  278   TVGDGLNDHLGFRSNPTAPLISGRVTMELLEKNINAIARCKAA-NATVSLFETVAYGFTN  336

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             +G  F+GYPV+G+Q+ +Q+SG CL S  D L  +C WDPR+ G FF+   +SI+L++V +
Sbjct  337   NGSMFTGYPVVGFQHQIQASGACLGSQEDALLTSCAWDPRIRGTFFYTNGYSIALSRVPA  396

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI D+Q+L D  P S C +    G+L+RYVKAS+AYLGK EDSIDFDI+YYRS     P 
Sbjct  397   FIADMQQLRDRSPLSFCGIDASVGMLLRYVKASSAYLGKPEDSIDFDISYYRSYSKGEPN  456

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
              + D+L+E++QMA+ KY A+PHWGKNRN AF+G + K+  A +FL+VK+++DP G+FSSE
Sbjct  457   PHYDVLDELQQMALHKYSAIPHWGKNRNFAFEGTMAKHPKADKFLEVKQRYDPDGIFSSE  516

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSDQ+LG+    +I +  CA+EG+CICS D+HCAP +GY+C  GKVY DA+VC
Sbjct  517   WSDQVLGINGSPAIFEKHCAIEGMCICSDDSHCAPEEGYYCLPGKVYTDARVC  569



>ref|XP_002971003.1| hypothetical protein SELMODRAFT_94694 [Selaginella moellendorffii]
 gb|EFJ27601.1| hypothetical protein SELMODRAFT_94694 [Selaginella moellendorffii]
Length=571

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/532 (51%), Positives = 360/532 (68%), Gaps = 2/532 (0%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YGT+PDR  C+AA+  YP +E +++  +A   +   KMK  TR SHSIPKL CP GD G
Sbjct  34    TYGTWPDRSTCKAAQVFYPASEQQIVDAVAFGVRNNMKMKVVTRLSHSIPKLVCPGGDQG  93

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+ISTK  +  + ++  +MT+TV+SGV LR  ++  A + LA P S YW G+T+GGL+ T
Sbjct  94    LVISTKNYSSGIVIDREAMTVTVDSGVELRNFVDTLASSQLAFPQSSYWSGVTIGGLLST  153

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSSL  +GS+VH++V  IR+V PA+  EGYA + T  Q + D+ A +VSLGVLGV+S
Sbjct  154   GAHGSSLRDLGSAVHEYVTSIRLVVPASPAEGYAKVLTFTQASEDLDAVKVSLGVLGVLS  213

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             ++T K++PMFKRS++  +++D DL  +   F   +++ D+ W P     VYR+D RV + 
Sbjct  214   KITLKVEPMFKRSVTNTMRSDSDLEDQVATFANGNDYGDITWYPSMNQAVYRIDQRVPSI  273

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
               GNG+ DF G +        A R  E   E   D    C N+  +  + +W   YGL N
Sbjct  274   VPGNGVNDFIGFQPTAVLISQATRTTERVFEFTRDTQGTC-NRARLQAFTLWTTGYGLKN  332

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFI  1330
             +GV F+GYP+IG QN +Q+SGTC +S +   TCPWDP ++GLFFHQTT SI+L + + FI
Sbjct  333   NGVLFTGYPLIGNQNRIQTSGTCYNSSSSLFTCPWDPSIDGLFFHQTTISIALERSRDFI  392

Query  1331  EDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLY  1510
              DV++L +     LC    Y G LMRYVK S+AYLGK EDS+D D+TYYR+ D   PRL 
Sbjct  393   LDVKRLRNATSNGLCGPDGYSGFLMRYVKKSSAYLGKPEDSVDIDVTYYRADDANTPRLN  452

Query  1511  EDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWS  1690
             ED+LEE+EQMA+FKY   PHWGKNRNVAF  A RKY +  +FL  KK+ DP  LFSSEWS
Sbjct  453   EDVLEELEQMAVFKYQGTPHWGKNRNVAFVNASRKYPNLPKFLDAKKRLDPNALFSSEWS  512

Query  1691  DQILGLKT-GLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             D +LG+ T GL+  KD CALEGLCICS D HCAP +GYFCR G+V++ A+VC
Sbjct  513   DLVLGVTTAGLTSDKDHCALEGLCICSSDRHCAPERGYFCRPGRVFQQARVC  564



>gb|EAZ05385.1| hypothetical protein OsI_27592 [Oryza sativa Indica Group]
Length=567

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/577 (51%), Positives = 391/577 (68%), Gaps = 28/577 (5%)
 Frame = +2

Query  125   KMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVY  304
             +  + +L+ + V   +   G+S P  P+ CT   T        YG+FPDR +CRAA A +
Sbjct  2     RTMLPLLVILVVGLRL--AGASPPPQPVACTKGTTDCTVTNV-YGSFPDRTICRAADASF  58

Query  305   PKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASS  484
             P+TEAEL++ +A A   +RK KAATR+SHS PKLACP G DG +IST++LNRT       
Sbjct  59    PRTEAELVAAVAAAAAAERKAKAATRHSHSFPKLACPGGRDGTIISTRFLNRT-------  111

Query  485   MTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHV  664
                               A AGLALP+SPYW+GLTVGGL+ TG+HGSSLWG GS+VH++V
Sbjct  112   ---------------GRRAAAGLALPHSPYWYGLTVGGLLATGAHGSSLWGKGSAVHEYV  156

Query  665   IHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVV  844
             + +RIVTPA   +G+A +R L  G+ D+ AA+VSLGVLGVISQVTF+LQP FKRS+ FV 
Sbjct  157   VGLRIVTPAPASQGFAVVRELVAGDPDLDAAKVSLGVLGVISQVTFELQPQFKRSVRFVT  216

Query  845   KNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTD  1024
             ++D D  ++   +G  HEF DM WLPR   V+YR DDRV   T GNGL D+ G RA  T 
Sbjct  217   RDDSDFAEKVAVWGGAHEFGDMAWLPRQGKVIYREDDRVDVATPGNGLNDYLGFRAQPTL  276

Query  1025  CLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQ  1204
              L   R  EE  E  G    +C    L    +    +YG T+DGV F+G+PV+G+Q+ +Q
Sbjct  277   GLITARAAEERLERNGTDIARCLAARLPPS-LFELQAYGFTHDGVFFTGWPVVGFQHRIQ  335

Query  1205  SSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCV  1378
             +SGTC+ S  D L  +C WDPR+ G F + + FSI+L +  +F+ D+ +L DL P++ C 
Sbjct  336   ASGTCISSPEDGLLSSCTWDPRIRGPFLYNSGFSIALPRAAAFVADMMRLRDLNPRAFCD  395

Query  1379  LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYG  1558
             +    GILMRYVKAS+AYLGK ED +DFD+TYYRS D   PR + D+ +E+EQMA+ KYG
Sbjct  396   IDAKLGILMRYVKASSAYLGKPEDCVDFDVTYYRSYDDGEPRPHSDVFDELEQMALRKYG  455

Query  1559  ALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
             A+PHWGKNRN AF GA  KY ++GEF+KVK+++DP G+FSSEWSDQ+LG+    +IV   
Sbjct  456   AVPHWGKNRNFAFDGAAAKYPNSGEFIKVKERYDPDGIFSSEWSDQVLGISGSPNIVDKR  515

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             CA+EGLC+CS D+HCAP  GYFCR GK++K+A+VC K
Sbjct  516   CAIEGLCVCSDDSHCAPELGYFCRPGKLFKEARVCSK  552



>gb|KHG01649.1| L-gulonolactone oxidase [Gossypium arboreum]
Length=501

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/452 (62%), Positives = 350/452 (77%), Gaps = 4/452 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
             VG S P +P+KC+  ++       SYG FPDR VCRA   VYP +E E +SI++ AT+ +
Sbjct  28    VGCSPPGEPVKCSTKDSNCTVTN-SYGAFPDRTVCRAGNVVYPISEQESVSILSAATEVQ  86

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RKMK  T +SHSIPKL CP+G DGLLISTK LNR +++N ++MTMTVESGV+LRQ+I EA
Sbjct  87    RKMKVVTHFSHSIPKLVCPDGQDGLLISTKNLNRVVKINLTAMTMTVESGVTLRQLINEA  146

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             AKAGLALPY+PYWWGLT+GGL+GTG+HGSSLW  GSSVHD+V+ +RIV+PA  ++GYA +
Sbjct  147   AKAGLALPYAPYWWGLTIGGLLGTGAHGSSLWEKGSSVHDYVVEMRIVSPAKAEDGYAKV  206

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
               L + + D+ AA+VSLGVLGVISQVT KLQ +FKRSI++V+K+D DLG +   FG  HE
Sbjct  207   WVLNESDKDLDAAKVSLGVLGVISQVTLKLQFLFKRSITYVMKDDTDLGDKVVTFGKLHE  266

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FADM W P  R V YR+DDRV  N SG+G++ F   R+  +  L+ +R  EE QES+ D 
Sbjct  267   FADMFWYPSQRKVAYRIDDRVPVNVSGSGVYYFTPFRSTLSSVLSVIRSVEETQESLRDT  326

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
             + KC N  L+    +   +YGLT++GV F+GYPVIG+ + +QSSGTCLDS  D+L   CP
Sbjct  327   EGKCLNAKLVTS-TLQSSAYGLTDNGVIFTGYPVIGFHHRLQSSGTCLDSHKDSLITACP  385

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPR+ G FFHQTTFSI L+ VKSFI+DVQKLV ++PKSLC L LY+GI+MRYVKASTAY
Sbjct  386   WDPRIKGEFFHQTTFSIDLSVVKSFIQDVQKLVSMDPKSLCGLELYNGIVMRYVKASTAY  445

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEE  1528
             LGKQED+IDFDITYYRSKDPM PRLY+D+LEE
Sbjct  446   LGKQEDAIDFDITYYRSKDPMAPRLYQDVLEE  477



>gb|EMT11279.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=586

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/564 (52%), Positives = 395/564 (70%), Gaps = 10/564 (2%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnc-titnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQ  355
              GSS P +P+ C      +  T++N+YG+FPD  VCRAA A +P+TE EL++   G    
Sbjct  19    AGSSPPPEPVVCDYAYGTSGCTVSNAYGSFPDHTVCRAADATFPRTEEELVAARGGVAAG  78

Query  356   KRKMK------AATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSL  517
                         AT++SHS PKLACP G+DG +IST  LNRT+ V+A+   MTVESG+ L
Sbjct  79    AAASAAKRKVKVATKHSHSFPKLACPGGNDGAIISTARLNRTVSVDAAKGLMTVESGMVL  138

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATE  697
             R +I+ AA+AGLALP+SPYW GLT+GGL+ TG+HGSSL G G +VH++V+ +RIVTPA  
Sbjct  139   RDLIQAAAQAGLALPHSPYWSGLTIGGLLATGAHGSSLKGKGGAVHEYVVGMRIVTPAPA  198

Query  698   KEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEAT  877
              +G+A +R L+  + D+ AA+VSLGVLGV+SQVT  LQPMFKRS++FV  +D DL ++AT
Sbjct  199   SQGFAVVRELRAHDPDLDAAKVSLGVLGVVSQVTLALQPMFKRSVTFVTCDDSDLAEQAT  258

Query  878   KFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEH  1057
             K+G  HEF DM WLP  R V+YR DDRV+  ++G+GL ++   R+  T  L A R  EE 
Sbjct  259   KWGNLHEFGDMAWLPEQRKVIYRKDDRVAITSAGDGLNNYIAFRSNPTAALMAARVTEEL  318

Query  1058  QESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
              E    A  +C     + V     ++YG TN+G  F+GYPV+G+Q+ +Q+S  C+ S  D
Sbjct  319   LEKNASASARCKAAHKM-VSSFETVAYGFTNNGHLFTGYPVVGFQHRIQASSACVGSPED  377

Query  1238  NL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRY  1411
              L  +CPWDPR  GL F+   +SI+L+KV +FI D+++L +  P + C +    G+L+RY
Sbjct  378   MLLTSCPWDPRTRGLHFYSNAYSIALSKVSAFIADMKQLRERNPLAFCGIDAKMGMLLRY  437

Query  1412  VKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNV  1591
             VKAS+AYLGK EDSIDFDITYYRS     P  + D+L+E++QMA+ KYGA+PHWGKNRN 
Sbjct  438   VKASSAYLGKSEDSIDFDITYYRSYTRGEPSPHSDVLDELQQMALRKYGAIPHWGKNRNF  497

Query  1592  AFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQ  1771
             AF+GAI KY  A +FL+VK ++D  G+FSSEWSDQ+LG+     IV+ GCA+EGLCICS+
Sbjct  498   AFEGAIDKYPKADKFLEVKGRYDADGIFSSEWSDQVLGISGSPIIVEKGCAIEGLCICSE  557

Query  1772  DNHCAPNKGYFCRAGKVYKDAKVC  1843
               HCAP KGY+CR GKVY +A+VC
Sbjct  558   HLHCAPEKGYYCRPGKVYTEARVC  581



>ref|XP_002974095.1| hypothetical protein SELMODRAFT_100820 [Selaginella moellendorffii]
 gb|EFJ25050.1| hypothetical protein SELMODRAFT_100820 [Selaginella moellendorffii]
Length=584

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/534 (52%), Positives = 368/534 (69%), Gaps = 4/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YGT+PDR +C+  +  +P TE EL+ I+A   K + KMK  +  +HSIPK ACP G  G
Sbjct  40    AYGTWPDRSLCKVGEVAFPSTEQELVDIVAHGVKNRMKMKVVSNSAHSIPKFACPGGTSG  99

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+IST   +  + V ASSMT+T +SGV L ++++E  + GLALP SPYW G+++GGL+ T
Sbjct  100   LVISTAKYSSRIVVTASSMTVTADSGVELSRLLQEIGRHGLALPSSPYWNGISLGGLLST  159

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD-IKAARVSLGVLGVI  787
             GSHGSSL+G GS+VH++V  + +V PA EKEG+A +  + + + D + AA+VSLGVLGVI
Sbjct  160   GSHGSSLFGKGSAVHEYVKAMTMVVPAPEKEGFAKVVNITEQDEDFMNAAKVSLGVLGVI  219

Query  788   SQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST  967
             SQVT  LQP+FKRS++    +D +L KE  +FG  HEF D+ W+P    ++YR DDRV  
Sbjct  220   SQVTLALQPIFKRSVTKFEASDVNLEKEILEFGKNHEFGDVSWIPSKYKLIYRADDRVPA  279

Query  968   NTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT  1147
             +TSG+G+ DF G +   T  + A R  EE  E  GD+  KC+   L+   +++    G  
Sbjct  280   STSGDGVNDFIGFQPTLTTIVEAQRALEEAFEISGDSPGKCATG-LVQTQVLFTTGEGFK  338

Query  1148  -NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
              + G  F+GYPV+G+ + +QSSG C  S +  L CPWDP V GLF+HQTT SIS+ K++ 
Sbjct  339   KSSGGVFTGYPVVGFHHKIQSSGACQASTSRQLVCPWDPTVRGLFYHQTTVSISVDKIQD  398

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL  L P +LC + LY+G LMRYV+AS+AYLGKQ D++D DITYYR++    PR
Sbjct  399   FITDVKKLRALNPAALCGVDLYNGFLMRYVRASSAYLGKQSDAVDVDITYYRARSGNTPR  458

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAF-QGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             L ED+LEE+EQMA+FKYG LPHWGKNRN+AF    + KY    EFL VK K DP G FSS
Sbjct  459   LDEDVLEEVEQMALFKYGGLPHWGKNRNIAFGPRTVAKYPKLQEFLAVKSKLDPDGFFSS  518

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             EWSD  LG+  G S     CALEG+C+CS D+HCAP   YFCR G+VY DA+VC
Sbjct  519   EWSDFALGISGGSSSNLPHCALEGVCVCSLDSHCAPENYYFCRPGRVYTDARVC  572



>ref|XP_004973273.1| PREDICTED: uncharacterized protein LOC101767367 [Setaria italica]
Length=588

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/558 (52%), Positives = 381/558 (68%), Gaps = 7/558 (1%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             SS P DP+ C+   +       + G FPDR +CRAA A+YP+TE ELL+ +A A   KRK
Sbjct  19    SSPPLDPVACSNGMSNCTVTNAN-GYFPDRSICRAANAIYPRTEQELLAAVAAAAVAKRK  77

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             +K ATRYSHS  KL CP G DG +IST++LNRT++++     +TVESG+ L  ++  AA 
Sbjct  78    VKVATRYSHSFTKLTCPGGRDGTIISTRWLNRTVQIDGKKGLLTVESGMVLSDLMRVAAA  137

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
             AGL LP SPYW  +TVGGL+ TG+HGSSLWG GS+VH++V+ IRIVTPA   +G+A +R 
Sbjct  138   AGLCLPNSPYWSAVTVGGLLATGAHGSSLWGKGSAVHEYVVGIRIVTPAPASQGFAVVRE  197

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L   + D+ A +VSLGVLGVISQVT  LQP+FKRS++FV +++ DL  +   +G  HEF 
Sbjct  198   LGADHPDLDAVKVSLGVLGVISQVTLALQPLFKRSVTFVTRDESDLADQVAAWGGLHEFG  257

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFD---FFGLRAVGTDCLNALREKEEHQESIGD  1075
             D++WLP  R V+YR D+RV  ++ GNGL D   F+ L A          E+ E      D
Sbjct  258   DIRWLPHQRKVIYREDNRVDISSPGNGLNDFPAFWSLPAHEIVAARVEEERREEDNGGTD  317

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TC  1249
              D +CS      V +     +G TNDGV F+ YPV+GYQ+ MQ+S  C+DS  D L   C
Sbjct  318   DDARCSAAQQSTVALE-RQGHGFTNDGVSFTSYPVVGYQHRMQASSACVDSPEDGLQSAC  376

Query  1250  PWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTA  1429
              WDPR+ G   +   F+++L++  SF+ DV +L DL P + C L    G+ MRYVKAS+A
Sbjct  377   FWDPRLRGPSLYNPAFTVALSRAPSFLADVWRLRDLHPSAFCTLHGAMGVQMRYVKASSA  436

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLGK EDSI  DI YYRS+   VPR + D+++E+EQMA+ KYG +PHWGK+RN AF GAI
Sbjct  437   YLGKPEDSIAVDIAYYRSRTRGVPRAHADVVDELEQMALRKYGGVPHWGKSRNFAFDGAI  496

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
              +Y  AGEFL+VK ++DP G+FSSEWSDQ+LG+K    +V  GCA+EGLC+CS D+HCAP
Sbjct  497   ARYPKAGEFLEVKDRYDPDGIFSSEWSDQVLGIKGSPIVVGKGCAIEGLCVCSDDSHCAP  556

Query  1790  NKGYFCRAGKVYKDAKVC  1843
              +GYFCR GKVY +A+VC
Sbjct  557   EQGYFCRPGKVYAEARVC  574



>ref|XP_008790302.1| PREDICTED: uncharacterized protein LOC103707548 [Phoenix dactylifera]
Length=611

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/577 (50%), Positives = 385/577 (67%), Gaps = 16/577 (3%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
             FL     S  P  P+    +   NCT+TN+YG FPDR  CR A   YP  E ELL  ++ 
Sbjct  13    FLFHLPASGSPPGPVIKCTSGDTNCTVTNAYGAFPDRSTCRVAAVTYPTNEQELLLAVSN  72

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGVSL  517
             A+  K+ MKA + Y+HSIPKL+CP G  G  L IST+ LN+ + V+ +S  MTVE+G++L
Sbjct  73    ASFAKQHMKAVSAYAHSIPKLSCPGGPSGAGLAISTERLNKLVSVDPASSRMTVEAGITL  132

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPA-T  694
             R +++ AA  GLA+P+SPYW G+T+GGL+GTGSHGSS++G GS+VH++V+ +R+V P+  
Sbjct  133   RALLDVAAANGLAVPHSPYWEGVTLGGLLGTGSHGSSVFGKGSAVHEYVVGMRLVVPSPV  192

Query  695   EKEG-YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKE  871
             + +G YA + +L + + D+ AA+VSLGVLGV+SQVT +L+PMFKRSI+  V+ D    + 
Sbjct  193   QIDGLYARVVSLGEDDPDLLAAKVSLGVLGVVSQVTLQLEPMFKRSITNRVQRDEAFEQT  252

Query  872   ATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKE  1051
                F F  ++ D+ W P    VVY  D ++  N +G G  DF G R      + + R  E
Sbjct  253   IASFAFTTQYGDITWYPSQAIVVYGDDVKLPINATGKGENDFLGFRPQARLIIKSTRALE  312

Query  1052  EHQESIGDADEKCSNQWLINVWMVWFLSYGL---TNDG--VKFSGYPVIGYQNHMQSSGT  1216
             E  E+  DA+ KC    L    ++  L  G+    NDG  V F+GYPVIG Q+ MQSSG+
Sbjct  313   ELAEAREDANGKC---LLAKTQVISLLLLGMGLKNNDGSIVDFTGYPVIGNQSDMQSSGS  369

Query  1217  CLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLY  1390
             CL S  DN+   C WDPR+ G+F+HQTT SI  T + SFI DV+KL D  P +LC   LY
Sbjct  370   CLRSPEDNVQTACGWDPRIPGIFYHQTTASIPFTSIASFIADVKKLRDANPGALCGTELY  429

Query  1391  DGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPH  1570
              G LMR+V+ STAYLGK ED +D DITYYRS+DP  PRL+ED+LEEIEQMA+FKY  LPH
Sbjct  430   LGFLMRFVRNSTAYLGKTEDCVDIDITYYRSRDPEQPRLFEDVLEEIEQMALFKYNGLPH  489

Query  1571  WGKNRNVAFQGAIRKYKSAG-EFLKVKKKFDPLGLFSSEWSDQILGLK-TGLSIVKDGCA  1744
             WGKNRN+ F     K  + G EF+ V +K+D  GLFSS+W+D +LGL+   L I   GCA
Sbjct  490   WGKNRNIGFLKVREKLGAKGDEFVSVMEKYDQEGLFSSDWTDAVLGLRGKELVISGKGCA  549

Query  1745  LEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             LEGLCICS D+HCAP KGY+CR G+VY +A+VC +I 
Sbjct  550   LEGLCICSDDDHCAPEKGYYCRPGQVYGEARVCRRIQ  586



>emb|CAE05914.1| OSJNBa0034E24.8 [Oryza sativa Japonica Group]
 emb|CAH66583.1| OSIGBa0111E13.1 [Oryza sativa Indica Group]
 emb|CAH66654.1| OSIGBa0113I06.5 [Oryza sativa Indica Group]
 gb|EAY93709.1| hypothetical protein OsI_15499 [Oryza sativa Indica Group]
Length=662

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/543 (53%), Positives = 384/543 (71%), Gaps = 14/543 (3%)
 Frame = +2

Query  254   YGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGL  433
             YG+FPDR  CRAA   YP+TE EL++ +A A    RK KAATRYS+S P+LACP G +G 
Sbjct  88    YGSFPDRAACRAAGVAYPRTEEELVAAVAAAAAAGRKAKAATRYSNSFPRLACPGGVEGE  147

Query  434   L---ISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
                 IST++LNRT+ V+A+   MTVE G+ LR +I EAA AGLALP+SPYW G+TVGG +
Sbjct  148   GGVAISTRWLNRTVRVDAARRLMTVEGGMVLRDLIREAAAAGLALPHSPYWSGVTVGGAL  207

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSSLWG GS+VH++V+ +RIVTPA   EG+A +R L   + D+ AA+VSLGVLG+
Sbjct  208   ATGAHGSSLWGKGSAVHEYVVGMRIVTPAAASEGFAVVRELAADDPDLDAAKVSLGVLGI  267

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             ISQVT  L+P FKRS+ FV ++D D+ ++   +G  HEF DM WLP  R V+YR D+RV+
Sbjct  268   ISQVTLALEPQFKRSVKFVKRDDADIAEKVAVWGRLHEFGDMVWLPGQRQVIYREDNRVN  327

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEE--HQESIGDADEKCSNQWLINVWMVWFLSY  1138
              +T G+GL D+FG RA  T  +   R  +E   +  +     +C     +   M   L+Y
Sbjct  328   ISTPGDGLNDYFGFRAQPTLSMVGARVIDECLEENPMYTDTARCLASRAVTK-MFDLLAY  386

Query  1139  GLTNDGVKFSGYPVIGYQNHMQSSGTCLDSL---NDNL----TCPWDPRVNGLFFHQTTF  1297
             G TNDG  F+GYPV+GYQ+ +QSSG+C+ SL   +D L    TCPWD R  G+F +   F
Sbjct  387   GFTNDGATFTGYPVVGYQHRIQSSGSCMGSLEEKDDGLLLTTTCPWDRRTRGVFAYNVAF  446

Query  1298  SISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYY  1477
             ++ L++  +F+ DV +L DL+P + C +    G+L+RYV AS+AYLGK EDS+DFD+TYY
Sbjct  447   TVPLSRAPAFVADVSRLRDLDPAAFCQIDAKMGVLVRYVAASSAYLGKAEDSVDFDVTYY  506

Query  1478  RSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKF  1657
             RS+    PR + D+ +E+EQMA+  +G +PHWGKNRN AF GAI +Y +AGEFL+VK +F
Sbjct  507   RSRARGAPRAHADVFDEVEQMALRGHGGVPHWGKNRNAAFDGAIARYPNAGEFLRVKDRF  566

Query  1658  DPLGLFSSEWSDQILGL-KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDA  1834
             DP G+FSSEWSD++LG+     +IV DGCA+EGLC+CS D+HCAP  GYFCR GKV+ +A
Sbjct  567   DPEGVFSSEWSDRVLGVGGASPAIVGDGCAMEGLCVCSDDSHCAPELGYFCRPGKVFTEA  626

Query  1835  KVC  1843
             +VC
Sbjct  627   RVC  629



>dbj|BAJ99730.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=562

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/498 (55%), Positives = 364/498 (73%), Gaps = 3/498 (1%)
 Frame = +2

Query  356   KRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KRK+K ATR+SHS  KLACP G DG +IST+ LN+T+ V+A+   MTVESG+ L+ +I+ 
Sbjct  49    KRKVKVATRHSHSFTKLACPGGRDGTIISTERLNKTVSVDAAKGLMTVESGMVLKDLIQA  108

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             AA AGLALP+SPYW+GLT+GGL+ TG+HGSSL G GS+VH++V+ +RIVTPA   +G+A 
Sbjct  109   AAAAGLALPHSPYWYGLTIGGLLATGAHGSSLRGKGSAVHEYVVGMRIVTPAPASQGFAV  168

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             +R L  G+ D+ A +VSLGVLGV+SQVT  LQPMFKRS++F  ++D D   +A  +G  +
Sbjct  169   VRELSIGDPDLDAVKVSLGVLGVVSQVTLALQPMFKRSVTFEKRDDTDFASQAAMWGGLY  228

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EF DM WLPR   V+YR DDRV  +T GNGL D+ G R+  T  L   R  EEH +  G 
Sbjct  229   EFGDMAWLPRQGKVIYRKDDRVPVSTKGNGLNDYLGFRSNPTLALITARATEEHLQKDGS  288

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TC  1249
                +C      +V +    +YG TNDG  F+G+PV+G+QN +Q+SGTC+ S  D L  +C
Sbjct  289   NIARCLAARAPSV-LFELQAYGFTNDGSFFTGWPVVGFQNRIQASGTCISSPEDGLLSSC  347

Query  1250  PWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTA  1429
              WDPR+   FF+ + FS++L+K  +FI ++QKL DL+P++ C L    G+L+RYV+AS+A
Sbjct  348   TWDPRIRSPFFYNSGFSVALSKAPAFIAEMQKLRDLKPRAFCGLDAKLGVLLRYVRASSA  407

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLGK EDSIDFD+TYYRS     PR   D+++EIEQ+A+ KYGA+PHWGKNRN  F G I
Sbjct  408   YLGKSEDSIDFDVTYYRSYTEGEPRADSDVVDEIEQLALRKYGAVPHWGKNRNFVFDGVI  467

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
              KY  A EFLKVK ++DP G+FSSEWSDQ+LG+K   +IV+ GCA+EGLC+CS+D+HCAP
Sbjct  468   AKYPKAAEFLKVKARYDPDGIFSSEWSDQVLGVKGSPNIVQKGCAIEGLCVCSEDSHCAP  527

Query  1790  NKGYFCRAGKVYKDAKVC  1843
              KGYFCR G V+ +A+VC
Sbjct  528   EKGYFCRPGTVFPEARVC  545



>ref|XP_002968876.1| hypothetical protein SELMODRAFT_91192 [Selaginella moellendorffii]
 gb|EFJ29992.1| hypothetical protein SELMODRAFT_91192 [Selaginella moellendorffii]
Length=584

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/534 (52%), Positives = 365/534 (68%), Gaps = 4/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YGT+PDR +C+  +  +P TE EL+ I+A   K + KMK  +  +HSIPK ACP G  G
Sbjct  40    AYGTWPDRSLCKVGEVAFPSTEQELVDIVAHGVKNRMKMKVVSNSAHSIPKFACPGGTSG  99

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+IST   +  + V+ASSMT+T +SGV L ++++E    GLALP SPYW G+++GGL+ T
Sbjct  100   LVISTAKYSSRIVVSASSMTVTADSGVELSRLLQEIGSHGLALPSSPYWNGISLGGLLST  159

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD-IKAARVSLGVLGVI  787
             GSHGSSL+G GS+VH++V  + +V PA EKEG+A +  + + + D + AA+VSLGVLGVI
Sbjct  160   GSHGSSLFGKGSAVHEYVKAMTMVIPAPEKEGFAKVVKITEQDEDFMNAAKVSLGVLGVI  219

Query  788   SQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST  967
             SQVT  LQP+FKRS++    +D +L KE  +FG  HEF D+ W+P    ++YR DDRV  
Sbjct  220   SQVTLALQPIFKRSVTKFEASDVNLEKEILEFGKNHEFGDVSWIPSKYKLIYRADDRVPA  279

Query  968   NTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT  1147
             +TSG+G+ DF G +      + A R  EE  E  GD+  KC+   L+    ++    G  
Sbjct  280   STSGDGVNDFIGFQPTLATIVEAQRALEEAFEISGDSPGKCATG-LVQTQALFTTGEGFK  338

Query  1148  -NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
              + G  F+GYPV+G+ + +QSSG C  S +  L CPWDP V GLF+HQTT SIS+ K++ 
Sbjct  339   KSSGGVFTGYPVVGFHHKIQSSGACQASTSRQLVCPWDPTVRGLFYHQTTVSISVDKIQD  398

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL  L P +LC + LY+G LMRYV+AS+AYLGKQ D++D DITYYR++    PR
Sbjct  399   FITDVKKLRALNPAALCGVDLYNGFLMRYVRASSAYLGKQSDAVDVDITYYRARSGNTPR  458

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAF-QGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             L ED+LEE+EQMA+FKYG LPHWGKNRN+AF      KY    EFL VK K DP G FSS
Sbjct  459   LDEDVLEEVEQMALFKYGGLPHWGKNRNIAFGPHTAAKYPKLQEFLAVKSKLDPDGFFSS  518

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             EWSD  LG+  G S     CALEG+C+CS D+HCAP   YFCR G+VY DA+VC
Sbjct  519   EWSDFALGISGGSSSNLPHCALEGVCVCSLDSHCAPENYYFCRPGRVYTDARVC  572



>ref|XP_006659761.1| PREDICTED: uncharacterized protein LOC102718199 [Oryza brachyantha]
Length=567

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/559 (51%), Positives = 374/559 (67%), Gaps = 26/559 (5%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              GSS P  P+ CT   T        YG+FPDR +CRAA A +P++E EL++ +A      
Sbjct  21    AGSSPPPQPVACTSGTTDCTVTNV-YGSFPDRTICRAANASFPRSEQELVAAVA------  73

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
                             ACP G DG +IST++LNRT+ V+A    MTVE G+ LR +I  A
Sbjct  74    ----------------ACPGGRDGTIISTRFLNRTVSVDAGRRLMTVEGGMVLRDLIRAA  117

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A AGLALP+SPYW+GLT+GGL+ TG+HGSSLWG GS+VH++V+ +RIVTPA   +G+A +
Sbjct  118   AAAGLALPHSPYWYGLTIGGLLATGAHGSSLWGKGSAVHEYVVGLRIVTPAPASQGFAVV  177

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L  G+ D+ AA+VSLGVLGVISQVT +LQP FKRS+ FV ++D D  ++   +G  HE
Sbjct  178   RELVAGDPDLDAAKVSLGVLGVISQVTLELQPQFKRSVKFVTRDDSDFAEKVAVWGGLHE  237

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F DM WLPR R V+YR DDRV   T GNGL D+ G RA  T  L             G  
Sbjct  238   FGDMAWLPRQRKVIYREDDRVDVATPGNGLNDYLGFRAQPTLGLLTXXXXXXXXXXXGSD  297

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C      +  +    +YG TNDGV F+G+PV+G+QN +Q+SGTC+ S  D L  +C 
Sbjct  298   VARCLAARAPSA-LFELQAYGFTNDGVFFTGWPVVGFQNRIQASGTCISSPEDGLLSSCT  356

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPR+ G F + + FSI+L+K  +F+ D+ +L DL P++ C +    GILMRYVKAS+AY
Sbjct  357   WDPRIRGPFLYNSGFSIALSKAAAFVADMMRLRDLNPRAFCDIDAKLGILMRYVKASSAY  416

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGK ED +DFD+TYYRS     PR + D+ +E+EQMA+ KYGA+PHWGKNRN AF GA  
Sbjct  417   LGKPEDCVDFDVTYYRSYTDGEPRPHSDVFDELEQMALRKYGAVPHWGKNRNFAFDGAAA  476

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KY ++GEFLKVK ++DP G+FSSEWSDQ+LG+    +IV   C +EGLC+CS D+HCAP 
Sbjct  477   KYPNSGEFLKVKDRYDPDGIFSSEWSDQVLGINGSPNIVDRRCGIEGLCVCSDDSHCAPE  536

Query  1793  KGYFCRAGKVYKDAKVCVK  1849
             +GYFCR GK++K+A VC  
Sbjct  537   QGYFCRPGKLFKEAMVCTN  555



>ref|XP_002982103.1| hypothetical protein SELMODRAFT_115915 [Selaginella moellendorffii]
 gb|EFJ16771.1| hypothetical protein SELMODRAFT_115915 [Selaginella moellendorffii]
Length=578

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/533 (52%), Positives = 362/533 (68%), Gaps = 4/533 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YGT+PDR  C+  +  +P TE EL+ I+A   K + KMK  +  +HS PK ACP G  G
Sbjct  40    AYGTWPDRSFCKVGEEAFPSTEQELVDIVAHGVKNRMKMKVVSNSAHSFPKFACPGGTSG  99

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+IST   +  + +NASSMT+T +SGV L ++++E    GLALP SPYW G+++GGL+ T
Sbjct  100   LVISTAKYSSRVVINASSMTVTADSGVELSRLLQEIGSHGLALPSSPYWNGISLGGLLST  159

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD-IKAARVSLGVLGVI  787
             GSHGSSL G GS+VH++V  + +V PATE+EG+A I  +   + D + AA+VSLGVLGVI
Sbjct  160   GSHGSSLMGKGSAVHEYVKAMTMVVPATEQEGFAKIVKITDQDEDFMNAAKVSLGVLGVI  219

Query  788   SQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST  967
             SQVT  LQP+FKRS++    +D +L KE  +FG  HEF D+ W P    V+YR DDRV  
Sbjct  220   SQVTLSLQPIFKRSVTKFEASDVNLEKEILEFGKNHEFGDVSWYPSKYKVIYRADDRVPV  279

Query  968   NTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT  1147
             +TSG+G+ DF G +      + A R  EE  E  GD   KC+   L+    ++    G  
Sbjct  280   STSGDGVNDFTGFQPTLATAVEAQRILEEGFEISGDHTGKCATG-LVQTQALFATGEGFK  338

Query  1148  NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSF  1327
             + G  F+GYPV+G+Q+ +QSSG C  SL+  L CPWDP V GLF+HQTT SIS+ K++ F
Sbjct  339   SSGGVFTGYPVVGFQHKIQSSGGCQASLSQQLVCPWDPTVRGLFYHQTTVSISVDKIQEF  398

Query  1328  IEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRL  1507
             I DV+ L  L P +LC + LY+G LMRYV+AS+AYLGKQ D++D DITYYR++    PRL
Sbjct  399   ITDVKTLRALNPAALCGVDLYNGFLMRYVRASSAYLGKQSDAVDVDITYYRARSGNTPRL  458

Query  1508  YEDILEEIEQMAMFKYGALPHWGKNRNVAF-QGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
              ED+LEE+EQMA+FKYG LPHWGKNRN+AF      KY    +FL VK KFDP G FSSE
Sbjct  459   NEDVLEEVEQMALFKYGGLPHWGKNRNIAFGTHTAAKYPKLQKFLVVKSKFDPDGFFSSE  518

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD  LG+  G S +   CALEG C+CS D+HCAP   YFCR G+VY DA+VC
Sbjct  519   WSDFALGISGGSSNLPH-CALEGECVCSLDSHCAPENYYFCRPGRVYTDAQVC  570



>ref|XP_002992203.1| hypothetical protein SELMODRAFT_236475 [Selaginella moellendorffii]
 gb|EFJ06700.1| hypothetical protein SELMODRAFT_236475 [Selaginella moellendorffii]
Length=561

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/533 (52%), Positives = 362/533 (68%), Gaps = 4/533 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YGT+PDR  C+  +A +P TE EL+ I+A   K + KMK  +  +HS PK ACP G  G
Sbjct  23    AYGTWPDRSFCKVGEAAFPSTEQELVDIVAHGVKNRMKMKVVSNSAHSFPKFACPGGTSG  82

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             L+IST   +  + +NASSMT+T +SGV L ++++E    GLALP SPYW G+++GGL+ T
Sbjct  83    LVISTAKYSSRVVINASSMTVTADSGVELSRLLQEIGSHGLALPSSPYWNGISLGGLLST  142

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD-IKAARVSLGVLGVI  787
             GSHGSSL G GS+VH++V  + +V PATE+EG+A I  +   + D + AA+VSLGVLGVI
Sbjct  143   GSHGSSLMGKGSAVHEYVKAMTMVVPATEQEGFAKIVKITDQDEDFMNAAKVSLGVLGVI  202

Query  788   SQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST  967
             SQVT  LQP+FKRS++    +D +L +E  +FG  HEF D+ W P    V+YR DDRV  
Sbjct  203   SQVTLSLQPIFKRSVTKFEASDINLEREILEFGKNHEFGDVSWYPSKYKVIYRADDRVPV  262

Query  968   NTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLT  1147
             +TSG+G+ DF G +      + A R  EE  E  GD   KC+   L+    ++    G  
Sbjct  263   STSGDGVNDFTGFQPTLATAVEAQRILEEGFEISGDHTGKCATG-LVQTQALFATGEGFK  321

Query  1148  NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSF  1327
             + G  F GYPV+G+Q+ +QSSG C  SL+  L CPWDP V GLF+HQTT SIS+ K++ F
Sbjct  322   SSGGVFIGYPVVGFQHKIQSSGGCQASLSRQLVCPWDPTVRGLFYHQTTVSISVDKIQDF  381

Query  1328  IEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRL  1507
             I DV+ L  L P +LC + LY+G LMRYV+AS+AYLGKQ D++D DITYYR++    PRL
Sbjct  382   ITDVKTLRALNPAALCGVDLYNGFLMRYVRASSAYLGKQTDAVDVDITYYRARSGNTPRL  441

Query  1508  YEDILEEIEQMAMFKYGALPHWGKNRNVAF-QGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
              ED+LEE+EQMA+FKYG LPHWGKNRN+AF      KY    +FL VK KFDP G FSSE
Sbjct  442   NEDVLEEVEQMALFKYGGLPHWGKNRNIAFGTHTAAKYPKLQKFLVVKSKFDPDGFFSSE  501

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD  LG+  G S +   CALEG C+CS D+HCAP   YFCR G+VY DA+VC
Sbjct  502   WSDFALGISGGSSNLPH-CALEGECVCSLDSHCAPENYYFCRPGRVYTDAQVC  553



>ref|XP_003571543.2| PREDICTED: uncharacterized protein LOC100833703 [Brachypodium 
distachyon]
Length=585

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/562 (52%), Positives = 383/562 (68%), Gaps = 5/562 (1%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I   GSS P +P+    + T  C ITNSYG+F DR VC AA   YP TE E+++ +A A 
Sbjct  16    IPMAGSSPPPEPV-MCTHGTSGCIITNSYGSFTDRTVCHAASVTYPSTEEEVIAAVAAAV  74

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
               K+K+K AT++SHSIPKLACP G DG +IST  LNRT+ V+A+   MTVESG+ LR + 
Sbjct  75    AAKQKLKVATKHSHSIPKLACPGGHDGAIISTARLNRTVRVDAAKRLMTVESGMLLRDLT  134

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
             E AA AGLALP+SPY++G+T+GGL+ TG+HGSSLWG G +VH++V+ +RIVTPA   +G+
Sbjct  135   EAAAAAGLALPHSPYFYGVTIGGLLSTGAHGSSLWGKGGAVHEYVVGMRIVTPAPASKGF  194

Query  710   ATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGF  889
             A +R L  G+ D+ A +VS+GVLGV++Q+T  LQP+FKRS++FV +ND D  ++   +G 
Sbjct  195   AMVRELCAGDPDLDAVKVSIGVLGVVTQITLSLQPLFKRSLTFVSRNDSDFPEQVASWGR  254

Query  890   QHEFADMKWLPrdrhvvyrvddrvSTNTSGNG-LFDFFGLRAVGTDCLNALREKEEHQES  1066
              HEF D+ WLP    V YR DDRV  +T GNG L      R+  T      R  EE  + 
Sbjct  255   LHEFGDIAWLPALGKVAYRDDDRVDVSTPGNGRLNQVLLFRSTATREAIKARALEERLQQ  314

Query  1067  IGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
                 D          V  V  L  G TNDGV F+G+PV+GYQ+ +Q+SG C+DS  D L 
Sbjct  315   ANATDAARCEDLRRQVAAVQRLGNGFTNDGVSFTGFPVVGYQHRIQASGGCIDSPEDGLA  374

Query  1244  -TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC-VLGLYDGILMRYVK  1417
               C WDPR+ G FF    FS+ L+K  +FI ++QKL DL   + C  +    G+ +RYVK
Sbjct  375   TACVWDPRIRGSFFENDGFSVPLSKAPAFIAEMQKLRDLNSAAFCAAVDPRLGVFLRYVK  434

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
             ASTAYLG  EDS+ FDI YYRS+    PR++ D+++E+EQ+A+ KYG  PHWGKNR+ AF
Sbjct  435   ASTAYLGMPEDSVVFDIVYYRSRIDGTPRVHADVVDELEQLALTKYGGRPHWGKNRDFAF  494

Query  1598  QGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDN  1777
              GAI KY  AG+FLKVK ++DP GLFSSEW+D++LG+    S ++ GCA+EGLC+CS+D+
Sbjct  495   DGAIAKYPDAGKFLKVKGRYDPDGLFSSEWTDKVLGISGSPSSIEKGCAIEGLCVCSEDS  554

Query  1778  HCAPNKGYFCRAGKVYKDAKVC  1843
             HCAP  GYFCR GKVYK A+VC
Sbjct  555   HCAPELGYFCRPGKVYKKARVC  576



>gb|EMT15789.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=575

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/557 (51%), Positives = 381/557 (68%), Gaps = 17/557 (3%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              GSS P +P++C    +        YG+FPDR VCRAA A +P+TE EL++ +A A    
Sbjct  20    AGSSPPPEPVECAHGTSDCTVTNV-YGSFPDRTVCRAANATFPRTEEELVAAVAAAAAAS  78

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
              ++             ACP G DG +ISTK LN+T+ ++A+   MTVESG+ L+ +I+ A
Sbjct  79    ARL-------------ACPGGRDGTIISTKRLNKTVSLDAAKGLMTVESGMVLKDLIQAA  125

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A+AGLALP+SPYW+G+T+GGL+ TG+HGSSLWG GS+VH++++ +RIVTPA   +G+A +
Sbjct  126   AEAGLALPHSPYWYGVTIGGLLATGAHGSSLWGKGSAVHEYIVGMRIVTPALASQGFAVV  185

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L  G+ D+ A +VSLGVLGV+SQVT  LQPMFKRS++F  ++D DL  +A  +G  HE
Sbjct  186   RELSVGDPDLDAVKVSLGVLGVVSQVTLALQPMFKRSVTFETRDDMDLPAQAAVWGRLHE  245

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F DM WLP    V+YR D+RV  +T G+GL D+ G R+  T  L   R  EE  E     
Sbjct  246   FGDMAWLPWQGKVIYRKDNRVPVSTKGHGLNDYLGYRSNPTLALITDRATEERLEEDNSD  305

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C    + +  +     YG TNDG  F+G+PVIG+QN +Q+SGTC+ S  D L  TC 
Sbjct  306   IARCLAARVPSA-LFELQGYGFTNDGSFFTGWPVIGFQNRIQASGTCISSPEDGLLSTCT  364

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPR+   FF+ ++FSI+L+K  SFI ++QKL DL+P + C L    G+L+RYVKAS+AY
Sbjct  365   WDPRIRSPFFYSSSFSIALSKAPSFIAEMQKLRDLKPCAFCGLDATLGVLLRYVKASSAY  424

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGK EDSIDFD TYYRS     PR   D+++E+EQ+A+ KYGA+PHWGKNRN AF G I 
Sbjct  425   LGKSEDSIDFDFTYYRSYTQGEPRANSDVVDELEQLALCKYGAVPHWGKNRNFAFDGVIA  484

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
             KY  A EFLKVK ++DP G+FSSEWSDQ+LG K   ++ +  C +EG+CICS D+HCAP 
Sbjct  485   KYPKAAEFLKVKARYDPDGIFSSEWSDQVLGAKGSSNMAEKSCGIEGICICSDDSHCAPE  544

Query  1793  KGYFCRAGKVYKDAKVC  1843
             KGYFC  GKV+ DA+VC
Sbjct  545   KGYFCHPGKVFTDARVC  561



>ref|XP_002982127.1| hypothetical protein SELMODRAFT_115966 [Selaginella moellendorffii]
 gb|EFJ16795.1| hypothetical protein SELMODRAFT_115966 [Selaginella moellendorffii]
Length=560

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/559 (49%), Positives = 384/559 (69%), Gaps = 7/559 (1%)
 Frame = +2

Query  182   GSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKR  361
             G+ LP  P++C  + + NCT++ +YGT+PDR  CRAA+A++P +E EL++ +A  ++ K 
Sbjct  4     GTPLP--PVRCLADGSFNCTVSGTYGTWPDRSPCRAARALFPASEEELVTAVAFGSRNKM  61

Query  362   KMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAA  541
             KMK  ++ SHS+ KL CP GD+GL+IST+ LNR ++V+ S+ T+ V+SGV L+ +++  A
Sbjct  62    KMKVVSKSSHSMTKLVCPGGDEGLIISTQKLNRIVQVDPSTKTVVVDSGVQLQDLVDSVA  121

Query  542   KAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPA-TEKEGYATI  718
             + GL+LP+SPYW GL++GG++ TG+HGSSL+G GS+VH++VI +R++ P+ + +EGYA +
Sbjct  122   RFGLSLPHSPYWNGLSIGGVISTGAHGSSLFGKGSAVHEYVIAMRLIVPSPSAEEGYARV  181

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
               +    + + AARVSLGVLGV+SQ T  L+P+FKRS+    K D  L  E  + G   E
Sbjct  182   INVTS-EAMLNAARVSLGVLGVVSQATLALEPLFKRSVRIQQKADASLEDEIVEHGRMAE  240

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F D+ W P  +  ++R+D+RV  +T G G+ +F G R   T  L  LR  EE  E+  + 
Sbjct  241   FGDVAWYPSQKTALFRIDNRVPVDTPGEGVNEFLGFRPEATALLRMLRMSEELYEATNNP  300

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWD  1258
               KC+   L  V  +     G  N   KF+GYPVIG+QN +Q++GTC + L+ +  CPWD
Sbjct  301   AGKCTMSTL-QVDTLVMAGMGFKNQLQKFTGYPVIGFQNKIQTTGTCENVLDQHHFCPWD  359

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             P+ +GLFFHQTT SISL +++ FI DV+KL D+ P + C   LY G+L+RYV+ S A+LG
Sbjct  360   PQAHGLFFHQTTVSISLDRIRDFIVDVKKLRDMNPSAFCGAELYYGVLLRYVRGSRAFLG  419

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             K EDS+D DITYYRS+D   PRL +D+ EEIEQ+A+FKY    HWGKNRNVAF GA  KY
Sbjct  420   KSEDSVDVDITYYRSRDAHTPRLNQDVYEEIEQLAVFKYRGQSHWGKNRNVAFIGAAEKY  479

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTG--LSIVKDGCALEGLCICSQDNHCAPN  1792
                  FL+V++  DP GLFSSEWSD +LGL +    +     CALEGLC+CS D HCAP 
Sbjct  480   PGLTTFLQVRQSLDPEGLFSSEWSDSMLGLSSSGVANSQAKHCALEGLCLCSSDEHCAPE  539

Query  1793  KGYFCRAGKVYKDAKVCVK  1849
             K Y+CR G+V+ +A+VC K
Sbjct  540   KKYYCRPGRVFANARVCRK  558



>ref|XP_002993414.1| hypothetical protein SELMODRAFT_137111 [Selaginella moellendorffii]
 gb|EFJ05507.1| hypothetical protein SELMODRAFT_137111 [Selaginella moellendorffii]
Length=581

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/565 (48%), Positives = 383/565 (68%), Gaps = 5/565 (1%)
 Frame = +2

Query  164   FLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAG  343
              L+       P  P++C  N + NCT++ +YGT+PDR  CRAA+A++P +E EL++ +A 
Sbjct  17    LLLLKTSHGTPLPPVRCLANGSFNCTVSGTYGTWPDRSPCRAARALFPASEEELVTAVAF  76

Query  344   ATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
              ++ K KMK  ++ SHS+ KL CP GD+GL+IST+ L+R ++V+ S+ T+ V+SGV L+ 
Sbjct  77    GSRNKMKMKVVSKSSHSMTKLVCPGGDEGLIISTQKLDRIVQVDPSTKTVVVDSGVQLQD  136

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPA-TEK  700
             +++  AK GL+LP+SPYW GL++GG++ TG+HGSSL+G GS+VH++VI +R++ P+ + +
Sbjct  137   LVDSVAKFGLSLPHSPYWNGLSIGGVISTGAHGSSLFGKGSAVHEYVIAMRLIVPSPSAE  196

Query  701   EGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATK  880
             EGYA +  +    + + AARVSLGVLGV+SQ T  L+P+FKRS+    K D  L  E  +
Sbjct  197   EGYARVINVTS-EAMLNAARVSLGVLGVVSQATLALEPLFKRSVRIQQKADASLEDEIVE  255

Query  881   FGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQ  1060
              G   EF D+ W P  +  ++R+D+RV  +T G G+ +F G R   T  L  LR  EE  
Sbjct  256   HGRMAEFGDVAWYPSQKTALFRIDNRVPVDTPGEGVNEFLGFRPEATALLRMLRMSEELY  315

Query  1061  ESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDN  1240
             E+  +   KC+   L  V  +     G  N   KF+GYPVIG+QN +Q++GTC + L+ +
Sbjct  316   EATNNPAGKCTMSTL-QVDTLVMAGMGFKNQLQKFTGYPVIGFQNKIQTTGTCENVLDQH  374

Query  1241  LTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               CPWDP+ +GLFFHQTT SISL +++ FI DV+KL D+ P + C   LY G+L+RYV+ 
Sbjct  375   HFCPWDPQAHGLFFHQTTVSISLDRIRDFIVDVKKLRDMNPSAFCGAELYYGVLLRYVRG  434

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             S A+LGK EDS+D DITYYRS+D   PRL +D+ EEIEQ+A+FKY   PHWGKNRNVAF 
Sbjct  435   SMAFLGKSEDSVDVDITYYRSRDAHTPRLNQDVYEEIEQLAVFKYRGQPHWGKNRNVAFI  494

Query  1601  GAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTG--LSIVKDGCALEGLCICSQD  1774
             GA  KY     FL+VK+  D  GLFSSEWSD +LGL +    +     CALEGLC+CS D
Sbjct  495   GAAEKYPGLATFLQVKQSLDSEGLFSSEWSDAMLGLSSSGVANSQAKHCALEGLCLCSSD  554

Query  1775  NHCAPNKGYFCRAGKVYKDAKVCVK  1849
              HCAP K Y+CR G+V+ +A+VC K
Sbjct  555   EHCAPEKKYYCRPGRVFANARVCRK  579



>gb|AFW68326.1| hypothetical protein ZEAMMB73_477624 [Zea mays]
Length=787

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 376/567 (66%), Gaps = 43/567 (8%)
 Frame = +2

Query  188   SLPEDPIKctinntmnctitnS-YGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             S P DP++C+          +S YG FPDR  CRA+ AVYP +E EL+  +AGA     K
Sbjct  26    SPPPDPVQCSSGGGTADCTVSSAYGVFPDRSTCRASAAVYPASEDELVRAVAGAAAAGTK  85

Query  365   MKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             MK ATRYSHSIP LACP     +GL+IST+ L+R + V+ ++  +TVESGV+LR ++EEA
Sbjct  86    MKVATRYSHSIPPLACPGSGRGEGLVISTRRLDRVVSVDPAAGRVTVESGVTLRDLVEEA  145

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             AKAGLALPY PYWWGLTVGG++GTG+HGSSLWG GS+VH++V+ +RIVTPA   EGYA +
Sbjct  146   AKAGLALPYEPYWWGLTVGGMLGTGAHGSSLWGNGSAVHEYVVGMRIVTPAAAAEGYAKV  205

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L   + D+ AA+VSLGVLGVISQVT  LQP+FKRS++F  ++D DL ++   FG++HE
Sbjct  206   RVLTAADPDLDAAKVSLGVLGVISQVTLALQPLFKRSVTFSERDDDDLAEQVGTFGYRHE  265

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             FAD+ W P     VYR+DDR+  +   +G  DF G RA  T  + A R  E+  E   + 
Sbjct  266   FADIAWFPGHGRAVYRIDDRLPLSAPDDGAMDFIGFRATPTLAIQATRLAEDLFERADNG  325

Query  1079  DEKCSNQWLINVWMVWFLSYGLT-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPW  1255
               KC    + +  +     YGL    G  F+GYPV+G Q+ MQ+SG              
Sbjct  326   SGKCLTSRVTHATLS-AAGYGLQWRSGGLFAGYPVVGPQHRMQASG--------------  370

Query  1256  DPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYL  1435
                            + + +   F+ +V++L DLEP++LC + LYDGIL+RYVKASTA+L
Sbjct  371   --------------GLPVRRAVLFVAEVRRLRDLEPRALCGVELYDGILIRYVKASTAHL  416

Query  1436  GKQE-------DSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
             GK         D +DFDITYYRS+D   PRL+ED+LEE+EQM +FKYG LPHWGKNRN+A
Sbjct  417   GKPAPRGEPSGDMVDFDITYYRSRDSGRPRLFEDVLEEVEQMGIFKYGGLPHWGKNRNLA  476

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD--GCALEGLCICS  1768
             F GA RKY     FL+VK  +DP GLFSS+WS+ +LG+  G S   D  GCALEG+C+CS
Sbjct  477   FVGAARKYSGLPRFLRVKDAYDPDGLFSSDWSNMMLGIG-GRSPTTDAPGCALEGMCVCS  535

Query  1769  QDNHCAPNKGYFCRAGKVYKDAKVCVK  1849
             +D HCAP +GY CR GKVYK+A+VC +
Sbjct  536   RDEHCAPEQGYVCRPGKVYKEARVCTR  562



>ref|XP_010234473.1| PREDICTED: uncharacterized protein LOC104583572 [Brachypodium 
distachyon]
Length=583

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/575 (49%), Positives = 392/575 (68%), Gaps = 4/575 (1%)
 Frame = +2

Query  128   MSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYP  307
             M  N ++ +    LI   G S P +P+      T +CT+TN+YG+FPDR +C AA  +YP
Sbjct  1     MGSNFVLAVLFLLLIPMAGCSPPAEPV-ICTQGTSDCTVTNTYGSFPDRTLCHAATVMYP  59

Query  308   KTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSM  487
             +TE E+++ +A A   KRK++ AT++SH IPKLACP G DG ++ST  LNRT+ V+A++ 
Sbjct  60    RTEEEVIAAVAAAVSAKRKLRVATKHSHGIPKLACPGGHDGAIVSTALLNRTVSVDAANR  119

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
              MTVESG+ LR VI+ AA AGL+L  SPY++GLT+GG+M TG+HGSSLWG G +VH++++
Sbjct  120   LMTVESGMLLRDVIQAAAAAGLSLSQSPYFYGLTIGGMMSTGAHGSSLWGKGGAVHEYIV  179

Query  668   HIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
              +RIVTPA E EG+A +R L  G+ D+ AA+VS+GVLGV++Q+T  LQP+FKRS++ + +
Sbjct  180   GMRIVTPALESEGFAIVRELAAGDPDMDAAKVSIGVLGVVTQITLALQPLFKRSVTLLKR  239

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             ND D  ++   +G  HEF DM W+P    VVYR DDRV  +T GNGL      R+  T  
Sbjct  240   NDSDFPEQIATWGRLHEFGDMTWVPALGEVVYREDDRVDVSTPGNGLNGQPLFRSTPTRE  299

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
                 R  EE  +     D          V     +  G TNDG+ F+G+PV+G+Q+ +Q+
Sbjct  300   AIEARALEERLQQTNATDVARCEALRRQVAEAERVGNGFTNDGIAFTGFPVVGFQHRIQT  359

Query  1208  SGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLC-V  1378
             SG C+DS  D L  +C WDPR+ G F++   FS+ L+K  +F+ ++Q+L DL P + C  
Sbjct  360   SGGCIDSPEDGLASSCVWDPRIRGTFYYNAGFSVPLSKASAFVAEMQQLRDLNPDAFCAA  419

Query  1379  LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYG  1558
             +    G+L+RYVKAS+AYLGK  DS+ FDI YYRS+    PR + D+++E+EQ+A  KY 
Sbjct  420   VDPRVGLLIRYVKASSAYLGKPVDSVVFDILYYRSRIDGTPRAHADVVDELEQLAFRKYS  479

Query  1559  ALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
              LPHWGKNR  AF GAI KY + G+FLKVK ++DP GLFSSEW+D++LG+    + ++  
Sbjct  480   GLPHWGKNREFAFDGAIAKYPNVGKFLKVKGRYDPDGLFSSEWTDKVLGISGNPTTIEKR  539

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CA+EGLC+CS+D HCAP +GYFCR GKVY +A+VC
Sbjct  540   CAIEGLCVCSEDWHCAPEQGYFCRPGKVYPEARVC  574



>gb|EMT29824.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=524

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/494 (53%), Positives = 354/494 (72%), Gaps = 2/494 (0%)
 Frame = +2

Query  362   KMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAA  541
             ++K AT++ HS PKLACP G DG +IST+ LNR + ++ +   MTVESG+ LR +I++AA
Sbjct  27    RVKVATKHYHSFPKLACPGGSDGTIISTERLNRVVSIDVAKGLMTVESGMVLRDLIKKAA  86

Query  542   KAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIR  721
               GLALP+S YW GLT+GGL+ TG+HGSSLWG G +VH++V+ +RIVTPA   +G+A +R
Sbjct  87    AKGLALPHSTYWSGLTIGGLLATGAHGSSLWGKGGAVHEYVVGMRIVTPAPASQGFAVVR  146

Query  722   TLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEF  901
              L   + D+ AA+VSLGVLGV+SQVT  LQPMFKRS++FV  ND DL ++A K+G  HEF
Sbjct  147   ELSADDPDLDAAKVSLGVLGVVSQVTLALQPMFKRSVTFVTCNDSDLAEQAAKWGKLHEF  206

Query  902   ADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDAD  1081
             ADM WLP  R V+YR DDRV+  ++G+GL D+   R   T  L   R  EE  E   +A 
Sbjct  207   ADMAWLPEQRKVIYRKDDRVAITSAGDGLNDYLPFRPNPTAALITARVTEELLEKNINAV  266

Query  1082  EKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDP  1261
              +C       V +    +YG TN+G  F+GYPV+G+Q+ MQ+SG+C+DS   N +C WDP
Sbjct  267   ARCKAA-NATVSLFETAAYGFTNNGSVFTGYPVVGFQHRMQASGSCVDSPG-NTSCSWDP  324

Query  1262  RVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGK  1441
             R  G+      +SI+L++  +FI D+Q+L D +P + C +    GIL+RYVKAS+AYLGK
Sbjct  325   RTRGILLGNNGYSITLSRASAFIADMQQLRDRKPLAFCGIDAKLGILLRYVKASSAYLGK  384

Query  1442  QEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYK  1621
             +EDSIDFDITYYRS     P  + D+L+E++QMA+ KYGA+PHWGKNR+ AF+GAI KY 
Sbjct  385   EEDSIDFDITYYRSFTKGEPNPHSDVLDELQQMALRKYGAMPHWGKNRDFAFEGAIDKYP  444

Query  1622  SAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGY  1801
              A +F +VK ++D  G+FSSEWSDQ+LG+     IV+  CA+EGLC+CS D+HCAP +GY
Sbjct  445   KASKFFEVKGRYDSDGIFSSEWSDQVLGINGSPVIVEKRCAIEGLCVCSDDSHCAPEEGY  504

Query  1802  FCRAGKVYKDAKVC  1843
             +CR GKVY +A+VC
Sbjct  505   YCRPGKVYTEARVC  518



>ref|NP_001052551.2| Os04g0361500 [Oryza sativa Japonica Group]
 emb|CAE05926.1| OSJNBa0034E24.20 [Oryza sativa Japonica Group]
 dbj|BAF14465.2| Os04g0361500 [Oryza sativa Japonica Group]
Length=590

 Score =   538 bits (1387),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 286/570 (50%), Positives = 383/570 (67%), Gaps = 20/570 (4%)
 Frame = +2

Query  140   ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             +L+ + +  +    G   P  P+ C  N T  CT+TN YG+F DR +CRAA   YP+TE 
Sbjct  16    LLVILALWIVSHLAGDRPPPGPVVCAANGTSGCTLTNIYGSFSDRAICRAANVTYPRTEE  75

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL++ +A A    RK+K ATRYS+S P+LACP G+DG +IST++L+R + V+A+   MTV
Sbjct  76    ELVAAVAAAVAAGRKVKVATRYSNSFPRLACPGGEDGTVISTRWLDRAVRVDAARRLMTV  135

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESG+ +R +I EAA AGLALP+SPYW GLT+GG++ TG+HGSSLWG GS+VH++V+ +RI
Sbjct  136   ESGMVMRDLIREAAAAGLALPHSPYWSGLTIGGVLATGAHGSSLWGKGSAVHEYVVGMRI  195

Query  680   VTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRD  859
             VTPA   EG+A +R L  G+ D+ AA+VSLGVLG ISQVT +LQP+FKRS++FV +ND D
Sbjct  196   VTPAPASEGFAAVRELAAGDPDLDAAKVSLGVLGAISQVTLELQPLFKRSVAFVTRNDSD  255

Query  860   LGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNAL  1039
             +      +G  HEF D+ WLPR R  VYR DDRV   T G+G  D+   R   T  L A 
Sbjct  256   VADTVAAWGRLHEFGDVAWLPRRRVAVYREDDRVDVATPGDGRSDYPAFRPTPTLPLVAS  315

Query  1040  REKEE-HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGT  1216
             R  EE  +E  G    +C+   ++    +  L+YGLTNDG  F+G    G      +SGT
Sbjct  316   RLAEEWLEERSGSDAARCAASRVMPA-TLEHLNYGLTNDGEAFTG--TTGTSPPTTASGT  372

Query  1217  CLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDG  1396
              L                G  F+ + FSI+L++  +F+ DV ++ DL P + C +    G
Sbjct  373   AL---------------RGHLFYNSGFSIALSRAPAFVADVARIRDLNPAAFCQIDSKMG  417

Query  1397  ILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWG  1576
             +LMRYV AS+AYLGK EDS+DFD+TYYRS     PR + D+ +E+EQMA+ K+G +PHWG
Sbjct  418   LLMRYVAASSAYLGKAEDSVDFDVTYYRSYARGAPRAHADVFDEVEQMALRKHGGVPHWG  477

Query  1577  KNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLS-IVKDGCALEG  1753
             KNRN AF GAI +Y +AG+F++VK +FDP G+FSSEWSDQ+LG+      IV DGCA+EG
Sbjct  478   KNRNYAFDGAIARYPNAGKFMRVKDRFDPDGVFSSEWSDQVLGVGGASPVIVGDGCAMEG  537

Query  1754  LCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             LC+CS D+HCAP KGYFCR GKV+  A+VC
Sbjct  538   LCVCSDDSHCAPEKGYFCRPGKVFTAARVC  567



>gb|EMT16865.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=884

 Score =   549 bits (1414),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 284/550 (52%), Positives = 388/550 (71%), Gaps = 4/550 (1%)
 Frame = +2

Query  179   VGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQK  358
              GSS P  P+    + T +CT++N+YG+FPDR VC AA A +P+TE EL++ +A     K
Sbjct  21    AGSSPPPAPV-VCAHGTSDCTVSNAYGSFPDRTVCHAANATFPRTEKELVAAVAAVAAAK  79

Query  359   RKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEA  538
             RK+K AT++SHS PKLACP G DG +IST+ LNR + V+A    MTVESG+ LR +I+ A
Sbjct  80    RKVKVATKHSHSFPKLACPGGRDGTIISTERLNRVVSVDAVKGLMTVESGMVLRDLIQAA  139

Query  539   AKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATI  718
             A+AGLALP+SPYW GLT+GGL+ TG+HGSSL G G +VH++V+ +RIVTPA   +G+A +
Sbjct  140   AEAGLALPHSPYWSGLTIGGLLATGAHGSSLKGKGGAVHEYVVGMRIVTPAPASQGFAVV  199

Query  719   RTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHE  898
             R L   + D+ AA+VSLGVLGV+SQVT  LQPMFKRS++FV ++D D+ ++A+K+   HE
Sbjct  200   RELCADHPDLNAAKVSLGVLGVVSQVTLALQPMFKRSVTFVTRDDLDIAEQASKWSDLHE  259

Query  899   FADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDA  1078
             F DM WLP+   V+YR DDR+S    G+GL D+   R+  T  L   R   E  E   +A
Sbjct  260   FGDMAWLPQQGKVIYREDDRMSIELMGDGLNDYLAFRSTPTAVLINARVAMEPLEKNINA  319

Query  1079  DEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCP  1252
               +C       + +    +YG +N+G  F+GYPV+G+Q+ +Q+S  C+ S  D L  +C 
Sbjct  320   IARCKAA-EATISLFEMAAYGYSNNGSLFTGYPVVGFQHQIQASSGCIGSSKDALLTSCA  378

Query  1253  WDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAY  1432
             WDPR+ G FF+   +SI+L++V +FI D+Q+L D  P + C +    G+L+RYVKAS+AY
Sbjct  379   WDPRIEGTFFYSNGYSIALSRVSAFIADMQQLRDRSPLAFCGIDASVGMLLRYVKASSAY  438

Query  1433  LGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIR  1612
             LGK EDSIDFDI YYRS     P  + D+ +E+EQMA+ KY A+PHWGKNRN AF+GAI 
Sbjct  439   LGKPEDSIDFDIAYYRSYTKGEPNPHSDVFDELEQMALHKYDAIPHWGKNRNFAFEGAIA  498

Query  1613  KYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPN  1792
              Y  AGEFL+VK ++DP G+FSS+WSDQ+LG+     IV+  CA+EGLCICS+D+HCAP 
Sbjct  499   MYPKAGEFLEVKGRYDPDGIFSSKWSDQVLGINGSPVIVERRCAIEGLCICSEDSHCAPE  558

Query  1793  KGYFCRAGKV  1822
             +GY+CR GK+
Sbjct  559   EGYYCRPGKM  568



>ref|XP_010936174.1| PREDICTED: uncharacterized protein LOC105055864 [Elaeis guineensis]
Length=607

 Score =   538 bits (1387),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 283/567 (50%), Positives = 383/567 (68%), Gaps = 18/567 (3%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             P  P+    +  +NCT+TN+YG FPDR  C  A   YP  E ELL  ++ A+  K+ MKA
Sbjct  23    PPGPVINCTSGHINCTVTNAYGAFPDRSTCLVAAVTYPTNERELLLAVSNASFAKQHMKA  82

Query  374   ATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKA  547
              + Y+HSIPKL+CP G  G  L IST  LN+++ V+ +S  MTVE+G++LR +++ AA  
Sbjct  83    VSAYAHSIPKLSCPGGPSGAGLAISTLRLNKSVHVDLASSRMTVEAGITLRALLDVAAAN  142

Query  548   GLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG--YATIR  721
             GLALP+SPYW G+T+GGL+GTGSHGSS++G GS+VH++V+ +R+V P++ +    YA + 
Sbjct  143   GLALPHSPYWEGVTLGGLLGTGSHGSSVFGKGSAVHEYVVGMRLVVPSSVQINGLYAMVV  202

Query  722   TLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEF  901
             +L + + D+ AA+VSLGVLGV+SQVT +L+PMFKRS++  V+ D    +    F    ++
Sbjct  203   SLGEDDPDLLAAKVSLGVLGVVSQVTLQLEPMFKRSVTNRVRRDDAFEQTIASFASTTQY  262

Query  902   ADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDAD  1081
              D+ W P    V+YR D ++  N +G G  DF G R      + + R  EE  E+  DA+
Sbjct  263   GDIIWYPSQAIVIYRDDVKLPINATGKGENDFLGFRPQARLVIKSTRALEELAEAREDAN  322

Query  1082  EKCSNQWLINVWMVWFLSYGL---TNDG--VKFSGYPVIGYQNHMQSSGTCLDSLNDNL-  1243
              +C    L    ++  L  G+    NDG  V F+GYPVIG Q+ MQSSG+CL S  DN+ 
Sbjct  323   GRC---LLARTQVISLLLLGMGLKNNDGSIVDFTGYPVIGNQSDMQSSGSCLRSPEDNVQ  379

Query  1244  -TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKA  1420
               C WDPR+ G+F+HQTT SI  T + SFI DV+KL D  P++LC   LY G LMR+V+ 
Sbjct  380   TACGWDPRIPGIFYHQTTVSIPFTSIASFIGDVKKLRDANPEALCGTELYLGFLMRFVRN  439

Query  1421  STAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQ  1600
             STA+LGK EDS+D D+TYYRS+DP  PRL+ED+LEEIEQMA+FKY  LPHWGKNRN+ F 
Sbjct  440   STAFLGKIEDSVDIDMTYYRSRDPEQPRLFEDVLEEIEQMALFKYNGLPHWGKNRNIGFL  499

Query  1601  GAIRKYKSAGE-FLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD--GCALEGLCICSQ  1771
                 K  + G+ F  V +K+D  GLFSS+W+D +LGL+ G  +V    GCALEGLCICS 
Sbjct  500   KVREKLGAKGDKFGSVMEKYDQEGLFSSDWTDAVLGLR-GKEVVTSGKGCALEGLCICSV  558

Query  1772  DNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             DNHCAP KGY+CR G VY++A+VC KI
Sbjct  559   DNHCAPEKGYYCRPGHVYEEARVCRKI  585



>dbj|BAJ94584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   534 bits (1375),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 258/482 (54%), Positives = 343/482 (71%), Gaps = 4/482 (1%)
 Frame = +2

Query  407   ACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGL  586
             ACP GDDG +IST  LNRT+ ++ +   MTVESG+ LR +IE AA AGL+LP+SPYW+GL
Sbjct  2     ACPGGDDGTIISTARLNRTVCIDVAKRLMTVESGMVLRDLIEAAAAAGLSLPHSPYWYGL  61

Query  587   TVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVS  766
             T+GGL+GTG+HGSSLWG G +VH++V+ +RIVTPA   +G+A +R L+  + D+ AA+VS
Sbjct  62    TIGGLLGTGAHGSSLWGKGGAVHEYVVGMRIVTPAPASQGFAVVRELEADHPDLHAAKVS  121

Query  767   LGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyr  946
             LGVLGVISQVT  +QP+FKRS++ V ++D D  ++   +G  HEF DM WLP    VVYR
Sbjct  122   LGVLGVISQVTLTMQPLFKRSVTLVRRDDSDFQEQVAVWGDLHEFGDMTWLPHQGKVVYR  181

Query  947   vddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVW  1126
              DDRV  +T GNGL+D        T  L   R  EE  +  G    +C    L       
Sbjct  182   RDDRVDVSTPGNGLYDLLLFHPSPTRGLIDARVAEERLQENGTDAARCEAAAL-QAATSE  240

Query  1127  FLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFS  1300
               S G TNDGV F+GYPV+GYQ+ +Q+SG CL+  +D L   C WDPR+ G F++ + FS
Sbjct  241   RSSNGFTNDGVAFTGYPVVGYQHRIQASGACLNGPDDGLLTACAWDPRIRGSFYYNSGFS  300

Query  1301  ISLTKVKSFIEDVQKLVDLEPKSLC-VLGLYDGILMRYVKASTAYLGKQEDSIDFDITYY  1477
             ++L+K  +F+ D+++L DL P   C  +    G+L+RY+KASTAYLGK EDSID DI +Y
Sbjct  301   VALSKAPAFVADMKRLRDLNPDLFCAAVDARVGVLLRYIKASTAYLGKPEDSIDIDIVHY  360

Query  1478  RSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKF  1657
             RS+   +PR + D+++EIEQMA+ KYG LPHWGKNRN+AF GAI +Y  A EFL VK ++
Sbjct  361   RSRTDGMPRAHADVVDEIEQMALHKYGGLPHWGKNRNLAFDGAIARYPKAREFLGVKDRY  420

Query  1658  DPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAK  1837
             DP GLFSSEW+D++LG+    +I+K GCA+EGLC+CS D+HCAP +GYFCR GKVYK+A+
Sbjct  421   DPEGLFSSEWTDEVLGISGSPNIIKKGCAIEGLCVCSNDSHCAPEQGYFCRPGKVYKEAR  480

Query  1838  VC  1843
             VC
Sbjct  481   VC  482



>ref|XP_009389446.1| PREDICTED: L-gulonolactone oxidase-like [Musa acuminata subsp. 
malaccensis]
Length=598

 Score =   537 bits (1384),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 290/591 (49%), Positives = 389/591 (66%), Gaps = 18/591 (3%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             MA     +  +     L+   GS  P  P+    +   NCT+TN YG FPDR  C  A  
Sbjct  1     MAATYFALFASGLAVLLLLVQGS--PPGPVVQCRSGNTNCTVTNGYGAFPDRSTCCVAAV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEV  472
              YP TE ELL  ++ AT++++ MKA T YSHSIPKL+CP G    GL+IST+ LNR++ V
Sbjct  59    AYPSTELELLLAVSDATEKQQHMKAVTMYSHSIPKLSCPGGPSGQGLVISTQRLNRSVSV  118

Query  473   NASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSV  652
             + ++  MT E+G++LR++++ AA  GLALP+SPYW G+T+GGL+ TGSHGSS++G GS+V
Sbjct  119   DMATSRMTFEAGITLRELLDAAAARGLALPHSPYWQGMTLGGLLSTGSHGSSVFGKGSAV  178

Query  653   HDHVIHIRIV--TPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKR  826
             H++V+ +R+V  +PA     YA I  L + + D+ AA+VSLGVLGVISQVT +L+PMFKR
Sbjct  179   HEYVVGMRLVVPSPAPVNGYYAKIVNLGEDDPDLLAAKVSLGVLGVISQVTLQLEPMFKR  238

Query  827   SISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGL  1006
             SI+  V +D    +  + +     + D+ W P  R VVYR D +V   T G G+ D+ G 
Sbjct  239   SITNRVVSDVGFEQTISSYAVTTYYGDISWYPSQRRVVYRDDIKVPITTEGKGVNDYLGF  298

Query  1007  RAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL---TNDG--VKFSG  1171
             RA  T    +LR  EE  E+ G+A+ KC    L  + +   ++ G+    NDG  ++F+G
Sbjct  299   RAQPTHVGASLRASEERVEATGNAEGKCV---LFRLQVDTLIATGMGLKNNDGGLLEFTG  355

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPV+G Q+ MQSSG+CL S  DNL   C WDPR  G F+H+T  SI  T V  FI DV+K
Sbjct  356   YPVVGNQSDMQSSGSCLRSAEDNLLTACGWDPRFAGSFYHETAISIPFTTVADFIADVKK  415

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L D  P SLC   L  G  +R+++ STAYLGK +D ++ DITYYRS+DP  PRLYED+LE
Sbjct  416   LRDAHPNSLCGTELSLGFFIRFLRNSTAYLGKTDDVVEIDITYYRSRDPKRPRLYEDVLE  475

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA-GEFLKVKKKFDPLGLFSSEWSDQIL  1702
             EIEQMA+FKY  LPHWGKNRNV F     K  +   +F+ V +K+D  GLFSS+W+D +L
Sbjct  476   EIEQMALFKYNGLPHWGKNRNVGFLNVKNKLGAKLAKFVSVMQKYDSNGLFSSDWTDAVL  535

Query  1703  GLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             GL+    +V+ DGCALEGLCICS D+HCAP  GYFCR G+VY+ A+VC KI
Sbjct  536   GLRGKEVVVQGDGCALEGLCICSTDDHCAPKLGYFCRPGEVYEQARVCRKI  586



>ref|XP_009389445.1| PREDICTED: uncharacterized protein LOC103976003 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score =   537 bits (1384),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 298/591 (50%), Positives = 395/591 (67%), Gaps = 18/591 (3%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             MA   I +  +     L+   GS  P  P+    +   NCT+TN YG FPDR  CR A  
Sbjct  1     MAATHIALFASGLAVLLLLVQGS--PPGPVVRCRSGNTNCTVTNGYGAFPDRSTCRVAAV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEV  472
              YP TE ELL  ++ AT++++ MKA T YSHSIPKL+CP G    GL+IST+ LNR++ V
Sbjct  59    AYPSTEQELLLAVSDATEKQQHMKAVTMYSHSIPKLSCPGGPSGQGLVISTQLLNRSVSV  118

Query  473   NASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSV  652
             + ++  MT E+G++LR +++ AA  GLALP+SPYW G+T+GGL+ TGSHGSS++G GS+V
Sbjct  119   DMATSRMTFEAGITLRALLDAAAARGLALPHSPYWQGITLGGLLSTGSHGSSVFGKGSAV  178

Query  653   HDHVIHIRIVTPATEKEG--YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKR  826
             H++V+ +R+V P+       YA I  L + N D+ AA+VSLGVLGVISQVT +L+PMFKR
Sbjct  179   HEYVVGMRLVVPSPVPVNGYYAKIVNLGEDNPDLLAAKVSLGVLGVISQVTLQLEPMFKR  238

Query  827   SISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGL  1006
             SI+  V +D    +  + +     + D+ W P  R VVYR D +V   T G G+ D+ G 
Sbjct  239   SITNRVVSDVGFEQTISSYAAATYYGDISWYPSQRRVVYRDDIKVPITTKGKGVNDYLGF  298

Query  1007  RAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL---TNDG--VKFSG  1171
             RA  T  + +LR  EE  E+ G+A+ KC    L  + +   ++ G+    NDG  ++F+G
Sbjct  299   RAQPTLVVASLRASEELLEATGNAEGKCV---LFRLQVDTLIAIGMGFKNNDGGLLEFTG  355

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG Q+ MQS+G+CL S  DNL   C WDPR  GLF+HQTT SI  T +  FI DV+K
Sbjct  356   YPVIGNQSDMQSAGSCLRSAEDNLLTACGWDPRFAGLFYHQTTISIPFTTIAGFIADVKK  415

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L D  P +LC   LY G  MR+V+ STAYLGK +D +D DITYYRSKDP  PRLYED+LE
Sbjct  416   LRDAHPDALCSTELYLGFFMRFVRNSTAYLGKTDDVVDIDITYYRSKDPKKPRLYEDVLE  475

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA-GEFLKVKKKFDPLGLFSSEWSDQIL  1702
             EIEQMA+FKY ALPHWGKNRNV F     K  +   +F+ V +K+D  GLFSS+W+D +L
Sbjct  476   EIEQMALFKYNALPHWGKNRNVGFLNVKNKLGAKLDKFVSVMQKYDSNGLFSSDWTDAVL  535

Query  1703  GLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             GL+    +V+ DGCALEGLCICS D+HCAP +GY+CR G+VY+ A+VC KI
Sbjct  536   GLRGKEVVVQGDGCALEGLCICSTDDHCAPKQGYYCRPGEVYEQARVCRKI  586



>gb|EMS46905.1| L-gulonolactone oxidase [Triticum urartu]
Length=500

 Score =   532 bits (1370),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 262/495 (53%), Positives = 354/495 (72%), Gaps = 3/495 (1%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             MK AT++SHS PKLACP G DG +IST+ LNR + V+ +   MTVESG+ LR +I+ A+ 
Sbjct  1     MKVATKHSHSFPKLACPGGSDGTIISTERLNRVVSVDLAKRLMTVESGMVLRDLIQAASA  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
              GLALP+SPYW GLT+GGL+ TG+HGSSLWG G +VH++V+ +RIVTPA   +G+A +R 
Sbjct  61    KGLALPHSPYWSGLTIGGLLATGAHGSSLWGKGGAVHEYVVGMRIVTPAPASQGFAVVRE  120

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L   + D+ AA+VSLGVLGV+SQVT  LQPMFKRS++FV ++D D+ ++A ++G  HEF 
Sbjct  121   LCADHPDLNAAKVSLGVLGVVSQVTLALQPMFKRSVTFVTRDDSDMAEKAARWGDLHEFG  180

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             DM WLP+ R V+YR DDRV+  T G+GL D  G R+  T  L   R   E  E   +A  
Sbjct  181   DMAWLPQLRKVIYREDDRVAIKTVGHGLNDHLGFRSNPTASLIRGRVTMELLEKNINAIA  240

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
             +C       V +    +YG TN+G  F+GYPV+G+Q+ +Q+SG CL S  D L  +C WD
Sbjct  241   RCKAAN-ATVSLFETAAYGFTNNGSMFTGYPVVGFQHQIQASGACLGSQEDALLTSCAWD  299

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PR+ G FF+   +SI+L++V +FI D+Q+L D  P S C +    G+L+RYVKAS+AYLG
Sbjct  300   PRIRGTFFYTNGYSIALSRVPAFIADMQQLRDRSPLSFCGIDASMGMLLRYVKASSAYLG  359

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             K EDSIDFDI+YYRS     P  + D+L+E++QMA+ KY A+PH GKNRN AF+G + K+
Sbjct  360   KPEDSIDFDISYYRSYSKGDPNPHYDVLDELQQMALHKYNAIPHLGKNRNFAFEGTMAKH  419

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
               A +FL+VK+++DP G+FSSEWSDQ+LG+    +I +  CA+EGLCICS D+HCAP +G
Sbjct  420   PKADKFLEVKQRYDPDGIFSSEWSDQVLGINGSPAIFEKRCAIEGLCICSDDSHCAPEEG  479

Query  1799  YFCRAGKVYKDAKVC  1843
             Y+C  GKVY DA+VC
Sbjct  480   YYCLPGKVYTDARVC  494



>ref|XP_002885579.1| hypothetical protein ARALYDRAFT_319075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61838.1| hypothetical protein ARALYDRAFT_319075 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   526 bits (1355),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 268/501 (53%), Positives = 358/501 (71%), Gaps = 10/501 (2%)
 Frame = +2

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             M+  TR+SHS  KLAC +G DG LIS + LN+TL V+  +MT+TV+SGVSLRQ+I +AAK
Sbjct  1     MRVVTRFSHSTTKLACVDGKDGRLISAELLNKTLSVDRDAMTITVQSGVSLRQLIGDAAK  60

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV--GSSVHDHVIHIRIVTPATEKEGYATI  718
              GLAL  +P+WWGLTVGG+M TG+HGSS  G   G++ HD+VI +R+VT A   +GY+ I
Sbjct  61    VGLALRMAPHWWGLTVGGMMSTGAHGSSWDGERGGTAFHDYVIEMRMVTSAPPDQGYSMI  120

Query  719   RTLKQGN-SDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             RTL + N S++ AARVSLGV GVISQVT +L+ MFKRSI+++   D DL +   K G ++
Sbjct  121   RTLNRSNFSELDAARVSLGVFGVISQVTVQLELMFKRSITYMNIKDSDLVEMVEKHGDRY  180

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EF D+ W P    VVYR+D+RVS N SG+G +D     A  +  L   R KEE  E   +
Sbjct  181   EFPDIMWYPSQGEVVYRMDERVSMNISGSGSYDSVLFEAKDSKILAFQRSKEEELEFERN  240

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLT--C  1249
             ++E C+    +   +++ L YGL+NDG+    Y V    + + SSG CLDS  D L   C
Sbjct  241   SEEICTLARDVPA-LLYTLLYGLSNDGM----YEVFWLSSDLMSSGGCLDSKEDGLATAC  295

Query  1250  PWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTA  1429
             PWD R++G FFHQTTF+I +  VK FI D++ LV +EPK+LC L  Y+G+L+RYV+ S A
Sbjct  296   PWDSRIHGQFFHQTTFTIPIESVKEFISDIKTLVKIEPKALCGLNFYNGVLIRYVQPSFA  355

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLG + + ++F+ TYYRS+DP++PR+YED  E+IEQ+ +FKYG LPHWGKNRNVAF  A 
Sbjct  356   YLGIEFEGMEFEFTYYRSRDPLMPRMYEDFFEDIEQIGLFKYGGLPHWGKNRNVAFINAT  415

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAP  1789
              KYK A  FLK+K+ FDPL LFSS+W+D +LGL   L++  +GCALEGLCICS+D HC+P
Sbjct  416   EKYKDAALFLKMKQMFDPLHLFSSKWTDAVLGLGGDLTVDTEGCALEGLCICSKDVHCSP  475

Query  1790  NKGYFCRAGKVYKDAKVCVKI  1852
             ++GYFCRAGK+YK A+VC  +
Sbjct  476   SRGYFCRAGKIYKAARVCTHV  496



>ref|XP_009389444.1| PREDICTED: L-gulonolactone oxidase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   526 bits (1355),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 293/591 (50%), Positives = 390/591 (66%), Gaps = 18/591 (3%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             MA   I +  +     L+   GS  P  P+    +   NCT+TN YG FPDR  CR A  
Sbjct  1     MAATHIALFASGLAVLLLLVQGS--PPGPVVQCRSGNTNCTVTNGYGAFPDRSTCRVAAV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEV  472
              YP TE EL  +++ AT++++ MK  T YSHSIPKL+CP G    GL+IST+ L R++ V
Sbjct  59    AYPSTEEELRLVVSDATEKQQHMKVVTMYSHSIPKLSCPGGPSGQGLVISTQRLGRSVSV  118

Query  473   NASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSV  652
             + ++  MT E+G++LR +++ AA  GLAL +SPYW G+T+GGL+ TGSHGSS +G GS+V
Sbjct  119   DMATSRMTFEAGITLRALLDAAAARGLALSHSPYWQGMTLGGLLSTGSHGSSAFGKGSAV  178

Query  653   HDHVIHIRIVTPATEKEG--YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKR  826
             H++V+ +R+V P+       YA I  L + + D+ AA+VSLGVLGVISQVT +L+PMFKR
Sbjct  179   HEYVVGMRLVVPSPVPVNGYYAKIVNLGEDDPDLLAAKVSLGVLGVISQVTLQLEPMFKR  238

Query  827   SISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGL  1006
             SI+  V +D    +  + +     + D+ W P  R VVYR D +V   T G G+ D+ G 
Sbjct  239   SITNRVVSDVGFEQTISSYAVTTYYGDISWYPSQRRVVYRDDIKVPITTKGKGVNDYLGF  298

Query  1007  RAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL---TNDG--VKFSG  1171
             RA  T    +LR  EE  E+ G+A+ KC    L  + +   ++ G+    NDG  ++F+G
Sbjct  299   RAQPTLVGASLRASEERVEATGNAEGKCV---LFRLQVDTLIATGMGFKNNDGGLIEFTG  355

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG Q+ MQS+G+CL S  DNL   C WDPR  GLF+HQTT SI  T +  FI DV+K
Sbjct  356   YPVIGNQSDMQSAGSCLRSAEDNLLTACGWDPRFAGLFYHQTTISIPFTTIAGFIADVKK  415

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L D  P +LC   LY G  MR+V+ STAYLGK +D +D DITYYRSKDP  PRLYED+LE
Sbjct  416   LRDAHPDALCSTELYLGFFMRFVRNSTAYLGKTDDVVDIDITYYRSKDPKKPRLYEDVLE  475

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA-GEFLKVKKKFDPLGLFSSEWSDQIL  1702
             EIEQMA+FKY ALPHWGKNRNV F     K  +   +F+ V +K+D  GLFSS+W+D +L
Sbjct  476   EIEQMALFKYNALPHWGKNRNVGFLNVKNKLGAKLDKFVSVMQKYDSNGLFSSDWTDAVL  535

Query  1703  GLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             GL+    +V+ DGCALEGLCICS D+HCAP +GY+CR G+VY+ A+VC KI
Sbjct  536   GLRGKEVVVQGDGCALEGLCICSTDDHCAPKQGYYCRPGEVYEQARVCRKI  586



>ref|XP_002985505.1| hypothetical protein SELMODRAFT_181802 [Selaginella moellendorffii]
 gb|EFJ13379.1| hypothetical protein SELMODRAFT_181802 [Selaginella moellendorffii]
Length=587

 Score =   523 bits (1346),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 259/538 (48%), Positives = 364/538 (68%), Gaps = 14/538 (3%)
 Frame = +2

Query  257   GTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLL  436
             G +PDR  CRAA+  YP TE ELL+ +A A    RKMK  +R+S SIPKLACP GD G++
Sbjct  38    GVWPDRIPCRAAQVFYPATEEELLAAVAYAASNNRKMKMVSRWSQSIPKLACPGGDSGVI  97

Query  437   ISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGS  616
             IST+ LN  + VN+  MT+TV++GV L+Q+++  +  G ALP + YW  ++V G + TG+
Sbjct  98    ISTRDLNSGIVVNSEEMTVTVDAGVLLQQLVDTISTLGFALPAATYWNAVSVAGAVSTGA  157

Query  617   HGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGVIS  790
             HGSSLWG G ++HD+V+ + +V PATE++G+A +  L + +S   + AA++SLGVLG IS
Sbjct  158   HGSSLWGRGGALHDYVVGVSLVVPATEEDGFAKVVRLDENSSKDLLDAAKLSLGVLGAIS  217

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             ++T  ++PMFKRS++  VK+D ++ ++  +FG  HEF D+ W P  +  ++++D+R    
Sbjct  218   KITLSIEPMFKRSVALEVKDDAEIEEQVLRFGSDHEFGDICWHPSLKASLFKLDERAPLE  277

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE--KCS-NQWLINVWMVWFLSYG  1141
             T G G   + G +    +     R KE+ ++   D DE  +C  ++ ++N  +      G
Sbjct  278   TPGGGTNIYKGFQPFPVERAEQSRRKEKIEQ---DKDEWTRCRFSEMVLNSRVP--SGNG  332

Query  1142  LTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN---DNLTCPWDPRVNGLFFHQTTFSISLT  1312
               NDG+ F+G+PV+GY N MQ++G C D+     D+  C WDPRV G F+HQT FS+SL 
Sbjct  333   YLNDGINFTGFPVVGYNNLMQTAGGCQDAPPQEVDSDVCSWDPRVAGSFYHQTAFSVSLD  392

Query  1313  KVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDP  1492
             KVK  I D++KL D++P SLC L LY GI +RYVKAS+AYLG++ED+++FDITYYRS+D 
Sbjct  393   KVKDLILDIKKLRDMDPSSLCGLSLYGGIYLRYVKASSAYLGQKEDAVEFDITYYRSRDG  452

Query  1493  MVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGL  1672
               PRL ED++EEIEQMA+FKY   PHWGKNRN+AF     + K    F   K + DP GL
Sbjct  453   GTPRLNEDVVEEIEQMALFKYQGKPHWGKNRNIAFTSIRDRVKDLDRFAWAKSRLDPAGL  512

Query  1673  FSSEWSDQIL-GLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             FSSEWSD IL G + G+    D CALEG+CICS+D HCAP  G+FCR GKV+  A+VC
Sbjct  513   FSSEWSDAILGGDRDGIVSFHDHCALEGMCICSEDRHCAPESGFFCRPGKVFVSARVC  570



>gb|EMT12398.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=536

 Score =   520 bits (1340),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 267/556 (48%), Positives = 365/556 (66%), Gaps = 59/556 (11%)
 Frame = +2

Query  185   SSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRK  364
             SS P +P++C    +        YG+FPDR +CRAA A +P+TE EL++ +A     +R+
Sbjct  22    SSPPPEPVECARGTSDCTVTNV-YGSFPDRTICRAANATFPRTEKELVAAVAADAAGQRE  80

Query  365   MKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAK  544
             +K ATR+SHS  KLACP G DG +IST+ LN+T+ V+A+   MTVESG+ L+ +I+ AA 
Sbjct  81    VKVATRHSHSFTKLACPGGRDGTIISTERLNKTVSVDAAKGLMTVESGMVLKDLIQAAAA  140

Query  545   AGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRT  724
             AGLALP+SPYW+GLT+GGL+ TG+HGSSL G GS+VH++V+ +RIVTPA   +G+A +R 
Sbjct  141   AGLALPHSPYWYGLTIGGLLATGAHGSSLRGKGSAVHEYVVGMRIVTPAPASQGFAVVRE  200

Query  725   LKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFA  904
             L  G+ D+ A +VSLGVLGV+SQVT  LQPMFKRS++F  ++D D   +A  +G  +EF 
Sbjct  201   LSVGDPDLDAVKVSLGVLGVVSQVTLALQPMFKRSVTFEKRDDTDFASQAAMWGGLYEFG  260

Query  905   DMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADE  1084
             DM W+PR                 G G  +  G+           R+ E  +   G    
Sbjct  261   DMAWVPR--------------EGQGRGALEGAGVH---------RRDAEAPRPLTG----  293

Query  1085  KCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWD  1258
                       W V                   +G+QN +Q+SGTC+ S  D L  +C WD
Sbjct  294   ----------WPV-------------------VGFQNRIQASGTCISSPEDGLLSSCTWD  324

Query  1259  PRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLG  1438
             PR+   FF+ + FS++L+K  +FI ++QKL DL+P++ C L    G+L+RYV+AS+AYLG
Sbjct  325   PRIRSPFFYNSGFSVALSKAPAFIAEMQKLRDLKPRAFCGLDAKLGVLLRYVRASSAYLG  384

Query  1439  KQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY  1618
             K EDSIDFD+TYYRS     PR   D+++EIEQ+A+ KYGA+PHWGKNRN  F G I KY
Sbjct  385   KSEDSIDFDVTYYRSYTEGEPRANSDVVDEIEQLALRKYGAVPHWGKNRNFVFDGVIAKY  444

Query  1619  KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKG  1798
               A EFLKVK ++DP G+FSSEWSDQ+LG+K   +IV+ GCA+EGLC+CS+D+HCAP KG
Sbjct  445   PKAAEFLKVKARYDPDGIFSSEWSDQVLGIKGSPNIVEKGCAIEGLCVCSKDSHCAPEKG  504

Query  1799  YFCRAGKVYKDAKVCV  1846
             YFCR G V+ +A+VC+
Sbjct  505   YFCRPGTVFSEARVCL  520



>ref|XP_009389443.1| PREDICTED: L-gulonolactone oxidase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=598

 Score =   516 bits (1328),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 288/591 (49%), Positives = 386/591 (65%), Gaps = 18/591 (3%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             MA   I +  +     L+   GS  P  P+    +   NCT+TN YG FPDR  CR A  
Sbjct  1     MAATHIALFASGLAVLLLLVQGS--PPGPVVQCRSGNTNCTVTNGYGAFPDRSTCRVAAV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEV  472
              YP TE EL  +++ AT++++ MK  T YSHSIPKL+CP G    GL+IST+ L R++ V
Sbjct  59    AYPSTEEELRLVVSDATEKQQHMKVVTMYSHSIPKLSCPGGPSGQGLVISTQRLGRSVSV  118

Query  473   NASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSV  652
             + ++  MT E+G++LR +++ AA  GLAL +SPYW G+T+GGL+ TGSHGSS +G GS+V
Sbjct  119   DMATSRMTFEAGITLRALLDAAAARGLALSHSPYWQGMTLGGLLSTGSHGSSAFGKGSAV  178

Query  653   HDHVIHIRIVTPATEKEG--YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKR  826
             H++V+ +R+V P+       YA I  L + + D+ AA+VSLGVLGVISQVT +L+PMFKR
Sbjct  179   HEYVVGMRLVVPSPVPVNGYYAKIVNLGEDDPDLLAAKVSLGVLGVISQVTLQLEPMFKR  238

Query  827   SISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGL  1006
             SI+  V +D    +  + +     + D+ W P  R VVYR D +V   T G G+ D+ G 
Sbjct  239   SITNRVVSDVGFEQTISSYAVTTYYGDISWYPSQRRVVYRDDIKVPITTKGKGVNDYLGF  298

Query  1007  RAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL---TNDG--VKFSG  1171
             RA  T    +LR  EE  E+ G+A+ KC    L  + +   ++ G+    NDG  ++F+G
Sbjct  299   RAQPTLVGASLRASEERVEATGNAEGKCV---LFRLQVDTLIATGMGFKNNDGGLIEFTG  355

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG Q+ MQS+G+CL S  DNL   C WDPR  G F+HQTT SI  T +  FI DV+K
Sbjct  356   YPVIGNQSDMQSAGSCLRSPEDNLLTACGWDPRFAGFFYHQTTISIPFTTISDFIADVKK  415

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L D  P +LC   LY G L+R+V+ STAYLGK +D +  DITYYRSKDP  PRLYED+ E
Sbjct  416   LRDAHPDALCSTELYLGFLIRFVRNSTAYLGKTDDVVAIDITYYRSKDPKQPRLYEDVFE  475

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA-GEFLKVKKKFDPLGLFSSEWSDQIL  1702
             EIEQMA+FKY  LPHWGKNRNV F     K  +   +F+ V +K+D  GLFSS+W+D +L
Sbjct  476   EIEQMALFKYNGLPHWGKNRNVGFLNVKNKLGAKLAKFVSVMQKYDSNGLFSSDWTDAVL  535

Query  1703  GLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             GL+    +V+ DGCA+EGLCICS D+HCAP  GY+CR G+VY+ A+VC KI
Sbjct  536   GLRGKEVVVQGDGCAMEGLCICSTDDHCAPKLGYYCRPGEVYEQARVCRKI  586



>ref|XP_009389844.1| PREDICTED: L-gulonolactone oxidase-like [Musa acuminata subsp. 
malaccensis]
Length=598

 Score =   513 bits (1320),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 284/591 (48%), Positives = 385/591 (65%), Gaps = 18/591 (3%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             MA   I + ++     L+   GS  P  P+    +   NCT+TN YG FPDR  CR A  
Sbjct  1     MAATHIALFVSGLAVLLLLVQGS--PPGPVVQCRSGNTNCTVTNGYGAFPDRSTCRVAAV  58

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEV  472
              YP  E ELL  ++ AT +++ +KA T YSHSIPKL+CP G    GL+IST+ LNR++ V
Sbjct  59    AYPSNEQELLLAVSDATVKQQHVKAVTVYSHSIPKLSCPGGPSGQGLVISTQRLNRSVSV  118

Query  473   NASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSV  652
             + ++  MT E+G++LR +++ AA  GLALP+SPYW G+T+GGL+ TGSHGSS++G GS+V
Sbjct  119   DLATSRMTFEAGITLRALLDAAAARGLALPHSPYWQGVTLGGLLSTGSHGSSVFGKGSAV  178

Query  653   HDHVIHIRIV--TPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKR  826
             H++V+ +R+V  +P      YA I  L + + D+ AA+VSLGVLGVISQVT +L+PMFKR
Sbjct  179   HEYVVGMRLVVPSPVPVNGSYAKIVNLGEDDPDLLAAKVSLGVLGVISQVTLQLEPMFKR  238

Query  827   SISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGL  1006
             SI+  V +D    +  + +     + D+ W P    VVYR D +V   T G G+ +F G 
Sbjct  239   SITNRVVSDVGFEQTISSYAVTTHYGDIIWYPSQGRVVYRDDIKVPITTKGKGVNNFLGF  298

Query  1007  RAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL---TNDG--VKFSG  1171
             RA  T  + + R  EE  E  G+A+ KC    L  +     ++ G+    NDG  + F+G
Sbjct  299   RAQPTLVIASTRASEELSELTGNAEGKC---VLSRLQADTLIATGMGLKNNDGGLLDFTG  355

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPV+G Q+ MQS+G+CL S  D L   C WDPR  GLF+HQ+  SI  T +  FI DV+K
Sbjct  356   YPVVGNQSDMQSAGSCLRSAEDKLLTACGWDPRFAGLFYHQSAISIPFTTIADFIADVKK  415

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L D  P +LC   LY G  MR+V++STAYLGK +D +D DITYYRSKDP  PRLYED++E
Sbjct  416   LRDAHPNALCGTELYLGFFMRFVRSSTAYLGKTDDVVDIDITYYRSKDPKRPRLYEDVIE  475

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSA-GEFLKVKKKFDPLGLFSSEWSDQIL  1702
             EIEQ+A+FKY  LPHWGKNRNV F     K  +   +F+   +K+D  GLFSS+W+D +L
Sbjct  476   EIEQLALFKYNGLPHWGKNRNVGFLNIKNKLGAKLDKFVSAMQKYDSNGLFSSDWTDAVL  535

Query  1703  GLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKI  1852
             GL+    +V+ +GCALEGLCICS D+HCAP +GY+CR G+VY  A+VC KI
Sbjct  536   GLRGKEVVVQGNGCALEGLCICSTDDHCAPKQGYYCRPGEVYDQARVCRKI  586



>gb|KFK25416.1| hypothetical protein AALP_AA8G111800 [Arabis alpina]
Length=585

 Score =   505 bits (1300),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 261/576 (45%), Positives = 366/576 (64%), Gaps = 11/576 (2%)
 Frame = +2

Query  131   SINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPK  310
             ++N  I  +    I+TV S  P+ P++C            +YGT+PDR  C AA   YP 
Sbjct  6     TLNFSILCFFFVTIWTVQSVPPQPPVRCDQTGCTVSN---AYGTWPDRKTCHAANITYPT  62

Query  311   TEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMT  490
             TE EL   +A A++   K+K  T++SH+IPKLACP G D LLIST   N  +E+    +T
Sbjct  63    TEEELRKAVAYASEHNLKVKTVTKFSHTIPKLACPSGSDTLLISTSNYNSVIEIEPDRLT  122

Query  491   MTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIH  670
             +T +SGVSLR++I++  KAG ++  SPYW G+++GGL+ TGSHGSS  G G SVHDHV+ 
Sbjct  123   VTADSGVSLREIIDKVEKAGFSIGTSPYWEGVSIGGLISTGSHGSSWLGRGGSVHDHVVG  182

Query  671   IRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGVISQVTFKLQPMFKRSISFVV  844
             I +V P    EGYA +  +++G  D  + A +VSLGVLGVIS+V   ++  FKRS+++  
Sbjct  183   ISLVVPTNSSEGYAKVVRIEEGKDDKLLNAVKVSLGVLGVISKVKLSIEKAFKRSMTYNF  242

Query  845   KNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTD  1024
              +D  L     + G ++EF D+ W P  +  VYR D R+  N SGNG+ DF G ++    
Sbjct  243   TSDVALEDIFMEHGKKYEFGDITWYPSRKTAVYRYDSRLPVNVSGNGVNDFIGFQSNPIL  302

Query  1025  CLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQ  1204
                 +R  E+  ES  +   KC+       +       GL N+GV F+GYPVIG Q  +Q
Sbjct  303   ISKGIRALEKTLESSKNEKAKCTTADTTLAYKK-LTGNGLKNNGVIFTGYPVIGSQGKIQ  361

Query  1205  SSGTCL--DSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCV  1378
             +SG+CL   S+  +++C WDPR NGLFF++TT    +++ + F+ DV+K+ DL P  LC 
Sbjct  362   ASGSCLYSSSVRIDVSCAWDPRYNGLFFYETTAIFPVSRFRDFLLDVKKIRDLNPDRLCG  421

Query  1379  LGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYG  1558
             + +Y+GIL+R++K S AYLG+ EDS+  D  YYR+ D + PRL +D +EE+EQMA FK+G
Sbjct  422   IDIYNGILIRFIKGSKAYLGQTEDSVVIDFNYYRADDALTPRLNQDAMEEMEQMAFFKHG  481

Query  1559  ALPHWGKNRNVAFQGAIRKY-KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD  1735
             A PHWGKNR V F G  +KY  +  +FL+VK K DP  +FSSEWSD+IL  + G     D
Sbjct  482   AKPHWGKNRKVGFFGVKQKYGPNFDKFLEVKNKLDPKKMFSSEWSDEILFGQEGSKY--D  539

Query  1736  GCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             GCALEG C+CS++ HC+P+KGYFCR G VY  A+VC
Sbjct  540   GCALEGNCVCSENRHCSPSKGYFCRQGLVYTQARVC  575



>emb|CDP16177.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   500 bits (1287),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 267/589 (45%), Positives = 373/589 (63%), Gaps = 27/589 (5%)
 Frame = +2

Query  119   MAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKA  298
             MA  S  +L  I +  L+ T+ +  P +P++C     +      SY  + DR  C  +  
Sbjct  1     MANHSCFLLNGILL-ILMSTIQAIPPPNPVQCNSTGCILHN---SYAVWGDRKDCYVSGV  56

Query  299   VYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEG-------DDGLLISTKYLN  457
             VYP TE EL   +A A K K+K+K  T++SH+IPKLACP G        +  LIST+   
Sbjct  57    VYPATEEELRFAVANANKNKQKVKVVTKFSHTIPKLACPTGTASIQADQNATLISTEKYR  116

Query  458   RTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWG  637
               + ++A++MT+T +SGV LR +I++   AGL+L  SPYW G+TV GL+ TG+HGSS WG
Sbjct  117   SDINMDAANMTVTADSGVPLRDLIDKVEAAGLSLVASPYWEGVTVAGLISTGAHGSSWWG  176

Query  638   VGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPM  817
              G +VHDHVI + ++ PAT  EGYA + +L   +  + AA+VSLG+LGVIS+VTF L+P 
Sbjct  177   AGGAVHDHVIGLSLIIPATASEGYAKVISLNHQDPLLNAAKVSLGMLGVISKVTFSLEPA  236

Query  818   FKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDF  997
             FKRSI++   +D  +  +      +HEF D++W P  + VVYR DDRV  +T+GNG+ DF
Sbjct  237   FKRSITYNFASDDHIEDQVFDHAKKHEFGDIQWYPSRQTVVYRYDDRVPLSTAGNGVNDF  296

Query  998   FGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYG-LTNDGVK----  1162
              G +        ++R  E+  E+  + + KC+           F++Y  LT +G+K    
Sbjct  297   IGFQPNAILLSQSVRASEKSFENARNVNGKCT-------LASSFVAYKKLTANGLKNNLI  349

Query  1163  FSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIED  1336
             F+GYPV+G Q  MQ+SG+CL+S    +   C WDPR+ GLFF+++T     TK   F+ D
Sbjct  350   FTGYPVVGRQGKMQTSGSCLNSSPARIDQACSWDPRIKGLFFYESTAIFPATKFIDFLRD  409

Query  1337  VQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYED  1516
             V+KL DL+P++ C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+ DP  PRL +D
Sbjct  410   VRKLRDLKPENFCGVDIYNGFLIRFIKASKAYLGQSEDSVVVDFNYYRADDPSTPRLNQD  469

Query  1517  ILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQ  1696
             + EE+EQMA  KYGA PHW KNRNVAF     KY +   F+  K++ DP  +FSSEWSDQ
Sbjct  470   VWEEVEQMAFIKYGARPHWAKNRNVAFLDVQNKYPNFNRFVAAKEQLDPQNMFSSEWSDQ  529

Query  1697  ILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             IL  +   S   DGCALEG CICSQD HC+P KGYFCR+G VY +A+VC
Sbjct  530   ILFGRQ--SNKADGCALEGQCICSQDRHCSPEKGYFCRSGLVYTEARVC  576



>ref|XP_008378092.1| PREDICTED: L-gulonolactone oxidase [Malus domestica]
Length=595

 Score =   499 bits (1286),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/566 (44%), Positives = 370/566 (65%), Gaps = 8/566 (1%)
 Frame = +2

Query  152   IYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLS  331
             I+V  ++ T  +  P  PI+C  +   N +   SYG + DR  C A  A +P+TE +L  
Sbjct  15    IWVATMLITSQAMPPPPPIQCDASTGCNLSN--SYGVWGDRTDCHAPSAAHPQTEEDLRL  72

Query  332   IIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEVNASSMTMTVES  505
              +A A+K K K+K  +++SH+IPKLACP+    D +LIST  +N T+E++A+++ +TV++
Sbjct  73    AVAFASKNKIKVKVVSKFSHTIPKLACPDMSFGDAMLISTANVNSTIEIDAANLAVTVDA  132

Query  506   GVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVT  685
             GV LRQ+I++  +AGL+L  +PYW G+++GGL+ TG HGSS WG G +VHDHVI + +V 
Sbjct  133   GVGLRQLIDKVEEAGLSLVAAPYWEGVSIGGLISTGVHGSSWWGRGGAVHDHVIGLNLVV  192

Query  686   PATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLG  865
             PA + EGYA +  L   +   KAA+VSLG+LG IS+V  +L+P FKRSI++   +D  + 
Sbjct  193   PANQSEGYAKVLRLDSKDEIFKAAKVSLGLLGTISKVKLRLEPAFKRSIAYNFTDDAQIE  252

Query  866   KEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALRE  1045
                     ++EF D+ W P      YR D+R+  N SG+G +DF G ++        +R 
Sbjct  253   DIYMDHAKKYEFGDITWYPSKHTAAYRYDNRLPLNASGDGTYDFLGFQSNSVVVSKTIRA  312

Query  1046  KEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLD  1225
              E+  +S   +  KC+    + +     ++ GL N+ + F+GYPV+G+Q  MQ+SG+CL 
Sbjct  313   TEKTMDSGRSSIGKCTLASTV-LEAKKLVANGLKNNLI-FTGYPVVGHQGKMQTSGSCLY  370

Query  1226  SLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILM  1405
             S   + +C WDPR+NGLFF++TT     +K   FI DV+KL DL+P++ C + +Y+G L+
Sbjct  371   SAGTDKSCAWDPRINGLFFYETTAIFPASKFADFIRDVKKLRDLKPENFCGVDIYNGFLI  430

Query  1406  RYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNR  1585
             R+++ S AYLG+QE+S+  D  YYR+ D   PR  +D+ EE+EQ+A FK+GA PHW KNR
Sbjct  431   RFIRVSDAYLGQQENSVVVDFNYYRADDASTPRFNQDVWEEVEQLAFFKHGAKPHWAKNR  490

Query  1586  NVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCIC  1765
             N AF    +KY +  +FL VK++ DP  + SSEWSD+IL  K G    +DGCALEGLC+C
Sbjct  491   NAAFLDVQKKYPNFNKFLGVKRRLDPQNILSSEWSDEILSGKEGAK--RDGCALEGLCVC  548

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             S+D HC+P KGYFC+ G VYK+A+VC
Sbjct  549   SEDRHCSPAKGYFCKPGLVYKEARVC  574



>ref|XP_002882087.1| hypothetical protein ARALYDRAFT_904146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58346.1| hypothetical protein ARALYDRAFT_904146 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   499 bits (1285),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 279/583 (48%), Positives = 357/583 (61%), Gaps = 88/583 (15%)
 Frame = +2

Query  143   LITIYVQF-LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             LI +Y  F L+ T  S+ P+DP+KC   N        SYG FPDR  CRAA   YPK EA
Sbjct  20    LIGLYYIFTLVHTAVSTPPDDPVKCVSGNMNCTVTN-SYGAFPDRSTCRAANVAYPKNEA  78

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTV  499
             EL+S++A AT+  RKM+  TRYSHSI KL C +G DGL ISTK+LN T++ NA++MT+TV
Sbjct  79    ELVSVVAAATQAGRKMRVTTRYSHSITKLVCTDGTDGLFISTKFLNHTVQANATAMTLTV  138

Query  500   ESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRI  679
             ESG +LRQ+I EAAK GLALPY+PYWWGLTVGGLMGTG+HGSSLWG GS+VHD+V  IR+
Sbjct  139   ESGTTLRQLIAEAAKIGLALPYAPYWWGLTVGGLMGTGAHGSSLWGKGSAVHDYVTEIRM  198

Query  680   VTPATEKEGYATIRTLKQGNS--DIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKND  853
             V+P +  +G+A IR L +  +  + KAA+VSLGVLGVISQ          RS+++ +KND
Sbjct  199   VSPGSANDGFAKIRVLSEITTPNEFKAAKVSLGVLGVISQ----------RSLTYTMKND  248

Query  854   RDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLN  1033
              D   +A  FG + EFAD  WLP                + G  ++          D   
Sbjct  249   SDFEDQAVTFGKKQEFADFIWLP----------------SQGKVVYR-------RDDEYP  285

Query  1034  ALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSG-----------YPV  1180
             +     E QE+  D + KC    +I+   ++  SYGLTN+G  F               +
Sbjct  286   STHRAMETQETFRDVNGKCVGATIISS-TLFATSYGLTNNGNYFHFTYTFSLILQRIINI  344

Query  1181  IGYQNHMQSSGTCLDSLNDNLTCPWDPR--------------------VNGL-----FFH  1285
             + Y     S  +        L+  W PR                      GL      FH
Sbjct  345   LTYAYLYVSIFSGFRHYIHWLSGRWKPRPYDVVRIMSRQPSRWIDHGVCVGLTHKRRIFH  404

Query  1286  QTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFD  1465
             QTTFS+ LT+VKSFI D++ LV +EPKSLC L L+ GILMRYV +S AYL K+ +++DFD
Sbjct  405   QTTFSVPLTQVKSFISDIKSLVKIEPKSLCGLELHYGILMRYVTSSPAYLVKETEALDFD  464

Query  1466  ITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKV  1645
             ITYYR+KDP+ PRLY+D +EEIEQ+A+FKY ALPHW              Y +A  FLKV
Sbjct  465   ITYYRAKDPLTPRLYKDFIEEIEQIALFKYNALPHW--------------YNNALAFLKV  510

Query  1646  KKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             K+ +DP GLFSSEW+DQILG+K  ++IVKDGCALEGLCICS+D
Sbjct  511   KESYDPKGLFSSEWTDQILGIKGNVTIVKDGCALEGLCICSKD  553



>ref|XP_007012090.1| D-arabinono-1,4-lactone oxidase family protein [Theobroma cacao]
 gb|EOY29709.1| D-arabinono-1,4-lactone oxidase family protein [Theobroma cacao]
Length=584

 Score =   499 bits (1284),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 255/554 (46%), Positives = 356/554 (64%), Gaps = 10/554 (2%)
 Frame = +2

Query  194   PEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKA  373
             P DP++C            SYG + DR  C      YP TE EL   +A A K K K K 
Sbjct  28    PRDPVQCNGTVCTLYN---SYGAWGDRKDCHFKTVAYPTTEEELRLAVAYANKNKFKAKV  84

Query  374   ATRYSHSIPKLACP--EGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKA  547
              +++SH+IPKLACP    DD LLIST   +  +E+ +++  +T ++GV+LR++I++  +A
Sbjct  85    VSKFSHTIPKLACPSSRSDDSLLISTAKYDSNIEIESANFAVTADAGVALRELIDKVEEA  144

Query  548   GLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTL  727
             GL+L  +PYW G++V GL+ TG+HGSS WG G +VHDHVI + ++ PA+E EGYA +  +
Sbjct  145   GLSLVAAPYWEGVSVAGLISTGAHGSSWWGKGGAVHDHVIGLSLIVPASESEGYAKVIQI  204

Query  728   KQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFAD  907
                +  + AA+VSLGVLGVIS+V F L+P FKR I+F   +D  +  E  + G ++EF D
Sbjct  205   GAQDQLLNAAKVSLGVLGVISKVKFSLEPGFKRIITFNYTDDSLIESEFIEHGKKYEFGD  264

Query  908   MKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEK  1087
             + W P      YR D RVS + SG+G+ DF G +        ++R  E+  ES  + + K
Sbjct  265   ITWYPSKHTAAYRYDSRVSMDASGDGINDFLGFQDNEILASESVRAAEKAFESAKNVNGK  324

Query  1088  CSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDP  1261
             C+    I +     ++ GL N+G+ F+GYPV+G Q  MQ+SG+CL S    +  +C WDP
Sbjct  325   CTLA-AITLGYKKLIANGLKNNGLIFTGYPVVGRQGKMQASGSCLYSPITRIDSSCAWDP  383

Query  1262  RVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGK  1441
             R  GLFF+++T   S++K   FI DV++L DL P+  C + LY+G L+RY+KAS AYLG+
Sbjct  384   RYKGLFFYESTAIFSVSKFGEFIRDVKRLRDLRPEKFCGVDLYNGFLIRYIKASKAYLGQ  443

Query  1442  QEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYK  1621
              EDSI  D  YYR+ D   PRL +D++EE+EQ+A  KYGA PHW KNRN+AF     KY 
Sbjct  444   SEDSIVVDFNYYRADDASTPRLNQDVIEEVEQIAFLKYGARPHWAKNRNLAFLNVQTKYP  503

Query  1622  SAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGY  1801
             +  +FL  KK+ DP  +FSSEWSDQIL  K   ++  DGCALEGLCICS+D HC+P+KGY
Sbjct  504   NYNKFLAAKKQLDPQNMFSSEWSDQILFGKE--AVKSDGCALEGLCICSEDRHCSPSKGY  561

Query  1802  FCRAGKVYKDAKVC  1843
             FC+ G VY +A+VC
Sbjct  562   FCKPGLVYTEARVC  575



>ref|XP_008789306.1| PREDICTED: LOW QUALITY PROTEIN: L-gulonolactone oxidase-like 
[Phoenix dactylifera]
Length=610

 Score =   499 bits (1286),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 255/534 (48%), Positives = 350/534 (66%), Gaps = 8/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG + DR  C      YP TE EL S +A A+++ +K+KA + +SH+IPKLACP  ++ 
Sbjct  59    AYGAWSDRKDCWVRTVAYPTTEDELRSAVAQASRRNQKVKAVSGFSHTIPKLACPPTENS  118

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              LIST   N  +EV+   +T+T ++GV LR +I++   AGL+L  +PYW G ++GG++ T
Sbjct  119   TLISTAKYNTGIEVDVEKLTVTADAGVGLRDLIDKVEAAGLSLVAAPYWEGXSIGGVVST  178

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             GSHGSS WG G +VHDHV+ I +V PA   EGYA I  L+ G+    AARVSLG+LGVIS
Sbjct  179   GSHGSSWWGKGGAVHDHVVGISLVVPAGSSEGYAKIVRLEHGDPLFNAARVSLGLLGVIS  238

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             +VT  L+P FKRS+S+  ++D     E      +HEFAD+ W P     VYR DDRV  N
Sbjct  239   KVTLSLEPRFKRSVSYSYEDDSLFDDEFLDLAQKHEFADITWYPSQHKAVYRYDDRVPFN  298

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             +SG G+ DF G ++        +R  E+  ES  + + KC+    I V     +  GL N
Sbjct  299   SSGEGVNDFLGFQSNLIVVSTTVRATEKALESARNVNGKCTLA-AIEVGFKKLVGTGLKN  357

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             + V F+GYPV+GYQ  MQ+SG+CL S + N   +C WDPR+ GLFF++TT      K ++
Sbjct  358   N-VIFTGYPVVGYQGKMQTSGSCLYSPSSNTVSSCAWDPRIKGLFFYETTAIFPAPKFRN  416

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL DL+P++ C + +Y+G+L+R++K+S AYLG+ EDS+  D  YYR+ +P +PR
Sbjct  417   FILDVKKLRDLKPENFCGVDIYNGLLIRFIKSSEAYLGQSEDSVVVDFNYYRADEPSMPR  476

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L +DI EE+EQMA FKYGA PHW KNR +AF G  +KY    +FL  K++ DP G+F SE
Sbjct  477   LNQDIWEEVEQMAFFKYGAKPHWAKNRKLAFTGVQQKYSKMSKFLLAKRQLDPHGMFDSE  536

Query  1685  WSDQILGLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD++L    G  + K DGCALEG CICS+D HC+P KGY C+ G VY  A VC
Sbjct  537   WSDEML---LGKELAKDDGCALEGQCICSEDRHCSPAKGYLCKPGLVYNKAMVC  587



>ref|XP_009760726.1| PREDICTED: L-gulonolactone oxidase [Nicotiana sylvestris]
Length=583

 Score =   498 bits (1283),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 267/579 (46%), Positives = 370/579 (64%), Gaps = 25/579 (4%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSLPE-DPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             L+ ++V   + T+ S++P  +PIKC   +        SYG + DR +C A K VYP TE 
Sbjct  10    LVLLWVLATLVTISSAMPPPNPIKCDQTDCQLSN---SYGIWGDRKICHAPKIVYPTTEE  66

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACP-EGDDGLLISTKYLNRTLEVNASSMTMT  496
             EL   +A A K   K+K  TR+SH+IPKLACP  GD  + IST+  + T+ V+    T T
Sbjct  67    ELRQELANANKNNLKVKVVTRFSHTIPKLACPGTGDAAVFISTEKYDSTINVDVEKRTAT  126

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
              + GV LR+ I+   KAGL+L  +PYW G+TV G++ TG+HGSS WG G +VHDHVI + 
Sbjct  127   ADGGVGLRKFIDTIEKAGLSLVAAPYWEGVTVAGVISTGAHGSSWWGKGGAVHDHVIGLS  186

Query  677   IVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             ++ PA E +GYA I  L   N    AA+VSLG+LG+IS+VTF+++P FKRSI++   ND 
Sbjct  187   LIVPANEADGYAKIIKLIPQNPLFNAAKVSLGLLGIISKVTFQVEPAFKRSITYNFTNDS  246

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             D+  E  +   ++EF D++W P     VYR D+RV  NTSG+G+ DF G ++       +
Sbjct  247   DIEDEFMEHTRKNEFGDIQWYPSRHTAVYRYDNRVPLNTSGDGVNDFLGFQSNLILLSKS  306

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVWFLSY------GLTNDGVKFSGYPVIGYQNH  1198
             +R  E+  E+  +   KC+           F+SY      GL N+ + F+GYPV+G Q  
Sbjct  307   VRATEKGFENTRNVGGKCT-------MASSFVSYRKLIGNGLKNNKLIFTGYPVVGPQGK  359

Query  1199  MQSSGTCLDS--LNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKS  1369
             MQ+SG+CL S  ++   TC WDPR+ GLFF+++T     +K   FI DV+KL DL +P++
Sbjct  360   MQTSGSCLYSSPIDITNTCAWDPRIYGLFFYESTAKFPASKFGDFIRDVKKLRDLVKPEN  419

Query  1370  LCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMF  1549
             +C + +Y+G L R++KAS AYLG+ EDS+  D  YYR+ D + PRL +DI EEIEQMA  
Sbjct  420   MCGVDIYNGFLFRFIKASDAYLGQGEDSVVLDFNYYRANDDLTPRLNQDIWEEIEQMAFV  479

Query  1550  KYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIV  1729
             KYGA PHW KNR VAF    +KY    +F+  K + DP  +FSSEWSD+IL    G   V
Sbjct  480   KYGAKPHWAKNRKVAFLDVQKKYPKFNKFIAAKNQLDPKNMFSSEWSDEIL---FGKRTV  536

Query  1730  K-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             K DGCALEG+CICS+D HC+P+KGYFC+ G VY++A+VC
Sbjct  537   KWDGCALEGMCICSEDRHCSPSKGYFCKPGLVYQEARVC  575



>gb|EMT19772.1| L-gulonolactone oxidase [Aegilops tauschii]
Length=576

 Score =   495 bits (1275),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 331/462 (72%), Gaps = 3/462 (1%)
 Frame = +2

Query  356   KRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEE  535
             KRK+K ATR+SHS PKLACP G +G +IST+ LNRT+ V+A+   MTVESG+ LR +I  
Sbjct  2     KRKLKVATRHSHSFPKLACPGGREGTIISTERLNRTVSVDAAKGLMTVESGMVLRDLIHA  61

Query  536   AAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYAT  715
             AA AGLALP+SPYW+GLT+GGL+ TG+HGSSLWG GS+VH++V+ +RIVTPA   +G+A 
Sbjct  62    AAHAGLALPHSPYWYGLTIGGLLATGAHGSSLWGKGSAVHEYVVGMRIVTPAPASQGFAV  121

Query  716   IRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQH  895
             +R L   + D+ AA+VSLGVLGV+SQVT +LQPMFKRS++FV ++D D   +   +G +H
Sbjct  122   VRELGHKHPDLDAAKVSLGVLGVVSQVTLQLQPMFKRSVTFVERDDSDFAAQVAVWGDRH  181

Query  896   EFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGD  1075
             EF DM WLPR   V+YR D RV  ++ GNGL ++ G R+  T  L   R  EE  E  GD
Sbjct  182   EFGDMTWLPRQAKVIYREDGRVDVSSPGNGLNNYLGFRSNPTLGLIIARAAEERLEEDGD  241

Query  1076  ADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TC  1249
                +C    L+         YG TNDG  F+GYP++GYQ+ +Q+SGTC++   D L  +C
Sbjct  242   DIARCLAA-LVPAATFRLQGYGFTNDGSFFTGYPLVGYQHRIQASGTCINGKEDGLLSSC  300

Query  1250  PWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTA  1429
             PWDPR+   FF+ + FS++L+K  + + D+Q+L DL P++LC L    G+L+RYV+AS+A
Sbjct  301   PWDPRIRSFFFYNSGFSVALSKAPALVADMQRLRDLNPRALCGLDAKMGVLVRYVRASSA  360

Query  1430  YLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAI  1609
             YLGK EDS+DFDITYYRS     PR++ D+++E+EQ+A+ KY A+PHWGKNRN AF GAI
Sbjct  361   YLGKVEDSVDFDITYYRSYTEGTPRVHSDVIDELEQLALRKYNAVPHWGKNRNFAFDGAI  420

Query  1610  RKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD  1735
              KY  AGEFLKVK+++DP G+FSSEWSDQ       L   KD
Sbjct  421   AKYAKAGEFLKVKERYDPDGIFSSEWSDQFHVYLLHLRYAKD  462



>ref|XP_004498473.1| PREDICTED: L-gulonolactone oxidase-like isoform X1 [Cicer arietinum]
 ref|XP_004498474.1| PREDICTED: L-gulonolactone oxidase-like isoform X2 [Cicer arietinum]
Length=598

 Score =   496 bits (1277),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 262/591 (44%), Positives = 363/591 (61%), Gaps = 22/591 (4%)
 Frame = +2

Query  119   MAKMSIN----ILITIY-VQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVC  283
             M + S N    IL  I+ +   I T+    P+ PI+C            SYGT+ DR +C
Sbjct  1     MGRSSTNWIWWILCVIHTLPLFIKTIHGLTPQSPIQCNQTICTLQN---SYGTWNDRKIC  57

Query  284   RAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP-----------EGDDG  430
              A    YP  E EL   ++   +   K K  T++SH+IPKL+CP             +  
Sbjct  58    YALNVTYPTNEEELRLAVSYVVQNNLKAKVVTKFSHTIPKLSCPLQQQNIINNNNNVNSA  117

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              LIST+  N  +E++A ++ +TV+SGV LR +I+E  K G +L   PYW G++VGG++ T
Sbjct  118   FLISTEKYNSGIEIDAKNLFVTVDSGVGLRPLIDEVEKNGFSLGGVPYWEGVSVGGVIST  177

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSS WG G + HDHV+ I +V PA++ EGYA +  L+  +  +KAA+VSLGVLG IS
Sbjct  178   GAHGSSWWGKGGAFHDHVLGINLVVPASKSEGYAKVLRLEPNDPLLKAAKVSLGVLGAIS  237

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             +V   ++P FKRSI++   +D D+         ++EFAD+ W P     VYR D RV  N
Sbjct  238   KVKLSIEPRFKRSITYNFTDDTDIENIYIDHAKKYEFADITWYPSRNTAVYRYDFRVPLN  297

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             TSG+G FDF G +A       ++R  E+  E++     KC       +      + GL N
Sbjct  298   TSGDGHFDFIGFQANPIFISESVRGAEKLLENMRSTKGKCLTA-ATTLGFKKLTANGLKN  356

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFI  1330
             +G+ F+GYPVIGYQ  MQ+SG+CL S   + +C WDPR+ GLFF+++T     +K K FI
Sbjct  357   NGLIFTGYPVIGYQGKMQTSGSCLYSTKSDTSCAWDPRIKGLFFYESTAIFPASKFKDFI  416

Query  1331  EDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLY  1510
              DV+KL D++P+  C + +Y+GIL+RY+KAS AYLG+ EDSI  D  YYR+ DP  PRL 
Sbjct  417   IDVKKLRDIDPQKFCGIDIYNGILIRYIKASDAYLGQIEDSIVIDFNYYRANDPFTPRLN  476

Query  1511  EDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWS  1690
             +D+ EE+EQ+A FKYGA PHW KNRN+AF G  +KY     F++ K K DP  +FS +WS
Sbjct  477   QDVWEELEQLAFFKYGAKPHWAKNRNLAFLGVQKKYPKFNLFIEAKNKLDPQSVFSGDWS  536

Query  1691  DQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             D+IL  K   SI  DGCALEG CICS+D HC+P KGY+C+ G VY +A+VC
Sbjct  537   DEILYGKD--SIKYDGCALEGQCICSEDRHCSPQKGYYCKNGLVYNEARVC  585



>ref|XP_010917611.1| PREDICTED: L-gulonolactone oxidase [Elaeis guineensis]
Length=579

 Score =   493 bits (1270),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 251/533 (47%), Positives = 348/533 (65%), Gaps = 6/533 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG + DR  C      YP TE EL S +A A+++ +K+K A+ +SH+IPKLACP  ++ 
Sbjct  43    AYGAWGDRKDCWVQTVAYPTTEDELRSAVARASQRNQKVKVASGFSHTIPKLACPPSENS  102

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
              LIST   +  +EV+   MT+TV++GV+LR +I++   AG++L  +PYW G++VGG++ T
Sbjct  103   TLISTAKYSTGIEVDVEKMTVTVDAGVALRDLIDKVEAAGVSLVAAPYWEGVSVGGVVST  162

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             GSHGSS WG G +VHDHV+ + +V PA   EGYA I  L+ G+    AARVSLG+LGVIS
Sbjct  163   GSHGSSWWGKGGAVHDHVVGLSLVVPAGRSEGYAKIVRLEHGDPLFNAARVSLGLLGVIS  222

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             +VT  L+  FKRS+S+  ++D     E      +HEFAD+ W P     VYR DDRV  N
Sbjct  223   KVTLSLERRFKRSVSYSYEDDSRFEDEFLDLAQKHEFADITWYPSQHKAVYRYDDRVPLN  282

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             +SG+G  DF G ++      + +R  E+  E   + + KC+      V     +  GL N
Sbjct  283   SSGDGANDFLGFQSNLIAVSSTVRATEKALEKARNVNGKCTLA-ATEVGFKKLVGNGLKN  341

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             + V F+GYPV+GYQ  MQ+SG+CL S + N+  +C WDPR+ GLFF++TT      K + 
Sbjct  342   N-VIFTGYPVVGYQGKMQTSGSCLHSPSSNILSSCAWDPRIKGLFFYETTAIFPAPKFRD  400

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL DL+P++ C + +Y+G L+R++K+S AYLG+ EDS+  D  YYR+ +P +PR
Sbjct  401   FILDVKKLRDLKPENFCGIDIYNGFLIRFIKSSEAYLGQSEDSVVVDFNYYRADEPSIPR  460

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L +DI EE+EQMA FKYGA PHW KNR +AF G  +KY    +FL  K++ DP  +F S+
Sbjct  461   LNQDIWEEVEQMAFFKYGAKPHWAKNRKLAFTGVQQKYPKMSKFLLAKRQLDPQDIFDSQ  520

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD+IL  K   S   DGCALEG CICS+D HC+P KGY C+ G VY  A VC
Sbjct  521   WSDEILLGKE--SAKDDGCALEGQCICSEDRHCSPAKGYLCKPGLVYNKAMVC  571



>ref|XP_002516554.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF45895.1| gulonolactone oxidase, putative [Ricinus communis]
Length=584

 Score =   492 bits (1267),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 261/587 (44%), Positives = 368/587 (63%), Gaps = 23/587 (4%)
 Frame = +2

Query  119   MAKMSINILITIYVQF---LIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRA  289
             M  +S  +L  IY+      +  V +  P  PI+C     +      SYG + DR  C  
Sbjct  1     MINLSWCLLCVIYLVHRGPALLAVRAMPPPPPIRCNDAGCILYN---SYGAWNDRKECHV  57

Query  290   AKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDD---GLLISTKYLNR  460
                 YP TE EL   +A A K K K+K  +++SH+IPKLACP  ++    +LIST   N 
Sbjct  58    LNVTYPATEEELRRAVAYANKNKLKIKVVSKFSHTIPKLACPGSENYANSMLISTLNYNS  117

Query  461   TLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGV  640
              +E++ +++ +T ++GVSLR++I+   + GL+L  +PYW G+++GGL+ TG+HGSS WG 
Sbjct  118   GIEIDTANLAVTADAGVSLRELIDRVEETGLSLVAAPYWEGVSIGGLISTGAHGSSWWGK  177

Query  641   GSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMF  820
             G +VHDHVI + ++ PA+E EGYA I  +   +  ++AA+VSLG+LGVIS+V   L+P F
Sbjct  178   GGAVHDHVIGLSLIVPASESEGYAKIIRIGAQDQLLRAAKVSLGMLGVISKVKLSLEPAF  237

Query  821   KRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFF  1000
             KRSI++   ND  + +     G ++EF D+ W P     VYR D RV  N SG+G+FDF 
Sbjct  238   KRSITYNFTNDDHIEELFIDHGRKYEFGDVTWYPSRHTAVYRYDYRVPLNASGDGVFDFL  297

Query  1001  GLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWF---LSYGLTNDGVKFSG  1171
             G +        + R+ E+  E+  +   KC    L+    V F   ++ GL N G+ F+G
Sbjct  298   GFQPNSIVVSLSTRKAEKALENARNVKGKC----LLASTFVGFKKLVANGLKN-GLIFTG  352

Query  1172  YPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQK  1345
             YPVIG+Q  MQ+SG+C+ S    +  +C WDPR+ GLFF+++T     ++   F+ DV+K
Sbjct  353   YPVIGHQGKMQTSGSCIYSPAARIDTSCAWDPRIKGLFFYESTAIFRASQFGDFVRDVKK  412

Query  1346  LVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILE  1525
             L DL P++ C + +Y+G L+R++KAS AYLG+ EDS+  D  YYRS DP VPRL +DI E
Sbjct  413   LRDLNPENFCGVDIYNGFLIRFIKASQAYLGQSEDSVVLDFNYYRSDDPSVPRLNQDIWE  472

Query  1526  EIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILG  1705
             E+EQMA FKYGA PHW KNRN AF     KY +  +FL  KK+ DP  +FSSEWSD+I  
Sbjct  473   EVEQMAFFKYGAKPHWAKNRNSAFLNVQSKYPNYSKFLAAKKQLDPQNMFSSEWSDEIF-  531

Query  1706  LKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
                G    K DGCALEG CICS+D HC+PNKGYFC+ G VY++A+VC
Sbjct  532   --LGREAAKGDGCALEGQCICSEDRHCSPNKGYFCKPGLVYEEARVC  576



>ref|XP_010668160.1| PREDICTED: L-gulonolactone oxidase [Beta vulgaris subsp. vulgaris]
Length=593

 Score =   491 bits (1265),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 258/578 (45%), Positives = 365/578 (63%), Gaps = 17/578 (3%)
 Frame = +2

Query  134   INILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKT  313
             I ++ ++    L   + +  P +P++C            +YG + DR  C +    YP T
Sbjct  12    IIVIYSLIFSLLPLNLHAKPPPNPVQCNDTLCTLHN---AYGLWGDRRDCVSPTISYPTT  68

Query  314   EAELLSIIAGATKQKRKMKAATRYSHSIPKLACP--EGDDGLLISTKYLNRTLEVNASSM  487
             E +L   +A ATK K K+K  T++SH+IPKLACP  + D  +LIST+  +  ++++   M
Sbjct  69    EEQLRLAVANATKNKLKVKVVTKFSHTIPKLACPSSQSDKTMLISTELYSSGIDIDVKKM  128

Query  488   TMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVI  667
              +T ++GVSLR +I +   A L+L  +PYW G+TV G + TG+HGSS WG G +VHDHV+
Sbjct  129   VVTADAGVSLRDLINKVEGAALSLVAAPYWEGVTVAGFISTGAHGSSWWGKGGAVHDHVV  188

Query  668   HIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
              I +V P  E +GYA +  L+  +   KAA+VSLGVLGVIS+V   L+P FKRSI++   
Sbjct  189   GISLVVPGKESQGYAKVLMLEGSDPLFKAAKVSLGVLGVISKVKLALEPAFKRSITYSFT  248

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
              D +L +E      ++EF D+ W P     VYR D+RV  N+SG+GL DF G ++     
Sbjct  249   KDDNLEEEYVNHAKKYEFGDITWYPSKYTTVYRYDNRVPLNSSGDGLNDFLGFQSQSVLV  308

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVW--FLSYGLTNDGVKFSGYPVIGYQNHM  1201
               A R  E+  ES  D   KC+   +   +M +   ++ GL N+ + F+ YPVIG Q ++
Sbjct  309   SAATRAMEKTFESTKDEKSKCT---MATTFMAYKKLIANGLKNNKLLFTSYPVIGTQANI  365

Query  1202  QSSGTCLDS--LNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKSL  1372
             Q+SG+CL S  +  +LTC WDP + GL F+++T   S T    F+ DV+KL DL  P+ L
Sbjct  366   QTSGSCLYSSHVRQDLTCAWDPTIKGLSFYESTAIFSTTNFGDFVRDVKKLRDLISPQKL  425

Query  1373  CVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFK  1552
             C + +Y+G L+R++KAS AYLG+ EDSI  D  Y+R+ DP  PRL +D+LEEIEQMA FK
Sbjct  426   CGIDIYNGFLVRFIKASDAYLGQSEDSIVVDFNYFRADDPKTPRLNQDVLEEIEQMAFFK  485

Query  1553  YGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVK  1732
             YGA PHW KNRN+AF G  +KY +  +F+  KK+ DP G+FSSEWSD+IL    G  I +
Sbjct  486   YGAKPHWAKNRNLAFLGVPKKYPNWSKFIDAKKQLDPQGMFSSEWSDEIL---YGKEIKR  542

Query  1733  -DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
              DGCALEGLCICS D HC+P+KGY C+ G +Y +A+VC
Sbjct  543   EDGCALEGLCICSDDRHCSPSKGYVCKPGFLYYEARVC  580



>ref|XP_009597988.1| PREDICTED: L-gulonolactone oxidase [Nicotiana tomentosiformis]
Length=583

 Score =   491 bits (1264),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 260/575 (45%), Positives = 369/575 (64%), Gaps = 17/575 (3%)
 Frame = +2

Query  143   LITIYVQFLIFTVGSSLPE-DPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             L+ ++V   + T+ S++P  +PIKC   +        SYG + DR  C A K VYP TE 
Sbjct  10    LVLLWVLATLVTISSAMPPPNPIKCNKTDCQLSN---SYGIWGDRQTCHAPKIVYPTTEE  66

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPE-GDDGLLISTKYLNRTLEVNASSMTMT  496
             EL   +A A K K K+K  TR+SH+IPKLACP  G+  + IST+  +  + V+    T T
Sbjct  67    ELRQELANANKNKLKVKVVTRFSHTIPKLACPSTGNAAVFISTEKYDSNINVDVEKRTAT  126

Query  497   VESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIR  676
              + GV LR+ I+   KAGL+L  +PYW G+TV G++ TG+HGSS WG G +VHDHV  + 
Sbjct  127   ADGGVGLRKFIDTIEKAGLSLVAAPYWEGVTVAGVISTGAHGSSWWGKGGAVHDHVTGLS  186

Query  677   IVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDR  856
             ++ PA E  GYA I  L   +    AA+VSLG+LG+IS+VTF+L+P FKRSI++   ND 
Sbjct  187   LIVPANEANGYAKIIKLIPQDPLFNAAKVSLGLLGIISKVTFQLEPAFKRSITYNFTNDS  246

Query  857   DLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNA  1036
             D+  E      ++EF D++W P  R  VYR D+RV  NTSG+G+ DF G ++       +
Sbjct  247   DIEDEFMGHARKNEFGDIQWYPSRRTAVYRYDNRVPLNTSGDGVNDFLGFQSNLILLSKS  306

Query  1037  LREKEEHQESIGDADEKCSNQWLINVWMVW--FLSYGLTNDGVKFSGYPVIGYQNHMQSS  1210
             +R  E+  E+  +   KC+   + + ++ +   ++ GL N+ + F+GYPV+G    MQ+S
Sbjct  307   VRATEKGFENTRNVGGKCT---MASSFVSYKRLIANGLKNNKLIFTGYPVVGPHGKMQTS  363

Query  1211  GTCLDS--LNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKSLCVL  1381
             G+CL S  ++   TC WDPR+NGLFF+++T     +K   FI DV+KL DL +P+++C +
Sbjct  364   GSCLYSSPIDITNTCAWDPRINGLFFYESTAKFPASKFGDFIRDVKKLRDLVKPENMCGV  423

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
              +Y+G L R++KAS AYLG+ EDS+  D  Y+R+ D + PRL +DI EE+EQMA  KYGA
Sbjct  424   DIYNGFLFRFIKASEAYLGQSEDSVVLDFNYFRANDALTPRLNQDIWEEVEQMAFVKYGA  483

Query  1562  LPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQIL-GLKTGLSIVKDG  1738
              PHW KNRNVAF    +KY    +F+  K + DP  + SSEWSD+IL G +T      DG
Sbjct  484   KPHWAKNRNVAFLDVQKKYLKFNKFIAAKNQLDPKNMLSSEWSDEILFGKQTAKG---DG  540

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CALEG+CICS+D HC+P+KGYFC+ G VY+ A+VC
Sbjct  541   CALEGMCICSEDRHCSPSKGYFCKPGLVYQQARVC  575



>ref|XP_011070434.1| PREDICTED: L-gulonolactone oxidase, partial [Sesamum indicum]
Length=556

 Score =   489 bits (1258),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 253/540 (47%), Positives = 348/540 (64%), Gaps = 19/540 (4%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDD-  427
             SYG + DR  C     VYP TE EL S +A A K   K+K  +R+SH+IPKLACP     
Sbjct  19    SYGVWGDRKDCPVQAVVYPTTEEELRSAVANANKNHLKVKVVSRFSHTIPKLACPTNQSR  78

Query  428   GLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMG  607
              +LIST+  N +++V+  SMT+T ++GV LR +I+     GL+L  +PYW G++VGG++ 
Sbjct  79    AILISTEKYNTSIDVDVPSMTVTADAGVGLRALIDRVEAEGLSLVAAPYWEGVSVGGVIS  138

Query  608   TGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVI  787
             TG+HGSS  G G +VHDHV+ IR++ PA E EG+A I  L+  +  + AA+VSLG+LGVI
Sbjct  139   TGAHGSSWRGRGGAVHDHVVGIRLIVPAKESEGFARILDLRSDDPLLNAAKVSLGMLGVI  198

Query  788   SQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvST  967
             S+V   ++  FKRSI+     D  +  E  + G Q+EF D++W P     VYR D R+  
Sbjct  199   SKVRLMVEGGFKRSITLNFTKDGGIEDEFMEHGKQYEFGDIQWYPSTHTAVYRYDHRLPI  258

Query  968   NTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYG-L  1144
             NTSG+G++DF G ++       ++R  E+  E+  +AD KC       +    FL+Y  L
Sbjct  259   NTSGDGVYDFVGFQSNSAIIPKSVRASEKSAEAARNADAKC-------LLASSFLAYKKL  311

Query  1145  TNDGVK----FSGYPVIGYQNHMQSSGTCLDSLN--DNLTCPWDPRVNGLFFHQTTFSIS  1306
             T +G+K    F+GYPVIG+Q  MQ+SG+CL S     +  CPWDPR+ GLFF++TT   S
Sbjct  312   TANGLKNNLIFTGYPVIGHQAKMQTSGSCLYSPQAAKDAVCPWDPRIKGLFFYETTAIFS  371

Query  1307  LTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK  1486
              T    FI D++KL D+ PKS C + +Y+G L+R+V  S AYLG+ EDS+  D  YYR+ 
Sbjct  372   ATNFADFIRDIKKLRDINPKSFCGVDIYNGFLIRFVPKSDAYLGQPEDSVVVDFNYYRAD  431

Query  1487  DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPL  1666
             +   PRL +DI EE EQMA FKYGA PHWGKNRNVAF G  +KY S G+F++ K++ DP 
Sbjct  432   EGWTPRLNQDIWEEAEQMAFFKYGARPHWGKNRNVAFVGVEKKYPSFGKFVEAKRRVDPG  491

Query  1667  GLFSSEWSDQILGLKTGLSIV-KDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
              +F SEW+D+I+    G  +V  DGCALEG C+CS+D HC+P  GY+C  G VY  A+VC
Sbjct  492   NVFGSEWTDEIV---FGRGVVDDDGCALEGRCVCSEDRHCSPGNGYYCTRGLVYTAARVC  548



>ref|XP_009346083.1| PREDICTED: L-gulonolactone oxidase-like [Pyrus x bretschneideri]
Length=595

 Score =   489 bits (1260),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 247/567 (44%), Positives = 368/567 (65%), Gaps = 8/567 (1%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELL  328
              I+V  ++ T  +  P  PI+C  +   N +   SYG + DR  C    A +P+TE +L 
Sbjct  14    VIWVATMLITSQAMPPPPPIQCDASTGCNLSN--SYGVWGDRTDCHVPSAAHPQTEEDLR  71

Query  329   SIIAGATKQKRKMKAATRYSHSIPKLACPEGD--DGLLISTKYLNRTLEVNASSMTMTVE  502
               +A A+K K K+K  +++SH+IPK ACP+    D +LIST  +N T+E++A+++ +TV+
Sbjct  72    LAVAFASKNKIKIKVVSKFSHTIPKWACPDMSFGDAMLISTVNVNSTIEIDAANLAVTVD  131

Query  503   SGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIV  682
             +GV LRQ+I++  +AGL+L  +PYW G++VGGL+ TG+HGSS WG G +VHDHVI + +V
Sbjct  132   AGVGLRQLIDKVEEAGLSLVAAPYWEGVSVGGLISTGAHGSSWWGRGGAVHDHVIGLNLV  191

Query  683   TPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDL  862
              PA + EGYA +  L   +   KAA+VSLG+LG+IS+V  +L+P FKRSI++   +D  +
Sbjct  192   VPANQSEGYAKVLRLGSKDEIFKAAKVSLGLLGIISKVKLRLEPAFKRSIAYNFTDDAQI  251

Query  863   GKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALR  1042
                      ++EF D+ W P      YR D+R+    SG+G +DF G ++        +R
Sbjct  252   EDIYMDHAQKYEFGDITWYPSKHTAAYRYDNRLPLTASGDGTYDFLGFQSNSVVVSKTIR  311

Query  1043  EKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL  1222
               E+  +S   +  KC+    + +     ++ GL N+ + F+GYPV+G+Q  MQ+SG+CL
Sbjct  312   LTEKTIDSGRSSIGKCTLASTV-LEAKKLVANGLKNNLI-FTGYPVVGHQGKMQTSGSCL  369

Query  1223  DSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
              S   + +C WDPR+NGLFF++TT     +K   FI DV+KL DL+P++ C + +Y+G L
Sbjct  370   YSAGTDKSCAWDPRINGLFFYETTAIFPASKFADFIRDVKKLRDLKPENFCGVDIYNGFL  429

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             +R+++ S AYLG+QE+S+  D  YYR+ D   PR  +D+ EE+EQ+A FK+GA PHW KN
Sbjct  430   IRFIRVSDAYLGQQENSVVVDFNYYRADDASTPRFNQDVWEEVEQLAFFKHGAKPHWAKN  489

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN AF    +KY +  +FL VK++ DP  + SS WSD+IL  K G    +DGCALEGLC+
Sbjct  490   RNAAFLDMQKKYPNFNKFLGVKRRLDPQNILSSVWSDEILSGKEGAK--RDGCALEGLCV  547

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CS+D HC+P KGYFC+ G VYK+A+VC
Sbjct  548   CSEDRHCSPAKGYFCKPGLVYKEARVC  574



>gb|KDO79761.1| hypothetical protein CISIN_1g008595mg [Citrus sinensis]
Length=560

 Score =   488 bits (1257),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 245/534 (46%), Positives = 346/534 (65%), Gaps = 7/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP--EGD  424
             +YG + DR  C  +   YP TE EL   +A A K K K+K  +++SH+IPKLACP  +  
Sbjct  20    AYGAWGDRKDCHVSNVTYPTTEEELRLAVAHANKNKLKVKTVSKFSHTIPKLACPCSQSQ  79

Query  425   DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
               LLIST  L+  ++++ +++T+T ++GV LRQ+I+   +  L++  +PYW G++VGG++
Sbjct  80    STLLISTAKLDSNIDIDVANLTVTADAGVPLRQLIDRVEEENLSIVAAPYWEGVSVGGVI  139

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSS WG G +VHDHVI + +V PA E EGYA I  ++  +  + AA+VSLG+LGV
Sbjct  140   STGAHGSSWWGKGGAVHDHVIGLSLVVPAKESEGYAKIIRIEANDPLLDAAKVSLGLLGV  199

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             IS+V   L+P FKRSI+F   +D  +         +HEF D+ W P  R  VYR DDRV+
Sbjct  200   ISEVKLSLEPGFKRSITFNFTDDAHIEDIFMDHAKKHEFGDITWYPSRRTAVYRYDDRVT  259

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              NT G+G+ DF G +        + R  E+  E+  +A+ KC+    + +     ++ G 
Sbjct  260   LNTRGDGVNDFIGFQDTSILISKSTRAAEKALETAKNANGKCTLAATV-LGFKKLIANGF  318

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
              N+ + F+GYP++G Q  +Q+SG CL S   + +C WDPR+NGLFF++TT      K K 
Sbjct  319   KNNALIFTGYPIVGRQGKLQTSGACLYSRRVDTSCAWDPRINGLFFYETTAIFPANKFKD  378

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL DL+P++ C +  Y+G L+R++KAS+AYLG+ EDSI  D  YYR+ D   PR
Sbjct  379   FIRDVKKLRDLKPENFCGVDSYNGFLIRFIKASSAYLGQSEDSIVVDYNYYRADDASTPR  438

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L +D+ EE+EQMA FKYGA PHW KNR +AF    +KY +   FL  K + DP  +FSSE
Sbjct  439   LNQDVWEEVEQMAFFKYGARPHWAKNRKLAFLNVQQKYANFSRFLAAKNQMDPQNMFSSE  498

Query  1685  WSDQILGLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD+IL    G    K DGCALEG CICS+D HC+P+KGYFC+ G VY +A+VC
Sbjct  499   WSDEIL---FGTEAAKFDGCALEGQCICSEDRHCSPSKGYFCKPGLVYTEARVC  549



>ref|XP_010100664.1| hypothetical protein L484_023432 [Morus notabilis]
 gb|EXB83826.1| hypothetical protein L484_023432 [Morus notabilis]
Length=423

 Score =   483 bits (1242),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 239/363 (66%), Positives = 291/363 (80%), Gaps = 7/363 (2%)
 Frame = +2

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             + +V  KLQPMFKRSI++V KND DLG +   FG +HEFAD+ W P  +  +YRVDDRVS
Sbjct  56    LQRVRLKLQPMFKRSITYVTKNDSDLGDQVACFGREHEFADITWYPSQQKAIYRVDDRVS  115

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
             TNTSG+GL+DF   R+  +  L  +R  EE+QES  DA  KC+   LI   +    +YGL
Sbjct  116   TNTSGDGLYDFIPFRSTSSLALAFIRITEENQESTNDAGGKCTGAKLITSTLS-TSAYGL  174

Query  1145  TNDG----VKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSIS  1306
             TN+G    V F+GYPVIGYQ+ +QSSGTCLDSL+D     C WD RV   FFHQTTFS+ 
Sbjct  175   TNNGGYLGVIFTGYPVIGYQHRLQSSGTCLDSLHDARVTACSWDSRVKAEFFHQTTFSLG  234

Query  1307  LTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK  1486
             L+ VKSF+EDVQKLV LEPK+LC L LY+GILMRYV AS+AYLG+QED+IDFDITYYRSK
Sbjct  235   LSVVKSFVEDVQKLVKLEPKALCGLELYNGILMRYVTASSAYLGRQEDAIDFDITYYRSK  294

Query  1487  DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPL  1666
             DP+ PRLYEDILEEIEQ+A+FKYGALPHWGKNRNVAF+GAI+KYK++ EFLKVK  +DPL
Sbjct  295   DPLNPRLYEDILEEIEQLAIFKYGALPHWGKNRNVAFEGAIKKYKNSKEFLKVKAAYDPL  354

Query  1667  GLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCV  1846
             GLFSS+WSDQ+LGLK GL IVK+GCALEGLCIC++D HCAP+KGYFCR G++Y+DA+VC 
Sbjct  355   GLFSSDWSDQVLGLKGGLPIVKEGCALEGLCICAEDIHCAPSKGYFCRPGRIYEDARVCA  414

Query  1847  KIN  1855
             +++
Sbjct  415   RLD  417



>ref|XP_006476136.1| PREDICTED: L-gulonolactone oxidase-like [Citrus sinensis]
Length=585

 Score =   488 bits (1257),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 245/534 (46%), Positives = 346/534 (65%), Gaps = 7/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP--EGD  424
             +YG + DR  C  +   YP TE EL   +A A K K K+K  +++SH+IPKLACP  +  
Sbjct  45    AYGAWGDRKDCHVSNVTYPTTEEELRLAVAHANKNKLKVKTVSKFSHTIPKLACPCSQSQ  104

Query  425   DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
               LLIST  L+  ++++ +++T+T ++GV LRQ+I+   +  L++  +PYW G++VGG++
Sbjct  105   STLLISTAKLDSNIDIDVANLTVTADAGVPLRQLIDRVEEENLSIVAAPYWEGVSVGGVI  164

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSS WG G +VHDHVI + +V PA E EGYA I  ++  +  + AA+VSLG+LGV
Sbjct  165   STGAHGSSWWGKGGAVHDHVIGLSLVVPAKESEGYAKIIRIEANDPLLDAAKVSLGLLGV  224

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             IS+V   L+P FKRSI+F   +D  +         +HEF D+ W P  R  VYR DDRV+
Sbjct  225   ISEVKLSLEPGFKRSITFNFTDDAHIEDIFMDHAKKHEFGDITWYPSRRTAVYRYDDRVT  284

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              NT G+G+ DF G +        + R  E+  E+  +A+ KC+    + +     ++ G 
Sbjct  285   LNTRGDGVNDFIGFQDTSILISKSTRAAEKALETAKNANGKCTLAATV-LGFKKLIANGF  343

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
              N+ + F+GYP++G Q  +Q+SG CL S   + +C WDPR+NGLFF++TT      K K 
Sbjct  344   KNNALIFTGYPIVGRQGKLQTSGACLYSRRVDTSCAWDPRINGLFFYETTAIFPANKFKD  403

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL DL+P++ C +  Y+G L+R++KAS+AYLG+ EDSI  D  YYR+ D   PR
Sbjct  404   FIRDVKKLRDLKPENFCGVDSYNGFLIRFIKASSAYLGQSEDSIVVDYNYYRADDASTPR  463

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L +D+ EE+EQMA FKYGA PHW KNR +AF    +KY +   FL  K + DP  +FSSE
Sbjct  464   LNQDVWEEVEQMAFFKYGARPHWAKNRKLAFLNVQQKYANFSRFLAAKNQMDPQNMFSSE  523

Query  1685  WSDQILGLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD+IL    G    K DGCALEG CICS+D HC+P+KGYFC+ G VY +A+VC
Sbjct  524   WSDEIL---FGTEAAKFDGCALEGQCICSEDRHCSPSKGYFCKPGLVYTEARVC  574



>ref|XP_006833405.1| hypothetical protein AMTR_s00109p00128740 [Amborella trichopoda]
 gb|ERM98683.1| hypothetical protein AMTR_s00109p00128740 [Amborella trichopoda]
Length=577

 Score =   488 bits (1256),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 257/533 (48%), Positives = 353/533 (66%), Gaps = 7/533 (1%)
 Frame = +2

Query  254   YGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPE-GDDG  430
             YGT+ DR  C+A KA YP TE EL S IA A +QK K+K  + +SH+IPKLACP+  ++ 
Sbjct  41    YGTWGDRRPCKALKAFYPTTEEELRSTIAEAVRQKLKVKVVSGFSHTIPKLACPDLPENS  100

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             ++IST+  N  +EV+    T+TV+SGV LR +I++  + GL+L  SPYW G ++GG++ T
Sbjct  101   VIISTRKYNSGIEVDIGKSTVTVDSGVGLRTLIDKLEEEGLSLVASPYWEGASLGGIIST  160

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSS WG G  VHD+V+ +R+V PA+  EGYA +  +   +  +    VSLGVLG IS
Sbjct  161   GAHGSSWWGKGGGVHDYVVELRMVVPASASEGYAKVVEMDISHPLLNGVTVSLGVLGAIS  220

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             +V   L+P+FKRS++ + K+D  L +E      +HEFAD+ W P  + VVY+ DDRV  N
Sbjct  221   KVKLSLEPVFKRSVTNLYKDDTLLEEEFMDHAKKHEFADITWYPSQKKVVYKSDDRVPLN  280

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             T GNG+ DF G R  G     A+R  E+  ES  +   KC       +     ++ GL N
Sbjct  281   TCGNGVNDFLGFRPNGALVSAAVRSTEKALESTKNVKGKCL-MAATELAYKQVIANGLKN  339

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL-TCPWDPRVNGLFFHQTTFSISLTKVKSF  1327
             + + F+GYPV+G Q  MQ+SG+CL+S   +  TCPWDPR+ GLFF++TT        + F
Sbjct  340   NDLIFTGYPVVGMQGKMQASGSCLNSPETSTDTCPWDPRIKGLFFYETTAIFPAPNFRDF  399

Query  1328  IEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRL  1507
             I DV+KL DL+P++ C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+  P+ PRL
Sbjct  400   IIDVKKLRDLKPENFCGVDIYNGFLIRFIKASDAYLGQSEDSVVVDFNYYRADSPLTPRL  459

Query  1508  YEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEW  1687
              +D+ EE+EQMA FKY A PHW KNR +AF G  +KY    +F+  KK+ DP G+FSS+W
Sbjct  460   NQDVWEEVEQMAFFKYSAKPHWAKNRKLAFAGVQQKYPKFKDFVAAKKRIDPDGVFSSKW  519

Query  1688  SDQIL-GLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             SD+IL G +T  S   DGCALEGLCICS+D HC+P   YFCR G VYK A+VC
Sbjct  520   SDEILFGTETPKS---DGCALEGLCICSEDRHCSPQNDYFCRQGLVYKAARVC  569



>ref|XP_010254041.1| PREDICTED: L-gulonolactone oxidase [Nelumbo nucifera]
Length=579

 Score =   488 bits (1255),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 255/535 (48%), Positives = 353/535 (66%), Gaps = 8/535 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG + DR  C  +   YP TE EL   +A A ++K K+KA + +SH+IPKLACP    G
Sbjct  40    SYGVWGDRQDCWISGVSYPTTEEELRLAVAQANQRKFKVKAVSGFSHTIPKLACPGTPSG  99

Query  431   --LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
               +LIST  L+ T++V+++ +T+T ++GVSLR++I++  +AGL+L  SPYW G++VGGL+
Sbjct  100   NAVLISTARLDSTIQVSSADLTVTADAGVSLRRLIDKVEEAGLSLVASPYWEGVSVGGLI  159

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSS WG G +VHDHV+ + +V PATE EGYA I  L   +    AA++SLGVLGV
Sbjct  160   STGAHGSSWWGKGGAVHDHVVGLSLVVPATESEGYAKIIRLDSHDPLFNAAKLSLGVLGV  219

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             IS+V   L+P FKRSI+    +D     E      +HEFAD+ W P     VYR DDRV 
Sbjct  220   ISKVKLALEPGFKRSITNNFIDDAGFEDEFMDLAKKHEFADITWYPSRYTAVYRYDDRVP  279

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              N+ G+G+ DF G ++       A+R  E+  E+  + + KC     + V     +  GL
Sbjct  280   LNSFGDGVNDFIGFQSNSVLVSAAVRAIEKALETAQNVNGKCRMAASV-VAFKKLVGNGL  338

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKV  1318
              N+ + F+GYPV+G+Q  MQ+SG+CL S   +   TC WDPR+ GLFF++TT     ++ 
Sbjct  339   KNNLI-FTGYPVVGHQGKMQTSGSCLYSSEKSTQSTCAWDPRIKGLFFYETTAIFPRSRF  397

Query  1319  KSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMV  1498
               FI DV+KL DL+P++ C L +Y+G L+R+++AS AYLG+ EDS+  D  YYR+ +   
Sbjct  398   ADFIRDVKKLRDLKPENFCGLDVYNGFLIRFIRASEAYLGQAEDSVVVDFNYYRADEAST  457

Query  1499  PRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFS  1678
             PRL +D+ EE+EQMA FKYGA PHW KNRN+AF G  +KY +   FL  KK+ DP  +FS
Sbjct  458   PRLNQDVWEEVEQMAFFKYGAKPHWAKNRNLAFLGVQQKYPNFSRFLAAKKQLDPENMFS  517

Query  1679  SEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             S+WSD+IL  K   +   DGCALEG CICS+D+HC P KGYFC+ G VYK+A+VC
Sbjct  518   SDWSDEILFGKAAAN--GDGCALEGQCICSEDSHCNPGKGYFCKPGLVYKEARVC  570



>ref|XP_002324238.1| hypothetical protein POPTR_0018s00570g [Populus trichocarpa]
 gb|EEF02803.1| hypothetical protein POPTR_0018s00570g [Populus trichocarpa]
Length=556

 Score =   486 bits (1251),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 247/534 (46%), Positives = 344/534 (64%), Gaps = 7/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEG---  421
             SYG + DR  C      YP TE EL   +A A +   K+K  +R+SH+IPKLACP+    
Sbjct  19    SYGVWNDRKDCHVPSITYPTTEEELRLAVAHANQNNLKVKVVSRFSHTIPKLACPDDAQH  78

Query  422   DDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGL  601
              + +LIST   N ++E++ +++ +T ++GV LR++I+E  ++GL+L  +PYW G++VGG+
Sbjct  79    GNSMLISTLKYNSSIEIDTANLAVTADAGVGLRELIDEVERSGLSLVPAPYWEGVSVGGV  138

Query  602   MGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLG  781
             + TG+HGSS WG G +VHDHVI + ++ PA E EGYA I  +   +  + AA+VSLG+LG
Sbjct  139   ISTGAHGSSWWGKGGAVHDHVIGLNLIVPARESEGYAKIIRIGAKDPLLNAAKVSLGMLG  198

Query  782   VISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrv  961
             VIS+V   L+P FKRS+++   +D  +       G ++EFAD+ W P     VYR D RV
Sbjct  199   VISKVKLSLEPAFKRSVAYNFTDDAHIEDIFMDHGKKYEFADVTWYPSRHTAVYRYDYRV  258

Query  962   STNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYG  1141
               +TSGNG +DF G +        A R  E+  ES  + + KC+      V     ++ G
Sbjct  259   PLSTSGNGEYDFLGFQPNSIVVSKATRSSEKLLESARNVNGKCALATTF-VGFKKLVANG  317

Query  1142  LTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVK  1321
             L N G+ F+GYPV+G+Q  MQ+SG+CL S   + +C WDPR+ GLFF++TT      K  
Sbjct  318   LKN-GLIFTGYPVVGHQGKMQTSGSCLYSTKIDTSCAWDPRIGGLFFYETTAIFPALKFG  376

Query  1322  SFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVP  1501
              F+ DV+KL DL+P++ C + +Y+G L+R++KAS AYLG+ EDSI  D  YYR+ D   P
Sbjct  377   DFLRDVKKLRDLKPENFCGVDIYNGFLIRFIKASQAYLGQSEDSIVLDYNYYRADDSSTP  436

Query  1502  RLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSS  1681
             RL +D+ EE+EQMA FKYGA PHW KNRN+AF     KY +  +FL  KK+ DP  +FS 
Sbjct  437   RLNQDVWEEVEQMAFFKYGAKPHWAKNRNLAFLDLQHKYPNFSKFLAAKKQLDPKNMFSG  496

Query  1682  EWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             EWSD+IL  K       DGCALEG CICS+D HC+P KGYFC  G VYK+A+VC
Sbjct  497   EWSDEILYGKEAAK--ADGCALEGQCICSEDIHCSPKKGYFCEQGLVYKEARVC  548



>ref|XP_007161499.1| hypothetical protein PHAVU_001G074300g [Phaseolus vulgaris]
 gb|ESW33493.1| hypothetical protein PHAVU_001G074300g [Phaseolus vulgaris]
Length=594

 Score =   487 bits (1254),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 256/563 (45%), Positives = 354/563 (63%), Gaps = 11/563 (2%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I TV   LP  P++C+    +      +YG + DR  C A    YP TE +L S ++ A 
Sbjct  24    ITTVHGMLPHSPVECSSTGCILRN---AYGAWGDRRDCSALNVTYPTTEEQLRSAVSYAV  80

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDG----LLISTKYLNRTLEVNASSMTMTVESGVSL  517
             +   K+K  TR+SH+IPK+ACP+G  G    LLIST+  +  + ++ ++M +T ++GV L
Sbjct  81    RNNLKVKVVTRFSHTIPKIACPQGSAGAGATLLISTEKYDSGIVIDDANMAVTADAGVGL  140

Query  518   RQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATE  697
             RQ+I+     G +L  +PYW G+TV GL+ TG+HGSS WG G SVHDHV+ I +V PA++
Sbjct  141   RQLIDAVESRGFSLVAAPYWEGVTVAGLISTGAHGSSWWGKGGSVHDHVLGITVVVPASK  200

Query  698   KEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEA-  874
              EGYA +  L+  +  + AAR+SLGVLG IS+V   ++  FKRSI++      DL ++  
Sbjct  201   YEGYAKLLMLEAQDPMLNAARLSLGVLGAISKVKLSIEHRFKRSITYEFTEKDDLIEDLY  260

Query  875   TKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEE  1054
                  ++EFAD+ W P    VVYR D RV  N SG+G+ DF G +        ++R  E 
Sbjct  261   VDHAKKYEFADITWYPSKHTVVYRYDSRVPLNASGDGVNDFIGFQPNSILISESVRVAEN  320

Query  1055  HQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLN  1234
               ES  +A+ KC       +     +  GL N+G  FSGYPV+GYQ  MQ+SG+CL S  
Sbjct  321   LLESTRNANGKCLTAG-TTLGFKKLVGNGLKNNGQIFSGYPVVGYQGKMQTSGSCLYSTR  379

Query  1235  DNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYV  1414
              + +C WDPR+ GLFF+++T     +    FI DV+KL DL+P++ C + +Y+G+L R++
Sbjct  380   FDTSCAWDPRIKGLFFYESTAIFPASAFGDFIRDVRKLRDLKPENFCGVDIYNGLLFRFI  439

Query  1415  KASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVA  1594
             KAS+AYLG+ EDS+  D  YYR+ DP  PRL +D+ EE+EQ+A FKYGA PHWGKNRN+A
Sbjct  440   KASSAYLGQPEDSVVVDFNYYRANDPSNPRLNQDVWEEVEQLAFFKYGAKPHWGKNRNIA  499

Query  1595  FQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
             F G   KY     F+  K+K DP  +FSSEWSD IL  K    +  DGCALEGLCICS+D
Sbjct  500   FFGVQHKYPKFNMFIAAKQKMDPQNVFSSEWSDNILYGKESEKV--DGCALEGLCICSED  557

Query  1775  NHCAPNKGYFCRAGKVYKDAKVC  1843
              HC+P KGY C  G VYK+A+VC
Sbjct  558   RHCSPQKGYHCSHGLVYKEARVC  580



>ref|XP_009125808.1| PREDICTED: L-gulonolactone oxidase [Brassica rapa]
Length=584

 Score =   486 bits (1252),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 266/585 (45%), Positives = 371/585 (63%), Gaps = 19/585 (3%)
 Frame = +2

Query  104   SHTISMAKMSINILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVC  283
             SHTIS++   + + I+        TV S  P+ P++C        +   +YGT+PDR  C
Sbjct  4     SHTISLSIFCLLVTIS--------TVRSVPPQPPVRCDQTGCTVSS---AYGTWPDRKTC  52

Query  284   RAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRT  463
             +AA   YP TE EL   +A A+++  K+K  T++SH+IPKLACP G D +LIST   N  
Sbjct  53    KAANITYPTTEEELRKAVAYASERNLKVKTVTKFSHTIPKLACPSGSDAMLISTSKYNSV  112

Query  464   LEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVG  643
             +E+    +T+T +SGVSLR++I++   AG ++  SPYW G+++GGL+ TGSHGSS  G G
Sbjct  113   IEIEPDRLTVTADSGVSLRELIDKVEAAGFSIGTSPYWEGVSIGGLISTGSHGSSWSGRG  172

Query  644   SSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGVISQVTFKLQPM  817
              SVHDHV+ I +V PA   E YA +  L++G  D  + A +VSLGVLGVIS+V   ++  
Sbjct  173   GSVHDHVVGISLVVPANSSERYAKVIRLEEGRDDKLLNAVKVSLGVLGVISKVKLSIEKA  232

Query  818   FKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDF  997
             FKRSI++   +D  L +   + G + EF D+ W P  +  VYR D R   N SGNG+ DF
Sbjct  233   FKRSITYNFTSDVALEEIFMEHGKRFEFGDITWYPSRKTAVYRYDVRSPVNVSGNGVNDF  292

Query  998   FGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYP  1177
              G ++        +R  E+  E+      KC+       +       GL N+G+ F+GYP
Sbjct  293   IGFQSNPILISKGVRALEKSLEASKSESGKCTTADTTLAYKK-LTGNGLKNNGLLFTGYP  351

Query  1178  VIGYQNHMQSSGTCL--DSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLV  1351
             VIG Q  +Q+SG+CL   S   +++C WDPR NGLFF++TT    L + + FI DV+KL 
Sbjct  352   VIGNQGKIQTSGSCLYSSSFRIDVSCSWDPRYNGLFFYETTAIFPLPRFRDFILDVKKLR  411

Query  1352  DLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEI  1531
             D++P+ LC + +Y+GIL+R++K S AYLG+ EDS+  D  YYR+ D + PRL +D++EE+
Sbjct  412   DMKPERLCGIDIYNGILIRFIKGSKAYLGQGEDSVVIDFNYYRADDALTPRLNQDVMEEM  471

Query  1532  EQMAMFKYGALPHWGKNRNVAFQGAIRKY-KSAGEFLKVKKKFDPLGLFSSEWSDQILGL  1708
             EQMA  KYGA PHWGKNR V F G  +KY  +  +FL+VK K DP  +FSSEWSD+IL  
Sbjct  472   EQMAFLKYGAKPHWGKNRKVGFFGVKQKYGPNFDKFLEVKNKLDPKMMFSSEWSDEILFG  531

Query  1709  KTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             + GL    DGCALEG C+CS+D HC+P+KGYFCR G VY  A+VC
Sbjct  532   REGLKY--DGCALEGNCVCSEDRHCSPSKGYFCRQGLVYTQARVC  574



>ref|XP_008345666.1| PREDICTED: uncharacterized protein LOC103408607 [Malus domestica]
Length=372

 Score =   478 bits (1229),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 284/353 (80%), Gaps = 3/353 (1%)
 Frame = +2

Query  794   VTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNT  973
             VT  LQPMFKRSI+++ K+D DLG +  +FG +HEFAD+ W P     VYR+DDRVSTNT
Sbjct  20    VTLNLQPMFKRSITYLSKDDSDLGDQVVRFGKEHEFADILWYPSQHKAVYRMDDRVSTNT  79

Query  974   SGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTND  1153
             SGNGL+DF   RA  +  L  +R  EE+QES  DAD KC+   L+   ++   +YGLTN+
Sbjct  80    SGNGLYDFIPFRATPSIALAVVRTTEENQESKSDADGKCTGAKLVTSILIKS-AYGLTNN  138

Query  1154  GVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSF  1327
             G+ F+GYPVIGYQ+ +QSSGTCLDSL D+    C WDP++ G FFHQTTFSI+L+  K+F
Sbjct  139   GLIFTGYPVIGYQHRLQSSGTCLDSLEDSRITACAWDPKIKGEFFHQTTFSINLSLAKNF  198

Query  1328  IEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRL  1507
             I+DVQKLV++EPK+LC + +Y+GILMRYV  S+AYLGKQ+D+IDFDITYYRSKDPM PRL
Sbjct  199   IQDVQKLVEIEPKALCGVEIYNGILMRYVTTSSAYLGKQKDAIDFDITYYRSKDPMTPRL  258

Query  1508  YEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEW  1687
             +E ILEEIEQ+A+ KYGALPHWGKNRN+AF G + KYK A EFL+VK  +DP+GLFSSEW
Sbjct  259   HEGILEEIEQLALVKYGALPHWGKNRNIAFDGVMNKYKGAKEFLRVKNVYDPMGLFSSEW  318

Query  1688  SDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCV  1846
             +DQ+LGLK G++IVK+GCALEGLCICS+D HCAP+KGYFCR GK++ DA++C 
Sbjct  319   TDQVLGLKDGVTIVKEGCALEGLCICSKDIHCAPSKGYFCRPGKIFNDARICT  371



>ref|XP_008370596.1| PREDICTED: uncharacterized protein LOC103434065 [Malus domestica]
Length=355

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 284/353 (80%), Gaps = 3/353 (1%)
 Frame = +2

Query  794   VTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNT  973
             VT  LQPMFKRSI+++ K+D DLG +  +FG +HEFAD+ W P     VYR+DDRVSTNT
Sbjct  3     VTLNLQPMFKRSITYLSKDDSDLGDQVVRFGKEHEFADILWYPSQHKAVYRMDDRVSTNT  62

Query  974   SGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTND  1153
             SGNGL+DF   RA  +  L  +R  EE+QES  DAD KC+   L+   ++   +YGLTN+
Sbjct  63    SGNGLYDFIPFRATPSLALAVVRTTEENQESKSDADGKCTGAKLVTSTLIKS-AYGLTNN  121

Query  1154  GVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKSF  1327
             G+ F+GYPVIGYQ+ +QSSGTCLDSL D+    C WDP++ G FFHQTTFSI+L+  K+F
Sbjct  122   GLIFTGYPVIGYQHRLQSSGTCLDSLEDSRITACAWDPKIKGEFFHQTTFSINLSLAKNF  181

Query  1328  IEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRL  1507
             I+DVQKLV++EPK+LC + +Y+GILMRYV  S+AYLGKQ+D+IDFDITYYRSKDPM PRL
Sbjct  182   IQDVQKLVEIEPKALCGVEIYNGILMRYVTTSSAYLGKQKDAIDFDITYYRSKDPMTPRL  241

Query  1508  YEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEW  1687
             +E ILEEIEQ+A+ KYGALPHWGKNRN+AF G + KYK A EFL+VK  +DP+GLFSSEW
Sbjct  242   HEGILEEIEQLALVKYGALPHWGKNRNIAFDGVMNKYKGAKEFLRVKNVYDPMGLFSSEW  301

Query  1688  SDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCV  1846
             +DQ+LGLK G++IVK+GCALEGLCICS+D HCAP+KGYFCR GK++ DA++C 
Sbjct  302   TDQVLGLKDGVTIVKEGCALEGLCICSKDIHCAPSKGYFCRPGKIFNDARICT  354



>ref|XP_010100256.1| L-gulonolactone oxidase [Morus notabilis]
 gb|EXB82263.1| L-gulonolactone oxidase [Morus notabilis]
Length=578

 Score =   485 bits (1248),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 247/559 (44%), Positives = 353/559 (63%), Gaps = 7/559 (1%)
 Frame = +2

Query  176   TVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQ  355
             TV +  P  P++C            ++G+  DR  C      YP+TE EL   +A A + 
Sbjct  16    TVQAKAPPPPVQCNRTGCTLSNSYGAWGS--DRNGCHVTNVTYPETEEELRLAVAYANQH  73

Query  356   KRKMKAATRYSHSIPKLACPEGDD---GLLISTKYLNRTLEVNASSMTMTVESGVSLRQV  526
             + K+K  +++SH+IPKLACP  +      LIST+  +  +E++  ++ +T E+GV+LR++
Sbjct  74    QLKVKVVSKFSHTIPKLACPGSNSEGANFLISTENYDSGIEMDGVNLVVTAEAGVTLRRL  133

Query  527   IEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEG  706
             I+E    GL+L  +PYW G+++GG + TG+HGSS WG G +VHDHV+ I +V PA   EG
Sbjct  134   IDEVEGVGLSLVAAPYWEGVSIGGAISTGAHGSSWWGKGGAVHDHVVGISLVVPAKASEG  193

Query  707   YATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFG  886
             YA I  L+  +  + AA+VSLG+LGVIS+V F L+  FKRSI++    +        +  
Sbjct  194   YAKILRLEAKDPLLNAAKVSLGLLGVISKVKFSLERGFKRSITYNFTEEAGFEDTFIEHA  253

Query  887   FQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQES  1066
              +HEFAD+ W P     VYR DDRV  N SG+G FDF G +         +R  E+  ES
Sbjct  254   KRHEFADITWYPSRNVAVYRYDDRVPINASGDGTFDFLGFQPNSILISQTIRATEKALES  313

Query  1067  IGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLT  1246
               ++  KC+    + V +   ++ GL N+G  F+GYPVIG Q  MQ+SG+CL S   + T
Sbjct  314   SRNSKGKCALAGAV-VGVKKLVANGLKNNGQIFTGYPVIGRQGKMQTSGSCLYSTAIDTT  372

Query  1247  CPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKAST  1426
             C WDP + GLFF +TT   + +    FI  V++L DL P + C + +Y+G L+R+++AS 
Sbjct  373   CAWDPTIKGLFFFETTAIFAASSFADFIRHVKRLRDLNPDNFCGVDMYNGFLIRFIRASQ  432

Query  1427  AYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGA  1606
             AYLG+ EDS+  D  Y+R+  P+ PR+ +D+ EE+EQMA FKYGA PHWGKNRN+AF G 
Sbjct  433   AYLGQDEDSVAVDFNYFRADQPLTPRVNQDVWEEVEQMAFFKYGARPHWGKNRNLAFLGV  492

Query  1607  IRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCA  1786
              +KYK+ G F++VK+  DP  +FSSEWSD++L  K  L    DGCALEG C+CS+D HC+
Sbjct  493   PKKYKNFGNFVEVKRVLDPQNMFSSEWSDEVLFGKE-LGEKGDGCALEGQCVCSEDRHCS  551

Query  1787  PNKGYFCRAGKVYKDAKVC  1843
             P KGYFC+ G VYK+A+VC
Sbjct  552   PEKGYFCKQGLVYKEARVC  570



>ref|XP_010648508.1| PREDICTED: L-gulonolactone oxidase [Vitis vinifera]
Length=592

 Score =   485 bits (1249),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 249/537 (46%), Positives = 345/537 (64%), Gaps = 9/537 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--  424
             SYG + DR  CR     YP+TE E+   +A A ++K+K+K  + +SH+IPKLACP  +  
Sbjct  46    SYGEWGDRKDCRVLSIAYPETEEEMRLAVAQANQKKQKVKVVSGFSHTIPKLACPGKEYY  105

Query  425   --DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGG  598
               + +LIST  L  T+E++ + M +T +SGV LR +I     AGL+L  +PYW GL+VGG
Sbjct  106   SGNAVLISTAKLKSTIEIDTAEMVVTADSGVGLRDLINRVEAAGLSLVAAPYWEGLSVGG  165

Query  599   LMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVL  778
             L+ TG+HGSS WG G +VHDHV+ + +V PA E EG+A I  L+  +  + AA+VS+G+L
Sbjct  166   LISTGAHGSSWWGKGGAVHDHVVGLSLVVPAKESEGFAKIIRLEAQDPLLNAAKVSMGIL  225

Query  779   GVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddr  958
             G IS+V   L+P FKRSI+    +D     E      +HEFAD+ W P  R  VYR DDR
Sbjct  226   GAISKVKLSLEPGFKRSITNNFTDDAHFEDEFMDHAKKHEFADITWYPSRRTAVYRYDDR  285

Query  959   vSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSY  1138
             V  NTSG+G+ DF G ++        LR  E+  E+      KC+    +  +    ++ 
Sbjct  286   VPLNTSGDGINDFLGFQSNSILTSKLLRAAEKALENSRSVRGKCATASTVLAYKR-LVAN  344

Query  1139  GLTNDGVKFSGYPVIGYQNHMQSSGTCL--DSLNDNLTCPWDPRVNGLFFHQTTFSISLT  1312
             GL N+ + F+GYPV+G+Q  MQ+SG+CL   S   ++TC WDPR+NGLFF++TT     T
Sbjct  345   GLKNNNLIFTGYPVVGHQGKMQTSGSCLYSPSTRTDITCAWDPRINGLFFYETTAIFPAT  404

Query  1313  KVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDP  1492
             K   FI +V+ L +L+  + C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+ + 
Sbjct  405   KFAEFIREVKTLRELKIDNFCGVDMYNGFLIRFIKASGAYLGQAEDSVVVDFNYYRADNA  464

Query  1493  MVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGL  1672
               PRL +D+ EE+EQMA FKYGA PHW KNRN+AF G  +KY +  +F+  KK+ DP  +
Sbjct  465   STPRLNQDVWEEVEQMAFFKYGAKPHWAKNRNLAFLGVQKKYPNFNKFVAAKKQLDPQNI  524

Query  1673  FSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             FSS+WS+ IL  K       DGCALEG CICS D HC+P KGYFCR G VYK+A+VC
Sbjct  525   FSSDWSEAILFGKEAEK--GDGCALEGQCICSGDRHCSPEKGYFCRTGLVYKEARVC  579



>emb|CAN71327.1| hypothetical protein VITISV_031548 [Vitis vinifera]
Length=592

 Score =   483 bits (1244),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 344/537 (64%), Gaps = 9/537 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGD--  424
             SYG + DR  CR     YP+TE E+   +A A ++K+K+K  + +SH+IPKLACP  +  
Sbjct  46    SYGEWGDRKDCRVLSIAYPETEEEMRLAVAQANQKKQKVKVVSGFSHTIPKLACPGKEYY  105

Query  425   --DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGG  598
               + +LIST  L  T+E++ + M +T +SGV LR +I     AGL+L  +PYW GL+VGG
Sbjct  106   SGNAVLISTAKLKSTIEIDTAEMVVTADSGVGLRDLINRVEAAGLSLVAAPYWEGLSVGG  165

Query  599   LMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVL  778
             L+ TG+HGS  WG G +VHDHV+ + +V PA E EG+A I  L+  +  + AA+VS+G+L
Sbjct  166   LISTGAHGSXWWGKGGAVHDHVVGLSLVVPAKESEGFAKIIRLEAQDPLLNAAKVSMGIL  225

Query  779   GVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddr  958
             G IS+V   L+P FKRSI+    +D     E      +HEFAD+ W P  R  VYR DDR
Sbjct  226   GAISKVKLSLEPGFKRSITNNFTDDAHFEDEFMDHAKKHEFADITWYPSRRTAVYRYDDR  285

Query  959   vSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSY  1138
             V  NTSG+G+ DF G ++        LR  E+  E+      KC+    +  +    ++ 
Sbjct  286   VPLNTSGDGINDFLGFQSNSILTSKLLRAAEKALENSRSVRGKCATASTVLAYKR-LVAN  344

Query  1139  GLTNDGVKFSGYPVIGYQNHMQSSGTCL--DSLNDNLTCPWDPRVNGLFFHQTTFSISLT  1312
             GL N+ + F+GYPV+G+Q  MQ+SG+CL   S   ++TC WDPR+NGLFF++TT     T
Sbjct  345   GLKNNNLIFTGYPVVGHQGKMQTSGSCLYSPSTRTDITCAWDPRINGLFFYETTAIFPAT  404

Query  1313  KVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDP  1492
             K   FI +V+ L +L+  + C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+ + 
Sbjct  405   KFAEFIREVKTLRELKIDNFCGVDMYNGFLIRFIKASGAYLGQAEDSVVVDFNYYRADNA  464

Query  1493  MVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGL  1672
               PRL +D+ EE+EQMA FKYGA PHW KNRN+AF G  +KY +  +F+  KK+ DP  +
Sbjct  465   STPRLNQDVWEEVEQMAFFKYGAKPHWAKNRNLAFLGVQKKYPNFNKFVAAKKQLDPQNI  524

Query  1673  FSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             FSS+WS+ IL  K       DGCALEG CICS D HC+P KGYFCR G VYK+A+VC
Sbjct  525   FSSDWSEAILFGKEAEK--GDGCALEGQCICSGDRHCSPEKGYFCRTGLVYKEARVC  579



>ref|XP_011026614.1| PREDICTED: L-gulonolactone oxidase [Populus euphratica]
Length=582

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 247/537 (46%), Positives = 345/537 (64%), Gaps = 13/537 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEG---  421
             SYG + DR  C      YP TE EL   +A A +   K+K  +R+SH+IPKLACP+    
Sbjct  45    SYGVWNDRKDCHVPSITYPTTEEELRLAVAHANQNNLKVKVVSRFSHTIPKLACPDDAQH  104

Query  422   DDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGL  601
                +LIST   N ++E++A+++ +T ++GV LR++I+E  ++GL+L  +PYW G++VGG+
Sbjct  105   GSSMLISTLKYNSSIEIDAANLAVTADAGVGLRELIDEVERSGLSLVPAPYWEGVSVGGV  164

Query  602   MGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLG  781
             + TG+HGSS WG G +VHDHVI + ++ PA E EGYA I  +   +  + AA+VSLG+LG
Sbjct  165   ISTGAHGSSWWGKGGAVHDHVIGLNLIVPARESEGYAKIIRIGAKDPLLNAAKVSLGMLG  224

Query  782   VISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrv  961
             VIS+V   L+P FKRS+++   +D  +       G ++EFAD+ W P     VYR D RV
Sbjct  225   VISKVKLSLEPAFKRSVAYNFTDDAHIEDIFMDHGKKYEFADVTWYPSRHTAVYRYDYRV  284

Query  962   STNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWF---L  1132
               +TSGNG +DF G +          R  E+  ES  + + KC+    +    V F   +
Sbjct  285   PLSTSGNGEYDFLGFQPNSIVVSKTTRSSEKLLESGRNVNGKCA----LATTFVGFKKLV  340

Query  1133  SYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLT  1312
             + GL N G+ F+GYPV+G+Q  MQ+SG+CL S   + +C WDPR+ GLFF++TT      
Sbjct  341   ANGLKN-GLIFTGYPVVGHQGKMQTSGSCLYSTRIDTSCAWDPRIGGLFFYETTAIFPAL  399

Query  1313  KVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDP  1492
             K   F+ DV+KL DL+P++ C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+ D 
Sbjct  400   KFGDFLRDVKKLRDLKPENFCGVDIYNGFLIRFIKASQAYLGQSEDSVVLDFNYYRADDS  459

Query  1493  MVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGL  1672
               PRL +D+ EE+EQMA FKYGA PHW KNRN+AF     KY S  +FL  KK+ DP  +
Sbjct  460   STPRLNQDVWEEVEQMAFFKYGAKPHWAKNRNLAFLDLQHKYPSFSKFLAAKKQLDPKNM  519

Query  1673  FSSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             FS EWS++IL  K       DGCALEG CICS+D HC+P KGYFC  G VYK+A+VC
Sbjct  520   FSGEWSNEILYGKEAEK--ADGCALEGQCICSEDIHCSPKKGYFCEQGLVYKEARVC  574



>ref|XP_008220057.1| PREDICTED: L-gulonolactone oxidase [Prunus mume]
Length=594

 Score =   483 bits (1242),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/567 (43%), Positives = 363/567 (64%), Gaps = 9/567 (2%)
 Frame = +2

Query  149   TIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELL  328
              I+   ++ ++ +  PE P++C  N         SYG + DR  C      YP TE EL 
Sbjct  14    VIWAATMLISIQAMPPELPVRCNKNGCNLYN---SYGVWGDRKDCHVQNVTYPTTEEELR  70

Query  329   SIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVE  502
               +A A + K K+K  +++SH+IPKLACP    G  +LIST   N ++E++A ++ +TV+
Sbjct  71    LAVAYANQNKLKVKVVSQFSHTIPKLACPATSSGNSMLISTAKYNSSIEIDAKNLAVTVD  130

Query  503   SGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIV  682
             +G+ LR++I+   +AGL+L  +PYW G++VGGL+ TG+HGSS WG G +VHDH++ + ++
Sbjct  131   AGIGLRRLIDAVEEAGLSLVAAPYWEGVSVGGLVSTGAHGSSWWGKGGAVHDHIVGLSLI  190

Query  683   TPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDL  862
              PA + EG+A I  L+  +    AA+VSLG+LGVIS+V   L+P FKRSI++   +D  +
Sbjct  191   VPAKQSEGFAKIVKLEPKDQIFNAAKVSLGLLGVISKVKLSLEPRFKRSIAYDFTDDAQI  250

Query  863   GKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALR  1042
                      ++EFAD+ W P      YR D+RV  N SG+G +DF G ++       ++R
Sbjct  251   ENIYMDHAKKYEFADITWYPSKHTAAYRYDNRVPLNASGDGTYDFLGFQSNSILISKSIR  310

Query  1043  EKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL  1222
               E+  ++      KC+      + +   ++ GL N G+ F+GYPVIG Q  MQ+SG+CL
Sbjct  311   ATEKTMDNGRSLGGKCTMAASF-LGVKKLVANGLKN-GLIFTGYPVIGPQGKMQTSGSCL  368

Query  1223  DSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGIL  1402
              S   + +C WDPR+NGLFF++TT     +K   FI DV+KL DL+P + C + +Y+G L
Sbjct  369   YSTAADNSCAWDPRINGLFFYETTAIFPASKFGDFIRDVKKLRDLKPDNFCGVDIYNGFL  428

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             +R+++A+ AYLG+ EDS+  D  Y+R+ D + PR  +D+ EE+EQ+A FKYGA PHW KN
Sbjct  429   IRFIRATGAYLGQPEDSVVVDFNYFRADDALTPRFNQDVWEEVEQLAFFKYGARPHWAKN  488

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN+AF    +KY +  +F+ VK++ DP  LFSSEWSD+++  K G+    DGCALEG CI
Sbjct  489   RNLAFLDVQKKYPNFNKFVAVKRQLDPQNLFSSEWSDEVVFGKEGVK--GDGCALEGQCI  546

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CS+D HC+P KGYFC+ G VY++A+VC
Sbjct  547   CSEDRHCSPGKGYFCKPGLVYQEARVC  573



>gb|KDP34196.1| hypothetical protein JCGZ_07767 [Jatropha curcas]
Length=558

 Score =   481 bits (1238),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 246/540 (46%), Positives = 353/540 (65%), Gaps = 17/540 (3%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP---EG  421
             SYG + DR  C     +YP TE +L   +  A+K   K+K  +++SH+IPKLACP   E 
Sbjct  19    SYGAWNDRKACFVPNVLYPSTEEKLRLAVGYASKNNLKVKVVSKFSHTIPKLACPAASEH  78

Query  422   DDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGL  601
              + +LIST   + ++E++ +++ +TV++GV LRQ+I++  +AGL+L  +PYW G +VGG+
Sbjct  79    KNSILISTLNYSSSIEIDKANLAVTVDAGVGLRQLIDKVEEAGLSLVTAPYWEGASVGGV  138

Query  602   MGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLG  781
             + TG HGSS WG G +VHDHVI + ++ PA E EGYA I  ++  +  +KAA+VSLG+LG
Sbjct  139   ICTGGHGSSWWGKGGAVHDHVIGLSLIVPAKESEGYAKIIRIEAQDPLLKAAKVSLGMLG  198

Query  782   VISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrv  961
             VIS+V   L+  FKRSI++   +D ++       G ++EF D+ W P     VYR D RV
Sbjct  199   VISKVKLSLEQAFKRSITYNFTDDGNIEDMIINHGKKYEFGDITWYPSRHTAVYRYDSRV  258

Query  962   STNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWF---L  1132
               N SG+G+FDF G ++         R  E+  E   + + KC    L+    V F   +
Sbjct  259   PLNASGDGVFDFLGFQSNSIVVSQTTRATEKSLEKANNVNGKC----LLAATFVGFKKLV  314

Query  1133  SYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSIS  1306
             + GL N G+ F+GYPV+G+Q  MQ+SG+CL S    +  +C WDPR+NGLFF++TT    
Sbjct  315   ANGLKN-GLLFTGYPVVGHQGKMQTSGSCLYSPETRIDTSCAWDPRINGLFFYETTAIFP  373

Query  1307  LTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSK  1486
              +K + FI+DV+KL D++P++ C + +Y+G L+RY+KAS AYLG+ EDSI  D  YYR+ 
Sbjct  374   ASKFQDFIKDVKKLRDIKPENFCGVDIYNGFLIRYIKASDAYLGQSEDSIVLDFNYYRAD  433

Query  1487  DPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPL  1666
             DP  PRL +DI EE+EQ+A FKYGA PHW KNRN+AF     KY + G+FL  KK+ D  
Sbjct  434   DPSTPRLNQDIWEEVEQIAFFKYGAKPHWAKNRNLAFLDVQSKYANFGKFLAAKKQLDSQ  493

Query  1667  GLFSSEWSDQ-ILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
              +F+SE+ D+ +LG  +G     +GCALEG CICS+D HC+P  GYFCR G V+K+A+VC
Sbjct  494   NIFTSEFFDEMLLGQDSGKD---EGCALEGQCICSEDRHCSPKNGYFCRTGLVFKEARVC  550



>ref|XP_008353193.1| PREDICTED: uncharacterized protein LOC103416748 [Malus domestica]
Length=473

 Score =   477 bits (1228),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 285/353 (81%), Gaps = 3/353 (1%)
 Frame = +2

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             +VT  LQPMFKRSI+++ K+D DLG +  +FG +HEFAD+ W P     VYR+DDRVSTN
Sbjct  120   EVTLNLQPMFKRSITYLSKDDSDLGDQVVRFGKEHEFADILWYPSQHKAVYRMDDRVSTN  179

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
             TSGNGL+DF   RA  +  L  +R  EE+QES  DAD KC+   L+   ++   +YGLTN
Sbjct  180   TSGNGLYDFIPFRATPSIALAVVRTTEENQESKSDADGKCTGAKLVTSILIKS-AYGLTN  238

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             +G+ F+GYPVIGYQ+ +QSSGTCLDSL D+    C WDP++ G FFHQTTFSI+L+  K+
Sbjct  239   NGLIFTGYPVIGYQHRLQSSGTCLDSLEDSRITACAWDPKIKGEFFHQTTFSINLSLAKN  298

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI+DVQKLV++EPK+LC + +Y+GILMRYV  S+AYLGKQ+D+IDFDITYYRSKDPM PR
Sbjct  299   FIQDVQKLVEIEPKALCGVEIYNGILMRYVTTSSAYLGKQKDAIDFDITYYRSKDPMTPR  358

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L+E ILEEIEQ+A+ KYGALPHWGKNRN+AF G + KYK A EFL+VK  +DP+GLFSSE
Sbjct  359   LHEGILEEIEQLALVKYGALPHWGKNRNIAFDGVMNKYKGAKEFLRVKNVYDPMGLFSSE  418

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             W+DQ+LGLK G++IVK+GCALEGLCICS+D HCAP+KGYFCR GK++ DA++C
Sbjct  419   WTDQVLGLKDGVTIVKEGCALEGLCICSKDIHCAPSKGYFCRPGKIFNDARIC  471



>ref|XP_006287247.1| hypothetical protein CARUB_v10000435mg, partial [Capsella rubella]
 gb|EOA20145.1| hypothetical protein CARUB_v10000435mg, partial [Capsella rubella]
Length=643

 Score =   483 bits (1244),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 267/589 (45%), Positives = 372/589 (63%), Gaps = 18/589 (3%)
 Frame = +2

Query  113   ISMAKMSINILITIYVQFL-------IFTVGSSLPEDPIKctinntmnctitnSYGTFPD  271
             I + +M   +  T+Y+ FL       I+TV S  P+ P++C +          +YG +PD
Sbjct  50    IIIYRMRYYLHYTLYISFLSLFFVNTIWTVHSVPPQSPVRCDLTGCTVSN---AYGKWPD  106

Query  272   RGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDGLLISTKY  451
             R  CRAA   YP TE EL   +A A +   K+K  TR+SH+IPKLACP G D +LIST  
Sbjct  107   RKTCRAANVTYPTTEEELRKAVAYAAEHHLKVKTVTRFSHTIPKLACPSGSDAILISTSK  166

Query  452   LNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSL  631
              N  +E+    +T+T +SGVSLR++I++   AG ++  SPYW G++VGGL+ TGSHGSS 
Sbjct  167   YNSVIEIEPDRLTVTADSGVSLRELIDKVEGAGFSIGTSPYWEGVSVGGLISTGSHGSSW  226

Query  632   WGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSD--IKAARVSLGVLGVISQVTFK  805
              G G SVHDHV+ I +V PA   EG+A + +L+QG  D  + A ++SLGVLGVIS+V   
Sbjct  227   SGRGGSVHDHVVGISLVVPADSSEGFAKVVSLEQGKDDKLLNAVKLSLGVLGVISKVKLT  286

Query  806   LQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNG  985
             ++  FKRS+++    D  L     + G + EF D+ W P  R  VYR D R   N SG+G
Sbjct  287   IEKGFKRSMTYNFTTDVALEDVFMEHGKRFEFGDITWYPSKRTAVYRYDIRSPVNVSGDG  346

Query  986   LFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKF  1165
             + DF G ++        +R  E+  ES  +   KC        +       GL N+G+ F
Sbjct  347   VNDFIGFQSNPILISKGIRALEKGLESSKNEKGKCGTADTTLAYKK-LTGNGLKNNGLLF  405

Query  1166  SGYPVIGYQNHMQSSGTCL--DSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDV  1339
             +GYPVIG Q  +Q+SG+CL   SL  ++ C WDPR NGLFF++TT   ++++ + F+ DV
Sbjct  406   TGYPVIGRQGKIQTSGSCLYSSSLRIDVACAWDPRYNGLFFYETTAIFTVSRFRDFLLDV  465

Query  1340  QKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDI  1519
             +KL DL+P+ LC + +Y+GIL+R++KAS AYLG+ EDS+  D  YYR+ D + PRL +D+
Sbjct  466   KKLRDLKPERLCGIDIYNGILIRFIKASDAYLGQTEDSVVVDFNYYRADDELTPRLNQDV  525

Query  1520  LEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKY-KSAGEFLKVKKKFDPLGLFSSEWSDQ  1696
             +EE+EQMA  K+GA PHWGKNR V F G  +K   +  +FL+VK K DP  +FSSEWSD+
Sbjct  526   MEEMEQMAFVKHGAKPHWGKNRKVGFFGVKQKCGPNLDKFLQVKNKLDPTNMFSSEWSDE  585

Query  1697  ILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             IL  + G     DGCALEG C+CS+D+HC+P+KGYFCR G VY  A+VC
Sbjct  586   ILSGREGPKY--DGCALEGNCVCSEDSHCSPSKGYFCRQGLVYTQARVC  632



>ref|XP_007224611.1| hypothetical protein PRUPE_ppa026902mg [Prunus persica]
 gb|EMJ25810.1| hypothetical protein PRUPE_ppa026902mg [Prunus persica]
Length=568

 Score =   481 bits (1237),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 239/533 (45%), Positives = 346/533 (65%), Gaps = 6/533 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG + DR  C      YP TE EL   +A A + K K+K  +++SH+IPKLACP    G
Sbjct  19    SYGVWGDRKDCHVQNVTYPTTEEELRLAVAYANQNKLKVKVVSQFSHTIPKLACPATSSG  78

Query  431   --LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
               +LIST   N ++E++A ++ +TV++G+ LR++I    +AGL+L  +PYW G++VGGL+
Sbjct  79    NSMLISTAKYNSSIEIDAKNLAVTVDAGIGLRRLINAVEEAGLSLVAAPYWEGVSVGGLV  138

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSS WG G +VHDH++ + ++ PA + EG+A I  L+  +    AA+VSLG+LGV
Sbjct  139   STGAHGSSWWGKGGAVHDHIVGLSLIVPAKQSEGFAKIVKLEPKDQIFNAAKVSLGLLGV  198

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             IS+V   L+P FKRSI++   +D  +         ++EFAD+ W P      YR D+RV 
Sbjct  199   ISKVKLSLEPRFKRSIAYNFTDDAQIENIYMDHAKKYEFADITWYPSKHTAAYRYDNRVP  258

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              N SG+G +DF G ++       ++R  E+  ++      KC+      + +   ++ GL
Sbjct  259   LNASGDGTYDFLGFQSNSILISKSIRATEKTMDNGRSLGGKCTMAASF-LGVKKLVANGL  317

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
              N G+ F GYPVIG Q  MQ+SG+CL S   + +C WDPR+NGLFF++TT     +K   
Sbjct  318   KN-GLIFIGYPVIGPQGKMQTSGSCLYSTAADNSCAWDPRINGLFFYETTAIFPASKFGD  376

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL DL+P + C + +Y+G L+R+++AS AYLG+ EDS+  D  Y+R+ D + PR
Sbjct  377   FIRDVKKLRDLKPDNFCGVDIYNGFLIRFIRASGAYLGQPEDSVVVDFNYFRADDALTPR  436

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
               +D+ EE+EQ+A FKYGA PHW KNRN+AF    +KY +  +F+ VK++ DP  LFSSE
Sbjct  437   FNQDVWEEVEQLAFFKYGAKPHWAKNRNLAFLDVQKKYPNFNKFVAVKRQLDPQNLFSSE  496

Query  1685  WSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD+++  K G     DGCALEG CICS+D HC+P KGYFC+ G VYK+A+VC
Sbjct  497   WSDEVVFGKEGEK--SDGCALEGQCICSEDRHCSPGKGYFCKPGLVYKEARVC  547



>ref|XP_006450656.1| hypothetical protein CICLE_v10007892mg [Citrus clementina]
 gb|ESR63896.1| hypothetical protein CICLE_v10007892mg [Citrus clementina]
Length=560

 Score =   479 bits (1234),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/534 (45%), Positives = 343/534 (64%), Gaps = 7/534 (1%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP--EGD  424
             +YG + DR  C  +   YP TE EL   +A A K K K+K  +++SH+IPKLACP  +  
Sbjct  20    AYGAWGDRKDCHVSNVTYPTTEEELRLAVAHAHKNKLKVKTVSKFSHTIPKLACPCSQSQ  79

Query  425   DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLM  604
               LLIST  L+  ++++ +++ +T ++GV LRQ+I+   +  L++  +PYW G++VGG++
Sbjct  80    STLLISTAKLDSNIDIDVANLAVTADAGVPLRQLIDRVEEENLSIVAAPYWEGVSVGGVI  139

Query  605   GTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGV  784
              TG+HGSS WG G +V+DHVI + +V PA E EGYA I  ++  +  + AA+VSLG+LGV
Sbjct  140   STGAHGSSWWGKGGAVYDHVIGLSLVVPAKESEGYAKIIRIEANDPLLDAAKVSLGLLGV  199

Query  785   ISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvS  964
             IS+V   L+P FKR I+F   +D  +         +HEF D+ W P  R  VYR DDRV+
Sbjct  200   ISKVKLSLEPGFKRGITFNFTDDAHIEDIFMDHAKKHEFGDITWYPSRRTAVYRYDDRVT  259

Query  965   TNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGL  1144
              NT G+G+ DF G +        + R  E+  E+  + + KC+    + +     ++ G 
Sbjct  260   LNTRGDGVNDFIGFQDTSILISKSTRAAEKALETAKNGNGKCTLAATV-LGFKKLIANGF  318

Query  1145  TNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKS  1324
              N+ + F+GYP++G Q  +Q+SG CL S   + +C WDPR+NGLFF++TT      K K 
Sbjct  319   KNNALIFTGYPIVGRQGKLQTSGACLYSRRVDTSCAWDPRINGLFFYETTAIFPANKFKD  378

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV+KL DL+P++ C +  Y+G L+R++KAS+AYLG+ EDSI  D  YYR+ D   PR
Sbjct  379   FIRDVKKLRDLKPENFCGVDSYNGFLIRFIKASSAYLGQSEDSIVVDYNYYRADDASTPR  438

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L +D+ EE+EQMA FKYGA PHW KNR +AF    +KY +   FL  K + DP  +FSSE
Sbjct  439   LNQDVWEEVEQMAFFKYGARPHWAKNRKLAFLNVQQKYANFSRFLAAKNQMDPQNMFSSE  498

Query  1685  WSDQILGLKTGLSIVK-DGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             WSD+IL    G    K DGCALEG CICS+D HC+P+KGYFC+ G VY +A+VC
Sbjct  499   WSDEIL---FGTEAAKFDGCALEGQCICSEDRHCSPSKGYFCKPGLVYTEARVC  549



>ref|XP_004291192.1| PREDICTED: L-gulonolactone oxidase-like [Fragaria vesca subsp. 
vesca]
Length=584

 Score =   480 bits (1236),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 251/567 (44%), Positives = 363/567 (64%), Gaps = 13/567 (2%)
 Frame = +2

Query  158   VQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSII  337
             V  L+ +V + LP+ P++C      N     SYG + DR  C      YP TE ELL  +
Sbjct  10    VLHLLVSVAAMLPQSPVQCDGTGGCNLFN--SYGIWNDRKDCYVLNVTYPTTENELLKAV  67

Query  338   AGATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRTLEVNASSMTMTVESGV  511
             A A + K K+K  +++SH+I KLACP    G  LLIST   N  +E++A+++ +TV+SGV
Sbjct  68    AYANQNKFKLKVVSQFSHTITKLACPATTTGNSLLISTSSYNSGIEIDAANLAVTVDSGV  127

Query  512   SLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPA  691
              LR++I+    AGL+L  +PYW G+++GGL+ TGSHGSS WG G SVHDH++ + ++ PA
Sbjct  128   GLRKLIDTVEAAGLSLVAAPYWEGVSIGGLISTGSHGSSWWGKGGSVHDHIVGLSLIVPA  187

Query  692   TEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKE  871
              + EGYA I  L+  +    AA+VSLG+LGVIS+V   L+  FKRSI++   +D  +  +
Sbjct  188   KQPEGYAKILRLEPKDQLFNAAKVSLGLLGVISKVKLSLEKGFKRSITYDFTDDDQIEDK  247

Query  872   ATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKE  1051
                 G ++EFAD+ W P      YR D+RV  N SG+G++DF G +A       ++R  E
Sbjct  248   YMVHGKKYEFADITWYPSKHTAAYRSDNRVPLNASGDGVYDFLGFQANPILVSKSVRASE  307

Query  1052  EHQESIGDADEKCSNQWLINVWMVW--FLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLD  1225
             +  ++      KC    L + ++ +   ++ GL N G+ F+GYPVIG Q  MQ+SG+CL 
Sbjct  308   KVMDNGHSLSGKC---LLASSFLGYKKLVANGLKN-GLIFTGYPVIGNQGKMQTSGSCLY  363

Query  1226  SLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKSLCVLGLYDGIL  1402
             S +   +C WDPR+NGLFF++TT      K + FI DV+KL DL + ++ C + +Y+G L
Sbjct  364   STSQASSCAWDPRINGLFFYETTAIFPAPKFRDFILDVKKLRDLVKTENFCGVDIYNGFL  423

Query  1403  MRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKN  1582
             +R++KAS AYLG+ EDS+  D  YYR+ D + PR  +D+ EE+EQ+A FK+GA PHW KN
Sbjct  424   IRFIKASEAYLGQPEDSVVVDFNYYRADDALTPRFDQDVWEEVEQLAFFKHGAKPHWAKN  483

Query  1583  RNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCI  1762
             RN+AF     KY    +F+ VK++ DP  +FSSEWSD+++  K G     DGC LEG+CI
Sbjct  484   RNIAFLNVQNKYSKFNKFVGVKRQLDPQNMFSSEWSDEVVYGKEGGK--SDGCGLEGMCI  541

Query  1763  CSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CS+D HC+P KGYFC+ G VY++A+VC
Sbjct  542   CSEDRHCSPGKGYFCKPGLVYEEARVC  568



>ref|XP_006365179.1| PREDICTED: L-gulonolactone oxidase-like [Solanum tuberosum]
Length=585

 Score =   478 bits (1230),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 368/566 (65%), Gaps = 14/566 (2%)
 Frame = +2

Query  170   IFTVGSSLPE-DPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             +FT  S++P  +PIKC   N+       SYG + DR  C A   VYP TE +L   +A A
Sbjct  18    LFTTSSAMPPPNPIKCNDINSNCQLSN-SYGVWGDRQTCHAPNIVYPTTEEQLRQELANA  76

Query  347   TKQKRKMKAATRYSHSIPKLACPEGD-DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
              K   K+K  T++SH+IPKLACP    + L IST+  + T+++N   +T+T++ GV LR+
Sbjct  77    NKNNLKVKIVTKFSHTIPKLACPSNSKNSLFISTEKYDSTIDINMERLTVTIDGGVGLRK  136

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +I+   KAGL+L  S YW G+TV G++ TG+HGSS WG G ++HDHVI + ++ PA E E
Sbjct  137   LIDTIEKAGLSLVASTYWEGVTVAGVISTGAHGSSWWGKGGAIHDHVIGLNLIVPANENE  196

Query  704   GYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             GYA +  L   +    AA+VSLG+LG+IS+VTF+L+P FKRSI+    ND  +  E  + 
Sbjct  197   GYAKVIKLTPQDPLFNAAKVSLGLLGIISKVTFQLEPAFKRSITLNFTNDSGIEDEFMEH  256

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
               ++EF D++W P  +  VYR D+RV  NT G+ L DF G ++       ++R  E+  E
Sbjct  257   ARKNEFGDIQWYPSRQIAVYRYDNRVPLNTPGDALNDFLGFQSNPILVSKSVRAAEKGFE  316

Query  1064  SIGDADEKCSNQWLINVWMVW--FLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
             +  +   KC+   + + ++ +   ++ GL N+ + F+GYPV+G+Q  MQSSG+CL S + 
Sbjct  317   NTRNVGGKCT---MASFFVAYKKLIANGLKNNKLIFTGYPVVGHQGKMQSSGSCLYSSSI  373

Query  1238  NL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKSLCVLGLYDGILMR  1408
             ++  TC WDP +NGLFF+++T     +K  +FI DV+KL DL +P+++C + +Y+G L R
Sbjct  374   DITSTCAWDPTINGLFFYESTAIFPSSKFGNFIRDVKKLRDLVKPENMCGVDIYNGFLFR  433

Query  1409  YVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRN  1588
             ++KAS AYLG+ EDS+  D  YYR+ D + PR  +DI EEIEQMA  KYGA PHW KNRN
Sbjct  434   FIKASDAYLGQGEDSVVVDFNYYRASDALTPRFNQDIWEEIEQMAFLKYGAKPHWAKNRN  493

Query  1589  VAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQIL-GLKTGLSIVKDGCALEGLCIC  1765
             VAF    +KY    +F+    + DP  +FSSEWSD+IL G + GL    DGCALEG+CIC
Sbjct  494   VAFVDVQKKYPKFNKFIAAMVQLDPKNMFSSEWSDEILFGKQEGLK--SDGCALEGMCIC  551

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             S+D HC+P+KGYFC+ G VY+ A VC
Sbjct  552   SEDRHCSPSKGYFCKPGLVYQQAHVC  577



>ref|XP_002302669.2| hypothetical protein POPTR_0002s17910g, partial [Populus trichocarpa]
 gb|EEE81942.2| hypothetical protein POPTR_0002s17910g, partial [Populus trichocarpa]
Length=359

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 224/356 (63%), Positives = 283/356 (79%), Gaps = 3/356 (1%)
 Frame = +2

Query  794   VTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNT  973
             VT +LQP+FKRSIS+VVK D DLG +   FG QHEFAD+ W P     VYR+DDR+S+NT
Sbjct  1     VTLQLQPLFKRSISYVVKKDTDLGDQVASFGRQHEFADITWYPSQGKAVYRIDDRISSNT  60

Query  974   SGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTND  1153
             SGNGL+D    R+  +  L A+R  E+ QES+ D D KC++  LI   +V  L+YGLTN+
Sbjct  61    SGNGLYDSIAFRSTLSLGLAAIRATEDAQESLKDPDGKCASAKLITSTLV-NLAYGLTNN  119

Query  1154  GVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNGLFFHQTTFSISLTKVKSF  1327
             G+ F+GYP+IGY N +QSSGTCLDS  D L   CPWD R+ G +F Q TFSISL+ VKSF
Sbjct  120   GIVFTGYPIIGYHNRLQSSGTCLDSPEDALITACPWDSRIKGEYFFQATFSISLSVVKSF  179

Query  1328  IEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRL  1507
             I+DVQ LV LEP++LC L  Y+GILMRYVKAS+AYLGK++D++DFD+T+YR+KDP  PRL
Sbjct  180   IQDVQNLVKLEPRALCGLEQYNGILMRYVKASSAYLGKEDDALDFDMTFYRNKDPTKPRL  239

Query  1508  YEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEW  1687
             YEDI EEIEQ+A+FKYG LPHWGKNRN+ F GA++KYK+AG FL+VK+ +DPLGLFS+EW
Sbjct  240   YEDIYEEIEQLAVFKYGGLPHWGKNRNLVFNGALKKYKNAGAFLRVKEMYDPLGLFSNEW  299

Query  1688  SDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVCVKIN  1855
             +DQ+LGLK  ++I+K+GCALEGLCICSQD HCAP  GY CRAGK+Y+DA+VC  ++
Sbjct  300   ADQVLGLKGEVNIIKEGCALEGLCICSQDIHCAPRDGYLCRAGKIYQDARVCALVS  355



>gb|KCW81547.1| hypothetical protein EUGRSUZ_C02902 [Eucalyptus grandis]
Length=562

 Score =   477 bits (1227),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 245/536 (46%), Positives = 343/536 (64%), Gaps = 9/536 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP--EGD  424
             SYG + DR  CR     YP  E E+ S +A A + +  +K  +++SH+IPKLACP   G 
Sbjct  23    SYGAWNDRLDCRVQNVTYPSIEEEVRSAVAYAARHRLNVKVVSKFSHTIPKLACPGRAGS  82

Query  425   DG-LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGL  601
              G  LIST      ++++ +S+ +T ++GV LR++I+     GL+L   PYW G++V GL
Sbjct  83    AGSFLISTANYASGIDIDVTSLVVTADAGVPLRELIDRVEGQGLSLVAVPYWEGVSVAGL  142

Query  602   MGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLG  781
             + TG+HGSS WG G +VHDHV+ I +V PA E EG+A +  ++  +  + AARVSLG+LG
Sbjct  143   ISTGAHGSSWWGKGGAVHDHVVGISLVVPAKESEGFAKVIRIEAQDQLLNAARVSLGMLG  202

Query  782   VISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrv  961
             VIS+V F L+  FKRSI++   +D  + +  T    ++EFAD+ W P     VYR D+RV
Sbjct  203   VISKVKFSLEKGFKRSITYDFTDDARIEEIYTDHAMKYEFADITWYPSKHTAVYRNDNRV  262

Query  962   STNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYG  1141
               NTSG+GL+DF G ++       ++R  E+  E+  + D KC+      V     ++ G
Sbjct  263   PLNTSGDGLYDFLGFQSNSVVVSKSVRATEKLLENARNVDGKCALA-STTVEYKKLIANG  321

Query  1142  LTNDGVKFSGYPVIGYQNHMQSSGTCLDSL--NDNLTCPWDPRVNGLFFHQTTFSISLTK  1315
             L N G+ F+GYPVIG Q  MQ+SG+CL S     +LTC WDPR++GLFF+++T      +
Sbjct  322   LRN-GLIFTGYPVIGRQGKMQTSGSCLYSAPSRTDLTCAWDPRIDGLFFYESTAIFPAQR  380

Query  1316  VKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPM  1495
                F+ DV+K  D+ PK+ C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+ DP 
Sbjct  381   FADFVRDVKKHRDMNPKNFCGVDIYNGFLVRFIKASKAYLGQSEDSVVVDFNYYRADDPS  440

Query  1496  VPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLF  1675
              PRL +D+ EE+EQMA FK+GA PHW KNRN+AF     KY + G+F+  KK  DP  LF
Sbjct  441   TPRLNQDVWEEVEQMAFFKHGAKPHWAKNRNLAFLNVRNKYPNFGKFMAAKKLLDPQNLF  500

Query  1676  SSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             SSEWSD IL          DGCALEG CICS+D HC+P KGY C+AG VY++A+VC
Sbjct  501   SSEWSDDILFRNEAAK--GDGCALEGQCICSEDRHCSPAKGYLCKAGLVYQEARVC  554



>ref|XP_010541261.1| PREDICTED: uncharacterized protein LOC104814776 [Tarenaya hassleriana]
Length=588

 Score =   477 bits (1228),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 254/575 (44%), Positives = 361/575 (63%), Gaps = 13/575 (2%)
 Frame = +2

Query  140   ILITIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEA  319
             + I+  +    +T  S  PE P++C     M      +YG +PDR VC AA   YP TE 
Sbjct  10    LFISSLLGLTAWTARSVPPEPPVQCNQTGCMVSN---AYGAWPDRKVCHAANVTYPTTEE  66

Query  320   ELLSIIAGATKQKRKMKAATRYSHSIPKLACPE--GDDG-LLISTKYLNRTLEVNASSMT  490
             +L   +A A +   K+K  T++SH+IPKLACP   G  G +L+ST   +  +E++   +T
Sbjct  67    DLRRAVAYAVEHNLKIKTVTKFSHTIPKLACPSSSGSPGTILVSTSRYDSVIEIDPVRLT  126

Query  491   MTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIH  670
             +T +SG SLR +I++  ++G +L  SPYW G++VGGL+ TGSHGS+    G SVHDHV+ 
Sbjct  127   VTADSGASLRALIDKVEESGFSLGTSPYWEGVSVGGLISTGSHGSAWGARGGSVHDHVVG  186

Query  671   IRIVTPATEKEGYATIRTLKQGNSDI-KAARVSLGVLGVISQVTFKLQPMFKRSISFVVK  847
             + +V PA+  EG+A +  +++ ++++  A +VSLGVLGVIS+V   ++  FKRS+++   
Sbjct  187   LSLVVPASSSEGFAKVIRIEEKDAELLNAVKVSLGVLGVISKVKLSIEKAFKRSVTYNFT  246

Query  848   NDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDC  1027
             +D  +     + G + EF D+ W P  +  VYR D RV  N SG+G+ DF G ++     
Sbjct  247   SDVGMEDMFLEHGKKFEFGDITWYPSKKTAVYRYDFRVPVNVSGDGVNDFIGFQSNSILV  306

Query  1028  LNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQS  1207
                +R  E+  ES      KC     + +     L  GL N+GV F+GYPVIG Q  MQ+
Sbjct  307   TKGIRAAEKLLESTKSVKGKCVMADTV-IASKKLLGNGLKNNGVIFTGYPVIGKQGKMQT  365

Query  1208  SGTCLDSLND--NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVL  1381
             SG+CL S     ++ C WDPR  GLFF++TT     ++ + FI DV+KL DL+P++LC +
Sbjct  366   SGSCLYSSPSRIDVACAWDPRYKGLFFYETTAIFPASRSRDFIIDVKKLRDLKPENLCGM  425

Query  1382  GLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGA  1561
              +Y+GIL+RY+K S AYLG+ EDS+  D  YYRS +   PRL ED++EEIEQMA FKYGA
Sbjct  426   DIYNGILIRYIKRSDAYLGQGEDSVVVDFNYYRSDEASEPRLNEDVMEEIEQMAFFKYGA  485

Query  1562  LPHWGKNRNVAFQGAIRKYKSA-GEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDG  1738
              PHWGKNR +AF G   KYK+   +F+ V+ + DP  +FSSEWSD+IL    G    +D 
Sbjct  486   KPHWGKNRRLAFAGVKEKYKNGYDKFMGVRNRLDPRKVFSSEWSDEILSGAEGSR--EDS  543

Query  1739  CALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             CALEG C+CS+D HC+P+KGYFCR G VY  A+VC
Sbjct  544   CALEGSCVCSEDRHCSPSKGYFCRQGLVYTQARVC  578



>ref|XP_011081809.1| PREDICTED: uncharacterized protein LOC105164756 [Sesamum indicum]
Length=584

 Score =   477 bits (1227),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 250/582 (43%), Positives = 359/582 (62%), Gaps = 16/582 (3%)
 Frame = +2

Query  128   MSINILITIYVQFLIFTVGSSL------PEDPIKctinntmnctitnSYGTFPDRGVCRA  289
             M+ N  +TI     I  VG S       P++PI+C     +      SYG + DR  C  
Sbjct  1     MANNYFLTILCTTFIVVVGGSALIRAMPPQNPIQCNQTGCILYN---SYGVWDDRKTCHV  57

Query  290   AKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG--LLISTKYLNRT  463
             A AVYP TE EL   +A A K K K+K  +++SH+I KLACP   +G  +LIST+  N +
Sbjct  58    AAAVYPTTEEELRLAVANANKNKLKVKVVSKFSHTILKLACPTARNGNAVLISTERYNSS  117

Query  464   LEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVG  643
             + V+ +++ +TV++GV LR +I+   + GL+L  + YW G+++GG + TG HGSS WG G
Sbjct  118   IVVDVANLAVTVDAGVGLRPLIDRVEEEGLSLVAATYWEGVSIGGAVSTGGHGSSWWGKG  177

Query  644   SSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFK  823
              ++HDHVI +R++ P    EG+A +  LK  +  + AAR SLGVLGVIS+VT  L+  FK
Sbjct  178   GAIHDHVIGVRLIVPGNASEGFARVLDLKGDDPLLNAARASLGVLGVISKVTLSLERGFK  237

Query  824   RSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFG  1003
             RSI+    ND  +  E  +   ++EF D++W P     VYR DDRV  +TSG+G++DF G
Sbjct  238   RSITLNFTNDNGIEDEFMEHAKRYEFGDIQWYPSRYRAVYRYDDRVPLDTSGDGVYDFIG  297

Query  1004  LRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVI  1183
              R +       +R  E+  E+  + + KC    L ++     ++ GL N+ V F+GYPVI
Sbjct  298   FRPILAVIPETVRALEKAAEATKNQNPKCIMATL-SIAYRKLIANGLKNNLV-FTGYPVI  355

Query  1184  GYQNHMQSSGTCLDS--LNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL  1357
             G+Q  MQ+SG+CL S   + +  C WDPR+ GLFF++++  +  T    FI DV+KL ++
Sbjct  356   GHQGKMQTSGSCLYSPQTDKDSVCAWDPRIKGLFFYESSAILPATTFADFIRDVKKLRNI  415

Query  1358  EPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQ  1537
              P + C + +YDG L+R++  S AYLG+ EDS+  D  YYR+ +   PRL ED+LEE+EQ
Sbjct  416   NPDNFCGVDMYDGFLIRFISKSDAYLGQAEDSVVVDFNYYRADEASTPRLNEDVLEEVEQ  475

Query  1538  MAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTG  1717
             MA FKY   PHW KNR + F G   KY +  +F+  K   DP  +FSS+WSD++L L   
Sbjct  476   MAFFKYSGKPHWAKNRKLDFAGVKDKYPNFSKFIGAKNVLDPDNMFSSKWSDEVL-LGQA  534

Query  1718  LSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
               + +DGCALEG CICS+D HC+P  GY+CR G VYK+A+VC
Sbjct  535   EKVKEDGCALEGQCICSEDRHCSPGNGYYCRTGLVYKEARVC  576



>ref|XP_010049092.1| PREDICTED: L-gulonolactone oxidase [Eucalyptus grandis]
Length=590

 Score =   477 bits (1228),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/536 (46%), Positives = 343/536 (64%), Gaps = 9/536 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACP--EGD  424
             SYG + DR  CR     YP  E E+ S +A A + +  +K  +++SH+IPKLACP   G 
Sbjct  51    SYGAWNDRLDCRVQNVTYPSIEEEVRSAVAYAARHRLNVKVVSKFSHTIPKLACPGRAGS  110

Query  425   DG-LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGL  601
              G  LIST      ++++ +S+ +T ++GV LR++I+     GL+L   PYW G++V GL
Sbjct  111   AGSFLISTANYASGIDIDVTSLVVTADAGVPLRELIDRVEGQGLSLVAVPYWEGVSVAGL  170

Query  602   MGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLG  781
             + TG+HGSS WG G +VHDHV+ I +V PA E EG+A +  ++  +  + AARVSLG+LG
Sbjct  171   ISTGAHGSSWWGKGGAVHDHVVGISLVVPAKESEGFAKVIRIEAQDQLLNAARVSLGMLG  230

Query  782   VISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrv  961
             VIS+V F L+  FKRSI++   +D  + +  T    ++EFAD+ W P     VYR D+RV
Sbjct  231   VISKVKFSLEKGFKRSITYDFTDDARIEEIYTDHAMKYEFADITWYPSKHTAVYRNDNRV  290

Query  962   STNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYG  1141
               NTSG+GL+DF G ++       ++R  E+  E+  + D KC+      V     ++ G
Sbjct  291   PLNTSGDGLYDFLGFQSNSVVVSKSVRATEKLLENARNVDGKCALA-STTVEYKKLIANG  349

Query  1142  LTNDGVKFSGYPVIGYQNHMQSSGTCLDSL--NDNLTCPWDPRVNGLFFHQTTFSISLTK  1315
             L N G+ F+GYPVIG Q  MQ+SG+CL S     +LTC WDPR++GLFF+++T      +
Sbjct  350   LRN-GLIFTGYPVIGRQGKMQTSGSCLYSAPSRTDLTCAWDPRIDGLFFYESTAIFPAQR  408

Query  1316  VKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPM  1495
                F+ DV+K  D+ PK+ C + +Y+G L+R++KAS AYLG+ EDS+  D  YYR+ DP 
Sbjct  409   FADFVRDVKKHRDMNPKNFCGVDIYNGFLVRFIKASKAYLGQSEDSVVVDFNYYRADDPS  468

Query  1496  VPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLF  1675
              PRL +D+ EE+EQMA FK+GA PHW KNRN+AF     KY + G+F+  KK  DP  LF
Sbjct  469   TPRLNQDVWEEVEQMAFFKHGAKPHWAKNRNLAFLNVRNKYPNFGKFMAAKKLLDPQNLF  528

Query  1676  SSEWSDQILGLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             SSEWSD IL          DGCALEG CICS+D HC+P KGY C+AG VY++A+VC
Sbjct  529   SSEWSDDILFRNEAAK--GDGCALEGQCICSEDRHCSPAKGYLCKAGLVYQEARVC  582



>ref|XP_010419726.1| PREDICTED: L-gulonolactone oxidase-like isoform X1 [Camelina 
sativa]
 ref|XP_010419727.1| PREDICTED: L-gulonolactone oxidase-like isoform X2 [Camelina 
sativa]
Length=590

 Score =   476 bits (1226),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 260/563 (46%), Positives = 358/563 (64%), Gaps = 11/563 (2%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I+TV S  P+ P++C            +YGT+PDR  CRAA   YP TE EL   +A A 
Sbjct  24    IWTVQSVPPQPPVRCDQTGCTVFN---AYGTWPDRKTCRAANVTYPTTEDELRKAVAYAA  80

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             +   K+K  TR+SH+IPKLACP G D +LIST   N  +E+    +T+T +SGVSLR++I
Sbjct  81    EHHLKVKTVTRFSHTIPKLACPSGSDAMLISTSKYNSVIEIEPDRLTVTADSGVSLRELI  140

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
             ++  +AG ++  SPYW G+++GGL+ TGSHGSS  G G SVHDHV+ I +V PA   EG+
Sbjct  141   DKVEEAGFSIGTSPYWEGVSIGGLISTGSHGSSWSGRGGSVHDHVVGISLVVPANSSEGF  200

Query  710   ATIRTLKQGNSD--IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             A +  L++G  D  + A +VSLGVLGVIS+V   ++  FKRSI +   +D  +     + 
Sbjct  201   AKVVKLEEGRDDKLLDAVKVSLGVLGVISKVKLSIEKAFKRSIMYNFTSDVAIEDIFMEH  260

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G + EF D+ W P  +  VYR D R   N SGNG+ DF G ++        +R  E+  E
Sbjct  261   GKKIEFGDITWYPSRKTAVYRYDIRSPANVSGNGVNDFTGFQSNPILISKGVRALEKSLE  320

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL--DSLND  1237
             S  +   KC+       +       GL N+G+ F+GYPVIG Q  +Q+SG+CL   S+  
Sbjct  321   SSKNEKGKCTTADTTLAYKK-LTGNGLKNNGLLFTGYPVIGRQGKIQTSGSCLYSSSIRI  379

Query  1238  NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
             ++ C WDPR NGL F++TT   ++ + + F+ DV+KL DLEP+ LC + +Y+GIL+R++K
Sbjct  380   DVACAWDPRYNGLSFYETTAIFTVARFRDFLLDVKKLRDLEPERLCGIDIYNGILIRFIK  439

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
              S AYLG+ EDS+  D  YYR+ D + PRL ED++EE+EQMA  K+GA PHWGKNR V F
Sbjct  440   GSNAYLGQTEDSVVVDFNYYRADDELTPRLNEDVMEEMEQMAFVKHGAKPHWGKNRKVGF  499

Query  1598  QGAIRKY-KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
              G  +K   +  +FL+VK K DP  +FSSEWSD+IL  + G     DGCALEG C+CS+D
Sbjct  500   FGVKQKCGPNFDKFLEVKNKLDPTKMFSSEWSDEILFGREGPKY--DGCALEGNCVCSED  557

Query  1775  NHCAPNKGYFCRAGKVYKDAKVC  1843
              HC+P+KGYFCR G VY  A+VC
Sbjct  558   KHCSPSKGYFCRQGLVYTQARVC  580



>gb|EYU29272.1| hypothetical protein MIMGU_mgv1a003820mg [Erythranthe guttata]
Length=562

 Score =   474 bits (1221),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 249/543 (46%), Positives = 345/543 (64%), Gaps = 19/543 (3%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             SYG + DR  C    AVYP +E EL S +A A ++K K+K  +R+SH+IPKLACP     
Sbjct  19    SYGVWSDRKDCHVTSAVYPTSEEELRSAVADANRRKLKVKVVSRFSHTIPKLACPSPGST  78

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             +LIST+  N  +EV+ +++ +T ++GV LR++I+   + GL+L  +PYW G++VGG++ T
Sbjct  79    MLISTERYNTGIEVDVANLAVTADAGVGLRELIDRVEEEGLSLVAAPYWEGVSVGGVIST  138

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             G+HGSS WG G +VHDHVI +R+V PA E +G+A I  LK G+  + AA+VSLG+LG IS
Sbjct  139   GAHGSSWWGRGGAVHDHVIGVRLVVPAKESQGFARIVDLKGGDPLLNAAKVSLGMLGAIS  198

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             +VT  L+  FKRSI +   +D  +  E      +HEF D++W P     VYR DDRV  N
Sbjct  199   KVTLLLERGFKRSIRYNFTSDVGIEDEFMDHAQKHEFGDIQWYPSLHTAVYRYDDRVPVN  258

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSY-GLT  1147
              +G+G+ DF G ++       ++R  E+  E   + + KC       +    FLSY  LT
Sbjct  259   ATGDGVNDFLGFQSNLAIISKSVRASEKAVEKARNVNGKC-------ILASSFLSYKKLT  311

Query  1148  NDGVK-------FSGYPVIGYQNHMQSSGTCLDSLNDN--LTCPWDPRVNGLFFHQTTFS  1300
              +G+K       F+GYPVIG Q  MQ+SG+CL S   N   +C WDPR+NGLFF ++T  
Sbjct  312   ANGLKNSNNLKIFTGYPVIGRQGKMQTSGSCLYSPQSNTATSCAWDPRINGLFFFESTAI  371

Query  1301  ISLTKVKSFIEDVQKLVDL-EPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYY  1477
                 K   F+ DV+KL D+ + +S C + +Y+G L+R+V  S AYLG+ E+S+  D  YY
Sbjct  372   FPAKKFPDFVHDVRKLRDIVKSESFCGVDMYNGFLIRFVAKSGAYLGQSENSVVVDFNYY  431

Query  1478  RSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKF  1657
             R+ D   PRL  D+ EEIEQMA FKYGA PHW KNR+VAF    +KY   G+F++ K+  
Sbjct  432   RADDSSTPRLNGDVWEEIEQMAFFKYGAKPHWAKNRDVAFFDVQKKYVDFGKFVEAKRFL  491

Query  1658  DPLGLFSSEWSDQIL-GLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDA  1834
             DP  +FS E+SD IL G     S+  DGCALEG C+CS+D HC+P  GYFCR G VY +A
Sbjct  492   DPTNVFSGEFSDGILTGKGVPASVKGDGCALEGECVCSEDRHCSPENGYFCRNGSVYGEA  551

Query  1835  KVC  1843
             +VC
Sbjct  552   RVC  554



>ref|XP_004245272.1| PREDICTED: L-gulonolactone oxidase [Solanum lycopersicum]
Length=585

 Score =   474 bits (1219),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 366/566 (65%), Gaps = 14/566 (2%)
 Frame = +2

Query  170   IFTVGSSLPE-DPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGA  346
             +FT+  ++P  +PI+C   N+       SYG + DR  C A   VYP TE +L   +A A
Sbjct  18    LFTISFAMPPPNPIRCNDINSNCQLFN-SYGVWGDRQTCHAPNIVYPTTEEQLRQELANA  76

Query  347   TKQKRKMKAATRYSHSIPKLACPEGD-DGLLISTKYLNRTLEVNASSMTMTVESGVSLRQ  523
              K   K+K  T++SH+IPKLACP    + L +ST+  + T+++N   +T+T + GV LR+
Sbjct  77    NKNNLKVKIVTKFSHTIPKLACPSNSKNSLFVSTEKYDSTIDINMERLTVTTDGGVGLRK  136

Query  524   VIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKE  703
             +I+   KAGL+L  S YW G TV G++ TG+HGSS WG G ++HDHVI + ++ PA E E
Sbjct  137   LIDTIEKAGLSLVASTYWEGATVAGVISTGAHGSSWWGKGGAIHDHVIGLNLIVPANENE  196

Query  704   GYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             GYA I  L   +    AA+VSLG+LG+IS+VTF+L+  FKRSI     ND  +  E  + 
Sbjct  197   GYAKIIKLTPQDPLFNAAKVSLGLLGIISKVTFQLEAAFKRSIRLNYTNDSGIEDEFMEH  256

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
               ++EF D++W P  +  VYR D+RV  NT G+GL DF G ++       ++R  E+  E
Sbjct  257   ARKNEFGDIQWYPSRQIAVYRYDNRVPLNTPGDGLNDFLGFQSNPILLSKSVRGTEKGFE  316

Query  1064  SIGDADEKCSNQWLINVWMVW--FLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLND  1237
             +  +   KC    + + ++ +   ++ G  N+   F+GYPV+G+Q  MQSSG+CL S + 
Sbjct  317   NTRNVGGKCM---MASSFVAYKKLIANGFKNNKSIFTGYPVVGHQGKMQSSGSCLYSSSI  373

Query  1238  NL--TCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDL-EPKSLCVLGLYDGILMR  1408
             ++  TC WDPR+NGLFF+++T     +K  +FI DV+KL DL +P+S+C + +Y+G L R
Sbjct  374   DITSTCSWDPRINGLFFYESTAIFPSSKFGNFIRDVKKLRDLVKPESMCGVDIYNGFLFR  433

Query  1409  YVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRN  1588
             ++KAS AYLG+ EDS+  D  YYR+ D + PR  +DI EEIEQMA  KYGA PHW KNRN
Sbjct  434   FIKASDAYLGQGEDSVVVDFNYYRASDALTPRFNQDIWEEIEQMAFVKYGAKPHWAKNRN  493

Query  1589  VAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQIL-GLKTGLSIVKDGCALEGLCIC  1765
             VAF    +KY    +F+  K + DP  +FSSEWSD+IL G + GL    DGCALEG+CIC
Sbjct  494   VAFVDVQKKYPKFNKFVGAKAQLDPKNMFSSEWSDEILFGKQQGLK--SDGCALEGMCIC  551

Query  1766  SQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             S+D HC+P+KGYFC+ G VY++A+VC
Sbjct  552   SEDRHCSPSKGYFCKPGLVYQEARVC  577



>ref|XP_010491887.1| PREDICTED: L-gulonolactone oxidase-like [Camelina sativa]
Length=589

 Score =   473 bits (1218),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 260/563 (46%), Positives = 356/563 (63%), Gaps = 11/563 (2%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I+TV S  P+ P++C            +YGT+PDR  C AA   YP TE EL   +A A 
Sbjct  23    IWTVQSVPPQPPVRCDQTGCTVFN---AYGTWPDRKTCHAANVTYPTTEDELRKAVAYAA  79

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             +   K+K  TR+SH+IPKLACP G D +LIST   N  +E+    +T+T +SGVSLR++I
Sbjct  80    EHHLKVKTVTRFSHTIPKLACPSGSDAMLISTSKYNSVIEIEPDRLTVTADSGVSLRELI  139

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
             ++   AG ++  SPYW G+++GGL+ TGSHGSS  G G SVHDHV+ I +V PA   EG+
Sbjct  140   DKVEGAGFSIGTSPYWEGVSIGGLISTGSHGSSWSGRGGSVHDHVVGISLVVPANSSEGF  199

Query  710   ATIRTLKQGNSD--IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             A +  L++G  D  + A +VSLGVLGVIS+V   ++  FKRS+++   +D  L     + 
Sbjct  200   AKVVKLEEGRDDKLLDAVKVSLGVLGVISKVKLSIEKAFKRSMTYNFTSDVALEDIFMEH  259

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G Q EF D+ W P  +  VYR D R   N SGNG+ DF G ++        +R  E+  E
Sbjct  260   GKQFEFGDITWYPSRKTAVYRYDIRSPVNVSGNGVNDFTGFQSNPILISKGVRALEKALE  319

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL--DSLND  1237
             S  +   KC+       +       GL N+G+ F+GYPVIG Q  +Q SG+CL   S+  
Sbjct  320   SSKNEKGKCTTADTTLAYKK-LTGNGLKNNGLLFTGYPVIGRQGKIQCSGSCLYSSSIRI  378

Query  1238  NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
             ++ C WDPR NGL F++TT   ++ + + F+ DV+KL DLEP+ LC + +Y+GIL+R++K
Sbjct  379   DVACAWDPRYNGLSFYETTAIFTVARFRDFLLDVKKLRDLEPERLCGIDIYNGILIRFIK  438

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
              S+AYLG+ EDS+  D  YYR+ D + PRL ED++EE+EQMA  K+GA PHWGKNR V F
Sbjct  439   GSSAYLGQTEDSVVVDFNYYRADDELTPRLNEDVMEEMEQMAFVKHGAKPHWGKNRKVGF  498

Query  1598  QGAIRKY-KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
              G  +K   +  +FL+VK K DP  +FSSEWSD+IL    G     DGCALEG C+CS+D
Sbjct  499   FGVKQKCGPNFDKFLEVKNKLDPTKMFSSEWSDEILFGIEGPKY--DGCALEGNCVCSED  556

Query  1775  NHCAPNKGYFCRAGKVYKDAKVC  1843
              HC+P+KGYFCR G VY  A+VC
Sbjct  557   RHCSPSKGYFCRQGLVYTQARVC  579



>ref|XP_006651549.1| PREDICTED: uncharacterized protein LOC102717331, partial [Oryza 
brachyantha]
Length=434

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/436 (55%), Positives = 305/436 (70%), Gaps = 16/436 (4%)
 Frame = +2

Query  587   TVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVS  766
             TVGG +GTG+HGSSLWG GS+VH++V+ +RIVTPA   EGYA +R L   + D+ AA+VS
Sbjct  1     TVGGRLGTGAHGSSLWGKGSAVHEYVVGMRIVTPAPAAEGYAKVRVLAADDPDLDAAKVS  60

Query  767   LGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyr  946
             LGVLGVISQVT  LQP+FKRS++F  + D DL ++   FG+QHEFAD+ W P     +YR
Sbjct  61    LGVLGVISQVTLALQPLFKRSVTFAEREDDDLAEQVATFGYQHEFADIAWYPGLGRALYR  120

Query  947   vddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVW  1126
             VDDR+  N SG G+ DF G RA  T  + A R  EE  E  G+   KC    + +  +  
Sbjct  121   VDDRLPINASGEGVLDFIGFRATSTLVIRANRLAEELLERAGNGSGKCVTSRVTHAALA-  179

Query  1127  FLSYGLT-NDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPWDPRVNG-LFFHQTT  1294
                YGL    G  F GYPV+G QN MQ+SG C+    D L   CPWDPRV G  FFHQTT
Sbjct  180   SAGYGLMRRSGGLFGGYPVVGRQNRMQASGGCITGPEDLLLTACPWDPRVRGSSFFHQTT  239

Query  1295  FSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDS-------  1453
             FS+ +++ ++F+++V++L DL P++LC + LY+GILMRYVKASTA+LGK           
Sbjct  240   FSLPVSRARAFVDEVRRLRDLNPRALCGVELYNGILMRYVKASTAHLGKPAAGAGAGDAD  299

Query  1454  -IDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAG  1630
              +DFD+TYYRS+DP   RL+ED+LEEIEQM +FKYG LPHWGKNRN+AF GA  KY    
Sbjct  300   MVDFDMTYYRSRDPGRARLFEDVLEEIEQMGLFKYGGLPHWGKNRNLAFVGAAGKYPRLR  359

Query  1631  EFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKD--GCALEGLCICSQDNHCAPNKGYF  1804
             EFL+VK  FDP GLFSS+WSD +LG+  G +   D  GCALEG+C+CS+D HCAP++GY 
Sbjct  360   EFLRVKDAFDPDGLFSSDWSDMMLGIG-GRAPTTDAPGCALEGMCVCSRDAHCAPDQGYV  418

Query  1805  CRAGKVYKDAKVCVKI  1852
             CR GKVYKDA+VC K+
Sbjct  419   CRPGKVYKDARVCTKL  434



>dbj|BAK08164.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   469 bits (1207),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 305/437 (70%), Gaps = 5/437 (1%)
 Frame = +2

Query  542   KAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIR  721
             + GLALP+SPYW G+T+GGL+ TG+HGSSLWG G +VH++V+ +RIVTPA   +G+AT+R
Sbjct  58    RRGLALPHSPYWSGVTIGGLLATGAHGSSLWGNGDAVHEYVVGLRIVTPAPASQGFATVR  117

Query  722   TLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEF  901
              L   + D+ AA+VSLGVLGVISQVT  LQP+FKRS++FV ++D DL  +   +G +HEF
Sbjct  118   ELGAHHLDLGAAKVSLGVLGVISQVTLALQPLFKRSVTFVERDDSDLEDQVVAWGRRHEF  177

Query  902   ADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDAD  1081
              D+ W P    VVYR DDRV  ++ GNGL D   LR+         R  EE  E  G   
Sbjct  178   GDLAWQPGLGKVVYRQDDRVDVSSPGNGLNDHLTLRSRAALGRVDARRTEEQLEENGTVM  237

Query  1082  EKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCLDSLNDNL--TCPW  1255
              +C+     +       S+G TNDG  F+G+PV+GYQ+ MQ++G+C+DS  D L  +C W
Sbjct  238   ARCAAAETTSAGQPQ--SHGFTNDGQVFTGFPVVGYQHRMQATGSCIDSPEDGLLTSCKW  295

Query  1256  DPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYL  1435
             DPR+   F +    S+ L K  +F+ DV++L DL P++ C L    G+L RY++AS+AYL
Sbjct  296   DPRLGATFVYNAAISVPLHKATAFVADVKRLRDLNPRAFCGLDARGGLLARYLRASSAYL  355

Query  1436  GKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRK  1615
             GK ED++DFDITYYRS     PR + D+++E+EQMA+ KYG  PHWGKNRN AF GA+ +
Sbjct  356   GKPEDAVDFDITYYRSYAAGAPRAHADVIDELEQMALRKYGGFPHWGKNRNFAFDGAVDR  415

Query  1616  YKSAGEFLKVKKKFDPLGLFSSEWSDQILGLK-TGLSIVKDGCALEGLCICSQDNHCAPN  1792
             Y  AGEFL+VK ++DP GLFSS+WSDQ+LG+     S+V++GCA+EGLC+CS  +HCAP 
Sbjct  416   YPKAGEFLEVKGRYDPDGLFSSKWSDQVLGVDGASPSVVEEGCAMEGLCVCSDHSHCAPV  475

Query  1793  KGYFCRAGKVYKDAKVC  1843
              GY CR GKVYK+A+VC
Sbjct  476   LGYLCRPGKVYKEARVC  492



>ref|NP_196715.1| L-gulono-1,4-lactone (L-GulL) oxidase 3 [Arabidopsis thaliana]
 emb|CAB87714.1| putative protein [Arabidopsis thaliana]
 gb|AED91693.1| L-gulono-1,4-lactone (L-GulL) oxidase 3 [Arabidopsis thaliana]
Length=585

 Score =   471 bits (1213),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 257/563 (46%), Positives = 360/563 (64%), Gaps = 11/563 (2%)
 Frame = +2

Query  170   IFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPKTEAELLSIIAGAT  349
             I+TV S  P+ PI+C            +YGT+PDR  C AA   YP TE +L   +A A 
Sbjct  19    IWTVQSVPPQPPIRCDQTGCTVSN---AYGTWPDRKTCHAANVTYPTTEEDLRKAVAYAA  75

Query  350   KQKRKMKAATRYSHSIPKLACPEGDDGLLISTKYLNRTLEVNASSMTMTVESGVSLRQVI  529
             +   K+K  T++SH+IPKLACP G D LLIST   N  +E+    +T+T +SGVSLR++I
Sbjct  76    EHNLKVKTVTKFSHTIPKLACPSGSDALLISTSKYNSVIEIEPELLTVTADSGVSLRELI  135

Query  530   EEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGY  709
             E+   AG ++  SPYW G+++GGL+ TGSHGSS  G G SVHDHV+ I +V PA + EG+
Sbjct  136   EKVEGAGFSIGTSPYWEGVSIGGLISTGSHGSSWSGRGGSVHDHVVGISLVVPANQSEGF  195

Query  710   ATIRTLKQGNSD--IKAARVSLGVLGVISQVTFKLQPMFKRSISFVVKNDRDLGKEATKF  883
             A +  L++G  D  + A +VSLGVLGVIS+V   ++  FKRS+++   +D  L     + 
Sbjct  196   AKVVRLEEGRDDTLLNAVKVSLGVLGVISKVKLSIEKAFKRSVTYNFTSDVALEDIFMEH  255

Query  884   GFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFFGLRAVGTDCLNALREKEEHQE  1063
             G ++EF D+ W P  +  VYR D R   N SGNG+ DF G ++        +R  E+  E
Sbjct  256   GKKYEFGDITWYPSRKTAVYRYDIRAPVNVSGNGVNDFLGFQSNPILISKGVRALEKGFE  315

Query  1064  SIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPVIGYQNHMQSSGTCL--DSLND  1237
             S  + + KC+       +    +  GL N G+ F+GYPVIG Q  +Q+SG+CL   S+  
Sbjct  316   SSKNENGKCTTADTTLAYKK-LIGNGLKNSGLIFTGYPVIGRQGKIQTSGSCLYSSSIRI  374

Query  1238  NLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLEPKSLCVLGLYDGILMRYVK  1417
             ++ C WDPR NGLFF++TT    +++ + F+ DV+KL D++P+ LC + +Y+GI +R++K
Sbjct  375   DVACAWDPRYNGLFFYETTAIFPVSRFRDFLLDVKKLRDMKPERLCGIDIYNGIFIRFIK  434

Query  1418  ASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQMAMFKYGALPHWGKNRNVAF  1597
              S AYLG+ EDS+  D  YYR+ D + PRL +D++EE+EQMA  K+GA PHWGKNR V F
Sbjct  435   GSKAYLGQTEDSVVIDFNYYRADDELTPRLNQDVMEEMEQMAFVKHGAKPHWGKNRKVGF  494

Query  1598  QGAIRKY-KSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGLSIVKDGCALEGLCICSQD  1774
              G  +K   +  +FL+VK K DP  +FSSEWSD+IL L T  S   DGCALEG C+CS++
Sbjct  495   FGVKQKIGPNFDKFLEVKNKLDPKKMFSSEWSDEIL-LGTEASKY-DGCALEGNCVCSEE  552

Query  1775  NHCAPNKGYFCRAGKVYKDAKVC  1843
              HC P+KGYFC+ G VY  A+VC
Sbjct  553   RHCNPSKGYFCKEGLVYTQARVC  575



>ref|XP_009396668.1| PREDICTED: L-gulonolactone oxidase [Musa acuminata subsp. malaccensis]
Length=578

 Score =   470 bits (1210),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 246/536 (46%), Positives = 331/536 (62%), Gaps = 12/536 (2%)
 Frame = +2

Query  251   SYGTFPDRGVCRAAKAVYPKTEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPEGDDG  430
             +YG + DR  C     VYP  E  L S +A A +   K K  + +SH+IPKLACP  ++ 
Sbjct  45    AYGAWGDRSECWVRSVVYPTNEEALRSAVAEANRNNLKAKVVSGFSHAIPKLACPPPENS  104

Query  431   LLISTKYLNRTLEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGT  610
             +LIST   N  +EV+ +  T+T +SGV LR +I++   AGL+L  S YW G++VGG++ T
Sbjct  105   VLISTAKYNTRIEVDVAGRTVTADSGVGLRDLIDKVEAAGLSLVASTYWEGVSVGGIIST  164

Query  611   GSHGSSLWGVGSSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVIS  790
             GSHGSS WG G +VHDHV+ + +V PA E EGYA +  L +G+    AA VSLG+LG+IS
Sbjct  165   GSHGSSWWGKGGAVHDHVVSLSMVIPAGESEGYAKVVRLLRGDPLFNAASVSLGLLGIIS  224

Query  791   QVTFKLQPMFKRSISFVVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTN  970
             QVT  L+P FKRSI++   +D            +HEF D+ W P    V +R DDRV +N
Sbjct  225   QVTLSLEPSFKRSITYSFHDDASFQDRLLDVARKHEFPDLTWFPSQHTVAFRFDDRVPSN  284

Query  971   TSGNGLFDFFGLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTN  1150
              SG+G+ DF G +        A+R  E+  +   +   KC       +        GL N
Sbjct  285   ASGDGINDFIGFQPNLMAVCAAIRATEKRYDESRNRRGKCVTA-AAELEYRRLAGNGLKN  343

Query  1151  DGVKFSGYPVIGYQNHMQSSGTCLDSLN-DNL-TCPWDPRVNGLFFHQTTFSISLTKVKS  1324
             +G+ F+GYPV+G Q  MQ+SG+C  S   D+L TCPWDPR  GLFF++TT   S  K   
Sbjct  344   NGI-FTGYPVVGRQGKMQTSGSCQHSPEADSLRTCPWDPRGKGLFFYETTAIFSPPKFMD  402

Query  1325  FIEDVQKLVDLEPKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPR  1504
             FI DV++L DL+P++ C +  Y+G L+R++K S A LG+ EDSI  D  YYR+ DP  PR
Sbjct  403   FIHDVKQLRDLKPENFCGVDNYNGFLIRFIKKSDALLGQPEDSIVLDFNYYRADDPSTPR  462

Query  1505  LYEDILEEIEQMAMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSE  1684
             L +D+ EE+EQMA  K+GA PHW KNR VAF G  RKY     FL  K + DP G+F S 
Sbjct  463   LNQDVWEEVEQMAFMKHGARPHWAKNRRVAFLGVHRKYPGFSNFLAAKNQSDPGGMFQSP  522

Query  1685  WSDQIL---GLKTGLSIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             W D+++   G  TG     +GCALEG CIC++D HC+P+KGY CR G VYK+A+VC
Sbjct  523   WWDEVVSGQGSNTG-----NGCALEGQCICAEDEHCSPSKGYLCRPGLVYKEARVC  573



>ref|XP_003551148.1| PREDICTED: D-arabinono-1,4-lactone oxidase-like [Glycine max]
Length=596

 Score =   468 bits (1203),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 261/581 (45%), Positives = 361/581 (62%), Gaps = 16/581 (3%)
 Frame = +2

Query  134   INILI-TIYVQFLIFTVGSSLPEDPIKctinntmnctitnSYGTFPDRGVCRAAKAVYPK  310
             + ILI T+     + TV   +P+ PI+C+ +         SYG + DR  C A    YP 
Sbjct  9     LGILIHTLQFSCSVRTVHGLIPQSPIQCSSSGCTLRN---SYGAWGDRKDCSALNVTYPT  65

Query  311   TEAELLSIIAGATKQKRKMKAATRYSHSIPKLACPE---------GDDGLLISTKYLNRT  463
             TE +L S ++ A +   K+K  TR+SH+IPKL+CP              LLIST+  +  
Sbjct  66    TEEQLRSAVSYAVRNNLKVKVVTRFSHTIPKLSCPHENNNNNINSSTATLLISTEKYDSR  125

Query  464   LEVNASSMTMTVESGVSLRQVIEEAAKAGLALPYSPYWWGLTVGGLMGTGSHGSSLWGVG  643
             +E++A+ MT TV++GV LRQ+I    +AG +L  +PYW G+TV GL+ TG+HGSS WG G
Sbjct  126   IEIDAARMTATVDAGVGLRQLINAVEEAGFSLVAAPYWEGVTVAGLISTGAHGSSWWGKG  185

Query  644   SSVHDHVIHIRIVTPATEKEGYATIRTLKQGNSDIKAARVSLGVLGVISQVTFKLQPMFK  823
              SVHDHV+ + +V PA++ EGYA I  L+  +  + AA+VSLGVLG IS+V   L+  FK
Sbjct  186   GSVHDHVVGVSVVVPASKSEGYAKILRLEGQDPMLNAAKVSLGVLGAISKVKLSLERRFK  245

Query  824   RSISF-VVKNDRDLGKEATKFGFQHEFADMKWLPrdrhvvyrvddrvSTNTSGNGLFDFF  1000
             RSI++     D  +          +EFAD+ W P    VVYR D RV  N SG+ ++DF 
Sbjct  246   RSITYNFTAEDDHIEDVYVDHAKMYEFADLTWYPSRHTVVYRYDSRVPLNASGDAVYDFI  305

Query  1001  GLRAVGTDCLNALREKEEHQESIGDADEKCSNQWLINVWMVWFLSYGLTNDGVKFSGYPV  1180
             G +A       ++R  E+  ES  +A+ KC       + +   +  GL N+G  F+GYPV
Sbjct  306   GFQANSILVSESVRAAEKLLESTRNANGKCLTA-STTLGLKKLVGNGLKNNGQIFTGYPV  364

Query  1181  IGYQNHMQSSGTCLDSLNDNLTCPWDPRVNGLFFHQTTFSISLTKVKSFIEDVQKLVDLE  1360
             +GYQ  MQ+SG+CL S   +  C WDPR+ GLFF+++T     +K   F  DV+KL DL+
Sbjct  365   VGYQGKMQTSGSCLYSSRFDTACAWDPRIKGLFFYESTAIFPASKFGDFAGDVRKLRDLK  424

Query  1361  PKSLCVLGLYDGILMRYVKASTAYLGKQEDSIDFDITYYRSKDPMVPRLYEDILEEIEQM  1540
             P++ C +  Y+G+L+R++KAS+AYLG+ EDS+  D  YYR  DP  PRL +D+ EE+EQ+
Sbjct  425   PENFCGVDNYNGLLIRFIKASSAYLGQPEDSVVVDFNYYRGNDPSNPRLNQDVWEEVEQL  484

Query  1541  AMFKYGALPHWGKNRNVAFQGAIRKYKSAGEFLKVKKKFDPLGLFSSEWSDQILGLKTGL  1720
             A FK+GA PHW KNRN+AF G  +KY     F+  KK+ DPL +FSSEWSD+IL     L
Sbjct  485   AFFKHGAKPHWAKNRNIAFLGVNQKYPKFNMFIAAKKQMDPLNVFSSEWSDEIL-YGQEL  543

Query  1721  SIVKDGCALEGLCICSQDNHCAPNKGYFCRAGKVYKDAKVC  1843
             S   DGCALEGLCICS+  HC+P KGY+C  G VYK+A+VC
Sbjct  544   SEKVDGCALEGLCICSEHRHCSPQKGYYCSHGLVYKEARVC  584



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6337946833044