BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78495_g1_i1 len=698 path=[676:0-697]

Length=698
                                                                      Score     E

ref|XP_009592276.1|  PREDICTED: protein 108-like                        100   2e-23   
ref|XP_009783380.1|  PREDICTED: protein 108-like                        100   3e-23   
ref|XP_004240793.1|  PREDICTED: stamen-specific protein FIL1-like     99.4    9e-23   
gb|KDP22317.1|  hypothetical protein JCGZ_26148                       95.9    1e-21   
sp|Q38737.1|FIL1_ANTMA  RecName: Full=Stamen-specific protein FIL...  96.3    1e-21   Antirrhinum majus [garden snapdragon]
ref|XP_007152323.1|  hypothetical protein PHAVU_004G120100g           95.1    5e-21   
ref|XP_002510828.1|  MEN-8 protein precursor, putative                94.0    8e-21   Ricinus communis
ref|XP_009609847.1|  PREDICTED: protein 108-like                      93.2    2e-20   
gb|KDO60065.1|  hypothetical protein CISIN_1g037923mg                 93.2    2e-20   
ref|XP_009794896.1|  PREDICTED: protein 108-like                      93.2    2e-20   
ref|XP_006421867.1|  hypothetical protein CICLE_v10006307mg           92.8    3e-20   
ref|XP_006490470.1|  PREDICTED: stamen-specific protein FIL1-like     92.4    3e-20   
ref|XP_009800829.1|  PREDICTED: stamen-specific protein FIL1-like     91.3    1e-19   
ref|XP_007038611.1|  FAR1-related sequence 5 isoform 1                98.2    1e-19   
gb|EYU25068.1|  hypothetical protein MIMGU_mgv1a017004mg              90.5    2e-19   
ref|XP_007038613.1|  FAR1-related sequence 5 isoform 3                97.8    2e-19   
ref|XP_010693481.1|  PREDICTED: protein MEN-8-like                    90.1    3e-19   
ref|XP_004228450.1|  PREDICTED: protein 108                           89.7    4e-19   
ref|XP_008376537.1|  PREDICTED: protein MEN-8-like                    89.7    4e-19   
sp|O24356.1|MEN8_SILLA  RecName: Full=Protein MEN-8; Flags: Precu...  89.4    5e-19   Silene latifolia
ref|XP_009371295.1|  PREDICTED: protein MEN-8-like                    89.4    6e-19   
ref|XP_003533216.1|  PREDICTED: protein 108-like                      88.6    1e-18   
ref|XP_006365769.1|  PREDICTED: protein 108-like                      88.6    1e-18   
ref|XP_010317583.1|  PREDICTED: stamen-specific protein FIL1-like     88.2    1e-18   
ref|XP_010107405.1|  hypothetical protein L484_015746                 91.3    1e-18   
ref|XP_006599627.1|  PREDICTED: stamen-specific protein FIL1-like     87.0    3e-18   
ref|XP_002321889.1|  hypothetical protein POPTR_0015s13570g           86.3    6e-18   Populus trichocarpa [western balsam poplar]
gb|KHM99143.1|  Stamen-specific protein FIL1                          86.7    1e-17   
ref|XP_002318831.1|  Tapetum-specific protein A9 precursor            85.1    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002279400.2|  PREDICTED: stamen-specific protein FIL1          84.0    6e-17   Vitis vinifera
ref|XP_003592302.1|  Tapetum-specific protein A9                      83.6    7e-17   
gb|AEE92794.1|  LTP-like protein                                      83.2    7e-17   
gb|EYU19525.1|  hypothetical protein MIMGU_mgv1a017062mg              82.8    1e-16   
gb|KHN31527.1|  Stamen-specific protein FIL1                          82.8    2e-16   
ref|XP_002510832.1|  MEN-8 protein precursor, putative                82.0    2e-16   Ricinus communis
ref|XP_006401858.1|  hypothetical protein EUTSA_v10015124mg           80.9    5e-16   
ref|NP_200029.1|  bifunctional inhibitor/lipid-transfer protein/s...  80.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011101182.1|  PREDICTED: stamen-specific protein FIL1          80.1    1e-15   
ref|XP_002864156.1|  protease inhibitor/seed storage/lipid transf...  79.7    1e-15   
emb|CDY31917.1|  BnaC09g28270D                                        79.7    2e-15   
ref|XP_008234470.1|  PREDICTED: protein 108-like                      79.7    2e-15   
ref|XP_009106919.1|  PREDICTED: protein 108                           79.3    2e-15   
emb|CDY00514.1|  BnaA10g07590D                                        79.7    2e-15   
ref|XP_007220851.1|  hypothetical protein PRUPE_ppa020886mg           77.8    7e-15   
emb|CDP05237.1|  unnamed protein product                              77.4    1e-14   
emb|CDY32594.1|  BnaC03g15620D                                        76.6    2e-14   
emb|CDY38904.1|  BnaA03g12750D                                        76.6    2e-14   
ref|XP_006281994.1|  hypothetical protein CARUB_v10028221mg           76.6    2e-14   
ref|XP_010933873.1|  PREDICTED: protein LIM1                          75.5    5e-14   
gb|EPS60738.1|  hypothetical protein M569_14064                       75.1    5e-14   
gb|AGW52139.1|  A9                                                    74.7    1e-13   
ref|XP_004496598.1|  PREDICTED: stamen-specific protein FIL1-like     73.9    2e-13   
gb|AII99868.1|  protease inhibitor/seed storage/ltp family            74.3    2e-13   
ref|XP_008439180.1|  PREDICTED: protein MEN-8-like                    73.6    2e-13   
ref|XP_008378198.1|  PREDICTED: protein MEN-8                         73.9    2e-13   
ref|XP_009389821.1|  PREDICTED: protein LIM1-like                     73.6    3e-13   
ref|XP_006399206.1|  hypothetical protein EUTSA_v10015126mg           72.4    6e-13   
ref|XP_004140787.1|  PREDICTED: protein MEN-8-like                    71.6    1e-12   
ref|XP_010038429.1|  PREDICTED: stamen-specific protein FIL1          71.2    2e-12   
gb|KCW46398.1|  hypothetical protein EUGRSUZ_K00231                   70.9    2e-12   
gb|KFK25117.1|  hypothetical protein AALP_AA8G068000                  69.7    3e-12   
gb|KFK27943.1|  hypothetical protein AALP_AA8G451200                  70.1    4e-12   
ref|XP_010263270.1|  PREDICTED: stamen-specific protein FIL1-like     70.1    4e-12   
gb|ABO40456.2|  A9-like protein                                       69.7    4e-12   Sinapis alba [bai jie]
ref|XP_008799573.1|  PREDICTED: protein LIM2                          70.1    7e-12   
ref|XP_006289528.1|  hypothetical protein CARUB_v10003071mg           69.3    7e-12   
gb|ABO40458.2|  A9-like protein                                       68.2    1e-11   Brassica oxyrrhina
gb|ABV68564.1|  A9 protein                                            68.2    1e-11   Brassica napus [oilseed rape]
emb|CDX98995.1|  BnaC09g48400D                                        68.6    1e-11   
ref|XP_010452679.1|  PREDICTED: tapetum-specific protein A9           68.2    2e-11   
gb|ABV68562.1|  A9 protein                                            67.8    2e-11   Brassica oleracea
gb|ABV68560.1|  A9 protein                                            68.2    2e-11   Brassica rapa
gb|ABV68563.1|  A9 protein                                            68.2    2e-11   Brassica napus [oilseed rape]
ref|XP_009122360.1|  PREDICTED: tapetum-specific protein A9           68.2    2e-11   
gb|ABO40455.2|  A9-like protein                                       68.2    2e-11   Eruca vesicaria subsp. sativa [arugula]
gb|ABV68561.1|  A9 protein                                            68.2    2e-11   Brassica nigra
gb|ABV68565.1|  A9 protein                                            67.8    2e-11   Brassica juncea [brown mustard]
gb|ABO40457.2|  A9-like protein                                       67.8    2e-11   Sinapis arvensis [charlock mustard]
gb|AAO85389.1|  tapetum-specific protein BcA9                         68.2    2e-11   Brassica rapa
ref|XP_002871258.1|  protease inhibitor/seed storage/lipid transf...  67.8    3e-11   
gb|ABO40454.2|  A9-like protein                                       67.0    4e-11   Brassica tournefortii
ref|XP_010483942.1|  PREDICTED: tapetum-specific protein A9-like      65.5    2e-10   
ref|XP_006857882.1|  hypothetical protein AMTR_s00069p00110230        65.5    2e-10   
emb|CAA43889.1|  A9                                                   63.9    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66993.1|  A9                                                    63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196340.1|  Tapetum-specific protein A9                         63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
sp|Q40190.1|M7_LILHE  RecName: Full=Protein M7; AltName: Full=LhM...  63.2    9e-10   Lilium henryi
dbj|BAA04833.1|  ORF                                                  63.2    1e-09   Lilium longiflorum [Easter lily]
sp|Q40227.2|LIM3_LILLO  RecName: Full=Protein LIM3; Flags: Precursor  63.2    1e-09   Lilium longiflorum [Easter lily]
sp|Q43533.1|LIM1_LILLO  RecName: Full=Protein LIM1; Flags: Precursor  62.8    1e-09   Lilium longiflorum [Easter lily]
ref|XP_006394437.1|  hypothetical protein EUTSA_v10005193mg           62.8    1e-09   
gb|ABM68544.1|  unknown                                               62.8    1e-09   Lilium longiflorum [Easter lily]
ref|NP_568949.1|  protease inhibitor/seed storage/lipid transfer ...  62.8    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63848.1|  A9 protein precursor-like                             62.4    2e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q43534.2|LIM2_LILLO  RecName: Full=Protein LIM2; Flags: Precursor  61.6    3e-09   Lilium longiflorum [Easter lily]
dbj|BAA04832.1|  ORF                                                  62.0    3e-09   Lilium longiflorum [Easter lily]
dbj|BAB10170.1|  tapetum-specific protein A9-like protein             61.6    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866469.1|  hypothetical protein ARALYDRAFT_496383           61.2    5e-09   
ref|XP_006281768.1|  hypothetical protein CARUB_v10027932mg           61.2    5e-09   
ref|XP_010444077.1|  PREDICTED: tapetum-specific protein A9-like      60.8    6e-09   
ref|XP_006363333.1|  PREDICTED: stamen-specific protein FIL1-like     58.5    4e-08   
ref|XP_010940880.1|  PREDICTED: inactive rhomboid protein 1-like ...  57.4    2e-06   
ref|NP_001063720.1|  Os09g0525500                                     54.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940883.1|  PREDICTED: rhomboid-like protease 2 isoform X3   57.0    2e-06   
gb|EAZ09812.1|  hypothetical protein OsI_32100                        54.3    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009383170.1|  PREDICTED: inactive rhomboid protein 1-like      56.6    3e-06   
ref|XP_009393459.1|  PREDICTED: inactive rhomboid protein 1-like      56.2    5e-06   
ref|XP_009387684.1|  PREDICTED: protein LIM1-like                     53.5    8e-06   
ref|XP_009768672.1|  PREDICTED: inactive rhomboid protein 1-like ...  55.1    1e-05   
ref|XP_002445754.1|  hypothetical protein SORBIDRAFT_07g025160        52.4    1e-05   Sorghum bicolor [broomcorn]
ref|XP_009768671.1|  PREDICTED: inactive rhomboid protein 1-like ...  54.7    2e-05   
gb|AIY60764.1|  rhomboid protein Cabca_RBL1                           54.7    2e-05   
ref|XP_009418321.1|  PREDICTED: inactive rhomboid protein 1-like      54.7    2e-05   
ref|XP_003576753.2|  PREDICTED: protein YY1-like                      52.0    2e-05   
ref|XP_008812937.1|  PREDICTED: rhomboid-like protease 2              54.7    2e-05   
ref|XP_004234368.1|  PREDICTED: rhomboid-like protease 3              54.3    2e-05   
ref|XP_009384531.1|  PREDICTED: inactive rhomboid protein 1-like      54.3    3e-05   
ref|XP_006353343.1|  PREDICTED: inactive rhomboid protein 1-like      53.9    3e-05   
ref|XP_010107410.1|  Inactive rhomboid protein 1                      53.9    3e-05   
gb|AAG31822.1|  fil1B                                                 50.1    3e-05   Antirrhinum graniticum
gb|AIY60706.1|  rhomboid protein Lonja32412                           53.9    3e-05   
ref|XP_009608217.1|  PREDICTED: inactive rhomboid protein 1-like ...  53.5    4e-05   
gb|AIY60728.1|  rhomboid protein Yucsm9573                            52.8    4e-05   
ref|XP_009608216.1|  PREDICTED: inactive rhomboid protein 1-like ...  53.1    5e-05   
dbj|BAK05897.1|  predicted protein                                    50.4    5e-05   
ref|NP_001106005.1|  LTP-like protein precursor                       50.1    8e-05   Zea mays [maize]
ref|XP_003548211.1|  PREDICTED: inactive rhomboid protein 1-like ...  52.8    8e-05   
gb|KHN31525.1|  Inactive rhomboid protein 1                           52.8    8e-05   
gb|AIY60718.1|  rhomboid protein Dioop2183                            52.8    8e-05   
gb|AIY60672.1|  rhomboid protein Illhe_RBL1                           52.8    9e-05   
gb|AES62549.2|  inactive rhomboid-like protein                        52.4    1e-04   
emb|CDP21663.1|  unnamed protein product                              50.4    1e-04   
ref|XP_002509727.1|  conserved hypothetical protein                   52.4    1e-04   Ricinus communis
ref|XP_003592298.1|  Rhomboid family member                           52.4    1e-04   
ref|XP_004974078.1|  PREDICTED: anther-specific protein MZm3-3-like   49.7    1e-04   
gb|KDP22313.1|  hypothetical protein JCGZ_26144                       52.4    1e-04   
gb|AIY60774.1|  rhomboid protein Pintu32689                           52.0    1e-04   
gb|AIY60773.1|  rhomboid protein Pintu13861                           52.0    1e-04   
ref|XP_007038618.1|  RHOMBOID-like 2                                  52.0    1e-04   
gb|EAZ16718.1|  hypothetical protein OsJ_32194                        51.6    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011030083.1|  PREDICTED: inactive rhomboid protein 1-like      52.0    1e-04   
ref|XP_002462700.1|  hypothetical protein SORBIDRAFT_02g030450        51.6    2e-04   Sorghum bicolor [broomcorn]
gb|ACG33279.1|  membrane protein                                      51.2    2e-04   Zea mays [maize]
gb|ACF85618.1|  unknown                                               51.6    2e-04   Zea mays [maize]
ref|XP_002321905.2|  rhomboid family protein                          51.6    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010262519.1|  PREDICTED: rhomboid-like protease 2              51.6    2e-04   
ref|XP_011048686.1|  PREDICTED: inactive rhomboid protein 1-like      51.6    2e-04   
ref|XP_002318821.2|  hypothetical protein POPTR_0012s13370g           51.6    2e-04   Populus trichocarpa [western balsam poplar]
gb|AAA02747.1|  membrane protein                                      51.6    2e-04   Saccharum hybrid cultivar H65-7052
gb|ACF84585.1|  unknown                                               48.9    2e-04   Zea mays [maize]
gb|ABG66197.1|  Rhomboid family protein, expressed                    50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008679489.1|  PREDICTED: uncharacterized rhomboid protein ...  51.6    2e-04   
ref|NP_001063723.1|  Os09g0525900                                     51.6    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001158983.1|  YY1 protein precursor                            48.9    2e-04   Zea mays [maize]
ref|NP_001142335.1|  membrane protein                                 51.6    2e-04   Zea mays [maize]
ref|NP_001148543.1|  YY1 protein precursor                            48.9    2e-04   Zea mays [maize]
gb|AIY60689.1|  rhomboid protein Panut5866                            51.2    2e-04   
gb|EAY79245.1|  hypothetical protein OsI_34361                        51.6    2e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001167670.1|  YY1 protein precursor                            48.9    2e-04   Zea mays [maize]
gb|AAM92298.1|  putative membrane protein                             51.2    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AIY60690.1|  rhomboid protein Panut5887                            51.6    2e-04   
ref|NP_001065094.1|  Os10g0521900                                     51.2    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006846227.1|  hypothetical protein AMTR_s00012p00233600        50.8    2e-04   
ref|XP_003578474.1|  PREDICTED: uncharacterized rhomboid protein ...  51.2    2e-04   
ref|XP_004957411.1|  PREDICTED: uncharacterized rhomboid protein ...  51.2    2e-04   
gb|AIY60757.1|  rhomboid protein Alipl5646                            51.2    2e-04   
tpg|DAA45983.1|  TPA: hypothetical protein ZEAMMB73_979905            50.1    3e-04   
gb|ABG73460.1|  membrane protein                                      51.2    3e-04   Oryza brachyantha
emb|CDP09796.1|  unnamed protein product                              51.2    3e-04   
dbj|BAJ89286.1|  predicted protein                                    51.2    3e-04   
ref|XP_008679486.1|  PREDICTED: uncharacterized rhomboid protein ...  50.8    3e-04   
ref|XP_008679487.1|  PREDICTED: uncharacterized rhomboid protein ...  50.4    3e-04   
ref|XP_009421337.1|  PREDICTED: inactive rhomboid protein 1-like      51.2    3e-04   
ref|XP_007152326.1|  hypothetical protein PHAVU_004G120400g           50.8    3e-04   
gb|AIY60699.1|  rhomboid protein Aspof43958                           50.8    3e-04   
ref|XP_008785581.1|  PREDICTED: inactive rhomboid protein 1-like      50.8    3e-04   
gb|KHG07733.1|  Rhomboid-like protease 3                              50.8    3e-04   
gb|AHL43433.1|  rhomboid Ae                                           50.8    3e-04   
ref|XP_006659655.1|  PREDICTED: inactive rhomboid protein 1-like      50.8    3e-04   
gb|AGE14563.1|  rhomboid                                              50.8    3e-04   
ref|NP_001062422.1|  Os08g0546700                                     50.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011029207.1|  PREDICTED: uncharacterized rhomboid protein ...  50.8    4e-04   
gb|KHN37236.1|  Inactive rhomboid protein 1                           50.8    4e-04   
ref|XP_006601825.1|  PREDICTED: uncharacterized protein LOC100805...  50.4    4e-04   
ref|XP_002298056.1|  rhomboid family protein                          50.8    4e-04   Populus trichocarpa [western balsam poplar]
ref|NP_001242000.1|  uncharacterized protein LOC100784671             50.8    4e-04   
gb|AIY60754.1|  rhomboid protein Alipl6488                            50.8    4e-04   
gb|AHL43434.1|  rhomboid                                              50.8    4e-04   
ref|XP_008784595.1|  PREDICTED: inactive rhomboid protein 1-like      50.8    4e-04   
gb|KHM99144.1|  Inactive rhomboid protein 1                           50.8    4e-04   
gb|AHL43436.1|  rhomboid                                              50.8    4e-04   
ref|XP_002444633.1|  hypothetical protein SORBIDRAFT_07g025140        50.4    4e-04   Sorghum bicolor [broomcorn]
ref|NP_001105123.1|  anther-specific protein MZm3-3 precursor         48.1    4e-04   Zea mays [maize]
ref|XP_002304474.2|  rhomboid family protein                          50.4    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006288091.1|  hypothetical protein CARUB_v10001321mg           50.4    4e-04   
ref|XP_011033788.1|  PREDICTED: uncharacterized rhomboid protein ...  50.4    4e-04   
ref|XP_007218337.1|  hypothetical protein PRUPE_ppa008564mg           50.4    4e-04   
ref|XP_004515720.1|  PREDICTED: inactive rhomboid protein 1-like      50.4    5e-04   
emb|CAN71797.1|  hypothetical protein VITISV_026278                   50.8    5e-04   Vitis vinifera
ref|XP_008799836.1|  PREDICTED: inactive rhomboid protein 1-like ...  50.1    5e-04   
gb|AIY60700.1|  rhomboid protein Aspof9819                            50.4    5e-04   
ref|XP_004496594.1|  PREDICTED: inactive rhomboid protein 1-like ...  50.4    5e-04   
gb|AIY60772.1|  rhomboid protein Pintu40369                           50.4    5e-04   
ref|XP_004496595.1|  PREDICTED: inactive rhomboid protein 1-like ...  50.1    5e-04   
gb|AIY60755.1|  rhomboid protein Alipl2962                            50.1    5e-04   
ref|XP_008799828.1|  PREDICTED: inactive rhomboid protein 1-like ...  50.4    5e-04   
ref|XP_010491329.1|  PREDICTED: inactive rhomboid protein 1-like      50.1    5e-04   
gb|AIY60736.1|  rhomboid protein Lacsa18033                           50.1    5e-04   
ref|XP_010533712.1|  PREDICTED: inactive rhomboid protein 1-like      50.1    6e-04   
gb|KDO51157.1|  hypothetical protein CISIN_1g035016mg                 47.4    6e-04   
gb|EMT31293.1|  Rhomboid family member 1                              50.1    6e-04   
dbj|BAJ99834.1|  predicted protein                                    50.1    6e-04   
ref|XP_011076211.1|  PREDICTED: inactive rhomboid protein 1           50.1    6e-04   
ref|NP_001132594.1|  uncharacterized protein LOC100194066             49.7    6e-04   Zea mays [maize]
tpg|DAA45981.1|  TPA: hypothetical protein ZEAMMB73_979905            49.7    6e-04   
ref|XP_002467632.1|  hypothetical protein SORBIDRAFT_01g031210        50.1    6e-04   Sorghum bicolor [broomcorn]
ref|XP_006440556.1|  hypothetical protein CICLE_v10021119mg           50.1    7e-04   
ref|XP_007133989.1|  hypothetical protein PHAVU_010G009600g           50.1    7e-04   
gb|ACG45740.1|  membrane protein                                      50.1    7e-04   Zea mays [maize]
ref|XP_008659873.1|  PREDICTED: uncharacterized protein LOC100194...  50.1    7e-04   
ref|XP_007040140.1|  RHOMBOID-like 2                                  50.1    7e-04   
ref|XP_010919249.1|  PREDICTED: inactive rhomboid protein 1           50.1    7e-04   
ref|XP_006477415.1|  PREDICTED: inactive rhomboid protein 1-like      50.1    7e-04   
gb|ACF78235.1|  unknown                                               50.1    7e-04   Zea mays [maize]
gb|KFK40531.1|  hypothetical protein AALP_AA2G007800                  47.4    7e-04   
gb|AIY60781.1|  rhomboid protein Lilbr16267                           49.7    8e-04   
ref|XP_010922306.1|  PREDICTED: inactive rhomboid protein 1-like      49.7    8e-04   
ref|XP_002283259.1|  PREDICTED: inactive rhomboid protein 1           49.7    8e-04   Vitis vinifera
gb|EEE52579.1|  hypothetical protein OsJ_34868                        50.1    8e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AIY60717.1|  rhomboid protein Dioop15627                           49.7    8e-04   
ref|XP_003520922.1|  PREDICTED: inactive rhomboid protein 1-like      49.7    8e-04   
gb|KHN06912.1|  Inactive rhomboid protein 1                           49.7    8e-04   
ref|XP_004974112.1|  PREDICTED: inactive rhomboid protein 1-like      49.7    9e-04   
ref|XP_002510823.1|  KOM, putative                                    49.7    9e-04   Ricinus communis
gb|KDO63543.1|  hypothetical protein CISIN_1g045959mg                 49.3    0.001   
ref|XP_003580349.1|  PREDICTED: inactive rhomboid protein 1           49.7    0.001   
gb|AIY60725.1|  rhomboid protein Yucsm15031                           49.7    0.001   
ref|XP_006661971.1|  PREDICTED: inactive rhomboid protein 1-like      48.5    0.001   



>ref|XP_009592276.1| PREDICTED: protein 108-like [Nicotiana tomentosiformis]
Length=93

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            TC+ SL NLNVCAPFV+PG     PSADCCS +QS+DH+C+CNTLR++AR+PAQCN+P +
Sbjct  29   TCSVSLNNLNVCAPFVVPGTTNPTPSADCCSALQSVDHECLCNTLRISARLPAQCNLPPL  88

Query  390  SCSAN  404
            SC+AN
Sbjct  89   SCAAN  93



>ref|XP_009783380.1| PREDICTED: protein 108-like [Nicotiana sylvestris]
Length=93

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            TC+ SL NLNVCAPFV+PG     PSADCCS +QS+DH+C+CNTLR++AR+PAQCN+P +
Sbjct  29   TCSVSLNNLNVCAPFVVPGTTNPTPSADCCSALQSVDHECLCNTLRISARLPAQCNLPPL  88

Query  390  SCSAN  404
            SC+AN
Sbjct  89   SCAAN  93



>ref|XP_004240793.1| PREDICTED: stamen-specific protein FIL1-like [Solanum lycopersicum]
Length=99

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  ANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQ  371
            +  Q  TC ASLGNLNVC+PFV+PG   T P+ +CC+ +QS+DH+CICNT+RVAAR+P+ 
Sbjct  28   SQGQPQTCLASLGNLNVCSPFVLPGTSNTTPTTECCAALQSLDHECICNTVRVAARLPSH  87

Query  372  CNIPSISCSAN  404
            CN+P ISC+ +
Sbjct  88   CNLPPISCTRH  98



>gb|KDP22317.1| hypothetical protein JCGZ_26148 [Jatropha curcas]
Length=94

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  183  LQAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARI  362
            +Q+  + + +C A L NLNVCA +V+PG+  T PSA+CC+ +QS+ HDC+CNTLRV AR+
Sbjct  20   MQSQQAHSQSCPAQLNNLNVCAQYVVPGSTNTNPSAECCNALQSVQHDCLCNTLRVTARL  79

Query  363  PAQCNIPSISCSAN  404
            P+QCN+P +SC+AN
Sbjct  80   PSQCNLPPLSCAAN  93



>sp|Q38737.1|FIL1_ANTMA RecName: Full=Stamen-specific protein FIL1; Flags: Precursor 
[Antirrhinum majus]
 emb|CAA40553.1| FIL1 [Antirrhinum majus]
Length=99

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +3

Query  195  NSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQC  374
             S+  TC+ASL NLN CAPFV+ GA TT PS+DCC+ +QS+DH+C+CNTLR+A+R+PAQC
Sbjct  25   QSEAQTCSASLANLNACAPFVVLGAATT-PSSDCCTALQSVDHECLCNTLRIASRVPAQC  83

Query  375  NIPSISCSAN  404
            N+P +SC   
Sbjct  84   NLPPLSCGGK  93



>ref|XP_007152323.1| hypothetical protein PHAVU_004G120100g [Phaseolus vulgaris]
 gb|ESW24317.1| hypothetical protein PHAVU_004G120100g [Phaseolus vulgaris]
Length=107

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  180  FLQAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAAR  359
            F   A +Q+  CT  L NLNVCAPFV+PGA  T PSA CC+ +Q+MDHDC+CNTLR+A++
Sbjct  24   FSLMARAQSSACTNQLSNLNVCAPFVLPGASNTKPSATCCNALQAMDHDCLCNTLRIASQ  83

Query  360  IPAQCNIPSISC  395
            +P+QC I S++C
Sbjct  84   LPSQCQIQSLAC  95



>ref|XP_002510828.1| MEN-8 protein precursor, putative [Ricinus communis]
 gb|EEF51430.1| MEN-8 protein precursor, putative [Ricinus communis]
Length=93

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q   +Q+ TC + L +LNVCAPFV+PGA  T P+A+CCS +QS++HDC+CNTLR+AAR+P
Sbjct  21   QTQEAQSQTCPSQLNSLNVCAPFVVPGATNTNPNAECCSALQSVEHDCLCNTLRIAARLP  80

Query  366  AQCNIPSISCS  398
            +QCN+  ++C 
Sbjct  81   SQCNLAPVNCG  91



>ref|XP_009609847.1| PREDICTED: protein 108-like [Nicotiana tomentosiformis]
Length=94

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 59/68 (87%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q  TC+ASLGNLNVCAPFV+PGA     SA+CC+ ++S+D+DC+CNT+R++AR+P+QCN+
Sbjct  29   QGQTCSASLGNLNVCAPFVVPGAPNA--SAECCAALRSIDNDCMCNTMRISARLPSQCNL  86

Query  381  PSISCSAN  404
            P +SC+AN
Sbjct  87   PPLSCAAN  94



>gb|KDO60065.1| hypothetical protein CISIN_1g037923mg [Citrus sinensis]
Length=97

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q   + + +CT+ L NLN CAP+V+PG  TT PS+DCC+ +QS+D DC CNT+R+AAR+P
Sbjct  26   QTQMTHSQSCTSELTNLNSCAPYVVPGVATTTPSSDCCAALQSVDRDCFCNTVRIAARLP  85

Query  366  AQCNIPSISCS  398
            +QCN+P +SC+
Sbjct  86   SQCNLPPLSCT  96



>ref|XP_009794896.1| PREDICTED: protein 108-like [Nicotiana sylvestris]
Length=95

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 59/68 (87%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q  TC+ASLGNLNVCAPFV+PGA     SA+CC+ ++S+D+DC+CNT+R++AR+P+QCN+
Sbjct  30   QGQTCSASLGNLNVCAPFVVPGAPNA--SAECCAALRSIDNDCMCNTMRISARLPSQCNL  87

Query  381  PSISCSAN  404
            P +SC+AN
Sbjct  88   PPLSCAAN  95



>ref|XP_006421867.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
 ref|XP_006421868.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
 gb|ESR35107.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
 gb|ESR35108.1| hypothetical protein CICLE_v10006307mg [Citrus clementina]
Length=97

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q  N+Q+  CT+ L NLN CAP+V+PG  TT PS+DCC+ +QS+D DC CNT+R+AAR+P
Sbjct  28   QMTNAQS--CTSELTNLNSCAPYVVPGVATTTPSSDCCAALQSVDRDCFCNTVRIAARLP  85

Query  366  AQCNIPSISCS  398
            +QCN+P +SC+
Sbjct  86   SQCNLPPLSCT  96



>ref|XP_006490470.1| PREDICTED: stamen-specific protein FIL1-like [Citrus sinensis]
Length=97

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q   +   +CT+ L NLN CAP+V+PG  TT PS+DCC+ +QS+D DC CNT+R+AAR+P
Sbjct  26   QTQMTHAQSCTSELTNLNSCAPYVVPGVATTTPSSDCCAALQSVDRDCFCNTVRIAARLP  85

Query  366  AQCNIPSISCS  398
            +QCN+P +SC+
Sbjct  86   SQCNLPPLSCT  96



>ref|XP_009800829.1| PREDICTED: stamen-specific protein FIL1-like [Nicotiana sylvestris]
Length=105

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAAR--  359
            Q   SQ  TC+ASL NLNVCAPFVMPG    +PSAD C+ ++S+DHDCICNTLRVAAR  
Sbjct  24   QVIESQGQTCSASLWNLNVCAPFVMPGTSNPSPSADYCAALKSLDHDCICNTLRVAARPS  83

Query  360  IPAQCNIPSI  389
            +P Q  +PS+
Sbjct  84   LPVQPFLPSL  93



>ref|XP_007038611.1| FAR1-related sequence 5 isoform 1 [Theobroma cacao]
 gb|EOY23112.1| FAR1-related sequence 5 isoform 1 [Theobroma cacao]
Length=1025

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q+  ++  +C   L  LNVCAPFV+PG     PS+DCC+ +QS+ HDC+CNTLR+A+R+P
Sbjct  28   QSQTAKAQSCPNELNRLNVCAPFVVPGVPEATPSSDCCAALQSVQHDCLCNTLRIASRLP  87

Query  366  AQCNIPSISC  395
            ++CNIP++SC
Sbjct  88   SRCNIPALSC  97



>gb|EYU25068.1| hypothetical protein MIMGU_mgv1a017004mg [Erythranthe guttata]
Length=97

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = +3

Query  177  QFLQAANSQTDT-CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVA  353
            Q +    +Q+ T C A+LGNLNVCAPF++PG  T  P ++CC+ + ++D DC+CNTLR+A
Sbjct  23   QVITKTEAQSSTNCAATLGNLNVCAPFLIPGGAT--PGSECCTALSTVDRDCLCNTLRIA  80

Query  354  ARIPAQCNIPSISCSAN  404
            +RIP QCN+P ++CS N
Sbjct  81   SRIPVQCNLPPLTCSGN  97



>ref|XP_007038613.1| FAR1-related sequence 5 isoform 3 [Theobroma cacao]
 gb|EOY23114.1| FAR1-related sequence 5 isoform 3 [Theobroma cacao]
Length=981

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q+  ++  +C   L  LNVCAPFV+PG     PS+DCC+ +QS+ HDC+CNTLR+A+R+P
Sbjct  28   QSQTAKAQSCPNELNRLNVCAPFVVPGVPEATPSSDCCAALQSVQHDCLCNTLRIASRLP  87

Query  366  AQCNIPSISC  395
            ++CNIP++SC
Sbjct  88   SRCNIPALSC  97



>ref|XP_010693481.1| PREDICTED: protein MEN-8-like [Beta vulgaris subsp. vulgaris]
Length=100

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
            +TC   LGNLNVCAP+V+PG   T PS+DCC  +Q+++H+C+CNTLRVA+R+P+ CN+P 
Sbjct  36   NTCPTQLGNLNVCAPYVVPGTANTIPSSDCCGALQAVEHECLCNTLRVASRLPSSCNLPP  95

Query  387  ISCS  398
            ++C 
Sbjct  96   LNCG  99



>ref|XP_004228450.1| PREDICTED: protein 108 [Solanum lycopersicum]
 sp|Q43495.1|108_SOLLC RecName: Full=Protein 108; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78466.1| 108 protein [Solanum lycopersicum]
Length=102

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             +CTASL  LNVCAPF++PG+ T   S +CC+ VQS++HDC+CNT+R+AA+IPAQCN+P 
Sbjct  39   QSCTASLTGLNVCAPFLVPGSPTA--STECCNAVQSINHDCMCNTMRIAAQIPAQCNLPP  96

Query  387  ISCSAN  404
            +SCSAN
Sbjct  97   LSCSAN  102



>ref|XP_008376537.1| PREDICTED: protein MEN-8-like [Malus domestica]
Length=105

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A++Q  +C+A L +LNVCAPFV+PG+  T PS+DCCS +Q++  +CICN +RVAAR+P
Sbjct  33   QKADAQGGSCSAELSSLNVCAPFVVPGSTNTNPSSDCCSALQAVHPECICNAVRVAARLP  92

Query  366  AQCNIPSISCSAN  404
            AQCN+  ++C  N
Sbjct  93   AQCNLSPLTCDTN  105



>sp|O24356.1|MEN8_SILLA RecName: Full=Protein MEN-8; Flags: Precursor [Silene latifolia]
 emb|CAA70033.1| Men-8 [Silene latifolia]
Length=100

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  183  LQAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARI  362
            L+ + +Q   C + LGNLNVCAP+V+PGAV T PS +CC+ +  ++HDC+CNTLRVA+++
Sbjct  28   LKGSEAQAGGCASQLGNLNVCAPYVVPGAVNTNPSQECCAALSGVNHDCMCNTLRVASQL  87

Query  363  PAQCNIPSISCS  398
            P+ CN+ +++C 
Sbjct  88   PSSCNLAALNCG  99



>ref|XP_009371295.1| PREDICTED: protein MEN-8-like [Pyrus x bretschneideri]
Length=105

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A++Q  +C+A L +LNVCAPFV+PG+  T PS+DCCS +Q++  +CICN +RVAAR+P
Sbjct  33   QKADAQGSSCSAELSSLNVCAPFVVPGSTNTNPSSDCCSALQAVHPECICNAVRVAARLP  92

Query  366  AQCNIPSISCSAN  404
            AQCN+  ++C  N
Sbjct  93   AQCNLSPLTCDIN  105



>ref|XP_003533216.1| PREDICTED: protein 108-like [Glycine max]
Length=95

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A +Q+ TCT  L  LNVCAPFV+PG V T PS+ CC+ +Q++D DC+C+T+R+A+++P
Sbjct  24   QIAMAQSSTCTTQLSELNVCAPFVVPG-VNTNPSSRCCNALQAVDRDCLCSTIRIASQLP  82

Query  366  AQCNIPSISCSAN  404
            +QC IPS+ CSAN
Sbjct  83   SQCQIPSLGCSAN  95



>ref|XP_006365769.1| PREDICTED: protein 108-like [Solanum tuberosum]
Length=97

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             +CTASL  LNVCAPF++PG+ +   S +CC+ VQS++HDC+CNT+R+AA+IPAQCN+P 
Sbjct  34   QSCTASLTGLNVCAPFLVPGSPSA--STECCNAVQSINHDCMCNTMRIAAQIPAQCNLPP  91

Query  387  ISCSAN  404
            +SCSAN
Sbjct  92   LSCSAN  97



>ref|XP_010317583.1| PREDICTED: stamen-specific protein FIL1-like [Solanum lycopersicum]
Length=91

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  198  SQTDTCTASLGNLNVCAPFVMPGAVTTA-PSADCCSVVQSMDHDCICNTLRVAARIPAQC  374
             Q  TC+ASL NLN+CAPFV+PG +T   PS DCCS +Q +D +CICNTLR+ A +P+QC
Sbjct  25   EQITTCSASLNNLNICAPFVVPGTITNPNPSFDCCSALQLVDRECICNTLRIIAHLPSQC  84

Query  375  NIPSISC  395
            N+P +SC
Sbjct  85   NLPPLSC  91



>ref|XP_010107405.1| hypothetical protein L484_015746 [Morus notabilis]
 gb|EXC15943.1| hypothetical protein L484_015746 [Morus notabilis]
Length=231

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            CT+ L NLN CAPFV+PGA    PSA CC+ +Q++DHDC+CNTLR+A+R+P+ CNIP +S
Sbjct  37   CTSRLNNLNSCAPFVVPGAANPQPSAQCCAALQAVDHDCVCNTLRIASRLPSLCNIPPLS  96

Query  393  CSAN  404
            C   
Sbjct  97   CGVK  100



>ref|XP_006599627.1| PREDICTED: stamen-specific protein FIL1-like [Glycine max]
Length=93

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A +Q+ TC++ L +LNVCAPFV+PG V T P+A CC+ +Q++D DC+CNT+R+A+++ 
Sbjct  22   QMAMTQSSTCSSQLSDLNVCAPFVVPG-VNTNPNATCCNALQAVDRDCLCNTIRIASQLA  80

Query  366  AQCNIPSISCSAN  404
            +QC IPS+SC AN
Sbjct  81   SQCQIPSLSCGAN  93



>ref|XP_002321889.1| hypothetical protein POPTR_0015s13570g [Populus trichocarpa]
 gb|EEF06016.1| hypothetical protein POPTR_0015s13570g [Populus trichocarpa]
Length=94

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A+SQ   CT+ L NLNVCAPFV+PGA  T P+A+CC+ ++++ HDC+C+TL++++R+P
Sbjct  25   QLAHSQQ--CTSQLNNLNVCAPFVVPGAANTNPNAECCNALEAVQHDCLCSTLQISSRLP  82

Query  366  AQCNIPSISC  395
            +QCN+P ++C
Sbjct  83   SQCNLPPLTC  92



>gb|KHM99143.1| Stamen-specific protein FIL1 [Glycine soja]
Length=135

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A +Q+ TCT  L  LNVCAPFV+PG V T PS+ CC+ +Q++D DC+C+T+R+A+++P
Sbjct  24   QIAMAQSSTCTTQLSELNVCAPFVVPG-VNTNPSSRCCNALQAVDRDCLCSTIRIASQLP  82

Query  366  AQCNIPSISCS  398
            +QC IPS+ CS
Sbjct  83   SQCQIPSLGCS  93



>ref|XP_002318831.1| Tapetum-specific protein A9 precursor [Populus trichocarpa]
 gb|EEE97051.1| Tapetum-specific protein A9 precursor [Populus trichocarpa]
Length=94

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A+SQ   CT+ L +LNVCAPFV+PGA  T PS DCC+ + ++ HDC+C+TL++AAR+P
Sbjct  25   QLAHSQI--CTSQLNSLNVCAPFVVPGAPNTNPSTDCCNALGAVQHDCLCSTLQIAARLP  82

Query  366  AQCNIPSISCS  398
            +QCN+P I+C 
Sbjct  83   SQCNLPPITCG  93



>ref|XP_002279400.2| PREDICTED: stamen-specific protein FIL1 [Vitis vinifera]
Length=100

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A SQ   C+  L NL+VCAPFV+PGA  + PSADCC+ +Q++D  C+C+TLR+A+R+P
Sbjct  27   QMAWSQPSACSTQLNNLSVCAPFVVPGAPDSTPSADCCTALQTIDDACMCSTLRIASRLP  86

Query  366  AQCNIPSISCSAN  404
            + CN+  ++C  N
Sbjct  87   SHCNLTPVTCDVN  99



>ref|XP_003592302.1| Tapetum-specific protein A9 [Medicago truncatula]
 gb|AES62553.1| Lipid transfer protein (LIM1/2/3/MEN-8) [Medicago truncatula]
Length=97

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  183  LQAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARI  362
            ++   +QT TC   L NLNVCAPFV+PG+  T PS DCC+ +QS + DC+CNTLR+A+++
Sbjct  25   MEMGEAQT-TCPTQLSNLNVCAPFVVPGSPNTNPSPDCCTALQSTNPDCLCNTLRIASQL  83

Query  363  PAQCNIPSISCSAN  404
             +QCN+PS  C  N
Sbjct  84   TSQCNLPSFGCVLN  97



>gb|AEE92794.1| LTP-like protein [Capsicum annuum]
Length=94

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 55/68 (81%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C  SL +LNVCAPFV+PGA +   SA+CC+ +QS++H C+C+T+R+AA+IPAQCN+
Sbjct  29   QPQICNPSLTSLNVCAPFVVPGAPSA--SAECCTALQSINHGCMCDTMRIAAQIPAQCNL  86

Query  381  PSISCSAN  404
            P +SC+AN
Sbjct  87   PPLSCAAN  94



>gb|EYU19525.1| hypothetical protein MIMGU_mgv1a017062mg [Erythranthe guttata]
Length=95

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             TC ++L +LNVCA FV+PG     PS DCC  +Q+++HDC+C+TLR+A+RIP QCN+P 
Sbjct  31   STCASTLASLNVCAQFVVPGGGAATPSPDCCGALQAVNHDCLCSTLRIASRIPTQCNLPP  90

Query  387  ISCS  398
            ++C+
Sbjct  91   LTCA  94



>gb|KHN31527.1| Stamen-specific protein FIL1 [Glycine soja]
Length=112

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A +Q+ TC++ L +LNVCAPFV+PG V T P+A CC+ +Q++D DC+CNT+R+A+++ 
Sbjct  22   QMAMTQSSTCSSQLSDLNVCAPFVVPG-VNTNPNATCCNALQAVDRDCLCNTIRIASQLA  80

Query  366  AQCNIPSISC  395
            +QC IPS+ C
Sbjct  81   SQCQIPSLGC  90



>ref|XP_002510832.1| MEN-8 protein precursor, putative [Ricinus communis]
 gb|EEF51434.1| MEN-8 protein precursor, putative [Ricinus communis]
Length=97

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
             + TC   L +LNVCAPFV+PGA  T+P+A+CC+ ++S+ +DCICNTLR+A R+P+ CN+
Sbjct  31   HSQTCQNQLNSLNVCAPFVVPGAANTSPNAECCNALESVQNDCICNTLRIAGRLPSLCNL  90

Query  381  PSISCS  398
              I+C 
Sbjct  91   SPINCG  96



>ref|XP_006401858.1| hypothetical protein EUTSA_v10015124mg [Eutrema salsugineum]
 gb|ESQ43311.1| hypothetical protein EUTSA_v10015124mg [Eutrema salsugineum]
Length=96

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   LG LNVC  FV+PGA  T PSA+CC+ ++++  +C+CNTLR+A+R+P +CNIP++
Sbjct  34   SCNVHLGGLNVCGEFVVPGADKTNPSAECCNALEAVPSECLCNTLRIASRLPTRCNIPTL  93

Query  390  SCS  398
            SCS
Sbjct  94   SCS  96



>ref|NP_200029.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAA97459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM65986.1| unknown [Arabidopsis thaliana]
 gb|ABD57481.1| At5g52160 [Arabidopsis thaliana]
 gb|ABE66243.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis thaliana]
 gb|AED96178.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=96

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C A L  LNVC  FV+PGA  T PSA+CC+ ++++ ++C+CNT R+A+R+P++CNIP++
Sbjct  34   SCNAQLSTLNVCGEFVVPGADRTNPSAECCNALEAVPNECLCNTFRIASRLPSRCNIPTL  93

Query  390  SCS  398
            SCS
Sbjct  94   SCS  96



>ref|XP_011101182.1| PREDICTED: stamen-specific protein FIL1 [Sesamum indicum]
Length=96

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +3

Query  183  LQAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSA-DCCSVVQSMDHDCICNTLRVAAR  359
            L  A  Q  TC++SL +LNVCAPF +PG+ ++   + +CC  +Q++DHDC+C+TLR+A++
Sbjct  22   LITAQFQAQTCSSSLSSLNVCAPFAVPGSSSSTTPSPECCGALQAIDHDCMCSTLRIASQ  81

Query  360  IPAQCNIPSISCSAN  404
            IP QCN+P ++C  N
Sbjct  82   IPTQCNLPPLNCGGN  96



>ref|XP_002864156.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40415.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C A L  LNVC  FV+PGA  T PSA+CC+ ++++ ++C+CNT R+A+R+P++CNIP++
Sbjct  33   SCNAQLSGLNVCGEFVVPGADRTNPSAECCNALEAVPNECLCNTFRIASRLPSRCNIPTL  92

Query  390  SCS  398
            SCS
Sbjct  93   SCS  95



>emb|CDY31917.1| BnaC09g28270D [Brassica napus]
Length=95

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L  LNVC  FV+PGA TT PSA+CC+ ++++  DCICNT R+A+R+P +CNIP++
Sbjct  33   SCNTHLSGLNVCGEFVVPGADTTNPSAECCNALEAVPSDCICNTFRIASRLPTRCNIPTL  92

Query  390  SCS  398
            SC+
Sbjct  93   SCN  95



>ref|XP_008234470.1| PREDICTED: protein 108-like [Prunus mume]
Length=101

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  234  LNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSISCS  398
            LNVCAPFV+PG+  T PS+DCC  +Q++  DC+CNTLRVAAR+PAQCN+  I+C 
Sbjct  47   LNVCAPFVVPGSTNTNPSSDCCGALQAVHPDCLCNTLRVAARLPAQCNLSPITCG  101



>ref|XP_009106919.1| PREDICTED: protein 108 [Brassica rapa]
Length=95

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L  LNVC  FV+PGA TT PSA+CC+ ++++  DCICNT R+A+R+P +CNIP++
Sbjct  33   SCNTHLSGLNVCGEFVVPGADTTNPSAECCNALEAVPSDCICNTFRIASRLPTRCNIPTL  92

Query  390  SCS  398
            SC+
Sbjct  93   SCN  95



>emb|CDY00514.1| BnaA10g07590D [Brassica napus]
Length=112

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L  LNVC  FV+PGA TT PSA+CC+ ++++  DCICNT R+A+R+P +CNIP++
Sbjct  50   SCNTHLSGLNVCGEFVVPGADTTNPSAECCNALEAVPSDCICNTFRIASRLPTRCNIPTL  109

Query  390  SCS  398
            SC+
Sbjct  110  SCN  112



>ref|XP_007220851.1| hypothetical protein PRUPE_ppa020886mg [Prunus persica]
 gb|EMJ22050.1| hypothetical protein PRUPE_ppa020886mg [Prunus persica]
Length=101

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  234  LNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSISCS  398
            LNVCAPFV+PG+  T PS+DCC  +Q++  DC+CNTLRVAAR+P QCN+  I+C 
Sbjct  47   LNVCAPFVVPGSTNTNPSSDCCGALQAVHPDCLCNTLRVAARLPTQCNLSPITCG  101



>emb|CDP05237.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGA--VTTAPSADCCSVVQSMDHDCICNTLRVAAR  359
                SQ  +C  +L NLNVC PF++PG+      PSA+CC+ VQ++  DCICNTL++A+R
Sbjct  30   HVVKSQEPSCPTTLANLNVCVPFLVPGSGPADNPPSAECCNAVQAVKEDCICNTLQIASR  89

Query  360  IPAQCNIPSISC  395
            +P +CN+P ++C
Sbjct  90   LPTRCNLPVLNC  101



>emb|CDY32594.1| BnaC03g15620D [Brassica napus]
Length=98

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L  LNVC  FV+PGA  T PSA+CCS ++++  +C+CNT+R+A+R+P +C+IP++
Sbjct  36   SCNRHLSGLNVCGEFVVPGADKTNPSAECCSALEAVPSECLCNTMRIASRLPTRCSIPTL  95

Query  390  SCS  398
            SCS
Sbjct  96   SCS  98



>emb|CDY38904.1| BnaA03g12750D [Brassica napus]
Length=97

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L  LNVC  FV+PGA  T PSA+CCS ++++  +C+CNT+R+A+R+P +C+IP++
Sbjct  35   SCNRHLSGLNVCGEFVVPGADKTNPSAECCSALEAVPSECLCNTMRIASRLPTRCSIPTL  94

Query  390  SCS  398
            SCS
Sbjct  95   SCS  97



>ref|XP_006281994.1| hypothetical protein CARUB_v10028221mg [Capsella rubella]
 gb|EOA14892.1| hypothetical protein CARUB_v10028221mg [Capsella rubella]
Length=96

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             +C   L  LNVC  FV+PGA +  PSA+CC+ ++++ ++C+CNT R+A+R+P++CNIP+
Sbjct  33   QSCNTQLSGLNVCGEFVVPGADSRNPSAECCNALEAVPNECLCNTFRIASRLPSRCNIPT  92

Query  387  ISCS  398
            +SCS
Sbjct  93   LSCS  96



>ref|XP_010933873.1| PREDICTED: protein LIM1 [Elaeis guineensis]
Length=102

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q+  +Q   C+A+LG L  CAPFV+PG     PS  CC+ +Q +DH C+CNT+ + +R+P
Sbjct  31   QSPVAQPQNCSAALGRLTTCAPFVIPGTGQGPPSDQCCAALQGVDHTCLCNTINIISRLP  90

Query  366  AQCNIPSISCSA  401
            + C +P ++C+A
Sbjct  91   SSCKLPPVTCNA  102



>gb|EPS60738.1| hypothetical protein M569_14064, partial [Genlisea aurea]
Length=78

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +3

Query  222  SLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSISCS  398
            SL ++N CA FV+PGA    PSADCC+ +Q +DH+CIC+TLR+A++IP+ CN+P+I+C 
Sbjct  21   SLASVNACAAFVLPGA--GEPSADCCAALQGVDHECICSTLRIASQIPSLCNLPAITCG  77



>gb|AGW52139.1| A9 [Populus tomentosa]
Length=97

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q A+SQ   CT+   +LNVC PFV+PGA  T PS D C+ + ++ HDC+C+TL++AAR+P
Sbjct  25   QLAHSQK--CTSQHNSLNVCGPFVVPGAPNTNPSTDRCNPLCAVQHDCLCSTLQIAARLP  82

Query  366  AQCNIPSISCS  398
            +QC +P I+C 
Sbjct  83   SQCKLPPITCG  93



>ref|XP_004496598.1| PREDICTED: stamen-specific protein FIL1-like [Cicer arietinum]
Length=97

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L NLNVCAPFV+PG     PSADCCS +++ + DC+CNTLR+A+++ +QC +PS 
Sbjct  33   SCPVQLSNLNVCAPFVVPG-TNADPSADCCSALKATNRDCLCNTLRIASQLTSQCQLPSF  91

Query  390  SC  395
             C
Sbjct  92   GC  93



>gb|AII99868.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=108

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  210  TCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSI  389
            +C   L NLNVCAPFV+PG     PSADCCS +++ + DC+CNTLR+A+++ +QC +PS 
Sbjct  33   SCPVQLSNLNVCAPFVVPG-TNADPSADCCSALKATNRDCLCNTLRIASQLTSQCQLPSF  91

Query  390  SC  395
             C
Sbjct  92   GC  93



>ref|XP_008439180.1| PREDICTED: protein MEN-8-like [Cucumis melo]
Length=93

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +3

Query  180  FLQAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAAR  359
             L  A +Q   C+  L NLN CAPFV+PGA    PS +CC  + ++  DC+C+TLR+A+ 
Sbjct  21   MLVQAQAQPQGCSTQLSNLNSCAPFVLPGAPN--PSPECCGALGAVQQDCLCSTLRIAST  78

Query  360  IPAQCNIPSISCSAN  404
            +P+ C++P++SC +N
Sbjct  79   LPSLCHLPTLSCGSN  93



>ref|XP_008378198.1| PREDICTED: protein MEN-8 [Malus domestica]
Length=105

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  234  LNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSISCSAN  404
            LNVCAPFV+PG+  T P++DCC  +Q++  +C+CN  RVAAR+PAQCN+  I+C  N
Sbjct  49   LNVCAPFVVPGSTNTNPNSDCCGALQAVHPECLCNAARVAARLPAQCNLSPITCDTN  105



>ref|XP_009389821.1| PREDICTED: protein LIM1-like [Musa acuminata subsp. malaccensis]
Length=112

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             TC+A+LG L  CA FV+PG VT  P   CC+ +  +DH C+C+TL + AR+ A+CN+P 
Sbjct  42   QTCSANLGQLAACARFVVPGQVTGPPGEQCCASLGRVDHGCLCDTLSIIARLSARCNLPW  101

Query  387  ISCS  398
            I+CS
Sbjct  102  ITCS  105



>ref|XP_006399206.1| hypothetical protein EUTSA_v10015126mg [Eutrema salsugineum]
 gb|ESQ40659.1| hypothetical protein EUTSA_v10015126mg [Eutrema salsugineum]
Length=96

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C  SL N+ VCAP V+PGAV  AP+++CC+ +QS + DC+CN LR A  + + CN+
Sbjct  28   QAQECRDSLTNMQVCAPLVLPGAVNPAPNSNCCTALQSTNKDCLCNALRAATTLTSLCNL  87

Query  381  PSISCS  398
            PS  C 
Sbjct  88   PSFDCG  93



>ref|XP_004140787.1| PREDICTED: protein MEN-8-like [Cucumis sativus]
 ref|XP_004157201.1| PREDICTED: protein MEN-8-like [Cucumis sativus]
 gb|KGN57351.1| hypothetical protein Csa_3G180390 [Cucumis sativus]
Length=93

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C+  L NLN CAPFV+PGA  T PS +CC  + ++  DC+C+TLR+A+ +P+ C +P++S
Sbjct  32   CSTQLSNLNSCAPFVLPGA--TNPSPECCGALGAVQQDCLCSTLRIASTLPSLCQLPTLS  89

Query  393  CSAN  404
            C +N
Sbjct  90   CGSN  93



>ref|XP_010038429.1| PREDICTED: stamen-specific protein FIL1 [Eucalyptus grandis]
Length=96

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             +C   + +LNVCAPFV+PG  +  PS+ CC  +Q++DHDC+C+TL VA  +P+ C++P 
Sbjct  30   QSCPTQMASLNVCAPFVVPG-TSRGPSSQCCGALQAVDHDCLCSTLSVANSLPSACHLPP  88

Query  387  ISCSAN  404
            ISC  +
Sbjct  89   ISCGTS  94



>gb|KCW46398.1| hypothetical protein EUGRSUZ_K00231 [Eucalyptus grandis]
Length=92

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
             +C   + +LNVCAPFV+PG  +  PS+ CC  +Q++DHDC+C+TL VA  +P+ C++P 
Sbjct  30   QSCPTQMASLNVCAPFVVPG-TSRGPSSQCCGALQAVDHDCLCSTLSVANSLPSACHLPP  88

Query  387  ISC  395
            ISC
Sbjct  89   ISC  91



>gb|KFK25117.1| hypothetical protein AALP_AA8G068000 [Arabis alpina]
Length=83

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            +   C   L N+ VCAP V+PGAV  +P+++CC+ +Q+ + DC+CN LR A  + +QCN+
Sbjct  15   RAQVCNDQLSNVQVCAPLVLPGAVNPSPNSNCCTALQATNKDCLCNALRAATTLASQCNL  74

Query  381  PSISCS  398
            PS  C 
Sbjct  75   PSFDCG  80



>gb|KFK27943.1| hypothetical protein AALP_AA8G451200 [Arabis alpina]
Length=94

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG+ T  PS+DCC+ +QS + DC+CN LR A  +P+ CN+
Sbjct  28   QAQECGNDLANVQVCAAMVLPGSGT--PSSDCCAALQSTNKDCLCNALRAATSLPSLCNL  85

Query  381  PSISCSAN  404
            P+ISC  N
Sbjct  86   PAISCDIN  93



>ref|XP_010263270.1| PREDICTED: stamen-specific protein FIL1-like [Nelumbo nucifera]
Length=97

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q   +++  C   L NL  CAPFV+PG V+T P+A+CC+ +  +D  C+C+TL++ AR+P
Sbjct  26   QTQMARSQNCANELTNLTACAPFVLPG-VSTQPNAECCNALHGVDQTCLCSTLQIVARMP  84

Query  366  AQCNIPSISC  395
             QC +P ++C
Sbjct  85   TQCRLPPMAC  94



>gb|ABO40456.2| A9-like protein [Sinapis alba]
Length=92

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            +   C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A    A CN+
Sbjct  28   RAQECLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTATCNL  87

Query  381  PSISC  395
            PS+ C
Sbjct  88   PSLDC  92



>ref|XP_008799573.1| PREDICTED: protein LIM2 [Phoenix dactylifera]
Length=138

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            Q+  +++  C+A L  L  CAP+V+PG    +P   CC+ ++ +DH C+CNTL + +R+P
Sbjct  57   QSQVAESQNCSAGLAQLTSCAPYVLPGTNQGSPDDQCCAALRGLDHTCLCNTLNIISRLP  116

Query  366  AQCNIPSISCS  398
            + C +P ++CS
Sbjct  117  SSCKLPPVTCS  127



>ref|XP_006289528.1| hypothetical protein CARUB_v10003071mg [Capsella rubella]
 gb|EOA22426.1| hypothetical protein CARUB_v10003071mg [Capsella rubella]
Length=91

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            +   C   L N+ VCAP ++PGAV  AP++ CCS +Q+ D DC+CN LR A  + + CN+
Sbjct  23   RAQQCRDKLSNVQVCAPLLLPGAVNPAPNSRCCSALQATDKDCLCNALRAATTLTSLCNL  82

Query  381  PSISC  395
            PS  C
Sbjct  83   PSFDC  87



>gb|ABO40458.2| A9-like protein [Brassica oxyrrhina]
Length=71

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  11   CLENLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  70

Query  393  C  395
            C
Sbjct  71   C  71



>gb|ABV68564.1| A9 protein [Brassica napus]
Length=77

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            ++  C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+
Sbjct  13   RSQQCLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNL  72

Query  381  PSISC  395
            PS+ C
Sbjct  73   PSLDC  77



>emb|CDX98995.1| BnaC09g48400D [Brassica napus]
Length=96

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            ++  C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+
Sbjct  28   RSQQCLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNL  87

Query  381  PSISCS  398
            PS+ C 
Sbjct  88   PSLDCG  93



>ref|XP_010452679.1| PREDICTED: tapetum-specific protein A9 [Camelina sativa]
Length=91

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            +   C   L N+ VCAP ++PGAV+ AP+++CC+ +Q+ + DCICN LR A  + + CN+
Sbjct  23   RAQQCRDELSNVQVCAPLLLPGAVSPAPNSNCCAALQATNKDCICNALRAATTLTSLCNL  82

Query  381  PSISCS  398
            PS  C 
Sbjct  83   PSFDCG  88



>gb|ABV68562.1| A9 protein [Brassica oleracea]
 gb|ABV68568.1| A9 protein [Brassica carinata]
Length=76

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            ++  C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+
Sbjct  9    RSQQCLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNL  68

Query  381  PSISCS  398
            PS+ C 
Sbjct  69   PSLDCG  74



>gb|ABV68560.1| A9 protein [Brassica rapa]
Length=92

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  C  395
            C
Sbjct  92   C  92



>gb|ABV68563.1| A9 protein [Brassica napus]
Length=95

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  CS  398
            C 
Sbjct  92   CG  93



>ref|XP_009122360.1| PREDICTED: tapetum-specific protein A9 [Brassica rapa]
 sp|Q05772.1|A9_BRANA RecName: Full=Tapetum-specific protein A9; Flags: Precursor [Brassica 
napus]
 emb|CAA43890.1| A9 [Brassica napus]
 emb|CDX70018.1| BnaA10g23670D [Brassica napus]
Length=96

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  CS  398
            C 
Sbjct  92   CG  93



>gb|ABO40455.2| A9-like protein [Eruca vesicaria subsp. sativa]
Length=92

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTSCNLPSLD  91

Query  393  C  395
            C
Sbjct  92   C  92



>gb|ABV68561.1| A9 protein [Brassica nigra]
 gb|ABV68567.1| A9 protein [Brassica carinata]
Length=92

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  C  395
            C
Sbjct  92   C  92



>gb|ABV68565.1| A9 protein [Brassica juncea]
Length=80

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  17   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  76

Query  393  CS  398
            C 
Sbjct  77   CG  78



>gb|ABO40457.2| A9-like protein [Sinapis arvensis]
Length=92

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  C  395
            C
Sbjct  92   C  92



>gb|AAO85389.1| tapetum-specific protein BcA9 [Brassica rapa subsp. oleifera]
Length=103

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L N+ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  CS  398
            C 
Sbjct  92   CG  93



>ref|XP_002871258.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47517.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=91

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C   L N+ VCAP ++PGAV  AP+++CC+ +QS + DC+CN LR A  + + CN+PS  
Sbjct  27   CRDELSNVQVCAPLLLPGAVNPAPNSNCCAALQSTNKDCLCNALRAATTLTSLCNLPSFD  86

Query  393  CS  398
            C 
Sbjct  87   CG  88



>gb|ABO40454.2| A9-like protein [Brassica tournefortii]
Length=92

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C  +L ++ VCAP V+PGAV  AP+++CC  +Q+ + DCICN LR A      CN+PS+ 
Sbjct  32   CLENLSDMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLD  91

Query  393  C  395
            C
Sbjct  92   C  92



>ref|XP_010483942.1| PREDICTED: tapetum-specific protein A9-like [Camelina sativa]
Length=91

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   LGN+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR A  +PA CN+
Sbjct  25   QAQECGNDLGNVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPALCNL  82

Query  381  PSISCS  398
            P + C 
Sbjct  83   PPVDCG  88



>ref|XP_006857882.1| hypothetical protein AMTR_s00069p00110230 [Amborella trichopoda]
 gb|ERN19349.1| hypothetical protein AMTR_s00069p00110230 [Amborella trichopoda]
Length=105

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
            +TC+  L  LN CA F++PGA   AP+ +CC  +Q ++  C+C TLR+ +R+P+ CN+  
Sbjct  19   NTCSNQLSGLNQCARFLVPGASQVAPNQECCLALQGVEQRCLCETLRIVSRLPSACNLVP  78

Query  387  ISCS  398
            ++C 
Sbjct  79   LNCG  82



>emb|CAA43889.1| A9 [Arabidopsis thaliana]
Length=107

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C   L N+ VCAP ++PGAV  A +++CC+ +Q+ + DC+CN LR A  + + CN+PS  
Sbjct  27   CRDELSNVQVCAPLLLPGAVNPAANSNCCAALQATNKDCLCNRLRAATTLTSLCNLPSFD  86

Query  393  CS  398
            C 
Sbjct  87   CG  88



>gb|AAM66993.1| A9 [Arabidopsis thaliana]
Length=91

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C   L N+ VCAP ++PGAV  A +++CC+ +Q+ + DC+CN LR A  + + CN+PS  
Sbjct  27   CRDELSNVQVCAPLLLPGAVNPAANSNCCAALQATNKDCLCNALRAATTLTSLCNLPSFD  86

Query  393  CS  398
            C 
Sbjct  87   CG  88



>ref|NP_196340.1| Tapetum-specific protein A9 [Arabidopsis thaliana]
 sp|Q00762.2|A9_ARATH RecName: Full=Tapetum-specific protein A9; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB87279.1| A9 [Arabidopsis thaliana]
 dbj|BAD43757.1| A9 [Arabidopsis thaliana]
 gb|ABD57463.1| At5g07230 [Arabidopsis thaliana]
 gb|AED91125.1| Tapetum-specific protein A9 [Arabidopsis thaliana]
Length=91

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C   L N+ VCAP ++PGAV  A +++CC+ +Q+ + DC+CN LR A  + + CN+PS  
Sbjct  27   CRDELSNVQVCAPLLLPGAVNPAANSNCCAALQATNKDCLCNALRAATTLTSLCNLPSFD  86

Query  393  CS  398
            C 
Sbjct  87   CG  88



>sp|Q40190.1|M7_LILHE RecName: Full=Protein M7; AltName: Full=LhM7; Flags: Precursor 
[Lilium henryi]
 emb|CAA56724.1| M7 [Lilium henryi]
Length=89

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +3

Query  204  TDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIP  383
            +  C+A++G L  C P+V+PG+   APS  CCS +++++H C+C T+ + + +P  C++P
Sbjct  25   SQNCSAAIGELMTCGPYVLPGS-NGAPSEQCCSALKAVNHGCLCETINIISSLPDHCSLP  83

Query  384  SISCSA  401
            +++C+A
Sbjct  84   AVNCAA  89



>dbj|BAA04833.1| ORF [Lilium longiflorum]
Length=95

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
              C+A++G L  C P+V+PG   T PS  CCS +Q+++H C+C T+ + + +P  C++P 
Sbjct  31   QNCSAAIGGLMSCGPYVLPGNQLT-PSTQCCSAIQAVNHGCLCETINIISSLPGHCSLPP  89

Query  387  ISCS  398
            +SC 
Sbjct  90   VSCG  93



>sp|Q40227.2|LIM3_LILLO RecName: Full=Protein LIM3; Flags: Precursor [Lilium longiflorum]
Length=90

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPS  386
              C+A++G L  C P+V+PG   T PS  CCS +Q+++H C+C T+ + + +P  C++P 
Sbjct  26   QNCSAAIGGLMSCGPYVLPGNQLT-PSTQCCSAIQAVNHGCLCETINIISSLPGHCSLPP  84

Query  387  ISCS  398
            +SC 
Sbjct  85   VSCG  88



>sp|Q43533.1|LIM1_LILLO RecName: Full=Protein LIM1; Flags: Precursor [Lilium longiflorum]
 dbj|BAA04831.1| ORF [Lilium longiflorum]
Length=90

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  195  NSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQC  374
              ++  C+A++G L  C P+V+PG    APS  CCS +++++H C+C T+ + + +P  C
Sbjct  23   EGRSQNCSAAIGELMTCGPYVLPGN-NGAPSEQCCSALRAVNHGCLCETINIISSLPDHC  81

Query  375  NIPSISCSA  401
            ++P+++C+A
Sbjct  82   SLPAVNCAA  90



>ref|XP_006394437.1| hypothetical protein EUTSA_v10005193mg [Eutrema salsugineum]
 gb|ESQ31723.1| hypothetical protein EUTSA_v10005193mg [Eutrema salsugineum]
Length=94

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            +   C   L N+ VCA  V+PG  + +PS++CC  +QS + DC+CN LR A  +P+ CN+
Sbjct  28   RAQECGNDLANVQVCAAMVLPG--SGSPSSECCVALQSTNKDCLCNALRAATSLPSLCNL  85

Query  381  PSISCSAN  404
            P ++C  N
Sbjct  86   PPVNCGVN  93



>gb|ABM68544.1| unknown [Lilium longiflorum]
Length=94

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +3

Query  192  ANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQ  371
            A SQ + C A +GNL  C P+V+PGA   +PS +CCS +  +   C C  + + + +PA+
Sbjct  26   ALSQDEECLAGIGNLISCDPYVIPGANQGSPSKECCSALGGVKQSCYCTAIDIISNLPAR  85

Query  372  CNIPSISCS  398
            C++P+++C+
Sbjct  86   CSLPAVNCA  94



>ref|NP_568949.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 dbj|BAC42516.1| putative A9 protein precursor [Arabidopsis thaliana]
 gb|AED97559.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=95

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR A  +P+ CN+
Sbjct  29   QAQECGNDLANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNL  86

Query  381  PSISCSAN  404
            P + C  N
Sbjct  87   PPVDCGIN  94



>gb|AAM63848.1| A9 protein precursor-like [Arabidopsis thaliana]
Length=95

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR A  +P+ CN+
Sbjct  29   QAQECGNDLSNVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNL  86

Query  381  PSISCSAN  404
            P + C  N
Sbjct  87   PPVDCGIN  94



>sp|Q43534.2|LIM2_LILLO RecName: Full=Protein LIM2; Flags: Precursor [Lilium longiflorum]
Length=90

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +3

Query  198  SQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             ++  C+A++G L  C P+V+PG    APS  CCS +++++H C+C T+ + + +P  C+
Sbjct  24   GRSQNCSAAIGELMTCGPYVLPGN-NGAPSEQCCSALRAVNHGCLCETINIISSLPDHCS  82

Query  378  IPSISCSA  401
            +P+++C++
Sbjct  83   LPAVNCAS  90



>dbj|BAA04832.1| ORF [Lilium longiflorum]
Length=95

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +3

Query  198  SQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             ++  C+A++G L  C P+V+PG    APS  CCS +++++H C+C T+ + + +P  C+
Sbjct  29   GRSQNCSAAIGELMTCGPYVLPGN-NGAPSEQCCSALRAVNHGCLCETINIISSLPDHCS  87

Query  378  IPSISCSA  401
            +P+++C++
Sbjct  88   LPAVNCAS  95



>dbj|BAB10170.1| tapetum-specific protein A9-like protein [Arabidopsis thaliana]
Length=99

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR A  +P+ CN+
Sbjct  26   QAQECGNDLANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNL  83

Query  381  PSISCSAN  404
            P + C  +
Sbjct  84   PPVDCGTD  91



>ref|XP_002866469.1| hypothetical protein ARALYDRAFT_496383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42728.1| hypothetical protein ARALYDRAFT_496383 [Arabidopsis lyrata subsp. 
lyrata]
Length=95

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR A  +P+ CN+
Sbjct  26   QAQECGNDLANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNL  83

Query  381  PSISCSAN  404
            P + C  +
Sbjct  84   PPVDCGTD  91



>ref|XP_006281768.1| hypothetical protein CARUB_v10027932mg [Capsella rubella]
 gb|EOA14666.1| hypothetical protein CARUB_v10027932mg [Capsella rubella]
Length=94

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR A  +P+ CN+
Sbjct  28   QAQECGNDLANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAATSLPSLCNL  85

Query  381  PSISCS  398
            P + C 
Sbjct  86   PPVDCG  91



>ref|XP_010444077.1| PREDICTED: tapetum-specific protein A9-like [Camelina sativa]
Length=91

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            Q   C   L N+ VCA  V+PG  +  P+++CC+ +QS + DC+CN LR    +PA CN+
Sbjct  25   QAQECGNDLANVQVCAAMVLPG--SGRPNSECCAALQSTNRDCLCNALRAVTSLPALCNL  82

Query  381  PSISCS  398
            P + C 
Sbjct  83   PPVDCG  88



>ref|XP_006363333.1| PREDICTED: stamen-specific protein FIL1-like [Solanum tuberosum]
Length=70

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  PGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSISCSAN  404
            P      PS +CC+ +QS+DH+CICNT+RVA R+P+ CN+  +SC+ +
Sbjct  22   PKTSNMTPSTECCAALQSLDHECICNTVRVATRLPSNCNLSPVSCARH  69



>ref|XP_010940880.1| PREDICTED: inactive rhomboid protein 1-like isoform X1 [Elaeis 
guineensis]
Length=344

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYLNC+P+SKW+C
Sbjct  316  LFRGVNGYDHCHWCHYLNCVPTSKWSC  342



>ref|NP_001063720.1| Os09g0525500 [Oryza sativa Japonica Group]
 sp|O23810.1|YY1_ORYSJ RecName: Full=Protein YY1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA23617.1| YY1 protein [Oryza sativa]
 dbj|BAD46493.1| YY1 protein precursor [Oryza sativa Japonica Group]
 dbj|BAD46349.1| YY1 protein precursor [Oryza sativa Japonica Group]
 dbj|BAF25634.1| Os09g0525500 [Oryza sativa Japonica Group]
 dbj|BAG98204.1| unnamed protein product [Oryza sativa Japonica Group]
Length=95

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = +3

Query  183  LQAANSQTDTCTASLGNLNVCAPFVM---PGAVTTAPSADCCSVVQSMDHDCICNTLRVA  353
            ++ A +Q  +C A L  L  CA   +   PG    AP A+CCS + ++ HDC C TL + 
Sbjct  21   MRGAEAQQPSCAAQLTQLAPCARVGVAPAPGQPLPAPPAECCSALGAVSHDCACGTLDII  80

Query  354  ARIPAQCNIPSISC  395
              +PA+C +P ++C
Sbjct  81   NSLPAKCGLPRVTC  94



>ref|XP_010940883.1| PREDICTED: rhomboid-like protease 2 isoform X3 [Elaeis guineensis]
Length=297

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYLNC+P+SKW+C
Sbjct  269  LFRGVNGYDHCHWCHYLNCVPTSKWSC  295



>gb|EAZ09812.1| hypothetical protein OsI_32100 [Oryza sativa Indica Group]
Length=95

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = +3

Query  183  LQAANSQTDTCTASLGNLNVCAPFVM---PGAVTTAPSADCCSVVQSMDHDCICNTLRVA  353
            ++ A +Q  +C A L  L  CA   +   PG    AP A+CCS + ++ HDC C TL + 
Sbjct  21   MRGAEAQQPSCAAQLTQLAPCARVGVAPAPGQPLPAPPAECCSALGAVSHDCACGTLDII  80

Query  354  ARIPAQCNIPSISC  395
              +PA+C +P ++C
Sbjct  81   NSLPAKCGLPRVTC  94



>ref|XP_009383170.1| PREDICTED: inactive rhomboid protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=321

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVNG+DHCHWCHYLNC+P+S+W+C 
Sbjct  293  LFRGVNGNDHCHWCHYLNCVPTSRWSCE  320



>ref|XP_009393459.1| PREDICTED: inactive rhomboid protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=321

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G+NG+DHCHWCHYLNC+PSS+W+C
Sbjct  293  LFRGLNGNDHCHWCHYLNCVPSSRWSC  319



>ref|XP_009387684.1| PREDICTED: protein LIM1-like, partial [Musa acuminata subsp. 
malaccensis]
Length=140

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  213  CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNIPSIS  392
            C+A+L  L  CA + +PG+   APS +CC+ ++ +D  C+C+TL + +R+PA C +  ++
Sbjct  76   CSAALVGLATCASYAVPGS-HGAPSDECCTAMKGVDRVCLCDTLNIISRMPAACKLSPVT  134

Query  393  CS  398
            CS
Sbjct  135  CS  136



>ref|XP_009768672.1| PREDICTED: inactive rhomboid protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=287

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYL+C+P+SKW C
Sbjct  258  LFRGVNGYDHCHWCHYLSCVPTSKWKC  284



>ref|XP_002445754.1| hypothetical protein SORBIDRAFT_07g025160 [Sorghum bicolor]
 gb|EES15249.1| hypothetical protein SORBIDRAFT_07g025160 [Sorghum bicolor]
Length=103

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +3

Query  192  ANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQ  371
            A      C   L  L  C  +++PGA    PSADCCS + ++ H+C C+T+ +   +P +
Sbjct  36   AQGGGGLCLPQLNGLLACRAYLVPGAPD--PSADCCSALSAVSHECACSTMGIINSLPGR  93

Query  372  CNIPSISCSA  401
            CN+  ++CSA
Sbjct  94   CNLAQVNCSA  103



>ref|XP_009768671.1| PREDICTED: inactive rhomboid protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=320

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYL+C+P+SKW C
Sbjct  291  LFRGVNGYDHCHWCHYLSCVPTSKWKC  317



>gb|AIY60764.1| rhomboid protein Cabca_RBL1, partial [Cabomba caroliniana]
Length=371

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN  604
            +F+GVNG+DHC WCHY++C+P+S+W+C  EN
Sbjct  297  VFLGVNGNDHCSWCHYMSCVPTSRWSCKSEN  327



>ref|XP_009418321.1| PREDICTED: inactive rhomboid protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=322

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVNG+DHCHWC YLNC+P+S+W+C 
Sbjct  294  LFRGVNGNDHCHWCRYLNCVPTSRWSCE  321



>ref|XP_003576753.2| PREDICTED: protein YY1-like [Brachypodium distachyon]
Length=110

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +3

Query  189  AANSQTDTCTASLGNLNVCAPF---VMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAAR  359
            A  S   +C A L  L  CA +    MPG    AP  +CCS + S+  DC C  + +   
Sbjct  38   AQPSPNPSCGAQLSQLGPCARYSVPPMPGQALPAPGPECCSALGSVSRDCACGAIDIINS  97

Query  360  IPAQCNIPSISC  395
            +PA+C +P ISC
Sbjct  98   LPAKCGLPRISC  109



>ref|XP_008812937.1| PREDICTED: rhomboid-like protease 2 [Phoenix dactylifera]
Length=331

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHCHWCHYLNC+P+SKW+C
Sbjct  303  LFKGVNKNDHCHWCHYLNCVPTSKWSC  329



>ref|XP_004234368.1| PREDICTED: rhomboid-like protease 3 [Solanum lycopersicum]
Length=318

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYL+C+P+S+W C
Sbjct  289  LFRGVNGYDHCHWCHYLSCVPTSRWKC  315



>ref|XP_009384531.1| PREDICTED: inactive rhomboid protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=336

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYL+C+P+S+W C
Sbjct  308  LFRGVNGNDHCHWCHYLSCVPTSRWNC  334



>ref|XP_006353343.1| PREDICTED: inactive rhomboid protein 1-like [Solanum tuberosum]
Length=318

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHYL+C+P+S+W C
Sbjct  289  LFRGVNGYDHCHWCHYLSCVPTSRWKC  315



>ref|XP_010107410.1| Inactive rhomboid protein 1 [Morus notabilis]
 gb|EXC15948.1| Inactive rhomboid protein 1 [Morus notabilis]
Length=328

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWCHYLNC+P+SKW C
Sbjct  301  LFRGENGNDHCHWCHYLNCVPTSKWDC  327



>gb|AAG31822.1| fil1B [Antirrhinum graniticum]
 gb|AAG38185.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38186.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38187.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38188.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38189.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38190.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38191.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38192.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38193.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38194.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38195.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38196.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38197.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38198.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38199.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38200.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38201.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38202.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38203.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38204.1| fil1A1 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38205.1| fil1A1 [Antirrhinum majus subsp. linkianum]
 gb|AAG38206.1| fil1A1 [Antirrhinum majus subsp. linkianum]
 gb|AAG38207.1| fil1A1 [Antirrhinum majus subsp. linkianum]
 gb|AAG38208.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38209.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38210.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38211.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38212.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38213.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38214.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38215.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38216.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38217.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38218.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38219.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38220.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38221.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38222.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38223.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38224.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38225.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38226.1| fil1A2 [Antirrhinum majus subsp. linkianum]
 gb|AAG38227.1| fil1A2 [Antirrhinum majus subsp. linkianum]
 gb|AAG38228.1| fil1A2 [Antirrhinum majus subsp. linkianum]
 gb|AAG38229.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38230.1| fil1A2 [Antirrhinum majus subsp. cirrhigerum]
 gb|AAG38231.1| fil1B [Digitalis purpurea]
 gb|AAG38232.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38233.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38234.1| fil1B [Antirrhinum graniticum]
 gb|AAG38235.1| fil1B [Antirrhinum graniticum]
 gb|AAG38236.1| fil1B [Antirrhinum graniticum]
 gb|AAG38237.1| fil1B [Antirrhinum graniticum]
 gb|AAG38238.1| fil1B [Digitalis purpurea]
 gb|AAG38651.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38652.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38653.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38654.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38655.1| fil1C [Antirrhinum majus subsp. linkianum]
 gb|AAG38945.1| fil1A3 [Antirrhinum graniticum]
 gb|AAG38946.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38947.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38948.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38949.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38950.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38951.1| fil1B [Antirrhinum majus subsp. linkianum]
 gb|AAG38952.1| fil1B [Antirrhinum majus subsp. linkianum]
Length=28

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  321  HDCICNTLRVAARIPAQCNIPSISCSAN  404
            H+C+CNTLR+A+R+PAQCN+P +SC AN
Sbjct  1    HECLCNTLRIASRVPAQCNLPPLSCGAN  28



>gb|AIY60706.1| rhomboid protein Lonja32412 [Lonicera japonica]
Length=324

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHCHWCHY++C+P+SKW C
Sbjct  295  LFRGVNGNDHCHWCHYISCVPTSKWKC  321



>ref|XP_009608217.1| PREDICTED: inactive rhomboid protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=287

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWCHYL+C+P+SKW C
Sbjct  258  LFRGANGYDHCHWCHYLSCVPTSKWKC  284



>gb|AIY60728.1| rhomboid protein Yucsm9573, partial [Yucca filamentosa]
Length=221

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+D CHWCHYL+C+P+SKW+C
Sbjct  193  LFRGVNGNDRCHWCHYLSCVPTSKWSC  219



>ref|XP_009608216.1| PREDICTED: inactive rhomboid protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=320

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWCHYL+C+P+SKW C
Sbjct  291  LFRGANGYDHCHWCHYLSCVPTSKWKC  317



>dbj|BAK05897.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=95

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +3

Query  201  QTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCNI  380
            +   C   L  L  C  +++PGA    PSA+CC  + S+  DC C+T+ +   +P++CNI
Sbjct  31   RPGECVPQLNRLLACRAYLVPGAAD--PSAECCGALSSISRDCACSTMGIINSLPSRCNI  88

Query  381  PSISCSA  401
              ++CSA
Sbjct  89   GQVNCSA  95



>ref|NP_001106005.1| LTP-like protein precursor [Zea mays]
 emb|CAB65538.1| LTP-like protein [Zea mays]
 gb|ACG31215.1| LIM1 protein precursor [Zea mays]
 gb|ACG31557.1| LIM1 protein precursor [Zea mays]
 gb|AFW65022.1| hypothetical protein ZEAMMB73_598049 [Zea mays]
Length=103

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +3

Query  180  FLQAANSQTDT-CTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAA  356
             L+ A +Q    C   L  L  C  +++PGA    PSADCCS + ++ H+C C+T+ +  
Sbjct  31   VLRGAGAQAGGQCLPQLNRLLACRAYLVPGAPD--PSADCCSALSAVSHECACSTMGIIN  88

Query  357  RIPAQCNIPSISCSA  401
             +P +C++   +CSA
Sbjct  89   SLPGRCHLAQANCSA  103



>ref|XP_003548211.1| PREDICTED: inactive rhomboid protein 1-like isoform 1 [Glycine 
max]
Length=329

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL C+P+SKW C+
Sbjct  300  LFRGENGYDHCHWCHYLTCVPTSKWKCN  327



>gb|KHN31525.1| Inactive rhomboid protein 1 [Glycine soja]
Length=307

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL C+P+SKW C+
Sbjct  278  LFRGENGYDHCHWCHYLTCVPTSKWKCN  305



>gb|AIY60718.1| rhomboid protein Dioop2183, partial [Dioscorea oppositifolia]
Length=372

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHCHWCHYL+C+P+SKW C
Sbjct  344  LFRGVNANDHCHWCHYLSCVPTSKWKC  370



>gb|AIY60672.1| rhomboid protein Illhe_RBL1 [Illicium henryi]
Length=377

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*E  607
            LF GVNG+DHC WCHYL+C+P+S+W C  E
Sbjct  303  LFRGVNGNDHCSWCHYLSCVPTSRWKCQEE  332



>gb|AES62549.2| inactive rhomboid-like protein [Medicago truncatula]
Length=319

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL C+PSS+W C+
Sbjct  289  LFRGENGYDHCHWCHYLTCVPSSRWECN  316



>emb|CDP21663.1| unnamed protein product [Coffea canephora]
Length=134

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW+C+
Sbjct  106  LFRGENGNDHCSWCHYLSCVPTSKWSCN  133



>ref|XP_002509727.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51114.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+DHC WCHYL+C+P+SKW C
Sbjct  269  LFRGVNGNDHCSWCHYLSCVPTSKWKC  295



>ref|XP_003592298.1| Rhomboid family member [Medicago truncatula]
Length=314

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL C+PSS+W C+
Sbjct  284  LFRGENGYDHCHWCHYLTCVPSSRWECN  311



>ref|XP_004974078.1| PREDICTED: anther-specific protein MZm3-3-like [Setaria italica]
Length=97

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = +3

Query  186  QAANSQTDTCTASLGNLNVCAPFVMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIP  365
            +A       C   L  L  C  +++PGA    PSADCC  + ++ H+C C+T+ +   +P
Sbjct  28   EAQGGGVGQCVPQLNRLLACRAYLVPGA--PDPSADCCGALSAVSHECACSTMGIINSLP  85

Query  366  AQCNIPSISCSA  401
             +C++  ++CSA
Sbjct  86   GRCSLAPVNCSA  97



>gb|KDP22313.1| hypothetical protein JCGZ_26144 [Jatropha curcas]
Length=327

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWCHYL+C+P+S+W+C
Sbjct  296  LFRGENGNDHCHWCHYLSCVPTSRWSC  322



>gb|AIY60774.1| rhomboid protein Pintu32689 [Pinellia ternata]
Length=328

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+D CHWCHYL+C+P+S+W C
Sbjct  300  LFRGVNGNDRCHWCHYLSCVPTSRWEC  326



>gb|AIY60773.1| rhomboid protein Pintu13861, partial [Pinellia ternata]
Length=308

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG+D CHWCHYL+C+P+S+W C
Sbjct  280  LFRGVNGNDRCHWCHYLSCVPTSRWQC  306



>ref|XP_007038618.1| RHOMBOID-like 2 [Theobroma cacao]
 gb|EOY23119.1| RHOMBOID-like 2 [Theobroma cacao]
Length=334

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL+C+P+S+W C+
Sbjct  305  LFRGENGNDHCHWCHYLSCVPTSRWNCN  332



>gb|EAZ16718.1| hypothetical protein OsJ_32194 [Oryza sativa Japonica Group]
Length=253

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN ++ CHWCHYL+CIP+S+WTC
Sbjct  225  LFRGVNANERCHWCHYLSCIPTSRWTC  251



>ref|XP_011030083.1| PREDICTED: inactive rhomboid protein 1-like [Populus euphratica]
Length=342

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL+C+P+S+W C+
Sbjct  311  LFKGKNGNDHCHWCHYLSCVPTSRWKCN  338



>ref|XP_002462700.1| hypothetical protein SORBIDRAFT_02g030450 [Sorghum bicolor]
 gb|EER99221.1| hypothetical protein SORBIDRAFT_02g030450 [Sorghum bicolor]
Length=325

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  297  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  324



>gb|ACG33279.1| membrane protein [Zea mays]
Length=226

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  198  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  225



>gb|ACF85618.1| unknown [Zea mays]
 gb|ACG41020.1| membrane protein [Zea mays]
 gb|ACL54584.1| unknown [Zea mays]
 gb|ACN34704.1| unknown [Zea mays]
 tpg|DAA41950.1| TPA: membrane protein [Zea mays]
Length=327

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  299  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  326



>ref|XP_002321905.2| rhomboid family protein [Populus trichocarpa]
 gb|EEF06032.2| rhomboid family protein [Populus trichocarpa]
Length=333

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN  604
            LF G NG+DHCHWCHYL+C+P+S+W C+  N
Sbjct  302  LFKGENGNDHCHWCHYLSCVPTSRWKCNDNN  332



>ref|XP_010262519.1| PREDICTED: rhomboid-like protease 2 [Nelumbo nucifera]
 ref|XP_010262520.1| PREDICTED: rhomboid-like protease 2 [Nelumbo nucifera]
Length=381

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN  604
            LF GVN +DHC WCHYL+CIP+S+W+C  E 
Sbjct  307  LFRGVNANDHCSWCHYLSCIPTSRWSCKSEQ  337



>ref|XP_011048686.1| PREDICTED: inactive rhomboid protein 1-like [Populus euphratica]
Length=333

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN  604
            LF G NG+DHCHWCHYL+C+P+S+W C+  N
Sbjct  302  LFKGENGNDHCHWCHYLSCVPTSRWKCNDNN  332



>ref|XP_002318821.2| hypothetical protein POPTR_0012s13370g [Populus trichocarpa]
 gb|EEE97041.2| hypothetical protein POPTR_0012s13370g [Populus trichocarpa]
Length=346

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWCHYL+C+P+S+W C
Sbjct  315  LFKGKNGNDHCHWCHYLSCVPTSRWKC  341



>gb|AAA02747.1| membrane protein [Saccharum hybrid cultivar H65-7052]
Length=325

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  297  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  324



>gb|ACF84585.1| unknown [Zea mays]
 gb|ACF87792.1| unknown [Zea mays]
 gb|ACG31947.1| YY1 protein precursor [Zea mays]
 gb|ACG45917.1| YY1 protein precursor [Zea mays]
 tpg|DAA62377.1| TPA: anther-specific protein MZm3-3 Precursor isoform 1 [Zea 
mays]
 tpg|DAA62378.1| TPA: anther-specific protein MZm3-3 Precursor isoform 2 [Zea 
mays]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 34/66 (52%), Gaps = 3/66 (5%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPF---VMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             TC   L  L  C  +    +PG V  AP  +CCS + ++  DC C T  +   +PA+C 
Sbjct  43   QTCAGQLRGLAPCLRYSVPPLPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCG  102

Query  378  IPSISC  395
            +P +SC
Sbjct  103  LPPVSC  108



>gb|ABG66197.1| Rhomboid family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAG87689.1| unnamed protein product [Oryza sativa Japonica Group]
Length=227

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN ++ CHWCHYL+CIP+S+WTC
Sbjct  199  LFRGVNANERCHWCHYLSCIPTSRWTC  225



>ref|XP_008679489.1| PREDICTED: uncharacterized rhomboid protein AN10929-like [Zea 
mays]
 gb|AFW65015.1| hypothetical protein ZEAMMB73_264327 [Zea mays]
Length=322

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+S+W C
Sbjct  294  LFTGKNGNDSCHWCHYLNCVPTSRWKC  320



>ref|NP_001063723.1| Os09g0525900 [Oryza sativa Japonica Group]
 dbj|BAD46497.1| putative membrane protein [Oryza sativa Japonica Group]
 dbj|BAD46353.1| putative membrane protein [Oryza sativa Japonica Group]
 dbj|BAF25637.1| Os09g0525900 [Oryza sativa Japonica Group]
 gb|EAZ09815.1| hypothetical protein OsI_32104 [Oryza sativa Indica Group]
 gb|EAZ45415.1| hypothetical protein OsJ_30065 [Oryza sativa Japonica Group]
 dbj|BAG92414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=323

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  295  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  322



>ref|NP_001158983.1| YY1 protein precursor [Zea mays]
 gb|ACG31217.1| YY1 protein precursor [Zea mays]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 34/66 (52%), Gaps = 3/66 (5%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPF---VMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             TC   L  L  C  +    +PG V  AP  +CCS + ++  DC C T  +   +PA+C 
Sbjct  43   QTCAGQLRGLAPCLRYSVPPLPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCG  102

Query  378  IPSISC  395
            +P +SC
Sbjct  103  LPPVSC  108



>ref|NP_001142335.1| membrane protein [Zea mays]
 gb|ACF88217.1| unknown [Zea mays]
 gb|ACN36218.1| unknown [Zea mays]
 tpg|DAA62384.1| TPA: membrane protein [Zea mays]
Length=324

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  296  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  323



>ref|NP_001148543.1| YY1 protein precursor [Zea mays]
 gb|ACG31941.1| YY1 protein precursor [Zea mays]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 34/66 (52%), Gaps = 3/66 (5%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPF---VMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             TC   L  L  C  +    +PG V  AP  +CCS + ++  DC C T  +   +PA+C 
Sbjct  43   QTCAGQLRGLAPCLRYSVPPLPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCG  102

Query  378  IPSISC  395
            +P +SC
Sbjct  103  LPPVSC  108



>gb|AIY60689.1| rhomboid protein Panut5866, partial [Pandanus utilis]
Length=312

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN +D CHWCHYL+C+P+SKW+C 
Sbjct  284  LFRGVNANDRCHWCHYLSCVPTSKWSCE  311



>gb|EAY79245.1| hypothetical protein OsI_34361 [Oryza sativa Indica Group]
Length=332

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN ++ CHWCHYL+CIP+S+WTC
Sbjct  304  LFRGVNANERCHWCHYLSCIPTSRWTC  330



>ref|NP_001167670.1| YY1 protein precursor [Zea mays]
 gb|ACG31974.1| YY1 protein precursor [Zea mays]
 tpg|DAA62379.1| TPA: YY1 protein [Zea mays]
Length=119

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 34/66 (52%), Gaps = 3/66 (5%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPF---VMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             TC   L  L  C  +    +PG V  AP  +CCS + ++  DC C T  +   +PA+C 
Sbjct  43   QTCAGQLRGLAPCLRYSVPPLPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCG  102

Query  378  IPSISC  395
            +P +SC
Sbjct  103  LPPVSC  108



>gb|AAM92298.1| putative membrane protein [Oryza sativa Japonica Group]
Length=329

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN ++ CHWCHYL+CIP+S+WTC
Sbjct  301  LFRGVNANERCHWCHYLSCIPTSRWTC  327



>gb|AIY60690.1| rhomboid protein Panut5887 [Pandanus utilis]
Length=390

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN +DHC WCHYL+C+P+SKW+C 
Sbjct  316  LFRGVNANDHCSWCHYLSCVPTSKWSCK  343



>ref|NP_001065094.1| Os10g0521900 [Oryza sativa Japonica Group]
 dbj|BAF27008.1| Os10g0521900, partial [Oryza sativa Japonica Group]
Length=338

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN ++ CHWCHYL+CIP+S+WTC
Sbjct  310  LFRGVNANERCHWCHYLSCIPTSRWTC  336



>ref|XP_006846227.1| hypothetical protein AMTR_s00012p00233600 [Amborella trichopoda]
 gb|ERN07902.1| hypothetical protein AMTR_s00012p00233600 [Amborella trichopoda]
Length=240

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN +DHC WCHYL+C+P+S+W+C+
Sbjct  135  LFRGVNANDHCSWCHYLSCVPTSRWSCN  162



>ref|XP_003578474.1| PREDICTED: uncharacterized rhomboid protein AN10929 [Brachypodium 
distachyon]
Length=330

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  302  LFKGKNGNDGCHWCHYLNCVPTSKWKCN  329



>ref|XP_004957411.1| PREDICTED: uncharacterized rhomboid protein AN10929-like [Setaria 
italica]
Length=326

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYLNC+P+SKW C+
Sbjct  298  LFEGKNGNDGCHWCHYLNCVPTSKWKCN  325



>gb|AIY60757.1| rhomboid protein Alipl5646, partial [Alisma plantago-aquatica]
Length=269

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWCHYLNC+ SS+W C
Sbjct  241  LFRGENGNDHCHWCHYLNCVSSSRWQC  267



>tpg|DAA45983.1| TPA: hypothetical protein ZEAMMB73_979905 [Zea mays]
Length=184

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  156  LFRGVNANDHCGWCHYLSCVPTSRWSC  182



>gb|ABG73460.1| membrane protein [Oryza brachyantha]
Length=326

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+SKW C
Sbjct  298  LFKGKNGNDGCHWCHYLNCVPTSKWKC  324



>emb|CDP09796.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW+C+
Sbjct  298  LFRGENGNDHCSWCHYLSCVPTSKWSCN  325



>dbj|BAJ89286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG++HC WCHYL+C+P+++W+C
Sbjct  297  LFRGVNGNEHCQWCHYLSCVPTARWSC  323



>ref|XP_008679486.1| PREDICTED: uncharacterized rhomboid protein AN10929-like isoform 
X1 [Zea mays]
Length=240

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+S+W C
Sbjct  212  LFKGKNGNDSCHWCHYLNCVPTSRWKC  238



>ref|XP_008679487.1| PREDICTED: uncharacterized rhomboid protein AN10929-like isoform 
X2 [Zea mays]
 ref|XP_008679488.1| PREDICTED: uncharacterized rhomboid protein AN10929-like isoform 
X2 [Zea mays]
Length=226

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+S+W C
Sbjct  198  LFKGKNGNDSCHWCHYLNCVPTSRWKC  224



>ref|XP_009421337.1| PREDICTED: inactive rhomboid protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=390

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW+C 
Sbjct  319  LFRGFNGNDHCSWCHYLSCVPTSKWSCK  346



>ref|XP_007152326.1| hypothetical protein PHAVU_004G120400g [Phaseolus vulgaris]
 gb|ESW24320.1| hypothetical protein PHAVU_004G120400g [Phaseolus vulgaris]
Length=327

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G +G+DHCHWCHYL C+P+SKW C+
Sbjct  298  LFRGESGYDHCHWCHYLTCVPTSKWKCN  325



>gb|AIY60699.1| rhomboid protein Aspof43958 [Asparagus officinalis]
Length=311

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVNG++ CHWCHYL+C+P+SKW C 
Sbjct  283  LFRGVNGNEKCHWCHYLSCVPTSKWNCK  310



>ref|XP_008785581.1| PREDICTED: inactive rhomboid protein 1-like [Phoenix dactylifera]
Length=371

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN +DHC WCHYL+C+P+SKW+C 
Sbjct  298  LFRGVNANDHCSWCHYLSCVPTSKWSCK  325



>gb|KHG07733.1| Rhomboid-like protease 3 [Gossypium arboreum]
Length=328

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NGHDHC WCHYL+C+P+SKW C
Sbjct  300  LFRGENGHDHCSWCHYLSCVPTSKWHC  326



>gb|AHL43433.1| rhomboid Ae [Triticum timopheevii]
 gb|AHL43435.1| rhomboid 2 [Triticum timopheevii]
Length=326

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG++HC WCHYL+C+P+++W+C
Sbjct  298  LFRGVNGNEHCQWCHYLSCVPTARWSC  324



>ref|XP_006659655.1| PREDICTED: inactive rhomboid protein 1-like [Oryza brachyantha]
Length=326

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNCIP+S+W C
Sbjct  298  LFKGKNGNDGCHWCHYLNCIPTSRWKC  324



>gb|AGE14563.1| rhomboid [Triticum aestivum]
 gb|AHL43430.1| rhomboid [Triticum aestivum]
 gb|AHL43432.1| rhomboid [Aegilops tauschii]
Length=323

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG++HC WCHYL+C+P+++W+C
Sbjct  295  LFRGVNGNEHCQWCHYLSCVPTARWSC  321



>ref|NP_001062422.1| Os08g0546700 [Oryza sativa Japonica Group]
 dbj|BAD09236.1| putative membrane protein [Oryza sativa Japonica Group]
 dbj|BAF24336.1| Os08g0546700 [Oryza sativa Japonica Group]
 dbj|BAG87702.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83986.1| hypothetical protein OsI_30137 [Oryza sativa Indica Group]
 gb|EEE69103.1| hypothetical protein OsJ_28172 [Oryza sativa Japonica Group]
Length=323

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNCIP+S+W C
Sbjct  295  LFKGKNGNDGCHWCHYLNCIPTSRWKC  321



>ref|XP_011029207.1| PREDICTED: uncharacterized rhomboid protein AN10929-like [Populus 
euphratica]
Length=322

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW C 
Sbjct  293  LFKGENGNDHCSWCHYLSCVPTSKWNCE  320



>gb|KHN37236.1| Inactive rhomboid protein 1 [Glycine soja]
Length=321

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 5/42 (12%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN**TDCCHLESN  571
            L  GV+ +DHC WCHYL+C+P+SKW+CH     T+  + ESN
Sbjct  247  LLRGVDANDHCSWCHYLSCVPTSKWSCH-----TEAAYCESN  283



>ref|XP_006601825.1| PREDICTED: uncharacterized protein LOC100805186 isoform X1 [Glycine 
max]
Length=293

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 5/42 (12%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN**TDCCHLESN  571
            L  GV+ +DHC WCHYL+C+P+SKW+CH     T+  + ESN
Sbjct  219  LLRGVDANDHCSWCHYLSCVPTSKWSCH-----TEAAYCESN  255



>ref|XP_002298056.1| rhomboid family protein [Populus trichocarpa]
 gb|EEE82861.1| rhomboid family protein [Populus trichocarpa]
Length=322

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW C 
Sbjct  293  LFKGENGNDHCSWCHYLSCVPTSKWKCE  320



>ref|NP_001242000.1| uncharacterized protein LOC100784671 [Glycine max]
 gb|ACU19828.1| unknown [Glycine max]
Length=330

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G +G+DHCHWCHYL C+P+SKW C+
Sbjct  301  LFRGESGYDHCHWCHYLTCVPTSKWKCN  328



>gb|AIY60754.1| rhomboid protein Alipl6488 [Alisma plantago-aquatica]
Length=383

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            +F GV+G+ HC WCHYLNCIP+SKW+C 
Sbjct  308  VFRGVDGNKHCSWCHYLNCIPTSKWSCK  335



>gb|AHL43434.1| rhomboid [Triticum aestivum]
Length=326

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG++HC WCHYL+C+P+++W+C
Sbjct  298  LFRGVNGNEHCQWCHYLSCVPTARWSC  324



>ref|XP_008784595.1| PREDICTED: inactive rhomboid protein 1-like [Phoenix dactylifera]
Length=386

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN +DHC WCHYL+C+P+S+W+C 
Sbjct  310  LFRGVNANDHCSWCHYLSCVPTSRWSCE  337



>gb|KHM99144.1| Inactive rhomboid protein 1 [Glycine soja]
Length=330

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G +G+DHCHWCHYL C+P+SKW C+
Sbjct  301  LFRGESGYDHCHWCHYLTCVPTSKWKCN  328



>gb|AHL43436.1| rhomboid [Triticum turgidum subsp. durum]
Length=326

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG++HC WCHYL+C+P+++W+C
Sbjct  298  LFRGVNGNEHCQWCHYLSCVPTARWSC  324



>ref|XP_002444633.1| hypothetical protein SORBIDRAFT_07g025140 [Sorghum bicolor]
 gb|EES14128.1| hypothetical protein SORBIDRAFT_07g025140 [Sorghum bicolor]
Length=332

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+S+W C
Sbjct  304  LFKGKNGNDSCHWCHYLNCVPTSRWKC  330



>ref|NP_001105123.1| anther-specific protein MZm3-3 precursor [Zea mays]
 sp|O82106.1|ZM33_MAIZE RecName: Full=Anther-specific protein MZm3-3; Flags: Precursor 
[Zea mays]
 emb|CAA11913.1| anther specific protein [Zea mays]
Length=109

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 34/66 (52%), Gaps = 3/66 (5%)
 Frame = +3

Query  207  DTCTASLGNLNVCAPF---VMPGAVTTAPSADCCSVVQSMDHDCICNTLRVAARIPAQCN  377
             TC   L  L  C  +    +PG V  AP  +CCS + ++  DC C T  +   +PA+C 
Sbjct  43   QTCAGQLRGLAPCLRYSVPPLPGQVPPAPGPECCSALGAVSRDCACGTFSIINSLPAKCA  102

Query  378  IPSISC  395
            +P +SC
Sbjct  103  LPPVSC  108



>ref|XP_002304474.2| rhomboid family protein [Populus trichocarpa]
 gb|EEE79453.2| rhomboid family protein [Populus trichocarpa]
Length=321

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW C 
Sbjct  293  LFKGENGNDHCSWCHYLSCVPTSKWNCR  320



>ref|XP_006288091.1| hypothetical protein CARUB_v10001321mg [Capsella rubella]
 gb|EOA20989.1| hypothetical protein CARUB_v10001321mg [Capsella rubella]
Length=346

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWC YL C+P+SKW C
Sbjct  317  LFRGENGNDHCHWCRYLRCVPTSKWRC  343



>ref|XP_011033788.1| PREDICTED: uncharacterized rhomboid protein AN10929 [Populus 
euphratica]
Length=321

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHC WCHYL+C+P+SKW C 
Sbjct  293  LFKGENGNDHCSWCHYLSCVPTSKWNCR  320



>ref|XP_007218337.1| hypothetical protein PRUPE_ppa008564mg [Prunus persica]
 gb|EMJ19536.1| hypothetical protein PRUPE_ppa008564mg [Prunus persica]
Length=326

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL+C+PSS+W C 
Sbjct  297  LFHGENGNDHCHWCHYLSCVPSSRWHCE  324



>ref|XP_004515720.1| PREDICTED: inactive rhomboid protein 1-like [Cicer arietinum]
Length=327

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWC YL C+P+SKW C+
Sbjct  298  LFRGENGYDHCHWCSYLTCVPTSKWKCN  325



>emb|CAN71797.1| hypothetical protein VITISV_026278 [Vitis vinifera]
Length=754

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*E  607
            L  GV+ +D C WCHYL+C+P+SKW+C  E
Sbjct  314  LLRGVDANDRCSWCHYLSCVPTSKWSCKTE  343



>ref|XP_008799836.1| PREDICTED: inactive rhomboid protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=277

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN ++HC WCHYL+CIP+SKW+C 
Sbjct  201  LFRGVNANEHCSWCHYLSCIPTSKWSCK  228



>gb|AIY60700.1| rhomboid protein Aspof9819 [Asparagus officinalis]
Length=323

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G +G+DHCHWCHYL+C+P+S+W+C
Sbjct  295  LFRGESGNDHCHWCHYLSCVPTSRWSC  321



>ref|XP_004496594.1| PREDICTED: inactive rhomboid protein 1-like isoform X1 [Cicer 
arietinum]
Length=317

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL C+P+S W+C+
Sbjct  286  LFKGENGYDHCHWCHYLTCVPTSIWSCN  313



>gb|AIY60772.1| rhomboid protein Pintu40369, partial [Pinellia ternata]
Length=363

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  687  GVNGHDHCHWCHYLNCIPSSKWTCH  613
            GVNG+DHC WCHYL+C+P+SKW+C 
Sbjct  292  GVNGNDHCSWCHYLSCVPTSKWSCK  316



>ref|XP_004496595.1| PREDICTED: inactive rhomboid protein 1-like isoform X2 [Cicer 
arietinum]
Length=299

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+DHCHWCHYL C+P+S W+C+
Sbjct  268  LFKGENGYDHCHWCHYLTCVPTSIWSCN  295



>gb|AIY60755.1| rhomboid protein Alipl2962, partial [Alisma plantago-aquatica]
Length=244

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWCHYL+C+P+SKW C+
Sbjct  216  LFRGENGNDRCHWCHYLSCVPTSKWDCN  243



>ref|XP_008799828.1| PREDICTED: inactive rhomboid protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=386

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN ++HC WCHYL+CIP+SKW+C 
Sbjct  310  LFRGVNANEHCSWCHYLSCIPTSKWSCK  337



>ref|XP_010491329.1| PREDICTED: inactive rhomboid protein 1-like [Camelina sativa]
Length=349

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHCHWC YL C+P+S+W+C
Sbjct  320  LFRGENGNDHCHWCRYLRCVPTSRWSC  346



>gb|AIY60736.1| rhomboid protein Lacsa18033 [Lactuca sativa]
Length=330

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHC WCHYL+C+P+SKW C
Sbjct  301  LFKGENGNDHCSWCHYLSCVPTSKWRC  327



>ref|XP_010533712.1| PREDICTED: inactive rhomboid protein 1-like [Tarenaya hassleriana]
 ref|XP_010533713.1| PREDICTED: inactive rhomboid protein 1-like [Tarenaya hassleriana]
Length=317

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+ HC WCHYL+C+P+SKWTC
Sbjct  291  LFKGENGNKHCKWCHYLSCVPTSKWTC  317



>gb|KDO51157.1| hypothetical protein CISIN_1g035016mg [Citrus sinensis]
Length=76

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*E  607
            L  GV+ +DHC WCHYL+C+P+S+W+C  E
Sbjct  2    LLRGVDANDHCSWCHYLSCVPTSRWSCRTE  31



>gb|EMT31293.1| Rhomboid family member 1 [Aegilops tauschii]
Length=320

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+S+W C
Sbjct  292  LFKGKNGNDGCHWCHYLNCVPTSRWKC  318



>dbj|BAJ99834.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=321

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYLNC+P+S+W C
Sbjct  293  LFKGKNGNDGCHWCHYLNCVPTSRWKC  319



>ref|XP_011076211.1| PREDICTED: inactive rhomboid protein 1 [Sesamum indicum]
Length=329

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVNG++ CHWC YL+C+P+SKW C
Sbjct  300  LFRGVNGYERCHWCRYLSCVPTSKWKC  326



>ref|NP_001132594.1| uncharacterized protein LOC100194066 [Zea mays]
 gb|ACF81509.1| unknown [Zea mays]
Length=248

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  220  LFRGVNANDHCGWCHYLSCVPTSRWSC  246



>tpg|DAA45981.1| TPA: hypothetical protein ZEAMMB73_979905 [Zea mays]
Length=254

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  220  LFRGVNANDHCGWCHYLSCVPTSRWSC  246



>ref|XP_002467632.1| hypothetical protein SORBIDRAFT_01g031210 [Sorghum bicolor]
 gb|EER94630.1| hypothetical protein SORBIDRAFT_01g031210 [Sorghum bicolor]
Length=335

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  307  LFRGVNANDHCGWCHYLSCVPTSRWSC  333



>ref|XP_006440556.1| hypothetical protein CICLE_v10021119mg [Citrus clementina]
 gb|ESR53796.1| hypothetical protein CICLE_v10021119mg [Citrus clementina]
Length=327

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHC WCHYL+C+P+SKW C
Sbjct  299  LFRGENGNDHCSWCHYLSCVPTSKWKC  325



>ref|XP_007133989.1| hypothetical protein PHAVU_010G009600g [Phaseolus vulgaris]
 gb|ESW05983.1| hypothetical protein PHAVU_010G009600g [Phaseolus vulgaris]
Length=383

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*E  607
            L  GV+ +DHC WCHYL+C+P+SKW+CH E
Sbjct  309  LLRGVDANDHCSWCHYLSCVPTSKWSCHTE  338



>gb|ACG45740.1| membrane protein [Zea mays]
Length=334

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  306  LFRGVNANDHCGWCHYLSCVPTSRWSC  332



>ref|XP_008659873.1| PREDICTED: uncharacterized protein LOC100194066 isoform X1 [Zea 
mays]
 tpg|DAA45979.1| TPA: membrane protein [Zea mays]
Length=334

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  306  LFRGVNANDHCGWCHYLSCVPTSRWSC  332



>ref|XP_007040140.1| RHOMBOID-like 2 [Theobroma cacao]
 gb|EOY24641.1| RHOMBOID-like 2 [Theobroma cacao]
Length=329

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHC WCHYL+C+P+SKW C
Sbjct  301  LFRGENGNDHCSWCHYLSCVPTSKWRC  327



>ref|XP_010919249.1| PREDICTED: inactive rhomboid protein 1 [Elaeis guineensis]
Length=337

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYL+C+P+S+W+C
Sbjct  309  LFRGENGNDRCHWCHYLSCVPTSRWSC  335



>ref|XP_006477415.1| PREDICTED: inactive rhomboid protein 1-like [Citrus sinensis]
Length=327

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHC WCHYL+C+P+SKW C
Sbjct  299  LFRGENGNDHCSWCHYLSCVPTSKWKC  325



>gb|ACF78235.1| unknown [Zea mays]
Length=336

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN +DHC WCHYL+C+P+S+W+C
Sbjct  308  LFRGVNANDHCGWCHYLSCVPTSRWSC  334



>gb|KFK40531.1| hypothetical protein AALP_AA2G007800 [Arabis alpina]
Length=98

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+ HC WCHYL+C P+SKWTC
Sbjct  72   LFKGENGNKHCKWCHYLSCFPTSKWTC  98



>gb|AIY60781.1| rhomboid protein Lilbr16267, partial [Lilium brownii]
Length=363

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            L  G NG+DHCHWCHYL+C+P+S+W+C
Sbjct  335  LLRGENGNDHCHWCHYLSCVPTSRWSC  361



>ref|XP_010922306.1| PREDICTED: inactive rhomboid protein 1-like [Elaeis guineensis]
Length=382

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF GVN +DHC WCHY+ C+P+SKW+C 
Sbjct  309  LFRGVNANDHCSWCHYITCVPTSKWSCK  336



>ref|XP_002283259.1| PREDICTED: inactive rhomboid protein 1 [Vitis vinifera]
 emb|CBI34724.3| unnamed protein product [Vitis vinifera]
Length=328

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHC WCHYL+C+P+SKW C
Sbjct  300  LFRGENGNDHCSWCHYLSCVPTSKWKC  326



>gb|EEE52579.1| hypothetical protein OsJ_34868 [Oryza sativa Japonica Group]
Length=864

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            L  G N +DHC WCHYL+C+P+ +W C+
Sbjct  300  LLRGYNANDHCSWCHYLSCVPTKRWKCN  327



>gb|AIY60717.1| rhomboid protein Dioop15627 [Dioscorea oppositifolia]
Length=327

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G +GHDHC WC YLNC+P+S+W+C
Sbjct  299  LFRGESGHDHCRWCKYLNCVPTSRWSC  325



>ref|XP_003520922.1| PREDICTED: inactive rhomboid protein 1-like [Glycine max]
Length=385

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 5/42 (12%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN**TDCCHLESN  571
            L  GV+ +DHC WCHYL+C+P+SKW+CH     T+  + +SN
Sbjct  311  LLQGVDANDHCSWCHYLSCVPTSKWSCH-----TEAAYCQSN  347



>gb|KHN06912.1| Inactive rhomboid protein 1 [Glycine soja]
Length=374

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 5/42 (12%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH*EN**TDCCHLESN  571
            L  GV+ +DHC WCHYL+C+P+SKW+CH     T+  + +SN
Sbjct  300  LLQGVDANDHCSWCHYLSCVPTSKWSCH-----TEAAYCQSN  336



>ref|XP_004974112.1| PREDICTED: inactive rhomboid protein 1-like [Setaria italica]
Length=331

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
            LF G NG+D CHWC YLNC+P+S+W C+
Sbjct  303  LFKGKNGNDSCHWCQYLNCVPTSRWKCN  330



>ref|XP_002510823.1| KOM, putative [Ricinus communis]
 gb|EEF51425.1| KOM, putative [Ricinus communis]
Length=325

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+D CHWCHYL+C+P+S+W C
Sbjct  294  LFRGENGNDRCHWCHYLSCVPTSRWKC  320



>gb|KDO63543.1| hypothetical protein CISIN_1g045959mg [Citrus sinensis]
Length=303

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF G NG+DHC WCHYL+C+P+SKW C
Sbjct  275  LFRGENGNDHCSWCHYLSCVPTSKWKC  301



>ref|XP_003580349.1| PREDICTED: inactive rhomboid protein 1 [Brachypodium distachyon]
Length=343

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            +F GVNG+DHC WCHYL C+P+S W C
Sbjct  315  VFRGVNGNDHCSWCHYLTCVPTSSWKC  341



>gb|AIY60725.1| rhomboid protein Yucsm15031 [Yucca filamentosa]
Length=408

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTCH  613
             F GVNG+ HC WCHYL+C+P+SKW+C 
Sbjct  334  FFRGVNGNKHCSWCHYLSCVPTSKWSCK  361



>ref|XP_006661971.1| PREDICTED: inactive rhomboid protein 1-like [Oryza brachyantha]
Length=193

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  696  LFIGVNGHDHCHWCHYLNCIPSSKWTC  616
            LF GVN ++ C WCHYL+CIP+S+W+C
Sbjct  165  LFRGVNANERCQWCHYLSCIPTSRWSC  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117891235824