BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78486_g1_i1 len=846 path=[1:0-845]

Length=846
                                                                      Score     E

ref|XP_009589829.1|  PREDICTED: dirigent protein 1-like                 266   6e-86   
emb|CDO98764.1|  unnamed protein product                                266   6e-86   
ref|XP_011094443.1|  PREDICTED: dirigent protein 1-like                 266   8e-86   
ref|XP_009799585.1|  PREDICTED: dirigent protein 11-like                263   7e-85   
ref|XP_004229007.1|  PREDICTED: dirigent protein 11-like                254   2e-81   
ref|XP_006358216.1|  PREDICTED: dirigent protein 11-like                256   1e-80   
ref|XP_010024793.1|  PREDICTED: dirigent protein 11-like                249   6e-79   
gb|KDP27914.1|  hypothetical protein JCGZ_18994                         246   2e-77   
gb|KCW61289.1|  hypothetical protein EUGRSUZ_H04044                     238   7e-75   
ref|XP_010097777.1|  hypothetical protein L484_004191                   231   4e-72   
ref|XP_008438952.1|  PREDICTED: dirigent protein 11-like                231   8e-72   
ref|XP_002519227.1|  Disease resistance response protein, putative      229   4e-71   Ricinus communis
ref|XP_003528619.1|  PREDICTED: dirigent protein 11-like                228   8e-71   
ref|XP_004508149.1|  PREDICTED: disease resistance response prote...    226   6e-70   
ref|XP_003609777.1|  Disease resistance response protein                225   1e-69   
gb|KDO37162.1|  hypothetical protein CISIN_1g046562mg                   224   2e-69   
ref|XP_003550557.1|  PREDICTED: dirigent protein 21-like                224   3e-69   
ref|XP_004165482.1|  PREDICTED: uncharacterized protein LOC101224120    224   3e-69   
ref|XP_004134245.1|  PREDICTED: uncharacterized protein LOC101211957    223   5e-69   
ref|XP_006419382.1|  hypothetical protein CICLE_v10007072mg             223   8e-69   
ref|XP_010921454.1|  PREDICTED: dirigent protein 11-like                214   2e-65   
ref|XP_008781145.1|  PREDICTED: dirigent protein 11-like                196   2e-58   
gb|KHN02894.1|  Disease resistance response protein 206                 193   1e-57   
ref|XP_003609779.1|  Disease resistance response protein                192   7e-57   
ref|XP_007154378.1|  hypothetical protein PHAVU_003G114200g             181   3e-53   
ref|XP_002270487.1|  PREDICTED: dirigent protein 22-like                164   4e-46   Vitis vinifera
emb|CAN61316.1|  hypothetical protein VITISV_023979                     164   5e-46   Vitis vinifera
ref|XP_009783175.1|  PREDICTED: dirigent protein 1-like                 161   5e-46   
ref|XP_002270588.1|  PREDICTED: dirigent protein 22                     164   7e-46   Vitis vinifera
ref|XP_002269397.1|  PREDICTED: dirigent protein 23                     158   8e-44   Vitis vinifera
emb|CAN61315.1|  hypothetical protein VITISV_023978                     157   1e-43   Vitis vinifera
ref|XP_010089481.1|  hypothetical protein L484_011935                   155   2e-42   
ref|XP_010089480.1|  hypothetical protein L484_011934                   153   2e-41   
ref|XP_008230043.1|  PREDICTED: dirigent protein 1-like                 146   5e-39   
ref|XP_007217311.1|  hypothetical protein PRUPE_ppa016125mg             144   9e-38   
ref|XP_009365226.1|  PREDICTED: dirigent protein 11-like                140   8e-37   
ref|XP_008365542.1|  PREDICTED: dirigent protein 11-like                139   2e-36   
ref|XP_002269348.1|  PREDICTED: dirigent protein 4                      135   1e-35   Vitis vinifera
ref|XP_002524832.1|  conserved hypothetical protein                     137   1e-35   Ricinus communis
gb|EYU43119.1|  hypothetical protein MIMGU_mgv1a021554mg                136   3e-35   
ref|XP_009347128.1|  PREDICTED: dirigent protein 22-like                135   4e-35   
ref|XP_009353297.1|  PREDICTED: dirigent protein 22-like                134   2e-34   
ref|XP_004309140.1|  PREDICTED: disease resistance response prote...    134   2e-34   
ref|XP_004289175.1|  PREDICTED: disease resistance response prote...    132   3e-34   
gb|KCW88771.1|  hypothetical protein EUGRSUZ_A01115                     133   3e-34   
ref|XP_010046355.1|  PREDICTED: dirigent protein 2-like                 133   3e-34   
gb|KCW88770.1|  hypothetical protein EUGRSUZ_A01114                     132   6e-34   
ref|XP_004305988.1|  PREDICTED: disease resistance response prote...    132   6e-34   
ref|XP_008379934.1|  PREDICTED: dirigent protein 1-like                 133   2e-33   
ref|XP_010046344.1|  PREDICTED: dirigent protein 2-like                 130   3e-33   
ref|XP_006592370.1|  PREDICTED: dirigent protein 2-like                 130   5e-33   
emb|CDY04773.1|  BnaC05g18160D                                          130   7e-33   
ref|XP_010089478.1|  hypothetical protein L484_011932                   129   1e-32   
ref|XP_004305989.1|  PREDICTED: disease resistance response prote...    129   1e-32   
ref|XP_010068013.1|  PREDICTED: dirigent protein 2-like                 127   3e-32   
ref|XP_009115582.1|  PREDICTED: dirigent protein 2                      128   3e-32   
emb|CAN73537.1|  hypothetical protein VITISV_012618                     131   6e-32   Vitis vinifera
ref|XP_004506278.1|  PREDICTED: disease resistance response prote...    127   7e-32   
ref|XP_008455898.1|  PREDICTED: dirigent protein 15-like                127   7e-32   
ref|XP_008230040.1|  PREDICTED: dirigent protein 22-like                127   8e-32   
gb|KEH29703.1|  disease resistance-responsive, dirigent domain pr...    127   9e-32   
ref|XP_007216497.1|  hypothetical protein PRUPE_ppa023893mg             125   2e-31   
ref|XP_007041904.1|  Disease resistance-responsive (dirigent-like...    125   3e-31   
ref|XP_006281178.1|  hypothetical protein CARUB_v10027213mg             125   4e-31   
ref|XP_006281166.1|  hypothetical protein CARUB_v10027200mg             125   4e-31   
gb|KEH30526.1|  disease resistance-responsive, dirigent domain pr...    125   6e-31   
ref|XP_007217417.1|  hypothetical protein PRUPE_ppa024264mg             124   6e-31   
gb|ABR27731.1|  dirigent-like protein                                   123   7e-31   Picea sitchensis
ref|XP_006487695.1|  PREDICTED: dirigent protein 23-like                124   8e-31   
ref|XP_010243406.1|  PREDICTED: dirigent protein 2-like                 124   9e-31   
gb|KDP27569.1|  hypothetical protein JCGZ_19574                         124   1e-30   
gb|ABK25297.1|  unknown                                                 123   1e-30   Picea sitchensis
ref|XP_008229971.1|  PREDICTED: dirigent protein 22-like                124   1e-30   
ref|XP_010101075.1|  hypothetical protein L484_007310                   124   2e-30   
ref|XP_010494187.1|  PREDICTED: dirigent protein 2-like                 123   2e-30   
gb|KGN63239.1|  hypothetical protein Csa_2G416780                       122   3e-30   
ref|XP_007216435.1|  hypothetical protein PRUPE_ppa021830mg             123   3e-30   
ref|XP_010477562.1|  PREDICTED: dirigent protein 11                     122   5e-30   
gb|ABK26126.1|  unknown                                                 121   7e-30   Picea sitchensis
ref|XP_009596486.1|  PREDICTED: dirigent protein 22-like                122   7e-30   
gb|ABK21834.1|  unknown                                                 121   7e-30   Picea sitchensis
gb|KHN41235.1|  Disease resistance response protein 206                 121   1e-29   
ref|XP_010442171.1|  PREDICTED: dirigent protein 2-like                 121   1e-29   
ref|XP_011046627.1|  PREDICTED: dirigent protein 23                     121   1e-29   
gb|KDO36723.1|  hypothetical protein CISIN_1g030123mg                   121   1e-29   
ref|XP_008358672.1|  PREDICTED: dirigent protein 2-like                 121   1e-29   
ref|XP_002313728.1|  disease resistance-responsive family protein       121   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010501557.1|  PREDICTED: dirigent protein 11-like                120   1e-29   
gb|KHN03295.1|  hypothetical protein glysoja_004321                     117   2e-29   
ref|XP_010048806.1|  PREDICTED: dirigent protein 21-like                120   2e-29   
ref|XP_006366583.1|  PREDICTED: dirigent protein 1-like                 120   2e-29   
ref|XP_002270663.2|  PREDICTED: dirigent protein 2-like                 122   2e-29   Vitis vinifera
ref|XP_010481983.1|  PREDICTED: dirigent protein 2-like                 120   2e-29   
ref|XP_006849316.1|  hypothetical protein AMTR_s03766p00005550          121   2e-29   
ref|XP_010048736.1|  PREDICTED: dirigent protein 22-like                120   3e-29   
ref|XP_007132491.1|  hypothetical protein PHAVU_011G098600g             120   4e-29   
gb|AAB72169.1|  hypothetical protein                                    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173703.2|  disease resistance-responsive, dirigent domain-...    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528277.1|  Disease resistance response protein, putative      119   6e-29   Ricinus communis
emb|CDP10173.1|  unnamed protein product                                118   9e-29   
ref|XP_011079170.1|  PREDICTED: dirigent protein 23-like                117   1e-28   
ref|XP_009762822.1|  PREDICTED: dirigent protein 22-like                118   1e-28   
gb|ABK25163.1|  unknown                                                 118   1e-28   Picea sitchensis
ref|XP_003540811.2|  PREDICTED: dirigent protein 23-like                119   1e-28   
ref|XP_010024253.1|  PREDICTED: dirigent protein 22-like                118   1e-28   
ref|XP_011088571.1|  PREDICTED: dirigent protein 21-like                118   2e-28   
ref|NP_199066.1|  disease resistance-responsive family protein          118   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010024289.1|  PREDICTED: dirigent protein 21-like                118   3e-28   
ref|XP_007132531.1|  hypothetical protein PHAVU_011G102300g             117   3e-28   
ref|XP_006464972.1|  PREDICTED: dirigent protein 23-like                117   3e-28   
ref|XP_004289850.1|  PREDICTED: disease resistance response prote...    117   4e-28   
ref|XP_006841304.1|  hypothetical protein AMTR_s00134p00100380          117   4e-28   
ref|XP_007024406.1|  Disease resistance-responsive family protein...    117   5e-28   
gb|EYU37929.1|  hypothetical protein MIMGU_mgv1a025367mg                115   5e-28   
ref|XP_010257547.1|  PREDICTED: dirigent protein 21-like                116   6e-28   
ref|XP_008229968.1|  PREDICTED: dirigent protein 2-like                 116   7e-28   
ref|XP_011088575.1|  PREDICTED: dirigent protein 21-like                116   7e-28   
ref|XP_006836063.1|  hypothetical protein AMTR_s00114p00093910          117   8e-28   
ref|XP_006582797.1|  PREDICTED: dirigent protein 23-like                115   8e-28   
gb|KCW90019.1|  hypothetical protein EUGRSUZ_A02219                     116   8e-28   
gb|AES88156.2|  disease resistance-responsive, dirigent domain pr...    116   9e-28   
ref|XP_011092911.1|  PREDICTED: dirigent protein 21-like                115   9e-28   
ref|XP_007132492.1|  hypothetical protein PHAVU_011G098700g             116   1e-27   
gb|EYU46052.1|  hypothetical protein MIMGU_mgv1a024219mg                116   1e-27   
ref|XP_010023728.1|  PREDICTED: dirigent protein 23-like                116   1e-27   
ref|XP_004248664.1|  PREDICTED: dirigent protein 22-like                116   1e-27   
ref|XP_010058351.1|  PREDICTED: dirigent protein 22-like                116   1e-27   
ref|XP_002313729.2|  hypothetical protein POPTR_0009s13340g             115   1e-27   Populus trichocarpa [western balsam poplar]
gb|KHN41236.1|  Disease resistance response protein 206                 115   1e-27   
ref|XP_009630041.1|  PREDICTED: dirigent protein 22-like                115   2e-27   
ref|XP_009346642.1|  PREDICTED: dirigent protein 4-like                 115   2e-27   
ref|XP_010257545.1|  PREDICTED: dirigent protein 19-like                115   2e-27   
ref|XP_006582798.1|  PREDICTED: dirigent protein 23-like                115   2e-27   
ref|NP_199065.1|  disease resistance-responsive (dirigent-like pr...    115   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44377.1|  hypothetical protein AALP_AA1G249600                    115   3e-27   
ref|XP_004243842.2|  PREDICTED: dirigent protein 1-like                 114   3e-27   
gb|AFK35849.1|  unknown                                                 115   3e-27   
ref|XP_006851937.1|  hypothetical protein AMTR_s00041p00178500          114   3e-27   
ref|XP_010416851.1|  PREDICTED: dirigent protein 23-like                114   4e-27   
ref|XP_010520009.1|  PREDICTED: dirigent protein 22-like                114   4e-27   
ref|XP_004289851.1|  PREDICTED: disease resistance response prote...    114   4e-27   
ref|XP_008241179.1|  PREDICTED: dirigent protein 21-like                114   5e-27   
ref|XP_011046639.1|  PREDICTED: dirigent protein 4-like                 114   6e-27   
ref|XP_006836064.1|  hypothetical protein AMTR_s00114p00094280          113   6e-27   
ref|XP_011080616.1|  PREDICTED: dirigent protein 21-like                114   7e-27   
ref|XP_008372887.1|  PREDICTED: dirigent protein 23                     114   8e-27   
gb|AAX96293.1|  At5g42500                                               114   9e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80168.1|  hypothetical protein OsI_35339                          113   9e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_006662777.1|  PREDICTED: dirigent protein 2-like                 113   9e-27   
ref|XP_010024277.1|  PREDICTED: dirigent protein 21-like                114   9e-27   
ref|XP_006851933.1|  hypothetical protein AMTR_s00041p00176840          113   1e-26   
ref|XP_007162362.1|  hypothetical protein PHAVU_001G145600g             113   1e-26   
ref|XP_002986379.1|  hypothetical protein SELMODRAFT_124022             113   1e-26   
ref|XP_004142156.1|  PREDICTED: uncharacterized protein LOC101214557    113   1e-26   
ref|XP_010065287.1|  PREDICTED: dirigent protein 23-like                113   1e-26   
gb|KDP40497.1|  hypothetical protein JCGZ_24496                         112   1e-26   
ref|XP_010023736.1|  PREDICTED: dirigent protein 23-like                113   1e-26   
ref|XP_010024241.1|  PREDICTED: dirigent protein 22-like                113   2e-26   
ref|XP_002863772.1|  disease resistance-responsive family protein       113   2e-26   
gb|KCW90335.1|  hypothetical protein EUGRSUZ_A02479                     113   2e-26   
ref|XP_009775777.1|  PREDICTED: dirigent protein 22-like                113   2e-26   
ref|XP_002513105.1|  Disease resistance response protein, putative      113   2e-26   Ricinus communis
ref|XP_008245704.1|  PREDICTED: dirigent protein 23                     113   2e-26   
ref|XP_002276722.1|  PREDICTED: dirigent protein 23-like                112   2e-26   Vitis vinifera
ref|XP_006366619.1|  PREDICTED: dirigent protein 21-like                112   2e-26   
ref|XP_010549445.1|  PREDICTED: dirigent protein 21-like                112   2e-26   
ref|XP_004151934.1|  PREDICTED: disease resistance response prote...    114   2e-26   
ref|XP_010058355.1|  PREDICTED: dirigent protein 22-like                112   2e-26   
ref|XP_007145709.1|  hypothetical protein PHAVU_007G261700g             112   2e-26   
ref|XP_004158576.1|  PREDICTED: disease resistance response prote...    113   3e-26   
ref|XP_006829349.1|  hypothetical protein AMTR_s01152p00009680          111   3e-26   
ref|XP_009346640.1|  PREDICTED: dirigent protein 23-like                112   3e-26   
ref|XP_010690412.1|  PREDICTED: dirigent protein 23-like                113   3e-26   
ref|XP_010041372.1|  PREDICTED: dirigent protein 23-like                112   3e-26   
ref|XP_003605959.1|  Disease resistance response protein                113   3e-26   
ref|XP_010038598.1|  PREDICTED: dirigent protein 22-like                111   3e-26   
ref|XP_010472088.1|  PREDICTED: dirigent protein 23-like                112   3e-26   
ref|XP_006851934.1|  hypothetical protein AMTR_s00041p00176950          112   3e-26   
gb|EMS46182.1|  hypothetical protein TRIUR3_05228                       112   3e-26   
ref|XP_010429003.1|  PREDICTED: dirigent protein 23                     112   4e-26   
ref|XP_004978852.1|  PREDICTED: disease resistance response prote...    111   5e-26   
ref|XP_003625315.1|  Disease resistance response protein                112   5e-26   
ref|XP_004142155.1|  PREDICTED: uncharacterized protein LOC101214318    112   5e-26   
ref|XP_006851948.1|  hypothetical protein AMTR_s00041p00182920          111   5e-26   
gb|ACN40946.1|  unknown                                                 111   5e-26   Picea sitchensis
ref|XP_011039496.1|  PREDICTED: dirigent protein 22-like                112   5e-26   
ref|XP_009339555.1|  PREDICTED: dirigent protein 23-like                111   5e-26   
emb|CDY21398.1|  BnaA09g30290D                                          111   5e-26   
gb|ACU24649.1|  unknown                                                 111   5e-26   Glycine max [soybeans]
ref|XP_002988690.1|  hypothetical protein SELMODRAFT_184063             111   5e-26   
gb|ABD52128.1|  dirigent-like protein pDIR17                            111   5e-26   Picea sitchensis
ref|XP_008457663.1|  PREDICTED: dirigent protein 23-like                111   6e-26   
ref|XP_009404870.1|  PREDICTED: dirigent protein 22-like                111   6e-26   
ref|XP_006485705.1|  PREDICTED: dirigent protein 23-like                111   6e-26   
ref|XP_007204144.1|  hypothetical protein PRUPE_ppa021998mg             112   6e-26   
ref|XP_006851938.1|  hypothetical protein AMTR_s00041p00178600          111   7e-26   
ref|XP_003625316.1|  Disease resistance response protein                111   7e-26   
ref|XP_002960306.1|  hypothetical protein SELMODRAFT_139600             110   7e-26   
ref|XP_002276741.3|  PREDICTED: dirigent protein 23-like                111   7e-26   Vitis vinifera
ref|XP_010693846.1|  PREDICTED: dirigent protein 22-like                111   7e-26   
emb|CDP10782.1|  unnamed protein product                                110   8e-26   
gb|ACN40835.1|  unknown                                                 111   8e-26   Picea sitchensis
ref|NP_850009.1|  dirigent protein 23                                   111   8e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880356.1|  hypothetical protein ARALYDRAFT_480959             111   8e-26   
ref|XP_010472250.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    111   8e-26   
ref|XP_006404548.1|  hypothetical protein EUTSA_v10000677mg             111   9e-26   
ref|XP_004243690.1|  PREDICTED: dirigent protein 22-like                111   9e-26   
ref|XP_010531503.1|  PREDICTED: dirigent protein 23                     110   9e-26   
ref|XP_008449790.1|  PREDICTED: dirigent protein 7-like                 111   9e-26   
ref|XP_007041903.1|  Disease resistance-responsive family protein...    111   9e-26   
gb|ABD52118.1|  dirigent-like protein pDIR7                             111   9e-26   Picea glauca
gb|ABD52120.1|  dirigent-like protein pDIR9                             111   9e-26   Picea engelmannii x Picea glauca
ref|XP_006295056.1|  hypothetical protein CARUB_v10024124mg             111   9e-26   
gb|ABD52125.1|  dirigent-like protein pDIR14                            110   1e-25   Picea engelmannii x Picea glauca
gb|AFK34612.1|  unknown                                                 110   1e-25   
gb|ABD52114.1|  dirigent-like protein pDIR3                             110   1e-25   Picea engelmannii x Picea glauca
ref|XP_007201657.1|  hypothetical protein PRUPE_ppa022063mg             110   1e-25   
ref|XP_006363502.1|  PREDICTED: dirigent protein 19-like                110   1e-25   
ref|XP_004231599.1|  PREDICTED: dirigent protein 22-like                110   1e-25   
ref|XP_003625317.1|  Disease resistance response protein                110   1e-25   
ref|XP_003576241.1|  PREDICTED: dirigent protein 22-like                110   1e-25   
ref|XP_008356340.1|  PREDICTED: dirigent protein 23-like                110   1e-25   
ref|XP_010693847.1|  PREDICTED: dirigent protein 21-like                112   1e-25   
gb|ABE73781.1|  dirigent-related protein                                110   2e-25   Tamarix androssowii
emb|CDY13841.1|  BnaA09g43430D                                          110   2e-25   
ref|XP_009117440.1|  PREDICTED: dirigent protein 23                     110   2e-25   
ref|XP_010930785.1|  PREDICTED: dirigent protein 22-like                110   2e-25   
ref|XP_006492824.1|  PREDICTED: dirigent protein 23-like                110   2e-25   
ref|XP_010257548.1|  PREDICTED: dirigent protein 19-like                110   2e-25   
gb|KHN07457.1|  Disease resistance response protein 206                 110   2e-25   
ref|XP_010065290.1|  PREDICTED: dirigent protein 23-like                110   2e-25   
ref|XP_008449789.1|  PREDICTED: dirigent protein 20-like                110   2e-25   
ref|XP_003521232.1|  PREDICTED: dirigent protein 21-like                110   2e-25   
ref|XP_008783384.1|  PREDICTED: dirigent protein 22-like                110   2e-25   
emb|CAN61168.1|  hypothetical protein VITISV_038109                     108   2e-25   Vitis vinifera
ref|XP_003554228.1|  PREDICTED: dirigent protein 1-like                 110   2e-25   
ref|XP_006841312.1|  hypothetical protein AMTR_s00134p00124080          110   2e-25   
ref|XP_009601995.1|  PREDICTED: dirigent protein 21-like                110   2e-25   
gb|KDO65648.1|  hypothetical protein CISIN_1g043734mg                   109   2e-25   
ref|XP_009379877.1|  PREDICTED: dirigent protein 21-like                109   3e-25   
ref|XP_002967407.1|  hypothetical protein SELMODRAFT_87141              109   3e-25   
gb|ABR27721.1|  dirigent-like protein                                   109   3e-25   Picea sitchensis
dbj|BAJ89677.1|  predicted protein                                      109   3e-25   
gb|KEH41749.1|  disease resistance response protein                     109   3e-25   
ref|XP_004505770.1|  PREDICTED: disease resistance response prote...    109   3e-25   
ref|XP_006416145.1|  hypothetical protein EUTSA_v10008857mg             109   3e-25   
gb|KDP20413.1|  hypothetical protein JCGZ_06372                         109   3e-25   
ref|XP_007199411.1|  hypothetical protein PRUPE_ppa026244mg             109   3e-25   
ref|XP_002280817.1|  PREDICTED: dirigent protein 2                      109   3e-25   Vitis vinifera
gb|ABR27716.1|  dirigent-like protein                                   109   3e-25   Picea sitchensis
ref|XP_004493624.1|  PREDICTED: disease resistance response prote...    109   3e-25   
ref|XP_010039751.1|  PREDICTED: dirigent protein 23-like isoform X2     109   3e-25   
ref|XP_006841309.1|  hypothetical protein AMTR_s00134p00117580          109   3e-25   
ref|XP_011088568.1|  PREDICTED: dirigent protein 4-like                 109   3e-25   
gb|KDP31386.1|  hypothetical protein JCGZ_11762                         109   4e-25   
ref|XP_004231597.1|  PREDICTED: dirigent protein 22-like                109   4e-25   
ref|XP_009346643.1|  PREDICTED: dirigent protein 23                     109   4e-25   
gb|ABK93789.1|  unknown                                                 109   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004978853.1|  PREDICTED: disease resistance response prote...    108   4e-25   
ref|XP_002323339.2|  hypothetical protein POPTR_0016s06100g             109   4e-25   Populus trichocarpa [western balsam poplar]
ref|NP_001236043.1|  uncharacterized protein LOC100305483 precursor     109   4e-25   
ref|XP_002266452.2|  PREDICTED: dirigent protein 22                     108   4e-25   Vitis vinifera
gb|KHN42871.1|  Disease resistance response protein 206                 109   4e-25   
ref|XP_010257546.1|  PREDICTED: dirigent protein 22-like                109   4e-25   
ref|XP_002966352.1|  hypothetical protein SELMODRAFT_6118               107   5e-25   
ref|XP_010093168.1|  hypothetical protein L484_001308                   109   5e-25   
ref|XP_004978854.1|  PREDICTED: disease resistance response prote...    108   5e-25   
ref|XP_002276258.2|  PREDICTED: dirigent protein 22-like                109   5e-25   Vitis vinifera
ref|XP_010935386.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    109   5e-25   
ref|XP_010090301.1|  hypothetical protein L484_024966                   108   5e-25   
emb|CDP15163.1|  unnamed protein product                                109   6e-25   
ref|XP_002978209.1|  hypothetical protein SELMODRAFT_6231               107   6e-25   
ref|XP_006851932.1|  hypothetical protein AMTR_s00041p00176310          108   6e-25   
gb|KDO70858.1|  hypothetical protein CISIN_1g043227mg                   108   6e-25   
ref|XP_006366617.1|  PREDICTED: dirigent protein 21-like                108   7e-25   
dbj|BAJ99603.1|  predicted protein                                      108   7e-25   
ref|XP_007162358.1|  hypothetical protein PHAVU_001G145200g             108   7e-25   
ref|XP_009759252.1|  PREDICTED: dirigent protein 21-like                108   7e-25   
ref|XP_011088574.1|  PREDICTED: dirigent protein 22-like                108   8e-25   
ref|XP_010690411.1|  PREDICTED: dirigent protein 23-like                108   8e-25   
ref|XP_004147026.1|  PREDICTED: disease resistance response prote...    108   8e-25   
ref|XP_008245703.1|  PREDICTED: dirigent protein 15-like                108   9e-25   
ref|XP_011037132.1|  PREDICTED: dirigent protein 4-like                 108   1e-24   
emb|CAN76521.1|  hypothetical protein VITISV_000433                     107   1e-24   
ref|XP_008372888.1|  PREDICTED: dirigent protein 4-like                 108   1e-24   
ref|XP_003554229.1|  PREDICTED: dirigent protein 2-like                 108   1e-24   
ref|XP_006843315.1|  hypothetical protein AMTR_s00913p00008360          108   1e-24   
emb|CDO96939.1|  unnamed protein product                                108   1e-24   
gb|AFK35208.1|  unknown                                                 108   1e-24   
gb|ADP55101.1|  dirigent-like protein                                   107   1e-24   
ref|XP_010039750.1|  PREDICTED: dirigent protein 23-like isoform X1     110   1e-24   
emb|CDP14404.1|  unnamed protein product                                107   1e-24   
ref|XP_002878187.1|  hypothetical protein ARALYDRAFT_348875             110   1e-24   
ref|XP_002537933.1|  Disease resistance response protein, putative      107   1e-24   
gb|ADP55098.1|  dirigent-like protein                                   107   1e-24   
gb|ABD52123.1|  dirigent-like protein pDIR12                            107   2e-24   
ref|XP_006353783.1|  PREDICTED: dirigent protein 21-like                107   2e-24   
ref|XP_004978855.1|  PREDICTED: disease resistance response prote...    107   2e-24   
ref|XP_010911603.1|  PREDICTED: dirigent protein 22-like                107   2e-24   
gb|ABD52112.1|  dirigent-like protein pDIR1                             107   2e-24   
ref|XP_011037299.1|  PREDICTED: dirigent protein 23-like                107   2e-24   
ref|XP_002280791.1|  PREDICTED: dirigent protein 22                     107   2e-24   
emb|CDO96938.1|  unnamed protein product                                107   2e-24   
gb|ADP55097.1|  dirigent-like protein                                   107   2e-24   
gb|ABR27717.1|  dirigent-like protein                                   107   2e-24   
ref|XP_007162357.1|  hypothetical protein PHAVU_001G145100g             107   2e-24   
ref|XP_007029066.1|  Disease resistance-responsive family protein       107   2e-24   
ref|XP_010693845.1|  PREDICTED: dirigent protein 21-like                107   2e-24   
ref|XP_006363503.1|  PREDICTED: dirigent protein 19-like                107   3e-24   
ref|XP_010527557.1|  PREDICTED: dirigent protein 21-like                107   3e-24   
ref|XP_002312128.2|  disease resistance-responsive family protein       107   3e-24   
ref|XP_002299656.2|  hypothetical protein POPTR_0001s22170g             106   3e-24   
ref|XP_009367567.1|  PREDICTED: dirigent protein 22-like                107   3e-24   
ref|XP_011047083.1|  PREDICTED: dirigent protein 22-like                107   3e-24   
ref|XP_008457658.1|  PREDICTED: dirigent protein 4-like                 106   3e-24   
gb|ABR17958.1|  unknown                                                 106   3e-24   
gb|KHN01514.1|  Disease resistance response protein 206                 107   3e-24   
gb|ABD52115.1|  dirigent-like protein pDIR4                             107   3e-24   
ref|XP_009781679.1|  PREDICTED: dirigent protein 23-like                106   3e-24   
ref|XP_009342233.1|  PREDICTED: dirigent protein 22-like                107   3e-24   
gb|ADN34006.1|  disease resistance response protein                     107   3e-24   
ref|XP_008449786.1|  PREDICTED: dirigent protein 22-like                107   3e-24   
emb|CAN76752.1|  hypothetical protein VITISV_009422                     105   3e-24   
gb|KFK23946.1|  hypothetical protein AALP_AAs47289U000600               109   3e-24   
gb|ADP55095.1|  dirigent-like protein                                   106   4e-24   
ref|NP_001236934.1|  uncharacterized protein LOC100500621 precursor     106   4e-24   
ref|XP_006495204.1|  PREDICTED: dirigent protein 4-like                 106   4e-24   
ref|XP_010429184.1|  PREDICTED: dirigent protein 4-like                 106   4e-24   
ref|XP_004505769.1|  PREDICTED: disease resistance response prote...    106   4e-24   
ref|XP_006838077.1|  hypothetical protein AMTR_s01623p00005280          105   4e-24   
ref|XP_009610660.1|  PREDICTED: dirigent protein 23-like                106   4e-24   
ref|XP_010468131.1|  PREDICTED: dirigent protein 22-like                106   4e-24   
ref|XP_007041905.1|  Disease resistance response protein, putative      106   4e-24   
gb|KDO43263.1|  hypothetical protein CISIN_1g045658mg                   106   4e-24   
ref|XP_009138983.1|  PREDICTED: dirigent protein 21-like                106   5e-24   
ref|NP_179707.1|  dirigent protein 24                                   106   5e-24   
ref|XP_002323336.2|  hypothetical protein POPTR_0016s06070g             106   5e-24   
gb|ABK28504.1|  unknown                                                 106   5e-24   
ref|XP_010429185.1|  PREDICTED: dirigent protein 4-like                 106   5e-24   
ref|XP_003572563.1|  PREDICTED: dirigent protein 22-like                105   5e-24   
gb|KEH28824.1|  disease resistance response protein                     106   5e-24   
ref|XP_006851956.1|  hypothetical protein AMTR_s00041p00187220          106   5e-24   
ref|XP_006359662.1|  PREDICTED: dirigent protein 23-like                106   5e-24   
gb|EMS46181.1|  hypothetical protein TRIUR3_05227                       105   6e-24   
emb|CDP16948.1|  unnamed protein product                                106   6e-24   
gb|EMS59623.1|  hypothetical protein TRIUR3_27692                       105   6e-24   
ref|XP_003603258.1|  Disease resistance response like protein           106   6e-24   
ref|XP_004514163.1|  PREDICTED: disease resistance response prote...    106   6e-24   
gb|KDO83225.1|  hypothetical protein CISIN_1g047858mg                   105   7e-24   
ref|XP_009340248.1|  PREDICTED: dirigent protein 1-like                 105   7e-24   
ref|XP_008669799.1|  PREDICTED: dirigent protein 22-like                105   7e-24   
ref|XP_010910756.1|  PREDICTED: dirigent protein 22-like                105   7e-24   
ref|XP_006295932.1|  hypothetical protein CARUB_v10025069mg             105   7e-24   
ref|XP_003554227.1|  PREDICTED: dirigent protein 21-like                105   7e-24   
ref|XP_010489788.1|  PREDICTED: dirigent protein 22-like                105   8e-24   
ref|XP_009354496.1|  PREDICTED: dirigent protein 19-like                105   8e-24   
ref|XP_010101146.1|  hypothetical protein L484_016710                   105   8e-24   
dbj|BAK01620.1|  predicted protein                                      105   8e-24   
gb|KFK36665.1|  hypothetical protein AALP_AA4G154100                    104   9e-24   
ref|XP_009621800.1|  PREDICTED: dirigent protein 22-like                105   9e-24   
ref|XP_011088570.1|  PREDICTED: dirigent protein 21-like                105   9e-24   
ref|NP_176762.1|  dirigent protein 21                                   105   9e-24   
ref|XP_004248124.1|  PREDICTED: dirigent protein 22-like                105   9e-24   
ref|XP_008789330.1|  PREDICTED: dirigent protein 22-like                105   9e-24   
ref|XP_009588577.1|  PREDICTED: dirigent protein 22-like                105   1e-23   
ref|XP_006847238.1|  hypothetical protein AMTR_s03512p00007580          105   1e-23   
ref|XP_008393377.1|  PREDICTED: dirigent protein 23-like                105   1e-23   
ref|XP_009771303.1|  PREDICTED: dirigent protein 22-like                105   1e-23   
ref|XP_010243404.1|  PREDICTED: dirigent protein 22-like                105   1e-23   
gb|ABD52122.1|  dirigent-like protein pDIR11                            105   1e-23   
ref|XP_007029065.1|  Disease resistance-responsive family protein       105   1e-23   
emb|CDM86465.1|  unnamed protein product                                104   1e-23   
ref|XP_008351900.1|  PREDICTED: dirigent protein 23-like                105   1e-23   
ref|XP_006402810.1|  hypothetical protein EUTSA_v10006492mg             106   1e-23   
gb|ABD52121.1|  dirigent-like protein pDIR10                            105   2e-23   
emb|CDP15168.1|  unnamed protein product                                105   2e-23   
ref|XP_004147025.1|  PREDICTED: uncharacterized protein LOC101215304    105   2e-23   
emb|CDP16467.1|  unnamed protein product                                105   2e-23   
ref|XP_004142157.1|  PREDICTED: uncharacterized protein LOC101214802    105   2e-23   
gb|KGN61910.1|  hypothetical protein Csa_2G264050                       104   2e-23   
gb|EYU31698.1|  hypothetical protein MIMGU_mgv1a026952mg                103   2e-23   
ref|XP_004162008.1|  PREDICTED: uncharacterized LOC101214802            105   2e-23   
ref|NP_001051654.1|  Os03g0809000                                       104   2e-23   
ref|XP_002309288.2|  hypothetical protein POPTR_0006s20990g             105   2e-23   
ref|XP_011092999.1|  PREDICTED: dirigent protein 1-like                 105   2e-23   
gb|ACN41081.1|  unknown                                                 104   2e-23   
ref|XP_010315363.1|  PREDICTED: dirigent protein 23-like                104   2e-23   
ref|XP_007149007.1|  hypothetical protein PHAVU_005G032700g             104   2e-23   
emb|CAN69110.1|  hypothetical protein VITISV_006598                     103   2e-23   
ref|XP_010243401.1|  PREDICTED: dirigent protein 22-like isoform X1     104   2e-23   
ref|XP_006445860.1|  hypothetical protein CICLE_v10016848mg             104   2e-23   
ref|XP_002531174.1|  Disease resistance response protein, putative      104   3e-23   
ref|XP_006495202.1|  PREDICTED: dirigent protein 23-like                104   3e-23   
gb|EMS61803.1|  hypothetical protein TRIUR3_30369                       103   3e-23   
ref|XP_006388055.1|  hypothetical protein POPTR_0378s00200g             104   3e-23   
gb|ABR27719.1|  dirigent-like protein                                   103   3e-23   
ref|XP_010911301.1|  PREDICTED: dirigent protein 21-like                103   3e-23   
dbj|BAJ97815.1|  predicted protein                                      104   3e-23   
ref|XP_006492696.1|  PREDICTED: dirigent protein 19-like                104   3e-23   
ref|NP_001168549.1|  disease resistance response protein 206 prec...    103   3e-23   
emb|CDP13135.1|  unnamed protein product                                103   3e-23   
ref|XP_007162359.1|  hypothetical protein PHAVU_001G145300g             103   4e-23   
ref|NP_001238583.1|  uncharacterized protein LOC100305909 precursor     103   4e-23   
gb|KCW90339.1|  hypothetical protein EUGRSUZ_A02485                     103   4e-23   
ref|XP_002280711.1|  PREDICTED: dirigent protein 22                     103   4e-23   
gb|EAY80172.1|  hypothetical protein OsI_35343                          103   4e-23   
ref|XP_002441906.1|  hypothetical protein SORBIDRAFT_08g004670          103   4e-23   
ref|XP_003625312.1|  Disease resistance response protein                103   4e-23   
ref|XP_007029072.1|  Disease resistance-responsive family protein       103   4e-23   
ref|NP_001065892.1|  Os11g0180000                                       103   4e-23   
ref|NP_001241301.1|  uncharacterized protein LOC100775617 precursor     103   4e-23   
ref|NP_001151025.1|  disease resistance response protein 206 prec...    103   5e-23   
gb|EMT29645.1|  hypothetical protein F775_13105                         103   5e-23   
ref|XP_004231598.1|  PREDICTED: dirigent protein 22-like                103   5e-23   
ref|XP_010520657.1|  PREDICTED: dirigent protein 22-like                103   5e-23   
ref|XP_006361043.1|  PREDICTED: dirigent protein 19-like                103   5e-23   
ref|XP_010024264.1|  PREDICTED: dirigent protein 21-like                103   6e-23   
gb|ABK22746.1|  unknown                                                 102   6e-23   
ref|XP_002280722.1|  PREDICTED: dirigent protein 2-like                 103   6e-23   
ref|XP_003554226.1|  PREDICTED: dirigent protein 21-like                103   6e-23   
gb|EYU40130.1|  hypothetical protein MIMGU_mgv1a015023mg                103   6e-23   
ref|XP_003519012.1|  PREDICTED: dirigent protein 21-like                103   6e-23   
ref|XP_006829391.1|  hypothetical protein AMTR_s04829p00003930          103   6e-23   
ref|XP_004153955.1|  PREDICTED: disease resistance response prote...    103   6e-23   
emb|CDP16945.1|  unnamed protein product                                103   6e-23   
ref|XP_004155035.1|  PREDICTED: disease resistance response prote...    103   7e-23   
ref|XP_002449104.1|  hypothetical protein SORBIDRAFT_05g005200          103   7e-23   
gb|ABK26021.1|  unknown                                                 102   7e-23   
ref|XP_007041902.1|  Disease resistance-responsive family protein...    103   7e-23   
ref|XP_009791434.1|  PREDICTED: dirigent protein 23-like                103   7e-23   
ref|XP_004305538.1|  PREDICTED: disease resistance response prote...    103   8e-23   
ref|XP_003603257.1|  Disease resistance response like protein           103   8e-23   
ref|XP_002461904.1|  hypothetical protein SORBIDRAFT_02g010230          102   8e-23   
gb|AAD29806.1|  putative disease resistance response protein            104   9e-23   
ref|XP_006284589.1|  hypothetical protein CARUB_v10005815mg             102   9e-23   
ref|XP_010690414.1|  PREDICTED: dirigent protein 23-like                102   9e-23   
ref|XP_008453355.1|  PREDICTED: dirigent protein 22-like                102   9e-23   
ref|XP_004248663.1|  PREDICTED: dirigent protein 22-like                103   9e-23   
ref|XP_006366618.1|  PREDICTED: dirigent protein 21-like                102   1e-22   
ref|XP_004138340.1|  PREDICTED: disease resistance response prote...    102   1e-22   
ref|XP_002280963.1|  PREDICTED: dirigent protein 22                     102   1e-22   
gb|EYU37927.1|  hypothetical protein MIMGU_mgv1a018617mg                102   1e-22   
ref|XP_006664383.1|  PREDICTED: dirigent protein 21-like                102   1e-22   
emb|CDP13134.1|  unnamed protein product                                101   1e-22   
gb|AFW56216.1|  disease resistance response protein 206                 102   1e-22   
ref|XP_002514607.1|  Disease resistance response protein, putative      102   1e-22   
ref|NP_001149569.1|  disease resistance response protein 206 prec...    102   1e-22   
ref|XP_010531506.1|  PREDICTED: dirigent protein 15                     102   1e-22   
ref|XP_002880357.1|  disease resistance-responsive family protein       102   1e-22   
ref|XP_011093984.1|  PREDICTED: dirigent protein 21-like                102   1e-22   
gb|KDO39789.1|  hypothetical protein CISIN_1g038159mg                   102   1e-22   
emb|CDX81998.1|  BnaC08g36030D                                          102   1e-22   
ref|XP_004977239.1|  PREDICTED: disease resistance response prote...    102   1e-22   
ref|XP_006851935.1|  hypothetical protein AMTR_s00041p00177300          102   1e-22   
ref|XP_011039494.1|  PREDICTED: dirigent protein 22-like                102   2e-22   
emb|CDP11684.1|  unnamed protein product                                102   2e-22   
gb|AAZ20288.1|  disease resistance-responsive family protein            102   2e-22   
ref|XP_006492823.1|  PREDICTED: dirigent protein 11-like                102   2e-22   
ref|XP_009383450.1|  PREDICTED: dirigent protein 21-like                102   2e-22   
ref|XP_006423624.1|  hypothetical protein CICLE_v10030187mg             102   2e-22   
emb|CDM86466.1|  unnamed protein product                                101   2e-22   
gb|KDO35808.1|  hypothetical protein CISIN_1g029442mg                   102   2e-22   
dbj|BAF02555.1|  hypothetical protein                                   102   2e-22   
gb|KEH28830.1|  disease resistance response protein                     102   2e-22   
ref|XP_007162356.1|  hypothetical protein PHAVU_001G145000g             102   2e-22   
emb|CAB37526.1|  disease resistance response like protein               101   2e-22   
ref|XP_009394038.1|  PREDICTED: dirigent protein 23-like                102   2e-22   
ref|XP_010243405.1|  PREDICTED: dirigent protein 21-like                100   2e-22   
ref|XP_003578856.1|  PREDICTED: dirigent protein 22-like                101   2e-22   
ref|XP_008799043.1|  PREDICTED: dirigent protein 21-like                101   2e-22   
gb|KDO70859.1|  hypothetical protein CISIN_1g029641mg                   101   2e-22   
ref|XP_006386058.1|  hypothetical protein POPTR_0003s21450g             102   2e-22   
ref|XP_006492825.1|  PREDICTED: dirigent protein 3-like                 101   2e-22   
ref|NP_195582.2|  disease resistance-responsive, dirigent domain-...    101   3e-22   
gb|KEH28829.1|  disease resistance response protein                     102   3e-22   
gb|ABR18314.1|  unknown                                                 101   3e-22   
ref|XP_004289176.1|  PREDICTED: disease resistance response prote...    101   3e-22   
ref|XP_010999587.1|  PREDICTED: dirigent protein 22-like                101   3e-22   
emb|CDP16947.1|  unnamed protein product                                101   3e-22   
ref|XP_009131015.1|  PREDICTED: dirigent protein 15                     101   3e-22   
ref|XP_010911804.1|  PREDICTED: dirigent protein 22-like                101   3e-22   
ref|XP_003516988.1|  PREDICTED: dirigent protein 19-like                101   3e-22   
ref|XP_010238662.1|  PREDICTED: dirigent protein 21-like                100   3e-22   
gb|AFK45947.1|  unknown                                                 101   3e-22   
ref|XP_008460022.1|  PREDICTED: dirigent protein 20-like                101   3e-22   
ref|XP_010101145.1|  hypothetical protein L484_016709                   101   3e-22   
gb|KDP40498.1|  hypothetical protein JCGZ_24497                         101   3e-22   
ref|XP_006851946.1|  hypothetical protein AMTR_s00041p00182080          101   4e-22   
ref|XP_010527558.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    103   4e-22   
gb|EYU37925.1|  hypothetical protein MIMGU_mgv1a026652mg                100   4e-22   
ref|XP_006829350.1|  hypothetical protein AMTR_s01736p00007740          101   4e-22   
ref|XP_006366609.1|  PREDICTED: dirigent protein 21-like                101   4e-22   
ref|XP_002323338.1|  hypothetical protein POPTR_0016s06090g             101   4e-22   
ref|XP_006482976.1|  PREDICTED: dirigent protein 7-like                 100   4e-22   
ref|XP_006851930.1|  hypothetical protein AMTR_s00041p00175670          101   4e-22   
ref|XP_004514253.1|  PREDICTED: disease resistance response prote...    101   4e-22   
dbj|BAK04824.1|  predicted protein                                      100   4e-22   
ref|XP_011088572.1|  PREDICTED: dirigent protein 22-like                101   4e-22   
emb|CDY66798.1|  BnaCnng52410D                                          100   5e-22   
ref|XP_010032881.1|  PREDICTED: dirigent protein 19-like                101   5e-22   



>ref|XP_009589829.1| PREDICTED: dirigent protein 1-like [Nicotiana tomentosiformis]
Length=176

 Score =   266 bits (681),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            + +P++TKLVFYVHDYLSG +TSAI+VAG+DGPKT VL FGT+ AVDD VTEGPDPKSKE
Sbjct  25   KRQPKETKLVFYVHDYLSGHDTSAITVAGKDGPKTCVLHFGTMVAVDDRVTEGPDPKSKE  84

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+YINSQLDGKGLHL+FS+IFT+GE+KGS+LEIQGAD+F MKEREFS+VSGTG+F
Sbjct  85   IGRAQGMYINSQLDGKGLHLMFSIIFTDGEFKGSTLEIQGADLFAMKEREFSIVSGTGYF  144

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIMTT+F+DIPNL+AILKLD+TV HY
Sbjct  145  RFVKGYGIMTTQFIDIPNLRAILKLDVTVNHY  176



>emb|CDO98764.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   266 bits (681),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            + KP++T LVFYVHD  +G++TSA++VAG+DGP TS+L+FGT+ AVDDPVTEGPDPKSK+
Sbjct  29   KRKPKETNLVFYVHDNFAGDDTSAMTVAGKDGPTTSILEFGTLAAVDDPVTEGPDPKSKK  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQGLYINSQLDGKGL+LVFSVIFT+GEYKGS+LEIQGAD F++KEREFS+VSGTGFF
Sbjct  89   IGRAQGLYINSQLDGKGLYLVFSVIFTDGEYKGSTLEIQGADPFSVKEREFSIVSGTGFF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIMTTEF+DIPNL+AILKLD+TVRHY
Sbjct  149  RFVKGYGIMTTEFIDIPNLRAILKLDVTVRHY  180



>ref|XP_011094443.1| PREDICTED: dirigent protein 1-like [Sesamum indicum]
Length=180

 Score =   266 bits (680),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R +P++T L FYVHDYL+G +TSA++VAG+DG  TSVL FGT+ AVDDPVTEGPDPKSKE
Sbjct  29   RRQPKKTNLTFYVHDYLTGHDTSAVTVAGKDGHTTSVLHFGTLVAVDDPVTEGPDPKSKE  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+YINSQLDGKGLHLVFSVIFT+GEYKGS+LEIQGADIF MKEREFSVVSGTG+F
Sbjct  89   IGRAQGMYINSQLDGKGLHLVFSVIFTDGEYKGSTLEIQGADIFAMKEREFSVVSGTGYF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIMTTE +DIPNL+ ILKLDITV+HY
Sbjct  149  RFVKGYGIMTTEMLDIPNLRGILKLDITVKHY  180



>ref|XP_009799585.1| PREDICTED: dirigent protein 11-like [Nicotiana sylvestris]
Length=176

 Score =   263 bits (673),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            + +P++TKLVFYVHDYLSG +TSAI+VAG+D P+ SVL FGT+ AVDDPVTE PDPKSKE
Sbjct  25   KRQPKETKLVFYVHDYLSGHDTSAITVAGKDWPQASVLHFGTMVAVDDPVTESPDPKSKE  84

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+YINSQLDGKGLHL+FSVIFT GE+KGS+LEIQGAD+F MKEREFS+VSGTGFF
Sbjct  85   IGRAQGMYINSQLDGKGLHLMFSVIFTHGEFKGSTLEIQGADLFAMKEREFSIVSGTGFF  144

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIMTT F+DIPNLKAILKL +TV+HY
Sbjct  145  RFVKGYGIMTTHFIDIPNLKAILKLHVTVKHY  176



>ref|XP_004229007.1| PREDICTED: dirigent protein 11-like [Solanum lycopersicum]
Length=174

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            +QTKL FYVHDYLSG +TSAI+VAG++GP+TSVL FGTI AVDDPVTEGPD  SK IGRA
Sbjct  27   KQTKLAFYVHDYLSGHDTSAITVAGKEGPQTSVLSFGTIIAVDDPVTEGPDLNSKLIGRA  86

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+YINSQLDGKGLHL+FS+IFT+G YKGS+LEIQGAD+F MKEREFS+VSGTG+FRFV+
Sbjct  87   QGMYINSQLDGKGLHLMFSIIFTDGIYKGSTLEIQGADLFAMKEREFSIVSGTGYFRFVR  146

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+GIMTT F+DIPNLKAILKLD+TV+HY
Sbjct  147  GYGIMTTHFIDIPNLKAILKLDVTVKHY  174



>ref|XP_006358216.1| PREDICTED: dirigent protein 11-like [Solanum tuberosum]
Length=270

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            +QTKL FYVHDYLSG +TSAI+VAG+DGP+TSVL FGTI  VDDPVTEGPD  SK IGRA
Sbjct  123  KQTKLAFYVHDYLSGHDTSAITVAGKDGPQTSVLSFGTIIVVDDPVTEGPDLNSKLIGRA  182

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+YINSQLDGKGLHL+FS+IFT+G YKGS+LEIQGAD+F MKEREFS+VSGTG+FRFV+
Sbjct  183  QGMYINSQLDGKGLHLMFSIIFTDGIYKGSTLEIQGADLFAMKEREFSIVSGTGYFRFVR  242

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+GIMTT F+DIPNLKAILKLD+TV HY
Sbjct  243  GYGIMTTHFIDIPNLKAILKLDVTVNHY  270



>ref|XP_010024793.1| PREDICTED: dirigent protein 11-like [Eucalyptus grandis]
Length=180

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            RH+PR+T LVFYVHDYL+G + SA++VAGR GP++S+L FGT+  VDDPVTEGP  +S+E
Sbjct  29   RHQPRETNLVFYVHDYLTGHDASAVAVAGRAGPESSILHFGTVLVVDDPVTEGPTIESRE  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y+NSQLDGKGLHLVFSVIFT+GE++GS+LEIQGAD+F+M EREF VVSGTG F
Sbjct  89   IGRAQGMYVNSQLDGKGLHLVFSVIFTDGEHEGSTLEIQGADLFSMAEREFGVVSGTGKF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+G+M TEFMDI NL+A+LKL++TV+HY
Sbjct  149  RFVKGYGVMVTEFMDIANLRAVLKLNVTVKHY  180



>gb|KDP27914.1| hypothetical protein JCGZ_18994 [Jatropha curcas]
Length=206

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +H+P+QT LV YVHDY +G +TSA++VAG+ GP  S+LQFG+I  VDDPVTEGP  +SKE
Sbjct  55   QHQPKQTNLVVYVHDYFTGHDTSAVTVAGKSGPDFSILQFGSIAIVDDPVTEGPTIESKE  114

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG YINSQLDGKGL++VFS+IFT+G+YKGS+LEIQG+DIF+MKEREF +VSGTGFF
Sbjct  115  IGRAQGSYINSQLDGKGLYMVFSLIFTDGDYKGSTLEIQGSDIFSMKEREFGIVSGTGFF  174

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIM T+FMDIPNL+AI+KL++TV+HY
Sbjct  175  RFVKGYGIMQTQFMDIPNLRAIIKLNVTVKHY  206



>gb|KCW61289.1| hypothetical protein EUGRSUZ_H04044, partial [Eucalyptus grandis]
Length=174

 Score =   238 bits (607),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            RH+PR+T LVFYVHDYL+G + SA++VAGR GP++S+L FGT+  VDDPVTEGP  +S+E
Sbjct  29   RHQPRETNLVFYVHDYLTGHDASAVAVAGRAGPESSILHFGTVLVVDDPVTEGPTIESRE  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y+NSQLDGKGLHLVFSVIFT+GE++GS+LEIQGAD+F+M EREF VVSGTG F
Sbjct  89   IGRAQGMYVNSQLDGKGLHLVFSVIFTDGEHEGSTLEIQGADLFSMAEREFGVVSGTGKF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLD  238
            RFVKG+G+M TEFMDI NL+A+LKL+
Sbjct  149  RFVKGYGVMVTEFMDIANLRAVLKLN  174



>ref|XP_010097777.1| hypothetical protein L484_004191 [Morus notabilis]
 gb|EXB71056.1| hypothetical protein L484_004191 [Morus notabilis]
Length=180

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P+QT LVFYVHDY +G +TSA +VAG+ GP +SVL FGT+ AVDD VT GP  +SKEIG
Sbjct  31   QPKQTNLVFYVHDYFTGRDTSAATVAGKSGPTSSVLHFGTLVAVDDKVTVGPGVESKEIG  90

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+YINS LDGKGLH+VFSV+FT GE+KGSSLEIQGAD+F  KEREF VVSGTG+FRF
Sbjct  91   RAQGMYINSALDGKGLHMVFSVVFTGGEFKGSSLEIQGADLFAKKEREFGVVSGTGYFRF  150

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            VKG+G+M TE+MD+ NL+A++K +ITV+HY
Sbjct  151  VKGYGVMETEYMDLANLRAVIKHNITVKHY  180



>ref|XP_008438952.1| PREDICTED: dirigent protein 11-like [Cucumis melo]
Length=182

 Score =   231 bits (588),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P QT LV YVHDY +GE+ SAI+V GR GP++SVL+FGT+  VDDPVTEGP  +S+EIG
Sbjct  33   QPNQTNLVVYVHDYFTGEDASAITVGGRKGPESSVLEFGTVIVVDDPVTEGPKIESREIG  92

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+YINSQ DGKGL++VFS+IF+ GE+ GSSLEIQG+D+F MKEREF V SGTGFFRF
Sbjct  93   RAQGMYINSQSDGKGLYMVFSLIFSGGEFGGSSLEIQGSDLFTMKEREFGVASGTGFFRF  152

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            VKGFGIM TE MD+ NL+A++KL+ITV+HY
Sbjct  153  VKGFGIMQTESMDLVNLRAVIKLNITVKHY  182



>ref|XP_002519227.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF43091.1| Disease resistance response protein, putative [Ricinus communis]
Length=182

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             +P+QT L+ YVHDY +G++ SAI+VAG+ G    +LQFGT+  VDD +TEGP  +S+EI
Sbjct  32   QEPKQTNLLLYVHDYFTGDDMSAITVAGKSGSNFHILQFGTVAVVDDLITEGPTVESREI  91

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG Y NSQLDGKGL++VFS+IFT GEYKGS+LEIQG+DIF++KEREF VVSGTGFFR
Sbjct  92   GRAQGTYTNSQLDGKGLYMVFSLIFTHGEYKGSTLEIQGSDIFSLKEREFGVVSGTGFFR  151

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FVKG+G M T+FMDIPNL+AI+KL++TV+HY
Sbjct  152  FVKGYGTMQTQFMDIPNLRAIIKLNVTVKHY  182



>ref|XP_003528619.1| PREDICTED: dirigent protein 11-like [Glycine max]
Length=180

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R +P QT LVFYVHD+ +GE+++A +VAG+ GP +++L FGT+  VDDPVT GP   S  
Sbjct  29   RLQPNQTNLVFYVHDHFTGEHSTAATVAGKSGPASNILHFGTVAIVDDPVTVGPSDDSAL  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y+NSQLDGKGL++VFSVIFT+GE+KGSSLEIQG+DIF +KEREF VVSGTG+F
Sbjct  89   IGRAQGMYVNSQLDGKGLYMVFSVIFTDGEFKGSSLEIQGSDIFTVKEREFGVVSGTGYF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIM T FMDI NL+A LKL++TV+HY
Sbjct  149  RFVKGYGIMETVFMDIANLRATLKLNVTVKHY  180



>ref|XP_004508149.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=180

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R +P QT LVF+VHD+ +GE+T+A +VAG+ GP +S+L FGT+  VDDPVT+GP   S  
Sbjct  29   RLQPNQTNLVFFVHDHFTGEDTTAATVAGKTGPTSSILHFGTVAIVDDPVTDGPTMDSTL  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+YINSQLDGK L +VFSVIFT G+Y+GSSLEIQG+DIF MK+REF +VSGTG+F
Sbjct  89   IGRAQGVYINSQLDGKALFMVFSVIFTTGQYRGSSLEIQGSDIFTMKKREFGIVSGTGYF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+G+M TEFMD+ NL+A LKL++TV+HY
Sbjct  149  RFVKGYGVMETEFMDLVNLRATLKLNVTVKHY  180



>ref|XP_003609777.1| Disease resistance response protein [Medicago truncatula]
 gb|AES91974.1| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=180

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P QT LVFYVHD+ +GE+++A +VAG+ G  +S+L FGT+  VDDPVTEGP   SK IG
Sbjct  31   EPNQTNLVFYVHDHFTGEDSTAATVAGKTGVTSSILHFGTVAIVDDPVTEGPTMDSKLIG  90

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG YINSQLDGK L++VFSVIFT GEY+GS+LEIQG+DIF  KEREF +VSGTG+FRF
Sbjct  91   RAQGTYINSQLDGKALYMVFSVIFTAGEYRGSTLEIQGSDIFTTKEREFGIVSGTGYFRF  150

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            VKG+GIM TEFMD+ NL+A LKL++TV+HY
Sbjct  151  VKGYGIMETEFMDLVNLRATLKLNVTVKHY  180



>gb|KDO37162.1| hypothetical protein CISIN_1g046562mg [Citrus sinensis]
Length=180

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R + ++T LV YVHDY +G +TSAI+VAG+DGP + +L+FGTI  VDD VTEGP   SK+
Sbjct  29   RQEAKETNLVLYVHDYFTGRDTSAITVAGKDGPTSHILRFGTIAVVDDAVTEGPTIDSKQ  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y+NSQLDGK L++ FS+IFT+GE+KGS+LEIQG+DIF MK+REF VVSGTG F
Sbjct  89   IGRAQGIYVNSQLDGKALYMAFSLIFTDGEFKGSTLEIQGSDIFAMKQREFGVVSGTGHF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIM T+F+D+ NL  I+KL++TV+HY
Sbjct  149  RFVKGYGIMETQFLDVANLNGIIKLNVTVKHY  180



>ref|XP_003550557.1| PREDICTED: dirigent protein 21-like [Glycine max]
Length=180

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R +P+QT LVFYVHD+ +GE ++A +VAG+ GP +++L FGT+  VDDPVT GP   SK 
Sbjct  29   RLQPKQTNLVFYVHDHFTGELSTAATVAGKSGPASNILHFGTVAVVDDPVTVGPSDDSKL  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y+NSQLDGKGL++VFSVIFT G++KGSSLEIQG+DIF M EREF VVSGTG+F
Sbjct  89   IGRAQGIYVNSQLDGKGLYMVFSVIFTNGKFKGSSLEIQGSDIFTMTEREFGVVSGTGYF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIM T FMDI +L A LKL++TV+HY
Sbjct  149  RFVKGYGIMETVFMDIASLMATLKLNVTVKHY  180



>ref|XP_004165482.1| PREDICTED: uncharacterized protein LOC101224120 [Cucumis sativus]
Length=182

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P QT LV YVHDY +GE+ SAI+V GR GP++SVL+FGT   VDD VTEGP  +S+EIG
Sbjct  33   QPNQTNLVVYVHDYFTGEDASAITVGGRKGPESSVLEFGTQMVVDDLVTEGPKIESREIG  92

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+YINSQ DGKGL++VFSVIF+ GE++GSSLEIQG D+F MKEREF VVSGTGFFRF
Sbjct  93   RAQGMYINSQSDGKGLYMVFSVIFSGGEFRGSSLEIQGPDLFTMKEREFGVVSGTGFFRF  152

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            VKGFGIM TE MD+ +L+A++KL+ITV HY
Sbjct  153  VKGFGIMQTESMDLVHLRAVIKLNITVNHY  182



>ref|XP_004134245.1| PREDICTED: uncharacterized protein LOC101211957 [Cucumis sativus]
 gb|KGN57168.1| hypothetical protein Csa_3G166330 [Cucumis sativus]
Length=182

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P QT LV YVHDY +GE+ SAI+V GR GP++SVL+FGT   VDD VTEGP   S+EIG
Sbjct  33   QPNQTNLVVYVHDYFTGEDASAITVGGRKGPESSVLEFGTQMVVDDLVTEGPKIDSREIG  92

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+YINSQ DGKGL++VFSVIF+ GE++GSSLEIQG D+F MKEREF VVSGTGFFRF
Sbjct  93   RAQGMYINSQSDGKGLYMVFSVIFSGGEFRGSSLEIQGPDLFTMKEREFGVVSGTGFFRF  152

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            VKGFGIM TE MD+ +L+A++KL+ITV HY
Sbjct  153  VKGFGIMQTESMDLVHLRAVIKLNITVNHY  182



>ref|XP_006419382.1| hypothetical protein CICLE_v10007072mg [Citrus clementina]
 ref|XP_006488841.1| PREDICTED: dirigent protein 11-like [Citrus sinensis]
 gb|ESR32622.1| hypothetical protein CICLE_v10007072mg [Citrus clementina]
Length=180

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R + +++ LV YVHDY +G +TSAI+VAG+DGP + +L+FGTI  VDD VTEGP   SK+
Sbjct  29   RQEAKESNLVLYVHDYFTGRDTSAITVAGKDGPTSHILRFGTIAVVDDAVTEGPTIDSKQ  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y+NSQLDGK L++ FS+IFT+GE+KGS+LEIQG+DIF MK+REF VVSGTG F
Sbjct  89   IGRAQGIYVNSQLDGKALYMAFSLIFTDGEFKGSTLEIQGSDIFAMKQREFGVVSGTGHF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+GIM T+F+D+ NL  I+KL++TV+HY
Sbjct  149  RFVKGYGIMETQFLDVANLNGIIKLNVTVKHY  180



>ref|XP_010921454.1| PREDICTED: dirigent protein 11-like [Elaeis guineensis]
Length=178

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            +R  P+QT LV YVHDY SG+  SA +VAG+ G  +++LQFGTI  VDD VTEGP+  SK
Sbjct  26   HRRMPKQTNLVLYVHDYFSGDAKSATTVAGKLGAASNILQFGTIAVVDDVVTEGPEVDSK  85

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             IGRAQGLY+NS LDG  L++VFSV FTEG +KGS+LEIQGAD F ++EREF VVSGTGF
Sbjct  86   VIGRAQGLYVNSALDGTALYMVFSVTFTEGRFKGSTLEIQGADPFKLREREFGVVSGTGF  145

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FRF KG+GIM T+ MD+ NL+AI+KL+ITVR+
Sbjct  146  FRFAKGYGIMETQHMDVANLRAIIKLNITVRN  177



>ref|XP_008781145.1| PREDICTED: dirigent protein 11-like [Phoenix dactylifera]
Length=179

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            +R KP+QT LV YVHDY SG++ SA++VAG+ G  +++LQFGT+  VDD VTE P+  SK
Sbjct  27   HRRKPKQTNLVLYVHDYFSGDDASAVTVAGKLGAASNILQFGTVAVVDDVVTERPEVDSK  86

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             IGRAQGLYINS LDG  L++VFSV  TEG++KGS+LEIQGAD F +KEREF VVSGTGF
Sbjct  87   VIGRAQGLYINSALDGMALYMVFSVTLTEGQFKGSTLEIQGADPFKLKEREFGVVSGTGF  146

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FRF KG+GIM T+ +D+  L+AI+KL++T+RH
Sbjct  147  FRFAKGYGIMETQHLDVATLRAIIKLNLTIRH  178



>gb|KHN02894.1| Disease resistance response protein 206 [Glycine soja]
Length=158

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  615  NTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQLDGKGLHL  436
            NT     AG+ GP +++L FGT+  VDDPVT GP   S  IGRAQG+Y+NSQLDGKGL++
Sbjct  27   NTPPPPRAGKCGPASNILHFGTVAIVDDPVTVGPSDDSALIGRAQGMYVNSQLDGKGLYM  86

Query  435  VFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTEFMDIPNLK  256
            VFSVIFT+GE+KGSSLEIQG+DIF +KEREF VVSGTG+FRFVKG+GIM T FMDI NL+
Sbjct  87   VFSVIFTDGEFKGSSLEIQGSDIFTVKEREFGVVSGTGYFRFVKGYGIMETVFMDIANLR  146

Query  255  AILKLDITVRHY  220
            A LKL++TV+HY
Sbjct  147  ATLKLNVTVKHY  158



>ref|XP_003609779.1| Disease resistance response protein [Medicago truncatula]
 gb|AES91976.1| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=180

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            + +P QT ++FY+HD+ +GENTSA++VAG +GP  ++  FGT+  +DDPVTEGP   S  
Sbjct  29   KLEPNQTNMLFYIHDHFTGENTSAVTVAGINGPNFNIQHFGTVAIIDDPVTEGPAMDSTL  88

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +G AQG+Y+NSQLD K +++VFSVIFT G+Y GS+LE+QG  ++  KEREF +VSGTG+F
Sbjct  89   LGSAQGVYVNSQLDSKAVYMVFSVIFTSGKYIGSTLEMQGYSLYTTKEREFGIVSGTGYF  148

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFVKG+ +M T+ +D+  L+   KL++T++HY
Sbjct  149  RFVKGYAVMETQSVDLATLRTTFKLNVTIKHY  180



>ref|XP_007154378.1| hypothetical protein PHAVU_003G114200g [Phaseolus vulgaris]
 gb|ESW26372.1| hypothetical protein PHAVU_003G114200g [Phaseolus vulgaris]
Length=145

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + +QT LVFYVHD+ +G++++A +VAG+ GP +S+L FGT+  VDDPVTEGP+  S  IG
Sbjct  26   QSKQTNLVFYVHDHFTGDHSTASTVAGKTGPASSILNFGTVAIVDDPVTEGPNIDSALIG  85

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            RAQG+YINSQLDGKGL++VFSVIFT GE+KGSSLEIQG+DIF MKEREF VVSGTG+FR
Sbjct  86   RAQGMYINSQLDGKGLYMVFSVIFTTGEFKGSSLEIQGSDIFTMKEREFGVVSGTGYFR  144



>ref|XP_002270487.1| PREDICTED: dirigent protein 22-like [Vitis vinifera]
Length=179

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT++VFY+HD+ +G N +AI +AG      +V  F TI A+DD +TE  D  S +IG
Sbjct  30   KLKQTQVVFYMHDWETGANVTAIPIAGLPKKPWAVGTFATIIAIDDALTETIDRNSAQIG  89

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y+NS LDG  LH + SV+FT  +Y GSSLEIQGA+ F  K RE SVVSGTG FR 
Sbjct  90   RAQGIYVNSALDGSDLHFLMSVVFTNKQYNGSSLEIQGANRFFNKYREVSVVSGTGMFRL  149

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ I+ T ++D+P   AI++ ++TV HY
Sbjct  150  ARGYAILETVYLDLPVSNAIIRWNVTVLHY  179



>emb|CAN61316.1| hypothetical protein VITISV_023979 [Vitis vinifera]
Length=179

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT++VFY+HD+ +G N +AI +AG      +V  F TI A+DD +TE  D  S +IG
Sbjct  30   KLKQTQVVFYMHDWETGANVTAIPIAGLPKKPWAVGTFATIIAIDDALTETIDRNSAQIG  89

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y+NS LDG  LH + SV+FT  +Y GSSLEIQGA+ F  K RE SVVSGTG FR 
Sbjct  90   RAQGIYVNSALDGSDLHFLMSVVFTNKQYNGSSLEIQGANRFFNKYREVSVVSGTGMFRL  149

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ I+ T ++D+P   AI++ ++TV HY
Sbjct  150  ARGYAILETVYLDLPVSNAIIRWNVTVLHY  179



>ref|XP_009783175.1| PREDICTED: dirigent protein 1-like [Nicotiana sylvestris]
Length=100

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 10/110 (9%)
 Frame = -1

Query  549  ITAVDDPVTEGPDPKSKEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD  370
            +  V DPVTEGPDPKSKEIGRAQG+YINSQLDGKGLHL+ SVIFT+GE+KGS+LEI GAD
Sbjct  1    MVVVYDPVTEGPDPKSKEIGRAQGMYINSQLDGKGLHLMLSVIFTDGEFKGSTLEIPGAD  60

Query  369  IFNMKEREFSVVSGTGFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            +F MKEREFS+VSGTGF          TT F+D+PNL AILKL +TV+HY
Sbjct  61   LFAMKEREFSIVSGTGF----------TTHFIDMPNLIAILKLHVTVKHY  100



>ref|XP_002270588.1| PREDICTED: dirigent protein 22 [Vitis vinifera]
 emb|CBI28818.3| unnamed protein product [Vitis vinifera]
Length=179

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT++VFY+HD+ +G N +AI +AG      +V  F TI A+DD +TE  D  S +IG
Sbjct  30   KLKQTQVVFYMHDWETGANVTAIPIAGLPKKPWAVGTFATIIAIDDALTETIDRNSAQIG  89

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y+NS LDG  LH + SV+FT  +Y GSSLEIQGA+ F  K RE SVVSGTG FR 
Sbjct  90   RAQGIYVNSALDGSDLHFLMSVVFTNKQYNGSSLEIQGANRFFNKYREVSVVSGTGMFRL  149

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ I+ T ++D+P   AI++ ++TV HY
Sbjct  150  ARGYAILETVYLDLPVSNAIIRWNVTVLHY  179



>ref|XP_002269397.1| PREDICTED: dirigent protein 23 [Vitis vinifera]
 emb|CBI28817.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT +VFY+ ++ SG N ++I VAG      + L FGTI A+DD +TE  D KS ++G
Sbjct  28   KLKQTNIVFYMQEWESGANITSIPVAGIPKKPWATLAFGTIFAIDDALTESSDRKSAQVG  87

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+++N+ LDG  LHL+ S++FT  EY GS+LEIQGAD    K RE SVVSGTG FRF
Sbjct  88   RAQGIFVNTALDGTDLHLLMSLVFTNKEYNGSTLEIQGADRQFQKYREVSVVSGTGKFRF  147

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+  + T ++D+PN  AIL+ ++TV  +
Sbjct  148  ARGYATLETVYLDMPNANAILRWNVTVLSF  177



>emb|CAN61315.1| hypothetical protein VITISV_023978 [Vitis vinifera]
Length=177

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT +VFY+ ++ SG N ++I VAG      + L FGTI A+DD +TE  D KS ++G
Sbjct  28   KLKQTNIVFYMQEWESGANITSIPVAGIPKKPWATLAFGTIFAIDDALTESSDRKSAQVG  87

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RA G+++N+ LDG  LHL+ S++FT  EY GS+LEIQGAD    K RE SVVSGTG FRF
Sbjct  88   RAXGIFVNTALDGTDLHLLMSLVFTNKEYNGSTLEIQGADRXFQKYREVSVVSGTGKFRF  147

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+  + T ++DIPN  AIL+ ++TV  +
Sbjct  148  ARGYATLETVYLDIPNANAILRWNVTVLSF  177



>ref|XP_010089481.1| hypothetical protein L484_011935 [Morus notabilis]
 gb|EXB37874.1| hypothetical protein L484_011935 [Morus notabilis]
Length=187

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K ++T LVFY+HDY +G N + +++AG       +L+FGT+ A+DD +TE  D  S ++
Sbjct  38   RKLKETNLVFYMHDYATGRNATVLNIAG-PANHFDILKFGTMVAIDDKLTEAYDWDSPQV  96

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRA+G+Y NS ++G  L+L  S++FT  EY GS+L+IQG+D F +K RE SV+SGTG FR
Sbjct  97   GRARGVYANSAVEGNDLYLSMSLVFTNREYNGSTLQIQGSDRFFIKYRELSVMSGTGKFR  156

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
              +GF I+ T  +D+P L AIL+ ++TV H
Sbjct  157  MARGFAILETMLLDLPTLNAILRCNVTVFH  186



>ref|XP_010089480.1| hypothetical protein L484_011934 [Morus notabilis]
 gb|EXB37873.1| hypothetical protein L484_011934 [Morus notabilis]
Length=226

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K ++T LVFY+HDY +G N + +++AG       +L+FGT+ A+DD +TE  D  S ++
Sbjct  77   RKLKETNLVFYMHDYATGRNATVLNIAG-PANHFDILKFGTMVAIDDKLTEAYDWDSPQV  135

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRA+G+Y NS ++G  L+L  S++FT  EY GS+L+IQG+D F +K RE SV+SGTG FR
Sbjct  136  GRARGVYANSAVEGNDLYLSMSLVFTNREYNGSTLQIQGSDRFFIKYRELSVMSGTGKFR  195

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
              +GF I+ T  +D+P L AIL+ ++TV H
Sbjct  196  MARGFAILETMLLDLPTLNAILRCNVTVFH  225



>ref|XP_008230043.1| PREDICTED: dirigent protein 1-like [Prunus mume]
Length=181

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            H+ R+T+L FY  D  +G N + I  AG  G   +  QF T+ A+DDPVTEG  P S  +
Sbjct  31   HEVRETQLSFYFQDIFAGPNATDIPFAGISGKAWTFTQFATLYAIDDPVTEGSHPNSASV  90

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GR QG  + S LDG   H++FS++FT  +Y GS+L+IQG D      RE SVVSGTG FR
Sbjct  91   GRVQGTSMTSALDGLNAHVLFSIVFTNKKYNGSTLQIQGIDKQFEPVRELSVVSGTGKFR  150

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FV+G+    T  +DIPN  A+++ ++TV+HY
Sbjct  151  FVRGYITFETISVDIPNSYAVIRCNVTVKHY  181



>ref|XP_007217311.1| hypothetical protein PRUPE_ppa016125mg, partial [Prunus persica]
 gb|EMJ18510.1| hypothetical protein PRUPE_ppa016125mg, partial [Prunus persica]
Length=219

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 97/152 (64%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
             H+ ++T+L FY  D  +G N + I  AG  G   +  QF T+ A+DDPVTEG  P S  
Sbjct  68   NHEVKETQLSFYFQDIFAGPNATDIPFAGISGKAWTFTQFATLYAIDDPVTEGSHPNSAS  127

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GR QG  + S LDG   H++FS++FT  +Y GS+L+IQG D      RE SVVSGTG F
Sbjct  128  VGRVQGTSMTSALDGLNAHVLFSIVFTNKKYNGSTLQIQGIDKQFEPVRELSVVSGTGKF  187

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RFV+G+    T  +DIPN  A+++ ++TV+HY
Sbjct  188  RFVRGYITFETISVDIPNSYAVIRCNVTVKHY  219



>ref|XP_009365226.1| PREDICTED: dirigent protein 11-like [Pyrus x bretschneideri]
Length=183

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 100/151 (66%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            H+ ++T L FY HD+LSG N + ++ AG  G   +  QF T+ A D P+TEG D KS  +
Sbjct  33   HESKETHLSFYAHDFLSGPNITDVAFAGIPGKIWNYDQFATVYAEDAPLTEGIDLKSASV  92

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GR QG+++ + LDG+  + + S++FT  EY GS+L+IQG D    + RE SVVSGTG FR
Sbjct  93   GRIQGMFMVTSLDGRNSYDMLSIMFTNKEYNGSTLQIQGIDKQFEQHRELSVVSGTGKFR  152

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+ +  T F+D+PN   + + ++TV+HY
Sbjct  153  FARGYIMCNTVFVDLPNAYFVTQCNVTVKHY  183



>ref|XP_008365542.1| PREDICTED: dirigent protein 11-like [Malus domestica]
Length=183

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 101/151 (67%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            H+ ++T L FY HD+LSG N + ++ AG  G   +  QF T+ A D P+TEG D KS  +
Sbjct  33   HEFKETHLXFYAHDFLSGANITDVAFAGIPGKIWNYNQFATVYAEDAPLTEGMDLKSASV  92

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GR QG+++ S LDG+  + + S++FT  +Y GS+L+IQG D    + RE SVVSGTG FR
Sbjct  93   GRIQGMFMVSSLDGRNSYDMLSIVFTNKKYNGSTLQIQGIDKQFEQYRELSVVSGTGKFR  152

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FV+G+ +  T F+D+PN   + + ++TV+H+
Sbjct  153  FVRGYIMCNTVFVDLPNAYFVTQCNVTVKHH  183



>ref|XP_002269348.1| PREDICTED: dirigent protein 4 [Vitis vinifera]
 emb|CBI28816.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = -1

Query  597  VAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQLDGKGLHLVFSVIF  418
            VAG    +  +L+FGTI A DD +TE  D  S ++GRA G+Y+NS L G  LHL+ S++F
Sbjct  2    VAGNTKRRWYILEFGTIFATDDALTESIDRNSTQVGRAHGIYVNSALGGSDLHLLMSLVF  61

Query  417  TEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTEFMDIPNLKAILKLD  238
            T  EY GS+L+IQGAD F  K RE SVVSGTG FRF +G+  + T ++DIP   AI++ +
Sbjct  62   TNKEYNGSTLQIQGADRFLHKYREVSVVSGTGKFRFARGYATLETVYLDIPGSNAIIRWN  121

Query  237  ITVRHY  220
            +T  HY
Sbjct  122  VTFLHY  127



>ref|XP_002524832.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37552.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 93/151 (62%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             + ++ K+  Y  D  SG N + I VAG      +  QFGTI   D+P+TE  DP S  +
Sbjct  28   QQAKEIKMSLYFQDISSGPNATVIPVAGIAAKHWTFTQFGTIFVTDEPITETADPNSAPV  87

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y  S LDG   H++ S++FT GEY GS+L+IQG+       RE +VV+GTG FR
Sbjct  88   GRAQGIYATSALDGLNAHVMISIVFTNGEYGGSTLQIQGSSKQFEGVREVAVVAGTGLFR  147

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            + +G+    T ++DIP   +I++ +I+V HY
Sbjct  148  YARGYATFETYYLDIPAAYSIIRCNISVLHY  178



>gb|EYU43119.1| hypothetical protein MIMGU_mgv1a021554mg [Erythranthe guttata]
Length=175

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 90/150 (60%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P++TK+ FY  DY  G N + I + G+     S  +FG I   DDP+TEG D  S +I 
Sbjct  26   QPKETKMAFYFQDYSGGPNATVIEITGQPNGLLSFTKFGAIFCTDDPITEGFDESSAQIA  85

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY+ S LDG   H++ S++FT  EY+GS+LE+QG      + RE +VV GTG FR 
Sbjct  86   RAQGLYVTSALDGSNTHVLISIVFTNNEYRGSTLEVQGTSAQFERVREVAVVGGTGIFRL  145

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T   D     A+++ ++TV HY
Sbjct  146  ARGYATFETLHYDHALHYAVIQCNVTVYHY  175



>ref|XP_009347128.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=175

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R + ++TKL  + HD+++G NT+ I VAG  G   +  QFGT+   DDP+T  PD  S  
Sbjct  24   RSQLKETKLTVFFHDFVAGPNTTVIPVAGIAGKLWTFTQFGTVYVTDDPLTATPDLNSAV  83

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GR QG+Y+ S LDG   H++ S++FT  +Y GS+LEIQG        RE SVVSGTG F
Sbjct  84   VGRGQGVYVTSGLDGLNTHVLISIVFTNKKYNGSTLEIQGTSKQFEAVREVSVVSGTGKF  143

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RF +G+    T  +D     ++ + ++TV HY
Sbjct  144  RFARGYATFETLLVDAATFYSVERCNVTVEHY  175



>ref|XP_009353297.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=175

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R + ++TKL  + HD+++G NT+ I VAG  G   +  QFGT+   DDP+T  PD  S  
Sbjct  24   RSQLKETKLTVFFHDFVAGPNTTVIPVAGIAGKLWTFTQFGTVYVTDDPLTATPDLNSAV  83

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GR QG+Y+ S LDG   H++ S++F   +Y GS+LEIQG        RE SVVSGTG F
Sbjct  84   VGRGQGVYVTSGLDGLNTHVLISIVFANKKYNGSTLEIQGTSKQFEAVREVSVVSGTGKF  143

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RF +G+    T  +D     ++ + ++TV HY
Sbjct  144  RFARGYATFETLLVDAATFYSVERCNVTVEHY  175



>ref|XP_004309140.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=183

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            ++T +  Y+HD++SG N + I VAG  G   +  QFG+    D+P+TEGP   S  +GRA
Sbjct  36   KETNMSMYLHDFISGPNVTDIPVAGVAGKLWTFSQFGSFYVTDNPLTEGPSLHSPAVGRA  95

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+++ S LDG    +VFSV FT  EY GS++EIQG  I     RE SVVSGTG FRF +
Sbjct  96   QGVFVASALDGLSALIVFSVRFTNKEYNGSTIEIQGNSILMEPVRELSVVSGTGKFRFAR  155

Query  303  GFGIMTTEF--MDIPNLKAILKLDITVRH  223
            G+   T EF  +D P   A+++L+ITV H
Sbjct  156  GYA--TCEFYSVDTPAGYAVVRLNITVEH  182



>ref|XP_004289175.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=144

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLY  472
            +V Y  D+  G N ++I +AG  G   +  QFGT+  +DD +T+GP PKS  +GRAQG+ 
Sbjct  1    MVLYFQDFSGGPNATSIPIAGIAGKLWTFTQFGTVYVIDDTMTQGPSPKSAVVGRAQGVT  60

Query  471  INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGI  292
            + + LDG    ++ S++FT  EY GS++EIQG        RE +VVSGTG FRF +G+  
Sbjct  61   VAAALDGSNALVLVSLVFTNREYNGSTIEIQGNSKQFQPVREVAVVSGTGKFRFARGYAT  120

Query  291  MTTEFMDIPNLKAILKLDITVRHY  220
              T F+D+P+  +IL+ ++TV+HY
Sbjct  121  FETYFVDLPSAYSILRCNVTVQHY  144



>gb|KCW88771.1| hypothetical protein EUGRSUZ_A01115 [Eucalyptus grandis]
Length=178

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 2/150 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
              P  TKLV Y  D ++G N + I V G  G   S  QFGT+   D+P+TE PDP S  +
Sbjct  30   QPPLTTKLVLYFQDIIAGPNANDIPVVGIPGKLWSFSQFGTMFVADEPITETPDPNSAMV  89

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y+ + LDG  +  VFS++FT   Y GS+LE+QGA     +  EF+VV GTG FR
Sbjct  90   GRAQGMYVTASLDGSNVQTVFSIVFTNQAYNGSTLELQGAGNQLQRVLEFAVVGGTGKFR  149

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            F +G+   T E +      A+++L++TVRH
Sbjct  150  FARGY--TTFETISFSQGHAVVQLNVTVRH  177



>ref|XP_010046355.1| PREDICTED: dirigent protein 2-like [Eucalyptus grandis]
Length=186

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 2/150 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
              P  TKLV Y  D ++G N + I V G  G   S  QFGT+   D+P+TE PDP S  +
Sbjct  38   QPPLTTKLVLYFQDIIAGPNANDIPVVGIPGKLWSFSQFGTMFVADEPITETPDPNSAMV  97

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y+ + LDG  +  VFS++FT   Y GS+LE+QGA     +  EF+VV GTG FR
Sbjct  98   GRAQGMYVTASLDGSNVQTVFSIVFTNQAYNGSTLELQGAGNQLQRVLEFAVVGGTGKFR  157

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            F +G+   T E +      A+++L++TVRH
Sbjct  158  FARGY--TTFETISFSQGHAVVQLNVTVRH  185



>gb|KCW88770.1| hypothetical protein EUGRSUZ_A01114 [Eucalyptus grandis]
Length=187

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 89/149 (60%), Gaps = 0/149 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
              P+ T +V Y  D+ +G N + I VAG  G   +  QFGT+   DD +TE PDP S  +
Sbjct  37   QPPQTTDMVLYFQDFAAGPNATLIPVAGIAGKLWTFSQFGTVFVTDDFITETPDPNSPMV  96

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GR QG+Y+ S LDG     +FS++FT   Y GS+LEIQG        RE+SVV GTG FR
Sbjct  97   GRGQGMYVTSALDGSSTRAMFSIVFTNQAYNGSTLEIQGTAKQFEAVREYSVVGGTGKFR  156

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVR  226
            F +G+    T  MD+P   +I++ ++T+R
Sbjct  157  FARGYTTFETISMDMPQAHSIIQCNVTIR  185



>ref|XP_004305988.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=157

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 8/155 (5%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            H+ ++TK+  Y+HD+ +G N + I VAG  G      QFGT+  VDD +TEGP   S  +
Sbjct  7    HELKETKMSMYMHDFSAGPNITDIPVAGIAGKLWVFNQFGTVYVVDDSLTEGPSRNSTVV  66

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKE----REFSVVSGT  325
            GRAQG+ + + LDG+   ++ S++FT  +Y GS++EIQG    N K+    RE +VVSGT
Sbjct  67   GRAQGIVVTASLDGRNALVLLSIVFTNKKYNGSTIEIQG----NSKQFEPIREVAVVSGT  122

Query  324  GFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G FRF +G+    T F+D P   A+++ +ITV+HY
Sbjct  123  GKFRFARGYATFETYFVDQPTDYAVIRSNITVQHY  157



>ref|XP_008379934.1| PREDICTED: dirigent protein 1-like [Malus domestica]
Length=257

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            R + ++TKL  + HD+++G N++ I VAG  G   +  QFGT+   DDP+T  PD  S  
Sbjct  106  RSQLKETKLTVFFHDFVAGPNSTVIPVAGIAGKLWTFTQFGTVYVTDDPLTATPDLNSAV  165

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GR QGLY+ S LDG   H++ S++FT  +Y GS+LEIQG        RE SVVSGTG F
Sbjct  166  VGRGQGLYVTSGLDGLNTHVLISIVFTNKKYNGSTLEIQGISKQFEAVREVSVVSGTGKF  225

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RF +G+    T  +D     ++ + ++TV HY
Sbjct  226  RFARGYATFETLLVDAATFYSVERCNVTVEHY  257



>ref|XP_010046344.1| PREDICTED: dirigent protein 2-like [Eucalyptus grandis]
 gb|KCW88769.1| hypothetical protein EUGRSUZ_A01112 [Eucalyptus grandis]
Length=186

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 2/148 (1%)
 Frame = -1

Query  666  PRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            P  TKLV Y  D ++G N + I V G  G   S  QFGT+   D+P+TE PDP S  +GR
Sbjct  40   PHTTKLVLYFQDIIAGPNANDIPVVGIPGKLWSFSQFGTVFVADEPITETPDPNSAMVGR  99

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+Y+ S LDG  +  VFS++FT   Y GS+LE+QGA     +  EF+VV GTG FRF 
Sbjct  100  AQGMYVISSLDGSNVKTVFSIVFTNQAYNGSTLELQGAGKQLQRVLEFAVVGGTGKFRFA  159

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRH  223
            +G+   T E +       +++ ++TVRH
Sbjct  160  RGY--TTLETISFSQGHGVIQFNVTVRH  185



>ref|XP_006592370.1| PREDICTED: dirigent protein 2-like [Glycine max]
Length=180

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 88/152 (58%), Gaps = 0/152 (0%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            N   P QT LVFY+ D  +G N +   + G  G   +  QFGTI AVDDPV   P P S 
Sbjct  28   NSQLPLQTTLVFYLQDIATGPNATVSPITGLTGRDWTYEQFGTIFAVDDPVMMSPSPVSA  87

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
            ++GRAQGL + S  DG  ++ V S++FT  +Y GSS+EIQG        +E SVVSGTG 
Sbjct  88   QVGRAQGLLVVSAHDGANVNAVLSIVFTNLQYSGSSIEIQGISRQRESYKELSVVSGTGR  147

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FRF KG+    T F D     ++++L I +R 
Sbjct  148  FRFAKGYAAFETVFYDPGTAHSVIRLTINLRQ  179



>emb|CDY04773.1| BnaC05g18160D [Brassica napus]
Length=185

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            HKP + T L FY HD ++G+  +AI VA   G  +S + FG +   DDP+TEGPDP SKE
Sbjct  37   HKPEKLTHLHFYFHDVITGDKPTAIRVAAPPGANSSAVSFGVVMIADDPLTEGPDPSSKE  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y+++ ++     +VF+++FTEGE+ GS++ + G +    K RE  ++ GTG F
Sbjct  97   VGRAQGMYVSTDMNMLSFTMVFNLVFTEGEFNGSTIAMYGRNPIMSKVREMPIIGGTGVF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+    T    +  L A+++ ++ + H
Sbjct  157  RFARGYAQART--YKLVGLNAVVEYNVFIWH  185



>ref|XP_010089478.1| hypothetical protein L484_011932 [Morus notabilis]
 gb|EXB37871.1| hypothetical protein L484_011932 [Morus notabilis]
Length=182

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             +  QT LV +  DY SG N + + V G  G   S + FGTI A+DD VT+ PD  S ++
Sbjct  34   QRQNQTNLVLFFQDYASGRNATVVPVVGITGKTWSFVSFGTIFAIDDQVTQTPDKSSAQV  93

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRA+G+ + S LDG  + ++ S++F   EY GS+LE+QG    N + RE SVVSGTG FR
Sbjct  94   GRAEGVLVTSALDGSNVSVLISIVFNNLEYSGSTLELQGVIRQNERYREVSVVSGTGRFR  153

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITV  229
            F +G+ I  T + D      I++  +T+
Sbjct  154  FARGYAIFETIYYDRATSNTIIRCTVTL  181



>ref|XP_004305989.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=175

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 93/151 (62%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            H+ ++TK+  Y+HD+ +G N + I VAG  G      QFGTI   DD +TEGP   S  +
Sbjct  25   HEFKETKMSMYMHDFTAGPNITDIPVAGIAGKLWVFNQFGTIYVNDDSLTEGPSRNSTAV  84

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG  + + LDG+    + S +FT  +Y GS++E+QG      +  E  VVSGTG FR
Sbjct  85   GRAQGFAVTASLDGRNALSLISFVFTNKKYNGSTIEVQGCYKQYERSTEVPVVSGTGKFR  144

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+ I  T F DIP+  +I++ +ITV+HY
Sbjct  145  FARGYVIFETYFFDIPSGYSIIRCNITVQHY  175



>ref|XP_010068013.1| PREDICTED: dirigent protein 2-like [Eucalyptus grandis]
Length=144

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 86/142 (61%), Gaps = 0/142 (0%)
 Frame = -1

Query  651  LVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLY  472
            +V Y  D+ +G N + I VAG  G   +  QFGT+   DD +TE PDP S  +GR QG+Y
Sbjct  1    MVLYFQDFAAGPNATLIPVAGIAGKLWTFSQFGTVFVTDDFITETPDPNSPMVGRGQGMY  60

Query  471  INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGI  292
            + S LDG     +FS++FT   Y GS+LEIQG        RE+SVV GTG FRF +G+  
Sbjct  61   VTSALDGSSTRAMFSIVFTNQAYNGSTLEIQGTAKQFEAVREYSVVGGTGKFRFARGYTT  120

Query  291  MTTEFMDIPNLKAILKLDITVR  226
              T  MD+P   +I++ ++T+R
Sbjct  121  FETISMDMPQAHSIIQCNVTIR  142



>ref|XP_009115582.1| PREDICTED: dirigent protein 2 [Brassica rapa]
Length=185

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            HKP + T L FY HD ++G+  +AI VA   G  +S + FG +   DDP+TEGPDP SKE
Sbjct  37   HKPEKLTHLHFYFHDVITGDKPTAIRVAAPPGTNSSEVSFGVVMIADDPLTEGPDPSSKE  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y+++ +      +VF+++FTEGE+KGS++ + G +    K RE  ++ GTG F
Sbjct  97   VGRAQGMYVSTDMTMLSFTMVFNLVFTEGEFKGSTVAMYGRNPIMSKVREMPIIGGTGAF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+    T    +  L A+++ ++ + H
Sbjct  157  RFARGYAQART--YKLVGLNAVVEYNVFIWH  185



>emb|CAN73537.1| hypothetical protein VITISV_012618 [Vitis vinifera]
Length=327

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT++VFY+HD+ +G N +AI +AG      +V  F TI A+DD +T   D  S +IG
Sbjct  30   KLKQTQVVFYMHDWETGANVTAIPIAGLPKKPWAVGTFATIIAIDDALTXTIDRNSAQIG  89

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            RAQG+Y+NS LDG  LH + SV+FT  +Y GSSLEIQGA+ F  K RE SVVSGTG FR
Sbjct  90   RAQGIYVNSALDGSDLHFLMSVVFTNKQYNGSSLEIQGANRFFNKYREVSVVSGTGMFR  148


 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = -1

Query  609  SAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQLDGKGLHLVF  430
            + +SV G+    TS   F T+   DDP+TE PDP S  +GR QG+YI S+LDG   H++ 
Sbjct  151  AVLSVPGKIWSFTS---FRTVFVTDDPITEAPDPNSTPVGRGQGMYITSKLDGSTTHVLI  207

Query  429  SVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTEFMD  271
            S++FT G++ GS+LEIQG+     K RE  VVS TG  RF +G+ I  T F+D
Sbjct  208  SIVFTNGQFSGSTLEIQGSSPHFQKYREVFVVSETGRLRFARGYAIFETVFVD  260



>ref|XP_004506278.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=180

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 87/146 (60%), Gaps = 0/146 (0%)
 Frame = -1

Query  666  PRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            P QT LVFY+ D   G N +   V G +G   S   FGTI  VDDPV   P P S +IGR
Sbjct  32   PNQTTLVFYLQDIGKGLNATVSPVIGINGRVWSYNTFGTIFVVDDPVMVSPSPFSTQIGR  91

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+   + LDG  ++++ S++F   +Y GS+LEIQG        RE S+V GTG FRF 
Sbjct  92   AQGVITVTSLDGANVNILLSIVFNNMQYSGSTLEIQGTSRQRDNSRELSIVGGTGRFRFA  151

Query  306  KGFGIMTTEFMDIPNLKAILKLDITV  229
            +GF +  T   D PN+ +I++L IT+
Sbjct  152  RGFAVFETVSFDAPNVHSIIRLTITL  177



>ref|XP_008455898.1| PREDICTED: dirigent protein 15-like [Cucumis melo]
Length=172

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 91/150 (61%), Gaps = 4/150 (3%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K +QT L+ Y+ D+ +G N + I VAG  G   +  QFGTI   D+P+T GPD  S  +G
Sbjct  27   KSKQTNLILYLQDFANGPNPTFIPVAGVAGKPWNFTQFGTIFVTDNPITAGPDRNSTALG  86

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y+ +  DG+ L ++ ++   E    GSS+EIQG       ERE  VVSGTG FRF
Sbjct  87   RAQGIYVVAAADGRNLAVILTLALAE----GSSIEIQGTSRQFEGERELGVVSGTGKFRF  142

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            V+GF +      DI N   +++ ++T++HY
Sbjct  143  VRGFAVGKNVVTDIANGYTVIQFNVTLKHY  172



>ref|XP_008230040.1| PREDICTED: dirigent protein 22-like [Prunus mume]
Length=177

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            ++T L  + HD  +G N + I VAG  G   +  QFGT    DDP+TE PD  +  +GR 
Sbjct  30   KETHLSLFFHDIAAGSNFTLIPVAGIAGKLWTFDQFGTAFVTDDPLTETPDRNAPIVGRG  89

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y+ S LDG+  H++ S++FT  +Y GS+LEIQG      K RE SVVSGTG FRF +
Sbjct  90   QGIYVTSGLDGRNTHVLISIVFTNKKYNGSTLEIQGTSKQFEKVREVSVVSGTGQFRFAR  149

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T   D     ++ + ++TV+HY
Sbjct  150  GYATFETYLWDPATFYSVERCNVTVQHY  177



>gb|KEH29703.1| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=178

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 91/151 (60%), Gaps = 1/151 (1%)
 Frame = -1

Query  678  NRHKPRQTK-LVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKS  502
            N   P QT  LVFY+ D   G N + + V G +G   S   FGTI  VDDPV   P P S
Sbjct  25   NGQAPNQTSTLVFYLQDVGRGFNATVMPVIGINGRVWSYHSFGTIFVVDDPVMLSPSPFS  84

Query  501  KEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTG  322
             +IGRAQG+   + LDG  +++V S++F  GEY GS+LEIQG        RE SVVSGTG
Sbjct  85   TQIGRAQGVITVTSLDGANVNIVLSLVFNNGEYSGSTLEIQGNSRQRENSRELSVVSGTG  144

Query  321  FFRFVKGFGIMTTEFMDIPNLKAILKLDITV  229
             FR+ +GF +  T   D P+ +++++L IT+
Sbjct  145  RFRYARGFVVFETMSYDAPSERSVIRLTITL  175



>ref|XP_007216497.1| hypothetical protein PRUPE_ppa023893mg, partial [Prunus persica]
 gb|EMJ17696.1| hypothetical protein PRUPE_ppa023893mg, partial [Prunus persica]
Length=157

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            ++T L  + HD  SG N + I VAG  G   +  QFGT    DDP+TE PD  +  +GR 
Sbjct  10   KETHLSLFFHDIASGPNFTLIPVAGIAGKLWTFDQFGTAFVTDDPLTETPDRNAPIVGRG  69

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y+ S LDG+  H++ S++FT  +Y GS+LEIQG      K RE SVVSGTG FR  +
Sbjct  70   QGIYVTSGLDGRNTHVLISIVFTNKKYNGSTLEIQGTSKQFEKVREVSVVSGTGQFRLAR  129

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T   D     ++ + ++TV+HY
Sbjct  130  GYATFETYLWDPATFYSVERCNVTVQHY  157



>ref|XP_007041904.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
 gb|EOX97735.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
Length=186

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 86/146 (59%), Gaps = 0/146 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG+N SAI VA     + S   FG +   DDP+TE PDP SK +GRAQG
Sbjct  40   TNLQFYFHDTISGKNPSAIKVAQAPDTEKSPTLFGAMLMADDPLTESPDPNSKLLGRAQG  99

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            LY ++     GL +  S  FT+G+Y GSS+ I G +      RE  VV GTG FR  +G+
Sbjct  100  LYGSAGQTEVGLIMAMSFCFTDGKYNGSSISILGKNSALTPFREMPVVGGTGLFRLARGY  159

Query  297  GIMTTEFMDIPNLKAILKLDITVRHY  220
             I  T +MDI    AI+  ++T+ HY
Sbjct  160  AIAKTHWMDITTGDAIVGYNVTIVHY  185



>ref|XP_006281178.1| hypothetical protein CARUB_v10027213mg [Capsella rubella]
 gb|EOA14076.1| hypothetical protein CARUB_v10027213mg [Capsella rubella]
Length=182

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +AI VA   G  +S ++FG I   DDP+TEGPDP SKE
Sbjct  34   YKPEKFTHLHFYFHDVISGDKPTAIRVAEAPGTNSSAIKFGVIMIADDPLTEGPDPSSKE  93

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y ++ L      +VF++ FTEG++KGS+L + G +    K RE  ++ GTG F
Sbjct  94   IGRAQGMYASTDLKDLIFTMVFNLAFTEGQFKGSTLSMYGRNAIMSKVREMPIIGGTGCF  153

Query  315  RFVKGFG  295
            RF +G+ 
Sbjct  154  RFARGYA  160



>ref|XP_006281166.1| hypothetical protein CARUB_v10027200mg [Capsella rubella]
 gb|EOA14064.1| hypothetical protein CARUB_v10027200mg [Capsella rubella]
Length=186

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +AI VA   G  +S ++FG I   DDP+TEGPDP SKE
Sbjct  38   YKPEKFTHLHFYFHDVISGDKPTAIRVAEAPGTNSSAIKFGVIMIADDPLTEGPDPSSKE  97

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y ++ L      +VF++ FTEG++KGS+L + G +    K RE  ++ GTG F
Sbjct  98   IGRAQGMYASTDLKDLIFTMVFNLAFTEGQFKGSTLSMYGRNAIMSKVREMPIIGGTGCF  157

Query  315  RFVKGFG  295
            RF +G+ 
Sbjct  158  RFARGYA  164



>gb|KEH30526.1| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=192

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 90/154 (58%), Gaps = 1/154 (1%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGR-DGPKTSVLQFGTITAVDDPVTEGPDPKS  502
            N+ +  +T L FY HD LSG+N SAI VA   D  KT + QFG I   DDP+TE  DPKS
Sbjct  39   NKKQETETNLQFYFHDTLSGKNPSAIKVAEPVDKTKTYLTQFGNIMMADDPLTETSDPKS  98

Query  501  KEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTG  322
            K +GRAQG+Y +S     GL +  S  F +G Y GS+  + G +      RE  VV GTG
Sbjct  99   KLVGRAQGIYASSCQQEIGLLMSLSYSFVDGPYNGSTFALVGKNPAMNPVREMPVVGGTG  158

Query  321  FFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             FR  +G+ I  T ++DI    AI+  ++T+ HY
Sbjct  159  LFRMARGYAIAKTHWVDITTGDAIVGYNVTLVHY  192



>ref|XP_007217417.1| hypothetical protein PRUPE_ppa024264mg [Prunus persica]
 gb|EMJ18616.1| hypothetical protein PRUPE_ppa024264mg [Prunus persica]
Length=181

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 1/149 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLS-GENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T+LV Y  D +S G N +++ VAG  G   +  QFGT+   DDP+T GP+P S  IGR
Sbjct  33   KETQLVLYFQDNVSAGPNATSLPVAGIAGKLWTFTQFGTVYVTDDPLTAGPEPNSASIGR  92

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+ + + L+G+   ++ S++FT  EY GS+LE+QG      + RE +VVSGTG FRF 
Sbjct  93   AQGITVAAALNGRNALVLVSLVFTNQEYNGSTLELQGNSKQFEQVREVAVVSGTGKFRFA  152

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            +G+    T  +D     ++ + ++TV+HY
Sbjct  153  RGYATFETYLVDPATSYSVERCNVTVQHY  181



>gb|ABR27731.1| dirigent-like protein, partial [Picea sitchensis]
Length=148

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 93/148 (63%), Gaps = 7/148 (5%)
 Frame = -1

Query  654  KLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE----IGR  487
             +VFY HD LSG N +A SVAG +G  +S  +FGT+  + D VT+ P     +    +GR
Sbjct  1    NMVFYTHDNLSGNNVTAFSVAGLNGSSSSAGKFGTVVVMSDDVTKRPKINESDADNTVGR  60

Query  486  AQGLYINSQL-DGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            AQG+++N+ L  G    LVF+VIF + EY GS+LEIQG D F    RE +VV GTG FRF
Sbjct  61   AQGIFVNTNLVTGLDTLLVFTVIFHDMEYGGSTLEIQGTDRFAYPHREVAVVGGTGKFRF  120

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVR  226
             +G+ I+TTE +      +++K + T+R
Sbjct  121  ARGYAILTTELL--SGTDSVIKFNTTLR  146



>ref|XP_006487695.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
 gb|KDO40833.1| hypothetical protein CISIN_1g045008mg [Citrus sinensis]
Length=182

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 87/149 (58%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K   T L FY HD LSG+N SA+ +A       S   FG +   DDP+TE PDPKSK +G
Sbjct  34   KETTTNLQFYFHDTLSGQNPSAVRIAQATDTDKSPTLFGVLMMADDPLTETPDPKSKLVG  93

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY ++  D  GL +  S +F +G Y GSS+ + G +      RE  +V GTG FR 
Sbjct  94   RAQGLYGSASQDQLGLIMSMSFVFVDGSYNGSSISLLGNNRAMNPVREMPIVGGTGAFRL  153

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ I  T +MD+ +  AI+  ++TV H
Sbjct  154  ARGYAIAQTHWMDLKSGDAIVGYNVTVIH  182



>ref|XP_010243406.1| PREDICTED: dirigent protein 2-like [Nelumbo nucifera]
Length=197

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 91/150 (61%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + T L FY HD +SG N +AI VA       S+ +FG +  +DDP+TE P+P S+++G
Sbjct  48   REKITHLHFYFHDIVSGRNPTAIKVAAAASTNRSLTEFGLVVVMDDPLTETPEPTSRQVG  107

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++ LD   L +V +  FT G+Y GS+L I G +    + RE  VV GTG FRF
Sbjct  108  RAQGIYSSASLDDLSLLMVLNYAFTHGKYNGSTLSILGRNTVFSEVREMPVVGGTGLFRF  167

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  +D+    A+++ ++ V HY
Sbjct  168  ARGYAQAKTHTIDLNTGDAVVEYNVFVVHY  197



>gb|KDP27569.1| hypothetical protein JCGZ_19574 [Jatropha curcas]
Length=184

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 89/154 (58%), Gaps = 3/154 (2%)
 Frame = -1

Query  675  RHKPRQ---TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPK  505
            R KP++   T L FY HD +SG+N SAI VA     + S   FGTI   DDP+TEGPDPK
Sbjct  31   RLKPKKETVTNLQFYFHDTVSGKNPSAIKVAQSAYTEKSPTLFGTIMMADDPLTEGPDPK  90

Query  504  SKEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGT  325
            SK +GRAQGLY ++  D   L +  +  FT G   GSSL + G +      RE  +V GT
Sbjct  91   SKLVGRAQGLYGSAGQDELCLIMAMNFAFTNGMSNGSSLSVLGKNSALSPVRELPIVGGT  150

Query  324  GFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            G FR  +G+ +  T + DI    AI+  +ITV H
Sbjct  151  GVFRLARGYAVAKTHWFDITTGDAIVGYNITVMH  184



>gb|ABK25297.1| unknown [Picea sitchensis]
Length=147

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 93/147 (63%), Gaps = 7/147 (5%)
 Frame = -1

Query  651  LVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE----IGRA  484
            +VFY HD LSG N +A SVAG +G  +S  +FGT+  + D VT+ P     +    +GRA
Sbjct  1    MVFYTHDNLSGNNVTAFSVAGLNGSSSSAGKFGTVVVMSDDVTKRPKINESDADNTVGRA  60

Query  483  QGLYINSQL-DGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            QG+++N+ L  G    LVF+VIF + EY GS+LEIQG D F    RE +VV GTG FRF 
Sbjct  61   QGIFVNTNLVTGLDTLLVFTVIFHDMEYGGSTLEIQGTDRFAYPHREVAVVGGTGKFRFA  120

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVR  226
            +G+ I+TTE +      +++K + T+R
Sbjct  121  RGYAILTTELL--SGTDSVIKFNTTLR  145



>ref|XP_008229971.1| PREDICTED: dirigent protein 22-like [Prunus mume]
Length=184

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 0/146 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
              PR+T +V Y+ D  SG + + + + G  G   S   FGTI AVDD +TE PD  S +I
Sbjct  32   QSPRETTIVLYLQDLASGPDATVVPITGIQGKPQSFTSFGTIFAVDDVITETPDKVSAQI  91

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+ + S L G  +H+  S+ FT  EY GSSLEIQG      + +E SVVSGTG FR
Sbjct  92   GRAQGILVASSLSGSNVHVSMSLAFTNVEYNGSSLEIQGISRQFERYKEVSVVSGTGSFR  151

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDI  235
            + +G+  + T F D     +I++  +
Sbjct  152  YARGYATLETVFYDNKTFYSIIRCTV  177



>ref|XP_010101075.1| hypothetical protein L484_007310 [Morus notabilis]
 gb|EXB86887.1| hypothetical protein L484_007310 [Morus notabilis]
Length=212

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 91/150 (61%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD + G+N +AI +AG      S   FG +TA+DDP+T GP+P SK++G
Sbjct  63   REKLSHLHFYFHDIVGGKNPTAIQIAGPPVTNASSTFFGLVTAIDDPLTVGPEPNSKQLG  122

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY ++     GL +V + +FTEG+Y GS+L I G +      RE  +V G+G FRF
Sbjct  123  RAQGLYASASQSEVGLMMVLNYVFTEGKYNGSTLSILGRNAAFSAVREMPIVGGSGLFRF  182

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T   D+    A+++ ++ V HY
Sbjct  183  ARGYAQARTHKFDLKTGDAVVEYNVYVLHY  212



>ref|XP_010494187.1| PREDICTED: dirigent protein 2-like [Camelina sativa]
Length=185

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +AI VA   G  +S ++FG I   DDP+TEGPDP SKE
Sbjct  37   YKPEKFTHLHFYFHDVISGDKPTAIRVAEAPGTNSSAIKFGVIMIADDPLTEGPDPSSKE  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y ++ L      +VF++ FTEG++ GS+L + G +    K RE  ++ GTG F
Sbjct  97   VGRAQGMYASTALKDLIFTMVFNLAFTEGQFNGSTLAMYGRNAIMTKLREMPIIGGTGAF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+    T    + +  A+++ ++ + H
Sbjct  157  RFARGYAQAQT--YKLVDQDAVVEYNVFIWH  185



>gb|KGN63239.1| hypothetical protein Csa_2G416780 [Cucumis sativus]
Length=172

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 90/151 (60%), Gaps = 4/151 (3%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K + T L+ YV D+ +G N + I VAG  G   +  QFGTI   D+P+T GPD  S+ +
Sbjct  26   RKSKHTNLILYVQDFANGPNPTFIPVAGVAGKPWNFTQFGTIFVTDNPITAGPDRNSRAL  85

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y+ +  DG+ L ++ ++   E    GSS+EIQG        RE  VVSGTG FR
Sbjct  86   GRAQGMYVVAAADGRNLAVILTLALAE----GSSIEIQGTSRQFEGVRELGVVSGTGKFR  141

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FV+GF +      DI N   +++ +++++HY
Sbjct  142  FVRGFAVGKNVVTDIANGYTVVQFNVSLKHY  172



>ref|XP_007216435.1| hypothetical protein PRUPE_ppa021830mg [Prunus persica]
 gb|EMJ17634.1| hypothetical protein PRUPE_ppa021830mg [Prunus persica]
Length=184

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 0/146 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
              PR+T +V Y+ D  SG + + + + G  G   S   FGTI AVDD +TE PD  S +I
Sbjct  32   QSPRETTIVLYLQDLASGPDATVVPITGIQGKPQSFTSFGTIFAVDDIITETPDKVSAQI  91

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+ + S L G  +H+  S+ FT  EY GSSLEIQG      + +E SVVSGTG FR
Sbjct  92   GRAQGILVASSLSGSNVHVSMSLAFTSVEYNGSSLEIQGISRQFERYKEVSVVSGTGSFR  151

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDI  235
            + +G+  + T F D     +I++  +
Sbjct  152  YARGYATLETVFYDNKTSYSIIRCTV  177



>ref|XP_010477562.1| PREDICTED: dirigent protein 11 [Camelina sativa]
Length=186

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 85/131 (65%), Gaps = 1/131 (1%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            H P + T L FY HD +SG+  + I VA      +SV  FG +  VD P+TEGPDP+SKE
Sbjct  38   HDPEKLTHLHFYFHDVISGDKPTTIRVAEAPSTNSSVSSFGAVLIVDAPLTEGPDPRSKE  97

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y ++ +   G  +VF++ FTEGE+ GS++ + G +   +KERE  ++ GTG F
Sbjct  98   VGRAQGMYASTDMKTFGFTMVFNLAFTEGEFNGSTVGLYGRNPILLKERELPIIGGTGAF  157

Query  315  RFVKGFGIMTT  283
            RF +G+ +  T
Sbjct  158  RFARGYALPKT  168



>gb|ABK26126.1| unknown [Picea sitchensis]
 gb|ABR27724.1| dirigent-like protein [Picea sitchensis]
Length=172

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 93/150 (62%), Gaps = 7/150 (5%)
 Frame = -1

Query  660  QTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE----I  493
            +  +VFY+HD L G N +AI VAG +G  ++  +FGTI  + D +T  P     +    +
Sbjct  24   EINMVFYIHDNLRGSNVTAIPVAGLNGSSSNAGKFGTIVTISDVITRRPQITESDSDNIV  83

Query  492  GRAQGLYINSQ-LDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            GRAQG Y+N+  + G    +V +++F + EY GS+LEIQG D F   +REF+VV GTG F
Sbjct  84   GRAQGTYVNTNPVTGLDFLMVMTIVFQDMEYNGSTLEIQGTDRFTQPQREFAVVGGTGKF  143

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVR  226
            R  +G+ I +TE +  PN  +I+K + TV+
Sbjct  144  RLARGYAIASTEALSSPN--SIIKFNTTVQ  171



>ref|XP_009596486.1| PREDICTED: dirigent protein 22-like [Nicotiana tomentosiformis]
Length=175

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 87/148 (59%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            ++T++  Y  D+  G N + + + G      S  +FG++   DDP+TE  D  S EI RA
Sbjct  28   KETRMTVYFQDWSGGPNATVLQITGHQNGPLSFAKFGSVFVTDDPITEAFDKNSAEIARA  87

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y+ S LDG   H++ S+IFT  EYKGS+LEIQGA     + RE +VV GTG FR  +
Sbjct  88   QGIYVTSALDGTISHVLISIIFTIEEYKGSTLEIQGASPQFERVREVAVVGGTGKFRLAR  147

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T   D+     +++ ++TV HY
Sbjct  148  GYATFETIHFDLAVHYVVIQCNVTVLHY  175



>gb|ABK21834.1| unknown [Picea sitchensis]
 gb|ABR27718.1| dirigent-like protein [Picea sitchensis]
Length=174

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 6/147 (4%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            ++T++ FY+HD +     +  +V   DGP      FG I  +DD +TEGP   SKE+GRA
Sbjct  34   KKTQIEFYMHDVVKALKNATTAVKVTDGPPG----FGMIRVIDDSLTEGPQHNSKELGRA  89

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            +G+Y+   L G  L LVF+VIF  GE+ GS+L +QG D  N K+RE S+V GTG FR   
Sbjct  90   RGMYVQDSLSGVNLLLVFTVIFQAGEHNGSTLSLQGQDDTNDKQREVSIVGGTGHFRHAT  149

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRH  223
            G  I+ T+     N+  IL+ ++TV H
Sbjct  150  GHAILETQLTMGANV--ILRFNVTVLH  174



>gb|KHN41235.1| Disease resistance response protein 206 [Glycine soja]
Length=181

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAIS-VAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             P QT +VFY+ D  +G N + ++ VAG +G   S   FG+I  VD PVT    P S+ +
Sbjct  33   NPNQTTMVFYLQDLAAGPNATVVAPVAGINGRVWSFTTFGSIFVVDFPVTLSISPTSELV  92

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            G+AQGL + S LDG  +++  S++F   +Y GS+LE+QG    +   RE SVVSGTG FR
Sbjct  93   GQAQGLLVASALDGASVNVALSIVFNNLQYNGSTLELQGISRRHENYREVSVVSGTGKFR  152

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVR  226
            F +G+ ++ T F DI   ++ L+L IT++
Sbjct  153  FARGYAVLETAFFDIS--RSTLRLTITIQ  179



>ref|XP_010442171.1| PREDICTED: dirigent protein 2-like [Camelina sativa]
 ref|XP_010442172.1| PREDICTED: dirigent protein 2-like [Camelina sativa]
Length=186

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 83/127 (65%), Gaps = 1/127 (1%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +AI VA   G  +S ++FG I   DDP+T+GPDP SKE
Sbjct  38   YKPEKFTHLHFYFHDVISGDKPTAIRVAEAPGTNSSAIKFGVIMIADDPLTDGPDPSSKE  97

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y ++ L      +VF++ FTEG++ GS+L + G +    K RE  ++ GTG F
Sbjct  98   VGRAQGMYASTDLKDLIFTMVFNLAFTEGQFNGSTLAMYGRNAIMTKLREMPIIGGTGAF  157

Query  315  RFVKGFG  295
            RF +G+ 
Sbjct  158  RFARGYA  164



>ref|XP_011046627.1| PREDICTED: dirigent protein 23 [Populus euphratica]
Length=184

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K   T L FY HD LSG+N +AI VA       S   FG+I   DDP+TEGPDP SK +
Sbjct  35   EKENVTNLQFYFHDILSGKNPTAIKVAQPSADNKSPTLFGSIMMADDPLTEGPDPSSKPV  94

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y ++  +   L +  +  FT+G Y GS + + G +      RE  +V GTG FR
Sbjct  95   GRAQGIYGSAGQNELALIMAMNFAFTDGIYNGSCISLLGKNPAMNPVREMPIVGGTGLFR  154

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            F +G+ +  T ++D+    AI+  ++TV H
Sbjct  155  FARGYAVAQTYWLDVTTGDAIVGYNVTVVH  184



>gb|KDO36723.1| hypothetical protein CISIN_1g030123mg [Citrus sinensis]
Length=182

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 86/149 (58%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K   T L FY HD LSG+N SA+ +A       S   FG +  VDDP+TE PDP+SK +G
Sbjct  34   KETTTNLQFYFHDTLSGKNPSAVRIAQAIDTDRSRTLFGIVMMVDDPLTETPDPQSKLVG  93

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY ++  D   L +  S +F +G Y GSS+ + G +      RE  +V GTGFFR 
Sbjct  94   RAQGLYGSACQDQLSLIMSMSFVFVDGPYNGSSISLLGNNRAMNPVREMPIVGGTGFFRL  153

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ +  T +MD     AI+  ++TV H
Sbjct  154  ARGYAVAQTHWMDFKTGDAIVGYNVTVVH  182



>ref|XP_008358672.1| PREDICTED: dirigent protein 2-like [Malus domestica]
 ref|XP_008363488.1| PREDICTED: dirigent protein 2-like [Malus domestica]
Length=182

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (59%), Gaps = 1/146 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
              PR+T +VFY+ D  SG N + + + G  G   S   FGTI A+DDP+TE PD +S ++
Sbjct  31   QSPRETTIVFYLQDLASGPNATVVPITGIQGKPQSFTSFGTIFAIDDPITETPDKRSTQV  90

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+ + S   G  +H+  S+ FT   Y GSSLE+QG      + +E SVVSGT  FR
Sbjct  91   GRAQGILVASSXSGSNVHVSMSLAFTN-RYDGSSLELQGTSRQFERVKEVSVVSGTASFR  149

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDI  235
            + +G+  + T F D     ++++  I
Sbjct  150  YARGYATLETVFYDNKTSYSVVRCAI  175



>ref|XP_002313728.1| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEE87683.1| disease resistance-responsive family protein [Populus trichocarpa]
Length=184

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K   T L FY HD LSG+N +AI VA       S   FG+I   DDP+TEGPDP SK +
Sbjct  35   EKENVTNLQFYFHDILSGKNPTAIKVAQPSADNKSPTLFGSIMMADDPLTEGPDPNSKPV  94

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y ++  +   L +  +  FT+G Y GS + + G +      RE  +V GTG FR
Sbjct  95   GRAQGIYGSAGQNELALIMAMNFAFTDGIYNGSCISLLGKNPAMNPVREMPIVGGTGLFR  154

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            F +G+ +  T ++D+    AI+  ++TV H
Sbjct  155  FARGYAVAQTYWLDLTTGDAIVGYNVTVVH  184



>ref|XP_010501557.1| PREDICTED: dirigent protein 11-like, partial [Camelina sativa]
Length=174

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKP-RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            H+P + T L FY HD +SG+  + I VA      +SV  FG +  VD P+TEGPDP+SKE
Sbjct  26   HEPDKLTHLHFYFHDVISGDKPTTIRVAEAPSTNSSVSSFGAVLIVDAPLTEGPDPRSKE  85

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQ +Y ++ +   G  +VF++ FTEGE+ GS++ + G +   +KERE  ++ GTG F
Sbjct  86   VGRAQWMYASTDMKTFGFTMVFNLAFTEGEFNGSTVGLYGRNPILLKERELPIIGGTGPF  145

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+ +  T    + +  A+++ ++ + H
Sbjct  146  RFARGYALPKT--YKVVDKDAVVEYNVFIWH  174



>gb|KHN03295.1| hypothetical protein glysoja_004321 [Glycine soja]
Length=73

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  438  LVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTEFMDIPNL  259
            +VFSVIFT G++KGSSLEIQG+DIF MKEREF VVSGTG+FRFVKG+GIM T FMDI +L
Sbjct  1    MVFSVIFTNGKFKGSSLEIQGSDIFTMKEREFGVVSGTGYFRFVKGYGIMETVFMDIASL  60

Query  258  KAILKLDITVRHY  220
             A LKL++TV+HY
Sbjct  61   MATLKLNVTVKHY  73



>ref|XP_010048806.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
Length=175

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG N +A+ VA      +S   FG +  +DDP+TEGP+  SKE+G
Sbjct  26   KEKLSHLHFYFHDIVSGRNPTAVRVAEAKMTNSSATGFGAVVMIDDPLTEGPEMSSKEVG  85

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y  S  +  GL +V + +FTEG+Y GS+L + G +      RE S+V G+G FRF
Sbjct  86   RAQGIYALSSQNDVGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSGVREMSIVGGSGLFRF  145

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  MD      ++  ++ V HY
Sbjct  146  ARGYAQAKTHTMDRKTGDTVVNYNVYVFHY  175



>ref|XP_006366583.1| PREDICTED: dirigent protein 1-like [Solanum tuberosum]
Length=177

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAG-RDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T +  Y  D+  G N + + + G +D    S  +FG++   DDP+T+  D  S EI R
Sbjct  29   KETNMTLYFQDWSGGPNATVLQITGHQDHGILSFAKFGSVFVTDDPITQAFDKNSAEIAR  88

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+Y+ S LDGK  H++ S+IFT  EYKGS+LEIQGA     + RE ++V GTG FR  
Sbjct  89   AQGIYVTSALDGKISHVLISIIFTNNEYKGSTLEIQGASPQFERVREVAIVGGTGKFRLA  148

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            +G+    T   D+     +++ ++T+ HY
Sbjct  149  RGYATFETIHFDLAIHYVVIQCNVTILHY  177



>ref|XP_002270663.2| PREDICTED: dirigent protein 2-like [Vitis vinifera]
Length=238

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = -1

Query  618  ENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQLDGKGLH  439
             N + +SV G+    TS   FGT+   DDP+TE PDP S  +GR +G+YI S LDG   H
Sbjct  109  RNGAVLSVPGKIWSFTS---FGTVFVTDDPITEAPDPNSAPVGRGRGMYITSALDGSTTH  165

Query  438  LVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTEFMDIPNL  259
            ++ S++FT G++ GS+LEIQG+     K RE SVVSGTG  RF +G+ I  T F+D P  
Sbjct  166  VLISIVFTNGQFSGSTLEIQGSSPPFQKYREVSVVSGTGPLRFARGYAIFETGFVDTPIG  225

Query  258  KAILKLDITVR  226
             +++K ++T+R
Sbjct  226  YSVIKCNVTIR  236


 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -1

Query  639  VHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQ  460
            +HD+ +G N +AI +AG      +V  F TI  +DD +TE  D  S +IGRAQG+Y+NS 
Sbjct  1    MHDWETGANVTAIPIAGLPKKPWAVGTFATIIPIDDALTETIDRNSAQIGRAQGIYVNSA  60

Query  459  LDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            LDG  LH + SV+FT  +Y GSSLEIQGAD F  K RE SVVSGTG FR
Sbjct  61   LDGSDLHFLMSVVFTNKQYNGSSLEIQGADRFFNKYREVSVVSGTGMFR  109



>ref|XP_010481983.1| PREDICTED: dirigent protein 2-like [Camelina sativa]
Length=186

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +AI VA   G  +S ++FG I   DDP+T+GPDP SKE
Sbjct  38   YKPEKFTHLHFYFHDVISGDKPTAIRVAEAPGTNSSAIKFGVIMIADDPLTDGPDPSSKE  97

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y ++ L      +VF++ FTEG + GS+L + G +    K RE  ++ GTG F
Sbjct  98   VGRAQGMYASTDLKDLIFTMVFNLAFTEGHFNGSTLAMYGRNAIMTKLREMPIIGGTGAF  157

Query  315  RFVKGFG  295
            RF +G+ 
Sbjct  158  RFARGYA  164



>ref|XP_006849316.1| hypothetical protein AMTR_s03766p00005550 [Amborella trichopoda]
 gb|ERN10897.1| hypothetical protein AMTR_s03766p00005550 [Amborella trichopoda]
Length=199

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD LSG N SAI VA  D     +  FG +  +DDP+TEGPDPKSK  G
Sbjct  50   KEKISHLHFYFHDVLSGRNPSAIQVARADTTSKFLTLFGAVYMIDDPLTEGPDPKSKLFG  109

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG Y ++     GL +  +  F EG+YKGS+L I G +      RE  ++ G+G FR 
Sbjct  110  RAQGFYASASQTDLGLLMAMNFAFVEGKYKGSTLTILGRNPVLNPVREMPIIGGSGLFRL  169

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T   D+    A+++ ++ V HY
Sbjct  170  ARGYVLAKTHLFDLKTGDAVVEYNVYVTHY  199



>ref|XP_010048736.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 ref|XP_010040001.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW45566.1| hypothetical protein EUGRSUZ_L00694 [Eucalyptus grandis]
 gb|KCW81097.1| hypothetical protein EUGRSUZ_C02472 [Eucalyptus grandis]
Length=190

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG N +A+ VA      +S   FG +  +DDP+TEGP+  SKE+G
Sbjct  41   KEKLSHLHFYFHDIVSGRNPTAVRVAEAKMTNSSATGFGAVVMIDDPLTEGPEMSSKEVG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y  S  +  GL +V + +FTEG+Y GS+L + G +      RE S+V G+G FRF
Sbjct  101  RAQGIYALSSQNDVGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSGVREMSIVGGSGLFRF  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  MD      ++  ++ V HY
Sbjct  161  ARGYAQAKTHTMDRKTGDTVVNYNVYVFHY  190



>ref|XP_007132491.1| hypothetical protein PHAVU_011G098600g [Phaseolus vulgaris]
 gb|ESW04485.1| hypothetical protein PHAVU_011G098600g [Phaseolus vulgaris]
Length=184

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + RQT  VFY+ D  +G N +  +V G  G   +   FG+I  VDDPV  GP+P S  +G
Sbjct  34   RARQTTSVFYLQDVTTGPNATVAAVTGIKGRDWNYNTFGSIFVVDDPVMLGPNPGSTIVG  93

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGL + S  D   +++V S++F+  +Y GS+LE+QG        +E SVVSGTG FRF
Sbjct  94   RAQGLMVVSSHDAANVNVVLSIVFSNSQYSGSTLELQGISRQRENYKELSVVSGTGQFRF  153

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVR  226
             +G+  + T   D    ++I++L +T++
Sbjct  154  ARGYASLQTVVYDPQTTRSIIRLTVTIQ  181



>gb|AAB72169.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAQ65106.1| At1g22900 [Arabidopsis thaliana]
Length=187

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKP-RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  + I VA   G  +S   FG +  VD PVTEGP+  SKE
Sbjct  39   NKPDKLTHLHFYFHDIISGDKPTTIRVAEAPGTNSSATVFGAVLIVDAPVTEGPELSSKE  98

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY ++ +   G  +VF+ +FTEGE+ GS+  + G +   ++ERE  ++ GTG F
Sbjct  99   VGRAQGLYASTDMKTFGFTMVFNFVFTEGEFNGSTAALYGRNPILLEERELPIIGGTGDF  158

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+ +  T    + N+ A+++ ++ + H
Sbjct  159  RFARGYALPKT--YKVVNIDAVVEYNVFIWH  187



>ref|NP_173703.2| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
 sp|Q67YM6.1|DIR11_ARATH RecName: Full=Dirigent protein 11; Short=AtDIR11; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAD44205.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AEE30305.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=193

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKP-RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  + I VA   G  +S   FG +  VD PVTEGP+  SKE
Sbjct  45   NKPDKLTHLHFYFHDIISGDKPTTIRVAEAPGTNSSATVFGAVLIVDAPVTEGPELSSKE  104

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY ++ +   G  +VF+ +FTEGE+ GS+  + G +   ++ERE  ++ GTG F
Sbjct  105  VGRAQGLYASTDMKTFGFTMVFNFVFTEGEFNGSTAALYGRNPILLEERELPIIGGTGDF  164

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+ +  T    + N+ A+++ ++ + H
Sbjct  165  RFARGYALPKT--YKVVNIDAVVEYNVFIWH  193



>ref|XP_002528277.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF34115.1| Disease resistance response protein, putative [Ricinus communis]
Length=186

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 86/151 (57%), Gaps = 0/151 (0%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            + K   T L FY HD +SG+N +AI VA     + S   FG +   DDP+TEGPDPKSK 
Sbjct  36   QKKETVTNLQFYFHDIVSGKNRTAIRVAQSADTEKSPTLFGALIMADDPLTEGPDPKSKL  95

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY ++  +   L +  +  FT G Y GSS+ I G +      RE  VV GTG F
Sbjct  96   VGRAQGLYGSAGQNELCLIMAMNYAFTSGAYNGSSISILGKNSAMSPVRELPVVGGTGVF  155

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            R  +G+ I  T + DI    AI+  ++TV H
Sbjct  156  RMARGYAIARTHWFDITTGDAIVGYNLTVVH  186



>emb|CDP10173.1| unnamed protein product [Coffea canephora]
Length=154

 Score =   118 bits (295),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 87/150 (58%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG N +A+ VA      +S   FG +  +DDP+T GPD  SK +G
Sbjct  5    REKLSHLHFYFHDIVSGRNPTAVRVAAATTTNSSATGFGAVVMMDDPLTAGPDLSSKLVG  64

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  G  +V + +F EG+Y GS+L I G +      RE  VV G+G FRF
Sbjct  65   RAQGIYASAAQEESGYLMVLNYVFVEGKYNGSTLSILGRNTVLSTVREMPVVGGSGLFRF  124

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T + D+    A+++ ++ V HY
Sbjct  125  ARGYAQARTHYFDLKTGDAVVEYNVYVIHY  154



>ref|XP_011079170.1| PREDICTED: dirigent protein 23-like [Sesamum indicum]
Length=144

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = -1

Query  651  LVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLY  472
            +  Y  DY  G N + I + G         +FG I   DDP+TEG    S +I RAQGLY
Sbjct  1    MTLYFQDYSGGPNATVIEITGHPDGLLGFTRFGAIFCTDDPITEGFAESSAQIARAQGLY  60

Query  471  INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGI  292
            + S LDG   H++ S++FT  EYKGS+LE+QG+     + RE +VV GTG FR  +G+  
Sbjct  61   VTSALDGSNTHVLISIVFTNEEYKGSTLEVQGSSAQFERVREVAVVGGTGKFRLARGYAT  120

Query  291  MTTEFMDIPNLKAILKLDITVRHY  220
              T   D     A+++ ++TV HY
Sbjct  121  FETIHYDHTLYYAVIQCNVTVLHY  144



>ref|XP_009762822.1| PREDICTED: dirigent protein 22-like [Nicotiana sylvestris]
Length=175

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            ++T++  Y  D+  G N + + +        S  +FG++   DDP+TE  D  S EI RA
Sbjct  28   KETRMTLYFQDWSGGPNATVLQITDHQNGPLSFTKFGSMFVTDDPITEAYDKNSAEIARA  87

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y+ S LDG   H++ S+IFT  EYKG++LEIQGA     + RE +VV GTG FR  +
Sbjct  88   QGIYVTSALDGTISHVLISIIFTNEEYKGTTLEIQGASPQFERVREVAVVGGTGKFRLAR  147

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T   ++     I++ ++TV HY
Sbjct  148  GYATFETIHFNLAVHYVIIQCNVTVLHY  175



>gb|ABK25163.1| unknown [Picea sitchensis]
 gb|ABK26030.1| unknown [Picea sitchensis]
 gb|ABR27725.1| dirigent-like protein [Picea sitchensis]
Length=172

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 7/148 (5%)
 Frame = -1

Query  654  KLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE----IGR  487
             +VFY+HD L G + +AI VAG +G  ++  +FGTI  + D +T  P     +    +GR
Sbjct  26   NMVFYMHDNLRGSSVTAIPVAGLNGSSSNAGKFGTIVTISDVITRRPQITESDSDNIVGR  85

Query  486  AQGLYINSQ-LDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            AQG Y+N+  + G    +V +V+F + EY GS+LEIQG D F   +REF+VV GTG FR 
Sbjct  86   AQGTYVNTNPVTGLDFLMVMTVVFQDMEYNGSTLEIQGTDRFAQPQREFAVVGGTGKFRL  145

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVR  226
             +G+ I +TE +  PN  +I+K + TV+
Sbjct  146  ARGYAIASTEALSSPN--SIIKFNTTVQ  171



>ref|XP_003540811.2| PREDICTED: dirigent protein 23-like [Glycine max]
Length=190

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 86/152 (57%), Gaps = 1/152 (1%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
             +K   T L FY HD LSG+N SA+ VA   D  KTS+  FG I   DDP+TE  DPKSK
Sbjct  39   ENKETVTNLEFYFHDTLSGQNPSAVRVAEPLDKKKTSMTLFGAIMMADDPLTETSDPKSK  98

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             +GRAQGLY +S     GL +  S  FT+G Y GSS  + G +      RE  VV GTG 
Sbjct  99   IVGRAQGLYGSSCQQEIGLLMAMSYSFTDGPYNGSSFALLGKNSAMNPVREMPVVGGTGL  158

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FR  +G+ +  T + D     AI+  ++T+ H
Sbjct  159  FRMARGYALAKTHWFDPTTGDAIVAYNVTLLH  190



>ref|XP_010024253.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
Length=190

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 91/151 (60%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            +K + + L FY+HD +SG N +A+ VA      TS   FG I  +DDP+TEGP+  SK +
Sbjct  40   NKEKLSHLHFYLHDVVSGRNPTAVLVAEAKTTNTSATGFGAIVVIDDPLTEGPEASSKIV  99

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY ++ L+  GL +V + +FTEG+Y GS+L + G +      RE  +V G+  FR
Sbjct  100  GRAQGLYSSASLNEAGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSSMREMPIVGGSRLFR  159

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+    T  ++     A+++ ++ V HY
Sbjct  160  FARGYAQARTHTVNPHTGDAVVEYNVYVFHY  190



>ref|XP_011088571.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=197

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 90/150 (60%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T+L FY+HD +SG N + + +   +    S   FG I A+DDP+TEGP P S  +G
Sbjct  48   KHKVTELHFYLHDIVSGSNPTNVPLVVTNSTSQSPTYFGLIAAIDDPLTEGPAPDSPIVG  107

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGL+ ++ LD    H+ F+ +FT G+Y GS+L + G + F  + RE  +V G+G FR 
Sbjct  108  RAQGLFGSTSLDKIAYHMTFNFVFTSGKYNGSTLSVVGHNPFMDEYRELPIVGGSGVFRL  167

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G  ++ T   +  +  A+++ D+ V HY
Sbjct  168  ARGTALLNTLTFNSTSGDAVVEYDVVVLHY  197



>ref|NP_199066.1| disease resistance-responsive family protein [Arabidopsis thaliana]
 sp|Q9FIG6.1|DIR1_ARATH RecName: Full=Dirigent protein 1; Short=AtDIR1; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10492.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABR46205.1| At5g42510 [Arabidopsis thaliana]
 gb|AED94819.1| disease resistance-responsive family protein [Arabidopsis thaliana]
Length=182

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 95/152 (63%), Gaps = 5/152 (3%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +A+ VA      T  ++FG I   DDP+TEGPDP SKE
Sbjct  34   YKPEKFTHLHFYFHDVISGDKPTAVKVAEARPTTTLNVKFGVIMIADDPLTEGPDPSSKE  93

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGA-DIFNMKEREFSVVSGTGF  319
            +GRAQG+Y ++ +      +VF+ +FT GE+ GS++ + G  DIF+ K RE  ++ GTG 
Sbjct  94   VGRAQGMYASTAMKDIVFTMVFNYVFTAGEFNGSTIAVYGRNDIFS-KVRELPIIGGTGA  152

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FRF +G+ +  T    I  L A+++ ++ + H
Sbjct  153  FRFARGYALPKT--YKIVGLDAVVEYNVFIWH  182



>ref|XP_010024289.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
 gb|KCW90341.1| hypothetical protein EUGRSUZ_A02487 [Eucalyptus grandis]
Length=192

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 88/148 (59%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T L FY+HD ++ ++ +A+ VA      TS   FG +  +DDP+T GPD  S  +GRA
Sbjct  45   KMTHLRFYLHDIVTAQHPTAVPVAQAATTNTSSTSFGLVLVIDDPLTVGPDLNSTLVGRA  104

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+++ S      L ++ +++FTEG YKGS+L +   ++     RE ++V GTG FRF +
Sbjct  105  QGMFVMSSQSEVSLTMMMNLVFTEGAYKGSTLSVLAQNLVLKNPRELAIVGGTGVFRFAR  164

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+  + T  +++  L AI+K D    HY
Sbjct  165  GYIQLRTHTINMTTLNAIVKYDAYALHY  192



>ref|XP_007132531.1| hypothetical protein PHAVU_011G102300g [Phaseolus vulgaris]
 gb|ESW04525.1| hypothetical protein PHAVU_011G102300g [Phaseolus vulgaris]
Length=176

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 0/146 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             +P    +V Y+ D + G N +   + G  G   S  QFGTI AVDDP+   P+P S  +
Sbjct  28   EEPLPKTIVLYLQDTVKGPNATVSPIIGLTGKDWSFDQFGTIFAVDDPIVLTPNPFSSAV  87

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+ + S  DG  + +  S++FT  +Y GSS++IQG    + K RE SVVSGTG FR
Sbjct  88   GRAQGMLVVSARDGANVFVALSLVFTNFQYSGSSIQIQGVSRQHEKFREVSVVSGTGKFR  147

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDI  235
            FVKG+ +  T + D     +I+ L +
Sbjct  148  FVKGYAVFETAYYDANTAHSIISLTV  173



>ref|XP_006464972.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
 gb|KDO36136.1| hypothetical protein CISIN_1g030136mg [Citrus sinensis]
Length=182

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 84/149 (56%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K   T L FY HD LSG+N SA+ +A       S   FG +   DDP+TE PDP+SK +G
Sbjct  34   KETTTNLQFYFHDTLSGKNPSAVRIAQAIDTDKSPTLFGIVMMADDPLTETPDPQSKLVG  93

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY ++  D   L +  S +F +G Y  SS+ + G +      RE  +V GTGFFR 
Sbjct  94   RAQGLYGSACQDQLSLIMSMSFVFVDGPYNRSSISLLGNNRAMNPVREMPIVGGTGFFRL  153

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ I  T  MD     AI++ ++TV H
Sbjct  154  ARGYAIAQTHRMDFKTGDAIVRYNVTVVH  182



>ref|XP_004289850.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=190

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 84/147 (57%), Gaps = 1/147 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            R T L FY HD +SG+N SAI VA     + S   FG +   DDP+TE PDP SK +GRA
Sbjct  45   RVTNLQFYFHDTVSGKNPSAIRVAQAPDTEKSPTLFGALLMADDPLTETPDPDSKLVGRA  104

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QGLY +S     GL +  S  FT+G Y GSS+ I G +      RE  VV GTG FR  +
Sbjct  105  QGLYGSSGQHELGLIMAMSFAFTDGTYNGSSISIFGKNPALNPVRELPVVGGTGMFRLAR  164

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRH  223
            G+ I  T + D+    AI+  ++TV H
Sbjct  165  GYAIACTHWFDVSG-DAIVGYNVTVIH  190



>ref|XP_006841304.1| hypothetical protein AMTR_s00134p00100380 [Amborella trichopoda]
 gb|ERN02979.1| hypothetical protein AMTR_s00134p00100380 [Amborella trichopoda]
Length=203

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD +SG   +AI VA  D    S   FG I  +DDP+TEGP+  SK IG
Sbjct  54   KEKVTHLHFYFHDIVSGPKPTAIQVARADSTNKSATGFGAIVMIDDPLTEGPEVTSKLIG  113

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  + +F +G+YKGS+L I G +      RE ++V G+G FR 
Sbjct  114  RAQGIYASAAQEEVGLLMTLNYVFVKGKYKGSTLSILGRNAVFNGVREMAIVGGSGAFRL  173

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T   D+    A+++ ++ V HY
Sbjct  174  ARGYALAKTYTFDLKTGDAVVEYNVVVLHY  203



>ref|XP_007024406.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
 gb|EOY27028.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
Length=181

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 90/149 (60%), Gaps = 1/149 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSG-ENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T +  Y HDY SG  N++ + V G  G   +  QFGT+  VDD VTEGP+  S  +GR
Sbjct  33   KETNMTVYFHDYSSGGPNSTDLPVVGFPGKLWNFTQFGTLYVVDDLVTEGPELTSATVGR  92

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
             QG Y+ + LDG   ++ FS++FT   Y GS+++I G +      RE+SV SGTG FR+ 
Sbjct  93   GQGTYVIASLDGLNAYVSFSLVFTNMAYNGSTIQILGNNNQFKAVREYSVASGTGKFRYA  152

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             G+    T F+D     +IL+++++ RHY
Sbjct  153  TGYATFETIFLDQSTSYSILRVNVSARHY  181



>gb|EYU37929.1| hypothetical protein MIMGU_mgv1a025367mg [Erythranthe guttata]
Length=151

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 92/150 (61%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T+L FY+HD +SG + + I +A  +   TS   FG I A+DD +T GP   S  +G
Sbjct  2    KQKVTELHFYLHDVVSGPHPTNIPIATANSTATSPTFFGLIAAMDDLLTVGPTRNSTTVG  61

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGL+ ++ LD  G H+ F+++FT G+Y GS+L + G + F  + RE  VV G+G FR 
Sbjct  62   RAQGLFGSTSLDEIGFHMTFNIVFTAGKYNGSTLSLAGHNPFLDEFRELPVVGGSGVFRL  121

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G  ++ T   ++ +  AI++ DI V HY
Sbjct  122  ARGTALLDTVSYNMTSGDAIVEYDIMVLHY  151



>ref|XP_010257547.1| PREDICTED: dirigent protein 21-like [Nelumbo nucifera]
Length=171

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 0/146 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG N +A+ VA       S   FG +  +DDP+TE P+  SK +GRAQG
Sbjct  26   THLHFYFHDIVSGRNPTAVRVAEAPITNKSATFFGAVVVMDDPLTETPELTSKAVGRAQG  85

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y  +        L F+ +F+EG+Y GS+L + G +    K RE  V+ G+G FRF +G+
Sbjct  86   IYSATSQSELSFLLAFNFVFSEGKYNGSTLSVLGREPVGPKVRELPVIGGSGIFRFARGY  145

Query  297  GIMTTEFMDIPNLKAILKLDITVRHY  220
             ++ T+ +D+    A+L+ D+ V HY
Sbjct  146  ALVKTQALDLKTGDAVLEYDVFVIHY  171



>ref|XP_008229968.1| PREDICTED: dirigent protein 2-like [Prunus mume]
Length=181

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLS-GENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T LV Y  D +S G N +++ +AG  G   +  QFGT+   DDP+T GP+P S  IGR
Sbjct  33   KETHLVLYFQDNVSAGPNATSLPIAGIAGKLWTFTQFGTVYVTDDPLTAGPEPNSASIGR  92

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
             QG+ + + L+G+   ++ S++FT  EY GS++E+QG      +  E +VVSGTG FRF 
Sbjct  93   GQGIAVVAALNGRNALVLVSLVFTNQEYNGSTIELQGNSKQFEQVTEVAVVSGTGKFRFA  152

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            +G+    T  +D     ++ + ++TV+HY
Sbjct  153  RGYATFETYLVDPATSYSVERCNVTVQHY  181



>ref|XP_011088575.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=190

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 90/150 (60%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T+L FY HD +SG+N SAI+VA  +    S   FG I  +DD +T GP+P SK IG
Sbjct  41   KEKVTQLHFYFHDIVSGKNPSAITVAESNSSLDSPTMFGVIRMMDDALTVGPEPDSKIIG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++ ++  GL +  +++FT G+Y GS+L + G +    K RE  +V G+G FR 
Sbjct  101  RAQGIYGSASMEEIGLLMTLNLVFTHGKYNGSTLSVLGHNPILHKYREMPIVGGSGVFRL  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G     T + +  +  A+++  + V HY
Sbjct  161  ARGIATANTVWFNATSQDAVVEYSVIVLHY  190



>ref|XP_006836063.1| hypothetical protein AMTR_s00114p00093910 [Amborella trichopoda]
 gb|ERM98916.1| hypothetical protein AMTR_s00114p00093910 [Amborella trichopoda]
Length=229

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD LSG N +AI VA      +S+  FG I  +DDP+TEGP+  SK +G
Sbjct  80   KEKVSHLHFYFHDILSGPNPTAIEVACAHSTNSSMTGFGAIMMIDDPLTEGPELTSKLLG  139

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  + +F EG+Y GS+L I G +      RE +VV G+G FR 
Sbjct  140  RAQGIYASAAQEEVGLLMSLNYMFMEGKYNGSTLSILGRNAVMSGVRELAVVGGSGAFRL  199

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T   D     A+++ ++ V HY
Sbjct  200  ARGYALAKTHAFDPSTGDAVVEYNVVVLHY  229



>ref|XP_006582797.1| PREDICTED: dirigent protein 23-like [Glycine max]
Length=143

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 90/143 (63%), Gaps = 3/143 (2%)
 Frame = -1

Query  651  LVFYVHDYLSGENTSAIS-VAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGL  475
            +VFY+ D  +G N + ++ VAG +G   S   FG+I  VD PVT    P S+ +G+AQGL
Sbjct  1    MVFYLQDLAAGPNATVVAPVAGINGRVWSFTTFGSIFVVDFPVTLSISPASELVGQAQGL  60

Query  474  YINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFG  295
             I S LDG  +++  S++F   +Y GS+LE+QG    +   RE SVVSGTG FRF +G+ 
Sbjct  61   LIASALDGASVNVALSIVFNNLQYNGSTLELQGISRRHENYREVSVVSGTGKFRFARGYA  120

Query  294  IMTTEFMDIPNLKAILKLDITVR  226
            ++ T F DI   ++ L+L IT++
Sbjct  121  VLETAFFDIS--RSTLRLTITIQ  141



>gb|KCW90019.1| hypothetical protein EUGRSUZ_A02219 [Eucalyptus grandis]
Length=187

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T+L FY HD LSG+N +A+ VA     + S   FG +  +DDP+TEGP+P+S  IG
Sbjct  38   KRKTTRLHFYFHDTLSGKNPTAVRVAEAAMSEKSPTLFGVVNMIDDPLTEGPEPESPLIG  97

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG Y +  L+   LH+  +++FT  EY GS+L I G +      RE  +V GTG FR 
Sbjct  98   RAQGFYGSVGLESVALHMNVNLVFTTPEYNGSTLSILGRNPALETYREMPIVGGTGIFRL  157

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              G     T F+++    A+++  +   HY
Sbjct  158  ASGVATAKTYFLNLTTGDAVVEYKVIAMHY  187



>gb|AES88156.2| disease resistance-responsive, dirigent domain protein [Medicago 
truncatula]
Length=179

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = -1

Query  660  QTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQ  481
            Q+ LVF++ D   G   +   V G +G   S   FGTI  VDDP+   P+P S +IGRAQ
Sbjct  32   QSTLVFFLQDVGKGVGATVQPVIGINGKVWSYNSFGTIFVVDDPIMLNPNPGSTQIGRAQ  91

Query  480  GLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKG  301
            G+   + LDG  + +V S++F  G+Y GS+LEIQGA       RE SVVSGTG FR+ +G
Sbjct  92   GMITVTSLDGSNVSIVLSLVFNNGQYSGSTLEIQGASRQRENSRELSVVSGTGRFRYARG  151

Query  300  FGIMTTEFMDIPNLKAILKLDITV  229
            F +  T   D     ++L+L +T+
Sbjct  152  FVVFETVSYDDSTNHSVLRLTVTL  175



>ref|XP_011092911.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=169

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 0/147 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T L FY+HD +SG N + I +A  +    S   FG I A+DDP+T GP P S  +GRA
Sbjct  23   KATHLHFYLHDIVSGPNPTNIPIAMSNSTAQSPTYFGLIAAIDDPLTLGPSPDSGIVGRA  82

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QGL+ ++ L+    H+ F ++FT G+Y GS+L + G + F  + RE S+V G+G FR  +
Sbjct  83   QGLFGSTSLEEIAFHMTFDIVFTNGKYNGSTLTVVGRNPFLREYRELSIVGGSGVFRLAR  142

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRH  223
            G  I+ T   +  +  A+++ ++ V H
Sbjct  143  GTAILNTVTYNSTSGDAVVEYNVMVLH  169



>ref|XP_007132492.1| hypothetical protein PHAVU_011G098700g [Phaseolus vulgaris]
 gb|ESW04486.1| hypothetical protein PHAVU_011G098700g [Phaseolus vulgaris]
Length=176

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 0/146 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY+ D   G   +   + G  G   +  QFGTI AV+DPV  GP   S ++GRAQG
Sbjct  31   TTLTFYLQDIGKGPGATVSPITGLTGRDWTYDQFGTIIAVNDPVMMGPASLSTQVGRAQG  90

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            L + S  DG  ++ + S++FT  EY GS+LEIQG    +   +E SVVSGTG FRFV+G+
Sbjct  91   LLVVSAQDGANVNAILSIVFTNSEYSGSTLEIQGVSRQHENYKELSVVSGTGRFRFVRGY  150

Query  297  GIMTTEFMDIPNLKAILKLDITVRHY  220
              + T   D     ++++  +T++ +
Sbjct  151  ATLETVLYDPSTAHSVIRFTVTLKAF  176



>gb|EYU46052.1| hypothetical protein MIMGU_mgv1a024219mg [Erythranthe guttata]
Length=186

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 88/153 (58%), Gaps = 6/153 (4%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            +R   + T L FY HD +SG + +A++VAG         +FG    +DDP+TE PDP SK
Sbjct  40   HRTAEKTTHLHFYFHDIVSGPHPTAVTVAGTKN------KFGATAVIDDPLTENPDPGSK  93

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             +GRAQG+Y  S  D   L +V + +F EG Y GS+L + G + F    RE  V+ GTG 
Sbjct  94   VVGRAQGIYATSSKDTVSLLMVLNFVFVEGVYNGSALSVLGRNRFLEPVRELPVLGGTGI  153

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FRF +G+ +  T   D+    A+++ ++ V H+
Sbjct  154  FRFARGYALAKTVTFDVGTGDAVVEYNVFVLHH  186



>ref|XP_010023728.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
Length=195

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T+L FY HD LSG+N +A+ VA     + S   FG +  +DDP+TEGP+P+S  IG
Sbjct  46   KRKTTRLHFYFHDTLSGKNPTAVRVAEAAMSEKSPTLFGVVNMIDDPLTEGPEPESPLIG  105

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG Y +  L+   LH+  +++FT  EY GS+L I G +      RE  +V GTG FR 
Sbjct  106  RAQGFYGSVGLESVALHMNVNLVFTTPEYNGSTLSILGRNPALETYREMPIVGGTGIFRL  165

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              G     T F+++    A+++  +   HY
Sbjct  166  ASGVATAKTYFLNLTTGDAVVEYKVIAMHY  195



>ref|XP_004248664.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=189

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + TK  FY HD +SG+N SAI++A  +    S   FG++  +DDP+T GP+P S  +G
Sbjct  38   KQKVTKFHFYFHDIVSGKNPSAITIAQSNMTSKSPTFFGSVAMIDDPLTVGPEPNSTIVG  97

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFR  313
            RAQG+Y ++  +  GL + ++++FT G+Y GS+L + G + IFN + RE S++ G+G FR
Sbjct  98   RAQGIYGSADQNEAGLLMTYNIVFTTGKYNGSTLSVLGRNPIFN-QYREMSIIGGSGVFR  156

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              +G     T + +  +  A+++ ++ V HY
Sbjct  157  LAQGIATAKTYWFNTTSGDAVVEYNVIVLHY  187



>ref|XP_010058351.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW90333.1| hypothetical protein EUGRSUZ_A02477 [Eucalyptus grandis]
Length=190

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG N +A+ VA       S   FG +  +DDP+TEGP+  SK +G
Sbjct  41   KEKLSHLHFYFHDIVSGRNPTAVRVAEAKMTNKSATGFGLVVMIDDPLTEGPELSSKVVG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY ++  +  GL +V + +FTEG+Y GS+L + G +    + RE  +V G+  FRF
Sbjct  101  RAQGLYSSASQNDLGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSEVREMPIVGGSRLFRF  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  +D+    A+++ ++ V HY
Sbjct  161  ARGYAQARTHLLDLQTGDAVVEYNVYVFHY  190



>ref|XP_002313729.2| hypothetical protein POPTR_0009s13340g [Populus trichocarpa]
 gb|EEE87684.2| hypothetical protein POPTR_0009s13340g [Populus trichocarpa]
Length=187

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 94/159 (59%), Gaps = 7/159 (4%)
 Frame = -1

Query  678  NRHKPRQ---TKLVFYVHDYLSGENTSAISVAG--RDGPKTSVLQFGTITAVDDPVTEGP  514
            +RH PR+   T+L F++HD LSG+N SA+ VAG  R     S   FG++ A+DDP+  GP
Sbjct  29   SRHVPRKEKVTRLHFFLHDILSGKNPSAVKVAGSNRTEGDKSPTPFGSVYAIDDPLKVGP  88

Query  513  DPKSKEIGRAQGLYINSQLDGKGLHLVFSVI--FTEGEYKGSSLEIQGADIFNMKEREFS  340
            +P SK IG AQGLY++S  D     +V  V   FTEG++KGSS  +   +     +RE +
Sbjct  89   EPDSKTIGNAQGLYLSSSQDYSKFTIVMCVDFGFTEGKFKGSSFSVFSRNPVTEADREVA  148

Query  339  VVSGTGFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            VV G G FR  +GF  + T   +  N  A+L+  +T+ H
Sbjct  149  VVGGRGKFRMARGFAKVKTSHFNATNGDAVLEYKVTLIH  187



>gb|KHN41236.1| Disease resistance response protein 206 [Glycine soja]
Length=177

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = -1

Query  666  PRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            P QT +VFY+ D   G + +   VAG  G   +   FG+I  VDDPVT    P S+ +GR
Sbjct  29   PNQTTMVFYLQDIAKGSSATVTPVAGIKGSDWTYTTFGSIFVVDDPVTLSISPTSEMVGR  88

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQGL I S  DG  +++  S++F   +Y GS+LE+QG        RE SVVSGTG FRF 
Sbjct  89   AQGLLIASAHDGANVNVALSIVFNNLQYSGSTLELQGISRQRESYREVSVVSGTGKFRFA  148

Query  306  KGFGIMTTEFMDIP  265
            +G+ ++ T   D P
Sbjct  149  RGYALLQTVLYDAP  162



>ref|XP_009630041.1| PREDICTED: dirigent protein 22-like [Nicotiana tomentosiformis]
Length=193

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 87/150 (58%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG+N +A+ +A       S   FG +  +DDP+T GP+P SK +G
Sbjct  44   REKLSHLHFYFHDIVSGKNPTAVKIAEAAMTNRSPTGFGLMAMIDDPLTVGPEPNSKLVG  103

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y  + L+  GL +V +  F EG+Y GS+L I G +      RE  +V G+G FRF
Sbjct  104  RAQGIYAQASLNDVGLLMVLNFAFVEGKYNGSTLSILGRNSVMSTVREMPIVGGSGLFRF  163

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  +D     A+++ ++ V HY
Sbjct  164  ARGYAKAKTHTLDFKTGDAVVEYNVYVFHY  193



>ref|XP_009346642.1| PREDICTED: dirigent protein 4-like [Pyrus x bretschneideri]
Length=190

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 93/155 (60%), Gaps = 4/155 (3%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPK--TSVLQFGTITAVDDPVTEGPDPKSK  499
            HK + T+L FY+ D +SG   SA+ VA  +  K  +S   FG++ A+DDP+ EGP+  SK
Sbjct  36   HKEKVTRLHFYLFDIISGNKPSAVEVARPNSTKNDSSPTPFGSVWAIDDPLREGPEATSK  95

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIF--TEGEYKGSSLEIQGADIFNMKEREFSVVSGT  325
             IG AQGLY++S  D   L LV  V F  TEG++KGSS  +   +      RE +VV G 
Sbjct  96   VIGNAQGLYVSSVQDETKLGLVMYVDFGFTEGKFKGSSFSVFSRNPVTETNRELAVVGGR  155

Query  324  GFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G FR  +GF  + T ++++ N  AI++  +T+ HY
Sbjct  156  GRFRMARGFAKLKTSYLNVTNGDAIIEYKVTLIHY  190



>ref|XP_010257545.1| PREDICTED: dirigent protein 19-like [Nelumbo nucifera]
Length=196

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 0/142 (0%)
 Frame = -1

Query  645  FYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYIN  466
             Y HD +SG N S+I VA      TS  QFG +  +DDP+TEGP+  SK +GRAQG Y +
Sbjct  55   LYWHDIVSGSNPSSIRVAAAPSTDTSPTQFGIVRVIDDPLTEGPELSSKLVGRAQGFYTS  114

Query  465  SQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMT  286
            S     GL +  +  F EG+Y GS++ I G +    K RE  V+ G+G FRF +G+   +
Sbjct  115  SSQSDLGLLMAMNFAFMEGKYNGSTITILGRNHVFTKVREMPVIGGSGLFRFARGYAQAS  174

Query  285  TEFMDIPNLKAILKLDITVRHY  220
            T  +D+    AI++ +I V HY
Sbjct  175  THTVDLKTGDAIVEYNIYVFHY  196



>ref|XP_006582798.1| PREDICTED: dirigent protein 23-like [Glycine max]
Length=185

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = -1

Query  666  PRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            P QT +VFY+ D   G + +   VAG  G   +   FG+I  VDDPVT    P S+ +GR
Sbjct  37   PNQTTMVFYLQDIAKGSSATVTPVAGIKGSDWTYTTFGSIFVVDDPVTLSISPTSEMVGR  96

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQGL I S  DG  +++  S++F   +Y GS+LE+QG        RE SVVSGTG FRF 
Sbjct  97   AQGLLIASAHDGANVNVALSIVFNNLQYSGSTLELQGISRQRESYREVSVVSGTGKFRFA  156

Query  306  KGFGIMTTEFMDIP  265
            +G+ ++ T   D P
Sbjct  157  RGYALLQTVLYDAP  170



>ref|NP_199065.1| disease resistance-responsive (dirigent-like protein) family 
protein [Arabidopsis thaliana]
 sp|Q9FIG7.1|DIR2_ARATH RecName: Full=Dirigent protein 2; Short=AtDIR2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10491.1| disease resistance response protein-like [Arabidopsis thaliana]
 gb|AAM13094.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37801.1| At5g42500 [Arabidopsis thaliana]
 gb|AED94817.1| disease resistance-responsive (dirigent-like protein) family 
protein [Arabidopsis thaliana]
Length=185

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (60%), Gaps = 3/151 (2%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP + T L FY HD +SG+  +A+ VA      +S + FG I   DDP+TEGPDP SKE
Sbjct  37   YKPDKFTHLHFYFHDVISGDKPTAVKVAEARRTNSSNVNFGVIMIADDPLTEGPDPSSKE  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y  + +      +VF++ FT GE+ GS++ + G +    K RE  ++ GTG F
Sbjct  97   VGRAQGMYALTAMKNISFTMVFNLAFTAGEFNGSTVAMYGRNEIFSKVREMPIIGGTGAF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+    T    +  L A+++ ++ + H
Sbjct  157  RFARGYAQAKT--YKVVGLDAVVEYNVFIWH  185



>gb|KFK44377.1| hypothetical protein AALP_AA1G249600 [Arabis alpina]
Length=183

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 89/151 (59%), Gaps = 6/151 (4%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            H+P   T L FY HD LSG+  +AI V     P  +   FG +   D+ +TEGPDP SKE
Sbjct  38   HEPESFTHLHFYFHDVLSGDKPTAIRVTN---PPVTNTSFGVVVIADNLLTEGPDPSSKE  94

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQGLY ++ +      +VF++ FTEGE+ GS++ + G +    K RE  ++ GTG F
Sbjct  95   IGRAQGLYASTDMKTLSFTMVFNLAFTEGEFNGSTVSMYGRNPILSKVRELPIIGGTGEF  154

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            RF +G+    T  +D     A+++ +I +RH
Sbjct  155  RFARGYAQAETYKLD--GFNAVVEYNIFIRH  183



>ref|XP_004243842.2| PREDICTED: dirigent protein 1-like [Solanum lycopersicum]
Length=177

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 87/149 (58%), Gaps = 1/149 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAG-RDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T +  Y  D+  G N + + + G +D    S  +FG++   DDP+T+  D  S EI R
Sbjct  29   KETNMTLYFQDWSGGPNATVLQITGHQDHGLLSFAKFGSVFVTDDPITQAFDENSAEIAR  88

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+Y+ S LDGK  H++ S+IFT  + KGS+LEIQGA     + RE ++V GTG FR  
Sbjct  89   AQGIYVTSALDGKISHVLISIIFTNDDCKGSTLEIQGASPQFERVREVAIVGGTGKFRLA  148

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             G+    T   D+     +++ ++T+ HY
Sbjct  149  SGYATFETIHFDLAIHYVVIQCNVTILHY  177



>gb|AFK35849.1| unknown [Lotus japonicus]
Length=191

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 85/151 (56%), Gaps = 1/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVL-QFGTITAVDDPVTEGPDPKSKE  496
            +K   T L FY HD LSG N SA+ VA  +    S+L QFGTI   DDP+TE  DPKS+ 
Sbjct  41   NKETVTNLQFYFHDTLSGRNPSAVRVAQPEDKNKSLLTQFGTIMMADDPLTETSDPKSEM  100

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY +S     GL +  S  FT+G Y  SS  + G +      RE  VV GTG F
Sbjct  101  VGRAQGLYGSSCQQEIGLLMAMSYSFTDGPYNRSSFSLIGKNAAMNPIREMPVVGGTGLF  160

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            R  +G+ I  T + D     AI+  ++T+ H
Sbjct  161  RMARGYAIAKTHWFDPTTGDAIVGYNVTLIH  191



>ref|XP_006851937.1| hypothetical protein AMTR_s00041p00178500 [Amborella trichopoda]
 gb|ERN13404.1| hypothetical protein AMTR_s00041p00178500 [Amborella trichopoda]
Length=181

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 84/142 (59%), Gaps = 0/142 (0%)
 Frame = -1

Query  645  FYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYIN  466
            FY+HD L  +  +A++VA  +    S   FG +   DDP+TEGP+  SK IG+AQGLY  
Sbjct  40   FYLHDLLVADKPTAVTVAKANTTSASPTVFGEVVIADDPLTEGPELTSKWIGKAQGLYAF  99

Query  465  SQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMT  286
            S      L +  ++ FT+GE+ GS+L + G +    K RE S+V GTG FR   G+ ++ 
Sbjct  100  SSQSEFSLFMALNLAFTDGEFNGSTLTVIGRNPVQEKVRELSIVGGTGAFRLASGYVLIQ  159

Query  285  TEFMDIPNLKAILKLDITVRHY  220
            T F+D   L A++  ++TV HY
Sbjct  160  TFFLDTTTLNAVVHYNVTVIHY  181



>ref|XP_010416851.1| PREDICTED: dirigent protein 23-like [Camelina sativa]
Length=187

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
             K + T L FY HD LSG+N +A+ VA G D  K+  L FG +  VDD +TE  DPKSK 
Sbjct  38   EKEKVTNLQFYFHDTLSGKNPTAVKVAQGTDTEKSPTL-FGAVFMVDDALTETADPKSKL  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG F
Sbjct  97   VGRAQGLYGSSCKEEVGLTMAMSFCFEDGPYKDSTISMIGKNSAMNPIREMPIVGGTGMF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            R  +G+ I  T + DI    AI+  ++TV H
Sbjct  157  RMARGYAIAQTNWFDIKTGDAIVGYNVTVFH  187



>ref|XP_010520009.1| PREDICTED: dirigent protein 22-like [Tarenaya hassleriana]
Length=190

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD LSG+N +A+ VA      TS   FG++  +DDP+T  PDPKSK IG
Sbjct  41   KEKLSHLHFYFHDVLSGQNPTAVRVAAAAMTNTSRSFFGSVMMMDDPLTLLPDPKSKTIG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
             AQG+Y ++     GL +V + +F EG+Y GS+L + G +      RE  +V G+G FRF
Sbjct  101  YAQGIYASASQTEVGLLMVLNFVFKEGKYNGSTLSVLGRNAVFSGIREMPIVGGSGAFRF  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  +D+    A+++ ++   HY
Sbjct  161  ARGYAKAKTHSLDMNTGDAVVEYNVYALHY  190



>ref|XP_004289851.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 83/145 (57%), Gaps = 0/145 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG+N SA+ VA     + S   FG +   DDP+TE PDP SK +GRAQG
Sbjct  43   TNLQFYFHDTISGKNPSAVRVAQASDTEKSPTLFGALLMADDPLTETPDPNSKLLGRAQG  102

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y +S     GL +  S  FTEG Y GSS+ I G +      RE  VV GTG FR  +G+
Sbjct  103  MYGSSGQQEFGLIMAMSFAFTEGTYNGSSISIFGKNPITNPIRELPVVGGTGIFRSARGY  162

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
             I  T + +  +  AI+  ++TV H
Sbjct  163  AIAHTHWFNNDSGDAIVGYNLTVVH  187



>ref|XP_008241179.1| PREDICTED: dirigent protein 21-like [Prunus mume]
Length=199

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD LSG N +A+ VA      TS+  FG +  +DDP+T GP+  SK +G
Sbjct  50   REKLSHLHFYFHDILSGRNPTAVRVAEAPTTNTSLTAFGAVVVMDDPLTVGPELGSKLVG  109

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            +AQG+Y ++     GL + F+ +F EG+Y GS+L + G +    + RE  +V G+G FRF
Sbjct  110  KAQGIYASASQSELGLLMAFNFVFVEGKYNGSTLSVLGRNSVLSEVREMPIVGGSGLFRF  169

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+   +T  +D     AI++ ++ V HY
Sbjct  170  ARGYAHASTHQVDFKTGDAIVEYNVYVFHY  199



>ref|XP_011046639.1| PREDICTED: dirigent protein 4-like [Populus euphratica]
Length=187

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 94/157 (60%), Gaps = 7/157 (4%)
 Frame = -1

Query  678  NRHKPRQ---TKLVFYVHDYLSGENTSAISVAG--RDGPKTSVLQFGTITAVDDPVTEGP  514
            +RH PR+   T+L F++HD LSG+N SA+ VAG  R     S   FG++ A+DDP+  GP
Sbjct  29   SRHVPRKEKVTRLHFFLHDILSGKNPSAVKVAGSNRTEGDKSPTPFGSVYAIDDPLKVGP  88

Query  513  DPKSKEIGRAQGLYINSQLDGKGLHLVFSVI--FTEGEYKGSSLEIQGADIFNMKEREFS  340
            +P SK IG AQGLY++S  D     +V  V   FT+G++KGSS  +   +     +RE +
Sbjct  89   EPDSKTIGNAQGLYLSSSQDYSKFTIVMCVDFGFTKGKFKGSSFSVFSRNPVTEADREVA  148

Query  339  VVSGTGFFRFVKGFGIMTTEFMDIPNLKAILKLDITV  229
            VV G G FR  +GF  + T + +  N  A+L+  +T+
Sbjct  149  VVGGRGKFRMARGFAKVKTSYFNATNGDAVLEYKVTL  185



>ref|XP_006836064.1| hypothetical protein AMTR_s00114p00094280 [Amborella trichopoda]
 gb|ERM98917.1| hypothetical protein AMTR_s00114p00094280 [Amborella trichopoda]
Length=155

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG N +AI VA      TS   FG I  +DDP+T+GP+  SK IG
Sbjct  6    KEKVSHLHFYFHDIVSGPNPTAIEVARAHSTNTSDTGFGLIMMIDDPLTKGPELTSKLIG  65

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  + +F EG+Y GS+L I G +      RE +VV G+G FR 
Sbjct  66   RAQGIYASAAQEELGLLMSLNYMFVEGKYNGSTLSILGRNAAMSGVRELAVVGGSGAFRL  125

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T   D     A+++ ++ V HY
Sbjct  126  ARGYALAKTHAFDPSTGDAVVEYNVVVLHY  155



>ref|XP_011080616.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=186

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 89/153 (58%), Gaps = 6/153 (4%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            N    + + L FY HD +SG++ +AISVAGR        +FG    +DDP+TEG    SK
Sbjct  40   NHDVEKMSHLHFYFHDIVSGKHPTAISVAGRKN------EFGGTAIIDDPLTEGVKHGSK  93

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             +GRAQG+Y  S LD   L +V +  FTEG+Y GSSL + G + F    RE  VV G+G 
Sbjct  94   VVGRAQGMYSMSSLDASSLLMVMNFEFTEGKYNGSSLSVLGRNPFLETVREMPVVGGSGL  153

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FRF +G+ +  T   ++    A+++ ++ V H+
Sbjct  154  FRFARGYALAKTVHYNVGTGDAVVEYNVFVMHH  186



>ref|XP_008372887.1| PREDICTED: dirigent protein 23 [Malus domestica]
Length=193

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 85/145 (59%), Gaps = 1/145 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SGEN SA+ +A       S+  FG +  VDDP+TE PDP SK +GRAQG
Sbjct  50   TNLQFYFHDTVSGENPSAVRIAQATDTNKSLTLFGALLMVDDPLTETPDPNSKLVGRAQG  109

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y +S     GL +     F +G Y GSS+ I G +      RE  VV+GTG F+F +G+
Sbjct  110  MYGSSGQQEFGLTMAMCFAFCDGIYDGSSISIFGKNPALNLVREMPVVAGTGIFQFARGY  169

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
             I  T + +I    AI++ ++TV H
Sbjct  170  AIARTHWFNIMG-DAIVEYNVTVIH  193



>gb|AAX96293.1| At5g42500 [Oryza sativa Japonica Group]
 gb|ABA91781.1| Dirigent-like protein [Oryza sativa Japonica Group]
 gb|EAZ17642.1| hypothetical protein OsJ_33178 [Oryza sativa Japonica Group]
Length=184

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 86/145 (59%), Gaps = 1/145 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T + FY HD ++G + SA+ V      KTS   FGT+  +DDP+TEGPDP+SK +GRAQG
Sbjct  41   THIHFYFHDKITGPSPSAVQVVSPPN-KTSPTSFGTVYVMDDPLTEGPDPRSKPVGRAQG  99

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y++S     G     +++ T G Y GS + + G++  +   RE  VV GT  FRF +G+
Sbjct  100  MYLSSDQVRIGFLQAMNIVLTAGPYNGSVITVLGSNHISDSIREMPVVGGTSAFRFARGY  159

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
                T F+D   L AI++ ++ V H
Sbjct  160  AQARTYFLDSNGLDAIVEYNVYVFH  184



>gb|EAY80168.1| hypothetical protein OsI_35339 [Oryza sativa Indica Group]
Length=184

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 86/145 (59%), Gaps = 1/145 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T + FY HD ++G + SA+ V      KTS   FGT+  +DDP+TEGPDP+SK +GRAQG
Sbjct  41   THIHFYFHDKITGPSPSAVQVVSPPN-KTSPTSFGTVYVMDDPLTEGPDPRSKPVGRAQG  99

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y++S     G     +++ T G Y GS + + G++  +   RE  VV GT  FRF +G+
Sbjct  100  MYLSSDQVRIGFLQAMNIVLTAGPYNGSVITVLGSNHISDSIREMPVVGGTSAFRFARGY  159

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
                T F+D   L AI++ ++ V H
Sbjct  160  AQARTYFLDSNGLDAIVEYNVYVFH  184



>ref|XP_006662777.1| PREDICTED: dirigent protein 2-like [Oryza brachyantha]
Length=182

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 85/145 (59%), Gaps = 1/145 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T + FY HD ++G + SA+ V       TS+  FG +  +DDP+TEGPDP SK +GRAQG
Sbjct  39   THIHFYFHDKITGPSPSAVKVVNPPN-NTSLTSFGVMFVMDDPLTEGPDPASKPVGRAQG  97

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y+++     G     +++ T G Y GS + + G++  N   RE  VV GTG FRF +G+
Sbjct  98   MYLSADQARIGFLQAMNIVLTVGPYNGSMITVLGSNHINDNIREMPVVGGTGAFRFARGY  157

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
                T F+D   L AI++ ++ V H
Sbjct  158  AQAHTHFLDPNRLDAIVEYNVYVFH  182



>ref|XP_010024277.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
 gb|KCW90340.1| hypothetical protein EUGRSUZ_A02486 [Eucalyptus grandis]
Length=192

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 88/151 (58%), Gaps = 1/151 (1%)
 Frame = -1

Query  669  KP-RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            KP + T L FY+HD ++ ++ +A+ VA      TS   FG +  +DDP+T GPD  S  +
Sbjct  42   KPEKMTHLRFYLHDIVTAQHPTAVPVAQAATTNTSSTFFGLVMVMDDPLTVGPDLNSTLV  101

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+++ S      L +  +++FTEG YKGS+L +   ++     RE ++V GTG FR
Sbjct  102  GRAQGMFVKSSQSELSLTMTMNLVFTEGAYKGSTLSVLAQNLILKNPRELAIVGGTGVFR  161

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+  + T  +++    AI+K D    HY
Sbjct  162  FARGYIQLRTHTINMTTKNAIVKYDAYALHY  192



>ref|XP_006851933.1| hypothetical protein AMTR_s00041p00176840 [Amborella trichopoda]
 gb|ERN13400.1| hypothetical protein AMTR_s00041p00176840 [Amborella trichopoda]
Length=176

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P+ + + FY+HD L     +A++VA  +    S   FG +   DDP+TEGP+  SK IG
Sbjct  27   EPKVSYIDFYLHDLLVANKPTAVTVAKANTTNASPTVFGEVVVADDPLTEGPELTSKWIG  86

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            +AQGLY  S      L +  ++ FT+GE+ GS + + G +    K RE SVV GTG FR 
Sbjct  87   KAQGLYAFSSQSEFSLFMALNLAFTDGEFNGSIVTVIGRNPVQEKVRELSVVGGTGAFRL  146

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              G+ ++ T F+D     A+L  ++TV HY
Sbjct  147  ASGYVLIQTYFLDTTTPNAVLHYNLTVIHY  176



>ref|XP_007162362.1| hypothetical protein PHAVU_001G145600g [Phaseolus vulgaris]
 gb|ESW34356.1| hypothetical protein PHAVU_001G145600g [Phaseolus vulgaris]
Length=186

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L F+ HD ++G N S + VA  +G     L FGT+ A+DDP+T GP+P SK +G+AQG
Sbjct  40   THLHFFFHDVVTGPNPSMVIVAEPNGKAKDALPFGTVVAMDDPLTAGPEPDSKLVGKAQG  99

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +      GL +V ++ FT+GE+ GS++ +   + I     RE ++V GTG FRF +G
Sbjct  100  IYTSISQAEMGLMMVMTMAFTDGEFNGSTISVLARNMIMTEPVREMAIVGGTGAFRFARG  159

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     AI++ D+ V HY
Sbjct  160  YAQAKFHSVDFSKGDAIVEYDVFVNHY  186



>ref|XP_002986379.1| hypothetical protein SELMODRAFT_124022 [Selaginella moellendorffii]
 gb|EFJ12588.1| hypothetical protein SELMODRAFT_124022 [Selaginella moellendorffii]
Length=164

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T L FY+HD ++  N S + VAG   P T+   FGT+T +DDP+T+G D  S  IGR 
Sbjct  25   KDTSLHFYMHDNMTPPNQSVVMVAG---PGTA--GFGTVTVIDDPLTQGADASSPAIGRG  79

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG +I + +DG+ L L FS +F  G++KGS+L   G+D  +   RE +V+ GTG FR  +
Sbjct  80   QGTWIVASMDGRSLLLTFSAVFQTGDFKGSTLSFHGSDDTSEAVREIAVIGGTGQFRNAR  139

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRH  223
            G+  + T          IL++D+ V H
Sbjct  140  GYATIKTA--SASGASVILEIDVRVSH  164



>ref|XP_004142156.1| PREDICTED: uncharacterized protein LOC101214557 [Cucumis sativus]
 ref|XP_004162009.1| PREDICTED: uncharacterized LOC101214557 [Cucumis sativus]
 gb|KGN54087.1| Dirigent-like protein 2 [Cucumis sativus]
Length=195

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 1/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K + +   FY HD L+G+  ++I +       TS+  FG +  +D+P+TE PDPKSK  
Sbjct  46   RKEKLSHFRFYWHDVLTGKYPTSIQIV-PPASNTSMTGFGLVNMIDNPLTETPDPKSKLW  104

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY ++  D  GL +  +  F  G+Y GSSL I G + F  K RE  V+ G+G FR
Sbjct  105  GRAQGLYASASQDQFGLLMAMNFAFVSGKYNGSSLTIFGRNPFLEKVREMPVIGGSGLFR  164

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+   TT  +D     A+++ +I V HY
Sbjct  165  FARGYAKATTNKVDFKTGDAVVEYNIYVLHY  195



>ref|XP_010065287.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW62708.1| hypothetical protein EUGRSUZ_G00279 [Eucalyptus grandis]
Length=195

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 84/148 (57%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T+L FY HD LSG N +A+ VA     + S   FG +  +DDP+TEGP+P+S  +GRA
Sbjct  48   KTTRLHFYFHDTLSGRNPTAVRVAEATMTEKSPTLFGVVNMIDDPLTEGPEPESPLVGRA  107

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG Y +  L+   LH+  +++FT  EY GS+L I G +      RE  +V GTG FR   
Sbjct  108  QGFYGSVGLESMALHMNMNLVFTTPEYNGSTLSILGHNPALETYREMPIVGGTGVFRLAS  167

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G     T F+++    A+++  +   HY
Sbjct  168  GVVTAKTYFLNLTTGDAVVEYKVIALHY  195



>gb|KDP40497.1| hypothetical protein JCGZ_24496 [Jatropha curcas]
Length=148

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 6/150 (4%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T+L FY HD  SG N +AI +AG   P      FG+   +DDP+TEGP+P SK +GRA
Sbjct  3    KMTRLHFYFHDIPSGNNPTAILIAGP--PSKIANNFGSTFMMDDPLTEGPEPTSKLVGRA  60

Query  483  QGLY-INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRF  310
            QG+Y + SQ D  GL +V ++ F EG Y GS+L I G + IF+M  RE  V+ G+G FR+
Sbjct  61   QGMYGLASQHD-IGLLMVMNLAFVEGMYNGSTLAILGRNPIFSMV-REMPVIGGSGLFRY  118

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T  ++     A+++ ++TV H+
Sbjct  119  ARGYALAKTVSVNQKTGNAVVEYNVTVMHF  148



>ref|XP_010023736.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW90020.1| hypothetical protein EUGRSUZ_A02220 [Eucalyptus grandis]
Length=195

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T+L FY HD +SG++ +A  +A     K S   FG +  +DDP+TEGP+P+S  +GRA
Sbjct  48   KTTRLRFYFHDTVSGKSPTAARIAEATMTKKSPTLFGVVFMIDDPLTEGPEPESPLVGRA  107

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG Y ++ L+   L +  +++FT  EY GS+L I G +      RE  +V GTGFFR   
Sbjct  108  QGFYGSAGLESLSLLMNINLVFTSPEYNGSTLSIMGHNPTYETYREMPIVGGTGFFRLAS  167

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G     T F+++    A+++ ++   HY
Sbjct  168  GVATAKTYFLNLTTFDAVVEYNVLAMHY  195



>ref|XP_010024241.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW90332.1| hypothetical protein EUGRSUZ_A02475 [Eucalyptus grandis]
Length=190

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG N +A+ VA      TS   FG +  +DDP+TEGP+  SK +G
Sbjct  41   KEKLSHLHFYFHDIVSGRNPTAVRVAEAKMTNTSTTAFGAVVMIDDPLTEGPELSSKIVG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY  + L   GL +V +  FTEG+  GS+L + G +      RE  +V G+  FRF
Sbjct  101  RAQGLYAFASLSEIGLLMVQNYFFTEGKCNGSTLSVLGRNAVFSGVREMPIVGGSRLFRF  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  +D+    A+++ ++ V HY
Sbjct  161  ARGYAQAKTHSLDLQTGDAVVEYNVYVFHY  190



>ref|XP_002863772.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 ref|XP_002863775.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40031.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40034.1| disease resistance-responsive family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=185

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            +KP   T L FY HD ++G+  +AI VA      +  + FG I   DDP+TEGPDP SK 
Sbjct  37   YKPECFTHLHFYFHDVITGDKPTAIKVAEARPTNSLNVNFGVIMIADDPLTEGPDPSSKV  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGA-DIFNMKEREFSVVSGTGF  319
            +GRAQG+Y ++ +      +VF++ FTEGE+ GS+L + G  DIF+ K RE  ++ GTG 
Sbjct  97   VGRAQGMYASTAMKDIVFTMVFNLAFTEGEFNGSTLAMYGRNDIFS-KVREMPIIGGTGA  155

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FRF +G+    T    I  L A+++ ++ + H
Sbjct  156  FRFARGYAQAKT--YKIVGLDAVVEYNVFIWH  185



>gb|KCW90335.1| hypothetical protein EUGRSUZ_A02479, partial [Eucalyptus grandis]
Length=184

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 79/126 (63%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            +K + + L FY+HD +SG N +A+ VA      TS   FG I  +DDP+TEGP+  SK +
Sbjct  40   NKEKLSHLHFYLHDVVSGRNPTAVLVAEAKTTNTSATGFGAIVVIDDPLTEGPEASSKIV  99

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY ++ L+  GL +V + +FTEG+Y GS+L + G +      RE  +V G+  FR
Sbjct  100  GRAQGLYSSASLNEAGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSSMREMPIVGGSRLFR  159

Query  312  FVKGFG  295
            F +G+ 
Sbjct  160  FARGYA  165



>ref|XP_009775777.1| PREDICTED: dirigent protein 22-like [Nicotiana sylvestris]
Length=191

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG+N +A+ +A       S   FG +  +DDP+T GP+P SK +G
Sbjct  42   REKLSHLHFYFHDIVSGKNPTAVKIAEAAMTNRSSTGFGLMAMIDDPLTVGPEPNSKLVG  101

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y  + L+  GL +  +  F EG+Y GS+L I G +      RE  +V G+G FRF
Sbjct  102  RAQGIYAQASLNDIGLLMALNFAFVEGKYNGSTLSILGRNSVMSTVREMPIVGGSGLFRF  161

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  +D     A+++ ++ V HY
Sbjct  162  ARGYVQAKTHTLDFKTGDAVVEYNVYVFHY  191



>ref|XP_002513105.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF49608.1| Disease resistance response protein, putative [Ricinus communis]
Length=186

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 89/152 (59%), Gaps = 4/152 (3%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            + + + T L FY HD ++G+N +AI +AG   P +S+  FG    +DDP+TEGP+  SK 
Sbjct  39   KREEKTTHLHFYFHDIVAGKNATAIRIAGP--PDSSLTNFGNTMMIDDPLTEGPELTSKL  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            IGRAQG+Y  +  +   L +V +  FTEGEY GSS+ I G +      RE  +V G+G F
Sbjct  97   IGRAQGMYAMAAQNDFLLLMVLNYAFTEGEYNGSSISILGRNHVLDDMREMPIVGGSGAF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            +   G+ +  T  MDI    A ++ D+ V HY
Sbjct  157  KLAHGYALAHTIHMDIE--AATVEYDVYVTHY  186



>ref|XP_008245704.1| PREDICTED: dirigent protein 23 [Prunus mume]
Length=192

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 83/145 (57%), Gaps = 0/145 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG+  SA+ VA     + S   FG +   DDP+TE PDP SK +GRAQG
Sbjct  48   TNLQFYFHDTVSGKTPSAVRVAQATDTEKSPTLFGALLMADDPLTETPDPNSKLVGRAQG  107

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            LY +S     GL +  +  FT+G Y GSS+ I G +      RE  VV+GTG FR  +G+
Sbjct  108  LYGSSCQQELGLIMAMNFGFTDGMYNGSSISILGKNSAMNPVREMPVVAGTGVFRLGRGY  167

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
             I  T ++D     AI+  ++TV H
Sbjct  168  AIAKTHWIDFTTGDAIVGYNVTVIH  192



>ref|XP_002276722.1| PREDICTED: dirigent protein 23-like [Vitis vinifera]
Length=184

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 81/146 (55%), Gaps = 0/146 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD LSG+  +A+ VA       S   FG +   DDP+TEGPD  SK +GRAQG
Sbjct  39   TNLQFYFHDTLSGKTPTAVRVAQASQTDKSPTLFGALLMADDPLTEGPDLSSKLVGRAQG  98

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            LY ++  +G GL +  S  F +G Y GSS+ + G +      RE  VV GTG FR  +GF
Sbjct  99   LYGSASQEGFGLIMALSYGFCDGIYNGSSISVLGLNQALNPVRELPVVGGTGVFRMARGF  158

Query  297  GIMTTEFMDIPNLKAILKLDITVRHY  220
                T + D     AI+  ++TV HY
Sbjct  159  AEARTHWFDPATGDAIVAYNVTVFHY  184



>ref|XP_006366619.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=190

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + TK  FY HD +SG+N SAI++A  +    S   FG++  +DDP+T GP+P S  +G
Sbjct  39   KQKVTKFHFYFHDIVSGKNPSAITIAQSNMTTKSPTFFGSVAMIDDPLTVGPEPNSTIVG  98

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFR  313
            RAQG+Y ++  +   L + ++++FT G+Y GS+L + G + +FN + RE  +V G+G FR
Sbjct  99   RAQGIYGSADQNEAALLMTYNIVFTTGKYNGSTLSVLGRNPVFN-QYREMPIVGGSGVFR  157

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              +G     T + ++ +  A+++ ++ V HY
Sbjct  158  LAQGIATAKTYWFNLTSGDAVVEYNVMVLHY  188



>ref|XP_010549445.1| PREDICTED: dirigent protein 21-like [Tarenaya hassleriana]
Length=184

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 0/147 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            R T L FY HD +SGE T+A+ VA   G  +S   FG +   D+P+TEGP   SK +GRA
Sbjct  38   RLTHLHFYFHDTVSGEKTTAVRVAEAAGTNSSATLFGMVVIADNPLTEGPTMGSKMLGRA  97

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y ++ ++  GL + F+++FTE ++ GS++ + G +      RE  +V GTG FRF K
Sbjct  98   QGMYASADMNDFGLLMAFNLVFTEEKFNGSTVSLFGRNPILSAVREMPIVGGTGVFRFAK  157

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRH  223
            G+    T   D  +  A+++ ++ V H
Sbjct  158  GYAQAKTYTFDRVSGNAVVEYNVYVWH  184



>ref|XP_004151934.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
sativus]
Length=229

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L+ YV D+ +G N + I VAG  G   +  QFGTI   D+P+T GPD  S+ +G
Sbjct  27   KSKHTNLILYVQDFANGPNPTFIPVAGVAGKPWNFTQFGTIFVTDNPITAGPDRNSRALG  86

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y+ +  DG+ L    +VI T    +GSS+EIQG        RE  VVSGTG FRF
Sbjct  87   RAQGMYVVAAADGRNL----AVILTLALAEGSSIEIQGTSRQFEGVRELGVVSGTGKFRF  142

Query  309  VKGFGIMTTEFMDIPN  262
            V+GF +      DI N
Sbjct  143  VRGFAVGKNVVTDIAN  158



>ref|XP_010058355.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW90334.1| hypothetical protein EUGRSUZ_A02478 [Eucalyptus grandis]
Length=190

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 87/150 (58%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG   +A+ VA      +S   FG +  VDDP+TEGP+  SKE+G
Sbjct  41   KEKLSHLHFYFHDIVSGSKPTAVRVAEAKMTNSSTTGFGAVVMVDDPLTEGPEMSSKEVG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y  +  +  GL +V + +F+EG+Y GS+L + G +      RE  +V G+G FRF
Sbjct  101  RAQGIYALASQNDVGLLMVQNYVFSEGKYNGSTLSVLGRNAVFSGVREMPIVGGSGLFRF  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T   D+    A ++ ++ V HY
Sbjct  161  ARGYVRAKTHTFDLKTGDACVEYNVYVFHY  190



>ref|XP_007145709.1| hypothetical protein PHAVU_007G261700g [Phaseolus vulgaris]
 gb|ESW17703.1| hypothetical protein PHAVU_007G261700g [Phaseolus vulgaris]
Length=183

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + + L F++HD ++G N +A+ VA     + S   FG +  +DDP+TE PD  S  +GRA
Sbjct  38   KLSHLHFFLHDVVAGTNQTAVRVAAAPATEKSPTMFGAVVMMDDPLTELPDAASAVVGRA  97

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y ++     G  +  + +FTEG+Y GSSL + G +      RE  VV G+G FRF +
Sbjct  98   QGIYASASTSELGFLMAMNFVFTEGKYNGSSLAVLGRNTVQSAVREMPVVGGSGLFRFAR  157

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T +  +  L+A+++ ++ V HY
Sbjct  158  GYATAKTHYFGL--LEAVVEYNVYVFHY  183



>ref|XP_004158576.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
sativus]
Length=229

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 4/136 (3%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L+ YV D+ +G N + I VAG  G   +  QFGTI   D+P+T GPD  S+ +G
Sbjct  27   KSKHTNLILYVQDFANGPNPTFIPVAGVAGKPWNFTQFGTIFVTDNPITAGPDRNSRALG  86

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y+ +  DG+ L    +VI T    +GSS+EIQG        RE  VVSGTG FRF
Sbjct  87   RAQGMYVVAAADGRNL----AVILTLALAEGSSIEIQGTSRQFEGVRELGVVSGTGKFRF  142

Query  309  VKGFGIMTTEFMDIPN  262
            V+GF +      DI N
Sbjct  143  VRGFAVGKNVVTDIAN  158



>ref|XP_006829349.1| hypothetical protein AMTR_s01152p00009680 [Amborella trichopoda]
 gb|ERM96765.1| hypothetical protein AMTR_s01152p00009680 [Amborella trichopoda]
Length=155

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 84/150 (56%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K   T L FY HD +SG   +AI VA  D    S   FG +  +DDP+TEGP+  SK IG
Sbjct  6    KEHVTHLHFYFHDIVSGPKPTAIEVARADSTNKSATGFGAVVMIDDPLTEGPEVTSKPIG  65

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  + +F EG+Y+GS+L I G +       E ++V G+G FR 
Sbjct  66   RAQGIYASAAQEEVGLLMTLNYVFVEGKYEGSTLSILGRNAVFSGVTEMAIVGGSGTFRL  125

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              G+ +  T  +D+     +++  + V HY
Sbjct  126  AHGYALAKTHTLDLKTGDVVVEYTVLVLHY  155



>ref|XP_009346640.1| PREDICTED: dirigent protein 23-like [Pyrus x bretschneideri]
Length=193

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 84/145 (58%), Gaps = 1/145 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG+N SA+ +A       S+  FG +  VDDP+TE PDP SK +GRAQG
Sbjct  50   TNLHFYFHDTVSGKNPSAVRIAQATDTNKSLTLFGALLMVDDPLTETPDPNSKLVGRAQG  109

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y +S     GL +     F +G Y GSS+ I G +      RE  VV+GTG FRF +G+
Sbjct  110  MYGSSGQQEFGLTMAMCFAFCDGIYDGSSISIFGKNPALNLVREMPVVAGTGVFRFARGY  169

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
             I  T + +I    AI++  +TV H
Sbjct  170  AIARTHWFNIMG-DAIVEYHVTVIH  193



>ref|XP_010690412.1| PREDICTED: dirigent protein 23-like [Beta vulgaris subsp. vulgaris]
Length=216

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 91/155 (59%), Gaps = 2/155 (1%)
 Frame = -1

Query  678  NRHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKT--SVLQFGTITAVDDPVTEGPDPK  505
            +R + R+T +  Y HD +SGE+ +A+ +A  +G  +  + L FG +   DDP+T GP+P 
Sbjct  49   SRGERRKTTIECYYHDTISGESPTAVLIAQANGTSSDSAPLAFGKLFMFDDPLTIGPEPT  108

Query  504  SKEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGT  325
            SK +GR+QG+Y +      GL +     F+EG YKGSS+ I   +   +K RE  +V GT
Sbjct  109  SKLVGRSQGMYGSDSQGEVGLIMAMGFAFSEGIYKGSSISIMVHNPITVKPRELPIVGGT  168

Query  324  GFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G FR  +G+ +  T  +D+    AI+  +IT+ HY
Sbjct  169  GLFRLAQGYAVPNTYMLDLSTGDAIVGYNITIFHY  203



>ref|XP_010041372.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW44401.1| hypothetical protein EUGRSUZ_L02112 [Eucalyptus grandis]
Length=195

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 83/148 (56%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T L FY HD LSG+N +A+ +A     + S   FG +  +DDP+TEGP+P+S  IGRA
Sbjct  48   KTTHLHFYFHDTLSGKNPTAVRIAEATMTEKSPTLFGVVNMIDDPLTEGPEPESPLIGRA  107

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG Y +  L+   LH+  +++FT  EY GS+L I G +      RE  +V GTG FR   
Sbjct  108  QGFYGSVGLESLALHMNVNLVFTTPEYNGSTLSILGRNPALETYREMPIVGGTGVFRLAS  167

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G     T F ++    A+++  +   HY
Sbjct  168  GVATAKTYFFNLTTGDAVVEYKVIAMHY  195



>ref|XP_003605959.1| Disease resistance response protein [Medicago truncatula]
Length=234

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 82/140 (59%), Gaps = 0/140 (0%)
 Frame = -1

Query  660  QTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQ  481
            Q+ LVF++ D   G   +   V G +G   S   FGTI  VDDP+   P+P S +IGRAQ
Sbjct  32   QSTLVFFLQDVGKGVGATVQPVIGINGKVWSYNSFGTIFVVDDPIMLNPNPGSTQIGRAQ  91

Query  480  GLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKG  301
            G+   + LDG  + +V S++F  G+Y GS+LEIQGA       RE SVVSGTG FR+ +G
Sbjct  92   GMITVTSLDGSNVSIVLSLVFNNGQYSGSTLEIQGASRQRENSRELSVVSGTGRFRYARG  151

Query  300  FGIMTTEFMDIPNLKAILKL  241
            F +  T   D     ++L+L
Sbjct  152  FVVFETVSYDDSTNHSVLRL  171



>ref|XP_010038598.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
Length=151

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = -1

Query  633  DYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQLD  454
            ++ +G N + + VAG  G +  +L FGT+  ++D  T+  +  S E+GRA+G Y+N  +D
Sbjct  3    NWETGLNITTVPVAGVLGNQRWILGFGTVFVINDKHTKLYEYNSTEVGRARGAYVNLAVD  62

Query  453  GKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTEFM  274
            G  LHL+ S++FT  E+ GS+LEIQG+D F  K RE SVVSGTG FR  +G+  + T F+
Sbjct  63   GSDLHLLMSLVFTNQEFSGSTLEIQGSDWFYNKRREVSVVSGTGKFRLARGYAFLETLFL  122

Query  273  D  271
            D
Sbjct  123  D  123



>ref|XP_010472088.1| PREDICTED: dirigent protein 23-like [Camelina sativa]
Length=187

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (58%), Gaps = 2/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
             K + T L FY HD LSG+N +A+ VA G D  K+  L FG +  VDD +TE  DPKSK 
Sbjct  38   EKEKVTNLQFYFHDTLSGKNPTAVKVAQGTDTEKSPTL-FGAVFMVDDALTETADPKSKL  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG F
Sbjct  97   VGRAQGLYGSSCKEEVGLIMAMSFCFEDGPYKDSTISMTGKNSAMNPIREMPIVGGTGMF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            R  +G+ I  T + D     AI+  ++TV H
Sbjct  157  RMARGYAIAQTNWFDPKTGDAIVGYNVTVVH  187



>ref|XP_006851934.1| hypothetical protein AMTR_s00041p00176950 [Amborella trichopoda]
 gb|ERN13401.1| hypothetical protein AMTR_s00041p00176950 [Amborella trichopoda]
Length=196

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P+ +++  Y+HD L  E  +A+ VA  +  K+S   FG +  VDDP+TEGP+  SK IG
Sbjct  47   EPKVSQIEIYMHDLLVAEKPTAVIVAEANTTKSSPTLFGQVVVVDDPMTEGPELTSKLIG  106

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            +AQGLY  S      L      +FT  ++ GS+L + G +    KERE S++ G+G FR 
Sbjct  107  KAQGLYAPSSQSEISLFEAVDFVFTYDKFNGSTLSVMGRNPILQKERELSIIGGSGAFRL  166

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T   D   L A++  ++TV HY
Sbjct  167  ARGYALKQTYSFDTATLNAVVHYNVTVIHY  196



>gb|EMS46182.1| hypothetical protein TRIUR3_05228 [Triticum urartu]
Length=176

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 1/148 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSG-ENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T+L  Y HD +SG  N   + VA      TS   FGT+  +DDP+TEGP+  S+ +GR
Sbjct  28   KETRLRVYWHDVVSGGPNARVVQVAQAPSSNTSATGFGTVLVIDDPLTEGPNLTSRLLGR  87

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+YI++  D   L +  + +F +G Y GSS+ I G +  +   RE  VV GTG FRF 
Sbjct  88   AQGMYISAGKDSLSLLMAMNFVFVDGAYNGSSIAIIGPNQADRAVREMPVVGGTGVFRFA  147

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRH  223
            +G+  + T + D     A ++  I +RH
Sbjct  148  RGYCQLRTHWFDAKTGDATVEYKIHLRH  175



>ref|XP_010429003.1| PREDICTED: dirigent protein 23 [Camelina sativa]
Length=187

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (58%), Gaps = 2/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
             K + T L FY HD LSG+N +A+ VA G D  K+  L FG +  VDD +TE  DPKSK 
Sbjct  38   EKEKVTNLQFYFHDTLSGKNPTAVKVAQGTDTEKSPTL-FGAVFMVDDALTETADPKSKL  96

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG F
Sbjct  97   VGRAQGLYGSSCKEEVGLIMAMSFCFEDGPYKDSTISMIGKNSVMNPIREMPIVGGTGMF  156

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            R  +G+ I  T + D     AI+  ++TV H
Sbjct  157  RMARGYAIAKTNWFDPKTGDAIVGYNVTVVH  187



>ref|XP_004978852.1| PREDICTED: disease resistance response protein 206-like [Setaria 
italica]
Length=178

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 90/150 (60%), Gaps = 4/150 (3%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSG-ENTSAISVAGRDGPKT--SVLQFGTITAVDDPVTEGPDPKSKEI  493
            ++T+L  + HD  SG  N S + +  + GP +  S  +FG +T +DDP+TEGP+  S+ +
Sbjct  29   KETRLRVFWHDVGSGGPNVSTVVLVAK-GPNSDASATRFGYVTVIDDPLTEGPNLTSRLL  87

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQG+Y+++  D   L +  + +F +G Y GSSL I G +    K RE +VV GTG FR
Sbjct  88   GRAQGMYVSAGKDSMSLLMAMNFVFVDGAYNGSSLAILGPNAVERKVREMAVVGGTGVFR  147

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            F  G+    T+++D     A ++ +I VRH
Sbjct  148  FANGYCEARTQWIDTRTSDATVEYNIHVRH  177



>ref|XP_003625315.1| Disease resistance response protein [Medicago truncatula]
 gb|AES81533.1| disease resistance response protein [Medicago truncatula]
 gb|AFK36157.1| unknown [Medicago truncatula]
Length=194

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 90/147 (61%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG   S + VA  +G   + L FGT+ A+DDP+T GP+  SK +G+AQG
Sbjct  48   THLHFYFHDIVSGPKPSMVFVAEPNGKVKNALPFGTVVAMDDPLTAGPERDSKLVGKAQG  107

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +   +  GL +V ++ FT+G++ GS+L I G + I +   RE ++V GTG FRFV+G
Sbjct  108  IYTSISQEEMGLMMVMTMAFTDGDFNGSTLSILGRNMIMSEPVREMAIVGGTGAFRFVRG  167

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     AI++ D+ V HY
Sbjct  168  YAQAKFYSVDYTKGDAIVEYDVFVFHY  194



>ref|XP_004142155.1| PREDICTED: uncharacterized protein LOC101214318 [Cucumis sativus]
 ref|XP_004162010.1| PREDICTED: uncharacterized LOC101214318 [Cucumis sativus]
 gb|KGN54088.1| hypothetical protein Csa_4G280650 [Cucumis sativus]
Length=187

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 3/146 (2%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T+   Y HD + G N +++ V  R     +V  FG I   D+P+T GPDPKS+ +GR+QG
Sbjct  44   TRFHLYWHDVVGGSNPTSVPVLPR---LNNVTLFGLINMFDNPLTVGPDPKSRLVGRSQG  100

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            LY ++     GL +  +  FT G+YKGSS+ I G +    + RE  VV GTG FRF KG 
Sbjct  101  LYASTAQHEIGLLMAMNFAFTYGKYKGSSITILGRNPILNQVREMPVVGGTGRFRFAKGH  160

Query  297  GIMTTEFMDIPNLKAILKLDITVRHY  220
             +  T++ +   L A+++ DI V HY
Sbjct  161  ALAKTQYFNATTLDAVVEYDIYVLHY  186



>ref|XP_006851948.1| hypothetical protein AMTR_s00041p00182920 [Amborella trichopoda]
 gb|ERN13415.1| hypothetical protein AMTR_s00041p00182920 [Amborella trichopoda]
Length=185

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD ++G+N ++I+VAG +   TS   FG +  VD+ +T+GP P SK IG
Sbjct  36   KEKVSHLHFYFHDVITGKNPTSIAVAGANTTLTSPTFFGLVNVVDNTLTKGPKPTSKLIG  95

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            R QG + +S        +  + +F EG++ GS+L + G +    KERE +VV G+G FR 
Sbjct  96   RGQGFFASSSQSEISFFMAINFVFMEGKFNGSTLTMVGRNPIMHKEREMTVVGGSGAFRL  155

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ I  T   D+    AI++  ITV H+
Sbjct  156  ARGYAIAKTFVSDLRTKNAIVEYHITVIHF  185



>gb|ACN40946.1| unknown [Picea sitchensis]
Length=184

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD L G+N +A+ VA      +   QFG +  +DD +TEGP+  SK +G
Sbjct  35   REKTSHLHFYFHDLLEGKNVTAVQVASAPTTDSYFTQFGMVRVMDDWLTEGPEATSKMVG  94

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR 
Sbjct  95   RAQGIYVSSSQEKFHLLMASTFVFESGKYNGSTLAMVGKNAVLEQVREMPIVGGSGLFRL  154

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T  +D+    A+++ ++TV HY
Sbjct  155  ARGYALAHTHSIDLKTGNAVVEYNVTVLHY  184



>ref|XP_011039496.1| PREDICTED: dirigent protein 22-like [Populus euphratica]
Length=194

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 87/150 (58%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG+N +A+ +A  D   TS   FG +  +DDP+T  P+  SK +G
Sbjct  45   KEKLSHLHFYFHDIVSGKNPTAVRIARADMTNTSSTGFGMVAMIDDPLTMTPELSSKLVG  104

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  + +F EG+Y GS+L + G +      RE  +V G+G FRF
Sbjct  105  RAQGIYASASQNDIGLLMTMNFVFMEGKYNGSTLSVLGRNSVLSTVREMPIVGGSGLFRF  164

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+   +T   D     A+++ ++ V HY
Sbjct  165  ARGYAQASTHMFDSTTGDAVVEYNVYVFHY  194



>ref|XP_009339555.1| PREDICTED: dirigent protein 23-like [Pyrus x bretschneideri]
Length=180

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 7/151 (5%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGR----DGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            TK+ FY+HD + G N +A+ VAGR     G       FG++  +D+P+T  PDPKS  +G
Sbjct  32   TKMQFYMHDVVGGPNPTAVRVAGRLSNYTGTDPIAALFGSVYMMDNPLTATPDPKSALMG  91

Query  489  RAQGLY-INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            RAQG+Y + SQ D   L +  +  FT G Y GS+  + G +    +ERE  V+ GTG FR
Sbjct  92   RAQGIYSMASQRDEFSLLMTLTYGFTSGAYNGSTFSVVGRNPVMSEEREMPVLGGTGMFR  151

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              +GF I  T   D   + AI++ ++T+ HY
Sbjct  152  LARGFCIARTHSAD--QMDAIIRYNVTLIHY  180



>emb|CDY21398.1| BnaA09g30290D [Brassica napus]
Length=186

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = -1

Query  675  RHKPRQ-TKLVFYVHDYLSGENTSAISVAGRD-GPKTSVLQFGTITAVDDPVTEGPDPKS  502
             +KP + T L FY HD  SG+  +AI V        T+V  FG +   D+ +TEGPDP S
Sbjct  36   EYKPEKLTHLHFYFHDVTSGDKPTAIRVTNPPVSNTTAVSTFGVVVIADNLLTEGPDPSS  95

Query  501  KEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTG  322
            KEIGRAQGLY ++ ++   L +VF+++FTEGE+ GS++ + G +    K REF ++ GTG
Sbjct  96   KEIGRAQGLYASTDMNTVSLTMVFNLVFTEGEFNGSTVSMYGRNPIFSKLREFPIIGGTG  155

Query  321  FFRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             FR  +G+    T    +    A+++ ++ + H
Sbjct  156  EFRLARGYAQAQT--YSLSGFDAVVEYNVFISH  186



>gb|ACU24649.1| unknown [Glycine max]
Length=186

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 88/147 (60%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L F+ HD ++G   S + VA  DG     L FGT+ A+DDP+T GPD  SK +G+AQG
Sbjct  40   THLHFFFHDVVTGPKPSMVFVAEPDGKAKDALPFGTVVAMDDPLTVGPDHDSKLVGKAQG  99

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +   +  GL +V ++ FT+GE+ GS++ + G + I +   RE ++V GTG FRF +G
Sbjct  100  IYTSISQEEMGLMMVMTMAFTDGEFNGSTISVLGRNMIMSEPVREMAIVGGTGAFRFARG  159

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     AI++ D+ V HY
Sbjct  160  YAQAKFYSVDFTKGDAIVEYDVFVNHY  186



>ref|XP_002988690.1| hypothetical protein SELMODRAFT_184063 [Selaginella moellendorffii]
 gb|EFJ10201.1| hypothetical protein SELMODRAFT_184063 [Selaginella moellendorffii]
Length=164

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T L FY+HD ++  N S + VAG   P T+   FGT++ +DDP+T+G D  S  IGR 
Sbjct  25   KDTSLRFYMHDNMTPPNQSVVMVAG---PGTA--GFGTVSVIDDPLTQGADASSPAIGRG  79

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG +I + +DG+ L L FS +F  G++KGS+L   G+D  +   RE +V+ GTG FR  +
Sbjct  80   QGTWIVASMDGRSLLLTFSAVFQTGDFKGSTLSFHGSDDTSEAVREIAVIGGTGQFRNAR  139

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRH  223
            G+  + T          IL++D+ V H
Sbjct  140  GYATIKTA--SASGGSVILEIDVKVSH  164



>gb|ABD52128.1| dirigent-like protein pDIR17 [Picea sitchensis]
Length=178

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 2/150 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD L+G N +A++VA  +   TS   FG +  +DDP+TEGP+  SK +G
Sbjct  31   KEKTTHLHFYFHDRLAGINATAVAVASAN--VTSATGFGGVVVLDDPLTEGPNVTSKLLG  88

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY     +   L +V + +F  GEY GS+L + G D+   K RE  +V G+G FR 
Sbjct  89   RAQGLYAGVGQEQHVLLMVLTFVFQTGEYNGSTLTMVGNDVIFNKVRELPIVGGSGVFRL  148

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ ++ T         A ++ ++TV HY
Sbjct  149  ARGYALLQTITAASSPGNATVEHNVTVYHY  178



>ref|XP_008457663.1| PREDICTED: dirigent protein 23-like [Cucumis melo]
 gb|ADN34005.1| disease resistance response protein [Cucumis melo subsp. melo]
Length=184

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 87/155 (56%), Gaps = 4/155 (3%)
 Frame = -1

Query  678  NRH---KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDP  508
            +RH   K   T + FY HD +SG+  SAI VA       S   FG +   DDP+TE PDP
Sbjct  31   SRHLSQKQTVTNIQFYFHDTVSGKTPSAIKVAEAPTSSKSPTLFGALFIADDPLTESPDP  90

Query  507  KSKEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSG  328
            KSKE+GRAQGLY ++     GL +  +  FT GE+KGSS+ + G +      RE  VV G
Sbjct  91   KSKEVGRAQGLYGSAAQQEIGLMMALTYEFTAGEFKGSSIVVLGKNSVMHTVRELPVVGG  150

Query  327  TGFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            TG FRF +G+    T + +     AI+  ++TV H
Sbjct  151  TGVFRFARGYAEARTYWFNTLG-DAIVGYNVTVIH  184



>ref|XP_009404870.1| PREDICTED: dirigent protein 22-like [Musa acuminata subsp. malaccensis]
Length=178

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDG--PKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            K + + L FY HD +SG N +A++VA      P TS   FG +  +DD +TEGP+P S+ 
Sbjct  30   KEKVSHLHFYFHDVVSGSNVTAVAVARPPNAQPPTS---FGLVMVMDDLLTEGPEPTSRP  86

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQGLY  + L   G     +++F  G+Y GS L + G +      RE  VV G+G F
Sbjct  87   VGRAQGLYAAAGLQEMGFLQAMNLVFVGGKYDGSVLTVLGRNAPLHAVREMPVVGGSGLF  146

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RF +G+ +  T  +D+    AI++ D+ V HY
Sbjct  147  RFARGYAVARTHRLDMSTGNAIVEYDVYVMHY  178



>ref|XP_006485705.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
Length=175

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 89/154 (58%), Gaps = 6/154 (4%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDG---PKTSVLQFGTITAVDDPVTEGPDPKSK  499
            K + T++ FY+HD +SG N +A+ VAGR     P      FG++  +D+P+T  PDP S 
Sbjct  24   KSKVTRMQFYMHDIVSGPNATAVPVAGRSNFTSPDPIKAVFGSVFVMDNPLTMTPDPNST  83

Query  498  EIGRAQGLY-INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTG  322
             IGRAQG+Y ++SQ D   L +  +  FT G Y GSS  + G +    + RE  +V GTG
Sbjct  84   VIGRAQGIYAMSSQQDEFSLLMTLTYGFTSGPYNGSSFSVLGRNPVMSEVREMPIVGGTG  143

Query  321  FFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             FR  +G+ +  T  MD   + A++  ++T+ HY
Sbjct  144  IFRLARGYCLAKTSSMD--QMDAVIGYNVTLLHY  175



>ref|XP_007204144.1| hypothetical protein PRUPE_ppa021998mg [Prunus persica]
 gb|EMJ05343.1| hypothetical protein PRUPE_ppa021998mg [Prunus persica]
Length=198

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD LSG N +A+ VA      TS   FG +  +DDP+T GP+  SK +G
Sbjct  49   REKLSHLHFYFHDILSGRNPTAVRVAEAPTTNTSSTVFGAVVVMDDPLTVGPELGSKLVG  108

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            +AQG+Y ++     GL + F+ +F EG+Y GS+L + G +    + RE  +V G+G FRF
Sbjct  109  KAQGIYASASQSELGLLMAFNFVFEEGKYNGSTLSVLGRNSVLSEVREMPIVGGSGLFRF  168

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+   +T  +D     A+++ ++ V HY
Sbjct  169  ARGYAHASTHQVDFETGDAVVEYNVYVFHY  198



>ref|XP_006851938.1| hypothetical protein AMTR_s00041p00178600 [Amborella trichopoda]
 gb|ERN13405.1| hypothetical protein AMTR_s00041p00178600 [Amborella trichopoda]
Length=181

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 87/149 (58%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            +P+ +++ FY+HD L  E  +A+ VA  +  K+S   FG +  VDDP+TEGP+  SK IG
Sbjct  32   EPKVSQIEFYMHDLLVTEKPTAVIVAEANTTKSSPTLFGQVVVVDDPMTEGPELTSKLIG  91

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            +AQGLY  S      L    + +F +G++ GS+L + G +    KERE  ++ G+G FR 
Sbjct  92   KAQGLYAPSSQSEISLSEAVNFVFIDGKFNGSTLSVMGRNPILYKERELWIIGGSGAFRL  151

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ +  T   D   L A++  ++TV H
Sbjct  152  ARGYALKQTYSFDTTTLNAVVHYNVTVIH  180



>ref|XP_003625316.1| Disease resistance response protein [Medicago truncatula]
 gb|AES81534.1| disease resistance response protein [Medicago truncatula]
Length=193

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 90/147 (61%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG   S + VA  +G   + L FGT+ A+DDP+T GP+ +SK +G+AQG
Sbjct  47   THLHFYFHDIVSGPKPSMVFVAEPNGKVKNALPFGTVVAMDDPLTAGPERESKLVGKAQG  106

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +   +  GL +V ++ FT+G + GS+L I G + I +   RE ++V GTG FRFV+G
Sbjct  107  IYTSISQEEMGLMMVMTMTFTDGHFNGSTLSILGRNMIMSEPVREMAIVGGTGAFRFVRG  166

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     AI++ DI + HY
Sbjct  167  YAQAKFYSVDYTKGDAIVEYDIFMFHY  193



>ref|XP_002960306.1| hypothetical protein SELMODRAFT_139600 [Selaginella moellendorffii]
 gb|EFJ37845.1| hypothetical protein SELMODRAFT_139600 [Selaginella moellendorffii]
Length=164

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 83/144 (58%), Gaps = 5/144 (3%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            +++ FY+HD  +    + + VAG      S   FG +  +DD +TEGP P S+ +GRAQG
Sbjct  25   SRMQFYMHDNFNLSPRTVLRVAG---SANSTAAFGAVMVIDDLLTEGPSPASQPVGRAQG  81

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
             Y+ S LDG  L L F+ +F+ G   GS++   GAD F + ERE +V+ GTG FR  +GF
Sbjct  82   TYMISALDGSSLLLTFTAVFSRGSENGSTISFHGADRFLLAEREIAVIGGTGKFRMARGF  141

Query  297  GIMTTEFMDIPNLKAILKLDITVR  226
             ++ T      N   I+  D+T++
Sbjct  142  AVLNTT--SNTNRATIVGFDVTLQ  163



>ref|XP_002276741.3| PREDICTED: dirigent protein 23-like [Vitis vinifera]
Length=185

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 77/133 (58%), Gaps = 0/133 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K R T+L FY HD  SG+N SA  VA       S   FG I  +DDP+TEGP+  SK +G
Sbjct  36   KERTTRLHFYFHDTTSGKNPSARRVAQAPSTNKSPTFFGLINMMDDPLTEGPEATSKLVG  95

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            R QGLY +S LD   L + ++VIF  G+Y GSSL I G +      RE S+V GTG FR 
Sbjct  96   RGQGLYASSGLDELSLLMAWNVIFKSGDYNGSSLTILGRNPTTHPLREMSIVGGTGVFRM  155

Query  309  VKGFGIMTTEFMD  271
             +G   + T F +
Sbjct  156  ARGVVTLKTYFFN  168



>ref|XP_010693846.1| PREDICTED: dirigent protein 22-like [Beta vulgaris subsp. vulgaris]
Length=189

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 84/145 (58%), Gaps = 0/145 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HDY++G + +AI +A      TS   FG +  +DDP+TEGPD  S+ IG AQG
Sbjct  45   THLQFYFHDYVTGPSATAIRIAQAKTTDTSPSTFGALVMIDDPLTEGPDNSSRVIGHAQG  104

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y  +      L +  +++F+EG+Y GS+L + G +    + RE +V+ G+G FRF  G+
Sbjct  105  MYGFADQQEYALLMTMNLVFSEGQYNGSTLSVMGRNPVMEQVRELAVIGGSGVFRFASGY  164

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
                T  M  PN   I++ ++ V H
Sbjct  165  AQAKTITMMDPNGATIVEYNVYVSH  189



>emb|CDP10782.1| unnamed protein product [Coffea canephora]
Length=176

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 86/150 (57%), Gaps = 3/150 (2%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISV--AGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            ++T +  Y  D   G N +   +     DG   S  +FG I   DD VTEG D  S ++ 
Sbjct  28   KETSMTIYFQDQYGGPNATVAQILPENPDG-HLSFKKFGAIFCTDDLVTEGFDVSSTQVA  86

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+YI S LDG   H++ S++F  GE+KGS+LE+QGA     + RE +VV GTG FRF
Sbjct  87   RAQGVYITSALDGSNTHVLVSIVFNNGEFKGSTLEVQGASAQFERVREVAVVGGTGKFRF  146

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T  ++     A+++ +ITV HY
Sbjct  147  ARGYVTFETIHINSAANLAVIQCNITVLHY  176



>gb|ACN40835.1| unknown [Picea sitchensis]
Length=192

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 0/146 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            + L FY HD L G N +A+ VA      +S+ QFG +  +DD +TEGP+  SK +GRAQG
Sbjct  41   SHLHFYFHDLLEGTNVTAVDVASAPATDSSLTQFGMVRVMDDWLTEGPEATSKMVGRAQG  100

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR  +G+
Sbjct  101  IYVSSSQEKLHLLMATTFVFESGKYNGSTLSMVGKNAVFDEVREMPIVGGSGLFRLGRGY  160

Query  297  GIMTTEFMDIPNLKAILKLDITVRHY  220
             +  T   D+ +  A+++ ++TV HY
Sbjct  161  ALARTHSFDLKSGNAVVEYNVTVLHY  186



>ref|NP_850009.1| dirigent protein 23 [Arabidopsis thaliana]
 sp|Q84TH6.1|DIR23_ARATH RecName: Full=Dirigent protein 23; Short=AtDIR23; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO64191.1| putative disease resistance response protein/dirigent protein 
[Arabidopsis thaliana]
 gb|AAT71988.1| At2g21100 [Arabidopsis thaliana]
 dbj|BAF00324.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AEC07123.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=187

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 2/150 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            K + T L FY HD LSG+N +A+ VA G D  K+  L FG +  VDD +TE  DPKSK +
Sbjct  39   KDKVTNLQFYFHDTLSGKNPTAVKVAQGTDTEKSPTL-FGAVFMVDDALTETADPKSKLV  97

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG FR
Sbjct  98   GRAQGLYGSSCKEEVGLIMAMSFCFEDGPYKDSTISMIGKNSAMNPIREMPIVGGTGMFR  157

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
              +G+ I  T + D     AI+  ++T+ H
Sbjct  158  MARGYAIARTNWFDPKTGDAIVGYNVTIMH  187



>ref|XP_002880356.1| hypothetical protein ARALYDRAFT_480959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56615.1| hypothetical protein ARALYDRAFT_480959 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 2/150 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            K + T L FY HD LSG+N +A+ VA G D  K+  L FG +  VDD +TE  DPKSK +
Sbjct  39   KEKVTNLQFYFHDTLSGKNPTAVKVAQGTDTDKSPTL-FGAVFMVDDALTETADPKSKLV  97

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG FR
Sbjct  98   GRAQGLYGSSCKEEVGLIMAMSFCFEDGPYKDSTISMIGKNSAMNPIREMPIVGGTGMFR  157

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
              +G+ I  T + D     AI+  ++TV H
Sbjct  158  MARGYAIAKTNWFDPKTGDAIVGYNVTVVH  187



>ref|XP_010472250.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 4-like [Camelina 
sativa]
Length=187

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 9/157 (6%)
 Frame = -1

Query  666  PRQ---TKLVFYVHDYLSGENTSAISVA-----GRDGPKTSVLQFGTITAVDDPVTEGPD  511
            P+Q   T L F+ HD L+  N SA+ +A     GRD   +S   FG++ AVDDP+T GPD
Sbjct  32   PKQEVVTNLHFFFHDTLTAPNPSAVLIAKATLTGRDN-SSSPSPFGSLFAVDDPLTVGPD  90

Query  510  PKSKEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVS  331
            PKSK+IG A+G+Y++S  D   L +     FT G++ GSS  +   +    KERE +VV 
Sbjct  91   PKSKKIGNARGMYVSSGKDVPTLTMYVDFGFTSGKFNGSSFAVFSRNTIMEKEREVAVVG  150

Query  330  GTGFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G G FR  +G  ++ T  +++ N  AI++  +T+ HY
Sbjct  151  GRGRFRMARGVALLNTYSVNLTNGDAIVEYHVTLYHY  187



>ref|XP_006404548.1| hypothetical protein EUTSA_v10000677mg [Eutrema salsugineum]
 gb|ESQ46001.1| hypothetical protein EUTSA_v10000677mg [Eutrema salsugineum]
Length=185

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 83/149 (56%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD LSG+N +A+ VA       S   FG    VDD +TE  DPKSK +G
Sbjct  37   KEKVTNLQFYFHDTLSGKNPTAVKVAQAADTDKSPTLFGATFMVDDALTETADPKSKLVG  96

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG FR 
Sbjct  97   RAQGLYGSSCKEEVGLIMAMSFCFEDGPYKDSTISMIGKNSAMNPIREMPIVGGTGLFRM  156

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ I  T + D+    AI+  ++TV H
Sbjct  157  ARGYAIAQTNWFDLKTGDAIVAYNVTVVH  185



>ref|XP_004243690.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=187

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG+N +A+ +A       S   FG    +DDP+T GP+  SK +G
Sbjct  38   REKLSHLHFYFHDIVSGKNPTAVRIAEAAVTNRSATGFGLTAMIDDPLTVGPESNSKIVG  97

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y  + ++  GL +V + +F EG+Y GSSL I G +      RE  +V G+G FRF
Sbjct  98   RAQGIYAQASINDVGLLMVLNFVFIEGKYNGSSLSILGRNSVASIVREMPIVGGSGLFRF  157

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T   D+    A+++ ++ V HY
Sbjct  158  ARGYVQAKTHNFDLKTGDAVVEYNVYVFHY  187



>ref|XP_010531503.1| PREDICTED: dirigent protein 23 [Tarenaya hassleriana]
Length=180

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 82/147 (56%), Gaps = 0/147 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD LSG+N +A+ VA       S   FG    VDDP+TE PDP S+ +G
Sbjct  32   KEKVTNLQFYFHDTLSGKNPTAVRVAQAPDSDKSPTLFGATFMVDDPLTETPDPNSRLLG  91

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY +S     GL +  S  F +G YK S++ + G +      RE  +V GTG FR 
Sbjct  92   RAQGLYGSSGKQEIGLIMAMSFCFVDGPYKDSTISLVGKNPAMNPVREMPIVGGTGLFRM  151

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITV  229
             +G+ I  T ++D     AI+  ++TV
Sbjct  152  ARGYAIAQTHWLDPTTGDAIVGYNVTV  178



>ref|XP_008449790.1| PREDICTED: dirigent protein 7-like [Cucumis melo]
Length=195

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 89/151 (59%), Gaps = 1/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K + +    Y HD LSG++ ++I +       TS+ +FG +  +D+P+TE PDPKSK  
Sbjct  46   RKEKLSHFRLYWHDVLSGKDPTSIQIVPPVS-NTSMTRFGAVQMIDNPLTETPDPKSKLW  104

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRA+GLY ++  +G GL +  +  F  G+Y GSS+ + G + F  K RE  V+ G+G FR
Sbjct  105  GRAEGLYASASQEGSGLLMAMNFAFVSGKYNGSSITVFGRNPFLEKVREMPVIGGSGLFR  164

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+   +T  +D     A+++ +I V HY
Sbjct  165  FARGYAKASTVNIDFTTGDAVIEYNIYVLHY  195



>ref|XP_007041903.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
 gb|EOX97734.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
Length=189

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 83/148 (56%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + +KL FY HD LSG+N +A+ VA   G   S   FG +  +DDP+TEGP+  SKE+GRA
Sbjct  42   KVSKLHFYFHDTLSGKNPTAVRVAQASGSAKSPTFFGVVFVIDDPLTEGPEATSKELGRA  101

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QGLY +   +   L +    +FT G+Y GSSL + G +      RE  ++ GTG FR  +
Sbjct  102  QGLYGSDGKEEVSLLMAMDFVFTSGKYNGSSLTVLGRNPVFHPLREMPIIGGTGVFRLAR  161

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G   + T  ++     AI +  + V HY
Sbjct  162  GIATVKTRSLNTTTGDAIAEYHVVVIHY  189



>gb|ABD52118.1| dirigent-like protein pDIR7 [Picea glauca]
Length=188

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG+N +A+ VA      +S   FGT+  +DD +TEGP   SK +G
Sbjct  39   REKISHLHFYFHDLVSGKNVTAVKVASAPTTNSSATLFGTVMVMDDWLTEGPAATSKMVG  98

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR 
Sbjct  99   RAQGIYVSSSQEKFHLLMASTFVFESGKYNGSTLAMVGKNAALEQVREMPIVGGSGLFRL  158

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T  +++    A+++ ++TV HY
Sbjct  159  ARGYALARTHSLELNTGNAVVEYNVTVLHY  188



>gb|ABD52120.1| dirigent-like protein pDIR9 [Picea engelmannii x Picea glauca]
Length=192

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 88/148 (59%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + + L FY HD L G N +A+ VA      +S+ QFG +  +DD +TEGP+  SK +GRA
Sbjct  39   KISHLHFYFHDLLEGTNVTAVDVASAPATDSSLTQFGMVRVMDDWLTEGPEATSKMVGRA  98

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR  +
Sbjct  99   QGIYVSSSQEKLHLLMATTFVFESGKYNGSTLSMVGKNAVFDEVREMPIVGGSGLFRLGR  158

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+ +  T   D+ +  A+++ ++TV HY
Sbjct  159  GYALARTHSFDLKSGNAVVEYNVTVLHY  186



>ref|XP_006295056.1| hypothetical protein CARUB_v10024124mg [Capsella rubella]
 gb|EOA27954.1| hypothetical protein CARUB_v10024124mg [Capsella rubella]
Length=189

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 2/150 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVA-GRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
            K + T L FY HD LSG+N +A+ VA G D  K+  L FG +  VDD +TE  DPKSK +
Sbjct  41   KEKVTNLQFYFHDTLSGKNPTAVKVAQGTDTEKSPTL-FGAVFMVDDALTETADPKSKLV  99

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG FR
Sbjct  100  GRAQGLYGSSCKEEVGLIMAMSFCFEDGPYKDSTISMIGKNSVMNPIREMPIVGGTGMFR  159

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
              +G+ I  T + D     AI+  ++TV H
Sbjct  160  MARGYAIAHTNWFDPKTGDAIVGYNVTVVH  189



>gb|ABD52125.1| dirigent-like protein pDIR14 [Picea engelmannii x Picea glauca]
Length=184

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 87/148 (59%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + + L FY HD L G+N +A+ VA      +   QFG +  +DD +TEGP+  SK +GRA
Sbjct  37   KTSHLHFYFHDLLEGKNVTAVQVASAPTTDSYFTQFGMVRVMDDWLTEGPEATSKMVGRA  96

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR  +
Sbjct  97   QGIYVSSSQEKFHLLMASTFVFESGKYNGSTLAMVGKNAVLEQVREMPIVGGSGLFRLAR  156

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+ +  T  +D+    A+++ ++TV HY
Sbjct  157  GYALAHTHSIDLKTGNAVVEYNVTVLHY  184



>gb|AFK34612.1| unknown [Medicago truncatula]
Length=194

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG   S + +A  +G   + L FGT+ A+DDP+T GP+  SK +G+AQG
Sbjct  48   THLHFYFHDIVSGPKPSMVFIAEPNGKVKNALPFGTVVAMDDPLTAGPERDSKLVGKAQG  107

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +   +  GL +V ++ FT+G + GS+L I G + I +   RE ++V GTG FRFV+G
Sbjct  108  IYTSISQEEMGLMMVMTMAFTDGHFNGSTLSILGRNMIMSEPVREMAIVGGTGAFRFVRG  167

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     A+++ DI V HY
Sbjct  168  YAQAKFYSVDYTKGDAVVEYDIFVFHY  194



>gb|ABD52114.1| dirigent-like protein pDIR3 [Picea engelmannii x Picea glauca]
Length=188

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG+N +A+ VA      +S   FGT+  +DD +TEGP   SK +G
Sbjct  39   REKISHLHFYFHDLVSGKNVTAVKVASAPTTNSSATLFGTVMVMDDWLTEGPAATSKMVG  98

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR 
Sbjct  99   RAQGIYVSSSQEKFHLLMASTFVFESGKYNGSTLAMVGKNAALEQVREMPIVGGSGLFRL  158

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T  +++    A+++ ++TV HY
Sbjct  159  ARGYALARTHSLELNTGNAVVEYNVTVLHY  188



>ref|XP_007201657.1| hypothetical protein PRUPE_ppa022063mg, partial [Prunus persica]
 gb|EMJ02856.1| hypothetical protein PRUPE_ppa022063mg, partial [Prunus persica]
Length=189

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 81/142 (57%), Gaps = 0/142 (0%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD LSG+  SA+ VA     + S   FG +   DDP+TE PDP SK +GRAQG
Sbjct  48   TNLQFYFHDTLSGKTPSAVRVAQATDTEKSPTLFGALLMADDPLTETPDPNSKLVGRAQG  107

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            LY +S     GL +  +  FT+G Y GSS+ I G +      RE  VV+GTG FR  +G+
Sbjct  108  LYGSSCQQELGLIMAMNFGFTDGMYNGSSISILGKNSAMNPVREMPVVAGTGVFRLGRGY  167

Query  297  GIMTTEFMDIPNLKAILKLDIT  232
             I  T ++D     AI+  ++T
Sbjct  168  AIAKTHWIDFTTGDAIVGYNVT  189



>ref|XP_006363502.1| PREDICTED: dirigent protein 19-like, partial [Solanum tuberosum]
Length=180

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + TKL FY HD ++ +N SAI +A  +    S   FG +  +D+P+T  P+P SK IG
Sbjct  31   KAKMTKLHFYFHDIVTAKNPSAIQIAQANNTFQSPTFFGLVRMMDNPLTVNPEPNSKIIG  90

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  +++FT G+Y GS+L I G +    + RE  +V G+G FR 
Sbjct  91   RAQGIYGSASFEDIGLLMTLNLVFTNGKYNGSTLSILGHNQIFHEYREMPIVGGSGVFRL  150

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             KG     T  +D     AI++  + V HY
Sbjct  151  AKGIATAKTYQVDNTTQNAIVEYHVVVLHY  180



>ref|XP_004231599.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=191

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 85/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + TKL FY HD ++ EN SAI +A  +    S   FG +  +D+P+T  P+P SK IG
Sbjct  42   KAKMTKLHFYFHDIVTAENPSAIQIAQANNTFQSPTFFGLVRMMDNPLTVNPEPNSKIIG  101

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +  +++FT G+Y GS+L I G +    + RE  +  G+G FR 
Sbjct  102  RAQGIYGSTLFEDLGLLMTLNLVFTNGKYNGSTLSILGHNQIFQEYREMPINGGSGVFRL  161

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             KG     T  +D     AIL+  + V HY
Sbjct  162  AKGIATAKTYQIDNTTQNAILEYHVVVLHY  191



>ref|XP_003625317.1| Disease resistance response protein [Medicago truncatula]
 gb|AES81535.1| disease resistance response protein [Medicago truncatula]
Length=194

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG   S + +A  +G   + L FGT+ A+DDP+T GP+  SK +G+AQG
Sbjct  48   THLHFYFHDIVSGPKPSMVFIAEPNGKVKNALPFGTVVAMDDPLTAGPERDSKLVGKAQG  107

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +   +  GL +V ++ FT+G + GS+L I G + I +   RE ++V GTG FRFV+G
Sbjct  108  IYTSISQEEMGLMMVMTMAFTDGHFNGSTLSILGRNMIMSEPVREMAIVGGTGAFRFVRG  167

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     A+++ DI V HY
Sbjct  168  YAQAKFYSVDYTKGDAVVEYDIFVFHY  194



>ref|XP_003576241.1| PREDICTED: dirigent protein 22-like [Brachypodium distachyon]
Length=199

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 80/143 (56%), Gaps = 1/143 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG + SA+ VAG      S   FG +T +DDP+TEGP+P S  +GRAQG
Sbjct  56   THLHFYFHDTVSGGSPSAVHVAG-PADMASRTMFGLVTVMDDPLTEGPEPGSAAVGRAQG  114

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y+ S     G     +++   G Y GSSL + G +      RE  +V GTG FRF +G+
Sbjct  115  MYLASDQAQLGFLQAMNIVLQSGPYNGSSLAVLGRNCPLTDVREMPIVGGTGVFRFARGY  174

Query  297  GIMTTEFMDIPNLKAILKLDITV  229
             +  T ++D     A ++ DI V
Sbjct  175  ALARTHWLDFSTGDATVEYDIYV  197



>ref|XP_008356340.1| PREDICTED: dirigent protein 23-like [Malus domestica]
Length=192

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 1/145 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L FY HD +SG+N SA+ VA     + S+  FG +   DDP+TE PDPKSK +GRAQG
Sbjct  49   TNLQFYFHDTVSGKNPSAVRVAQAPETEKSLTLFGALLMADDPLTETPDPKSKLVGRAQG  108

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
            +Y +S     GL +     F +G Y GSS+ I G +      RE  VV+GTG FR  +G+
Sbjct  109  MYGSSGQQEFGLTMAMCFAFCDGMYNGSSISIFGKNSAMNPVREMPVVAGTGVFRLARGY  168

Query  297  GIMTTEFMDIPNLKAILKLDITVRH  223
             I  T + +     AI+  ++T+ H
Sbjct  169  AIAKTHWFNTMG-DAIVGYNVTLIH  192



>ref|XP_010693847.1| PREDICTED: dirigent protein 21-like [Beta vulgaris subsp. vulgaris]
Length=238

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 84/148 (57%), Gaps = 1/148 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
             QT L FY HD +SG N S I +A R    T+   FG +  +DDP+TEGP+  SK +GRA
Sbjct  43   NQTHLTFYFHDIVSGRNPSVIQIA-RANSTTNQSPFGNLAMMDDPLTEGPENTSKLVGRA  101

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y  +   G GL ++ +  F EG++ GS+L + G +  +   RE  VV GT  FRF K
Sbjct  102  QGMYGVADQQGPGLLMIMNFYFIEGDFNGSTLSVLGRNHASDGVREMPVVGGTKAFRFAK  161

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T   D     A+++ ++ V HY
Sbjct  162  GYAQARTHIFDPNTGDAVVQYNVFVNHY  189



>gb|ABE73781.1| dirigent-related protein [Tamarix androssowii]
Length=184

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = -1

Query  639  VHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQGLYINSQ  460
             HD +SG++ +A+ VA   G   S   FG++T  DD +TEGP+P SK IGRAQGLY ++ 
Sbjct  47   CHDIVSGKDATAVKVAQASGTDKSPTAFGSVTMADDKLTEGPEPSSKIIGRAQGLYASAC  106

Query  459  LDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGFGIMTTE  280
             +  GL +  S  FT+G Y GSSL I G +      RE  VV GTG FR  +GF +  T 
Sbjct  107  QEELGLLMAMSYSFTDGIYNGSSLSILGRNTVMHPVRELPVVGGTGVFRMARGFALAKTN  166

Query  279  FMDIPNLKAILKLDITVRH  223
            +  +    AI+  ++TV H
Sbjct  167  WFSMSG-DAIVGYNVTVIH  184



>emb|CDY13841.1| BnaA09g43430D [Brassica napus]
Length=186

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 84/149 (56%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD LSG+N +A+ VA       S   FG++  VDD +TE  DPKSK +G
Sbjct  38   KDKVTNLQFYFHDTLSGKNPTAVKVAQAADTDKSPTLFGSVFMVDDALTETADPKSKLVG  97

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG FR 
Sbjct  98   RAQGLYGSSCKEELGLLMAMSFCFEDGPYKDSTISMIGKNSAMKPVREMPIVGGTGMFRM  157

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ I  T + D     AI+  ++T+ H
Sbjct  158  ARGYAIAQTHWFDPKTGDAIVGYNVTIVH  186



>ref|XP_009117440.1| PREDICTED: dirigent protein 23 [Brassica rapa]
Length=188

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 84/149 (56%), Gaps = 0/149 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD LSG+N +A+ VA       S   FG++  VDD +TE  DPKSK +G
Sbjct  40   KDKVTNLQFYFHDTLSGKNPTAVKVAQAADSDKSPTLFGSVFMVDDALTETADPKSKLVG  99

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQGLY +S  +  GL +  S  F +G YK S++ + G +      RE  +V GTG FR 
Sbjct  100  RAQGLYGSSCKEELGLLMAMSFCFEDGPYKDSTISMIGKNSAMNPVREMPIVGGTGMFRM  159

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             +G+ I  T + D     AI+  ++T+ H
Sbjct  160  ARGYAIAQTHWFDPKTGDAIVGYNVTIVH  188



>ref|XP_010930785.1| PREDICTED: dirigent protein 22-like [Elaeis guineensis]
Length=194

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 88/150 (59%), Gaps = 2/150 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG N +A+ V        S   FG IT +DD +TE P+P SK +G
Sbjct  47   RQKVSHLHFYFHDVVSGRNATAVPVTEPVMNLPSA--FGMITMMDDLLTEAPEPTSKAVG  104

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++     GL +  +++FTEG+Y GS L + G +    + RE  VV G+G FRF
Sbjct  105  RAQGMYASAAQQELGLLMAMNLVFTEGKYNGSVLTVLGRNPPFQQVREMPVVGGSGLFRF  164

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +GF    T + D+ +  A+++ ++ V HY
Sbjct  165  ARGFAQAHTHWFDLKSGDAVVEYNVYVMHY  194



>ref|XP_006492824.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
Length=190

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 85/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + + L FY HD +SG+N +A+ VA       S   FG +  +DDP+T  P+P SK +G
Sbjct  41   KEKLSHLHFYFHDIVSGKNPTAVRVAQAAMTNHSPTLFGVVVMIDDPLTMEPEPSSKLVG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y ++  +  GL +V +  F EG+Y GS+L + G +      RE  +V G+G FRF
Sbjct  101  RAQGIYASASQNETGLLMVMNFSFMEGKYNGSTLSVLGRNAVLSTVREMPIVGGSGLFRF  160

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+    T   D     A+++ ++ V HY
Sbjct  161  ARGYAQAKTHTFDPKTGDAVVEYNVNVFHY  190



>ref|XP_010257548.1| PREDICTED: dirigent protein 19-like [Nelumbo nucifera]
Length=200

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 88/151 (58%), Gaps = 1/151 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQ-FGTITAVDDPVTEGPDPKSKEI  493
            + + T L FY HD LSG N +AI +      K+S+   FG +  +DDP+TE P+  SK +
Sbjct  50   REKITHLHFYFHDILSGRNPTAIQIVKPPAYKSSLATGFGAVFVIDDPLTETPEVTSKLV  109

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRA+G+Y ++  +  GL +V +  F EG+Y GS+L I G +      RE  VV GTG FR
Sbjct  110  GRAEGIYASTSKEELGLLMVLNYAFMEGKYNGSTLSILGRNTVFSTVREMPVVGGTGLFR  169

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+    T  +D+    A+++ ++ V HY
Sbjct  170  FARGYAHAKTHRIDLKTGDAVVEYNVFVIHY  200



>gb|KHN07457.1| Disease resistance response protein 206 [Glycine soja]
Length=187

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K + T L FY+HD +SG   +A+ +A      TS   FG +   DDP+T GP+P+SK +
Sbjct  37   RKEKLTHLRFYMHDVMSGPKPTAVKIAEAQMANTSSSFFGLLDMADDPLTAGPEPESKLV  96

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            G+ QG++  +  +  GL ++F+  FTEG+Y GS+L + G ++     RE  +V G+G FR
Sbjct  97   GKGQGMFGFADQNELGLVMLFNFAFTEGKYNGSTLSMLGRNMVLTAVREMPIVGGSGVFR  156

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+    T  +D     A+++ ++ V HY
Sbjct  157  FARGYAQAKTHTLDAKTGDAVVEFNVYVFHY  187



>ref|XP_010065290.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW62710.1| hypothetical protein EUGRSUZ_G00281 [Eucalyptus grandis]
Length=202

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T+L FY HD LSG   +A+ VA       S   FG +  +DDP+TEGP+P+S  +GRA
Sbjct  55   KTTRLHFYFHDTLSGRKPTAVRVAEATMTDKSPTGFGVVNMIDDPLTEGPEPESPLVGRA  114

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG Y +  L+   LH+  +++FT  EY GS+L I G +      RE  +V GTG FR   
Sbjct  115  QGFYGSVGLESVALHMNMNLVFTTPEYNGSTLSILGHNPALETYREMPIVGGTGIFRLAS  174

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G     T F+++    A+++  +   HY
Sbjct  175  GVVTAKTSFLNLTTGDAVVEYKVIALHY  202



>ref|XP_008449789.1| PREDICTED: dirigent protein 20-like [Cucumis melo]
Length=195

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 87/151 (58%), Gaps = 1/151 (1%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K + +    Y HD LSG+  ++I +       TS+  FG +  +D+P+TE PDPKSK  
Sbjct  46   RKEKLSHFRLYWHDVLSGKYPTSIQIVPPVS-NTSMTGFGLVNMIDNPLTETPDPKSKLW  104

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            GRAQGLY ++  D  GL +  +  F  G+Y GSSL I G + F  K RE  V+ G+G FR
Sbjct  105  GRAQGLYASASQDKFGLLMAMNFAFVSGKYNGSSLTIFGRNPFMEKVREMPVIGGSGLFR  164

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+   +T+ +D     A+++ +I V HY
Sbjct  165  FARGYAEASTKKVDFKTGDAVVEYNIYVLHY  195



>ref|XP_003521232.1| PREDICTED: dirigent protein 21-like [Glycine max]
Length=194

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 0/151 (0%)
 Frame = -1

Query  672  HKPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEI  493
             K + T L FY+HD +SG   +A+ +A      TS   FG +   DDP+T GP+P+SK +
Sbjct  44   RKEKLTHLRFYMHDVMSGPKPTAVKIAEAQMANTSSSFFGLLDMADDPLTAGPEPESKLV  103

Query  492  GRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            G+ QG++  +  +  GL ++F+  FTEG+Y GS+L + G ++     RE  +V G+G FR
Sbjct  104  GKGQGMFGFADQNELGLVMLFNFAFTEGKYNGSTLSMLGRNMVLTAVREMPIVGGSGVFR  163

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            F +G+    T  +D     A+++ ++ V HY
Sbjct  164  FARGYAQAKTHTLDAKTGDAVVEFNVYVFHY  194



>ref|XP_008783384.1| PREDICTED: dirigent protein 22-like [Phoenix dactylifera]
Length=188

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 3/153 (2%)
 Frame = -1

Query  669  KPRQTKLV---FYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            KPR  KL    F+ HD L+G N +A+ VA      TS   FG +  +DDP+TEGP+  SK
Sbjct  36   KPRHEKLTHLHFFWHDVLNGPNPTAVPVAQAATTSTSSSSFGLVNVIDDPLTEGPEMASK  95

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             +GRAQGLY ++  +G GL +  +  F +G+Y GS++ I G +      RE  V+ G+G 
Sbjct  96   LVGRAQGLYASAAQEGLGLLMAMNFAFMDGKYNGSTITILGRNEVFTAVREMPVIGGSGL  155

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            FR  +G+    T  +D+ +  A+++ +  V HY
Sbjct  156  FRLARGYVQAKTHNLDMKSGNAVVEYNCFVFHY  188



>emb|CAN61168.1| hypothetical protein VITISV_038109 [Vitis vinifera]
Length=151

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (57%), Gaps = 3/148 (2%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + + L FY HD +SG   +A+ VA       S   FG +  +DDP+T GP+P SK +GRA
Sbjct  7    KLSHLHFYFHDIISGPKPTAVRVAEAAMTNKSATMFGAVLMMDDPLTVGPEPSSKLVGRA  66

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y ++  +  GL +V +  F EG+Y GS+L + G +    K RE  +V G+G FRF +
Sbjct  67   QGIYASASQEEMGLLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRFAR  126

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T      NL  +++ ++ V HY
Sbjct  127  GYAQARTRTF---NLDVVVEYNVYVFHY  151



>ref|XP_003554228.1| PREDICTED: dirigent protein 1-like [Glycine max]
 gb|KHN45400.1| Disease resistance response protein 206 [Glycine soja]
Length=186

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 1/147 (1%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            T L F+ HD ++G   S + VA  +G     L FGT+ A+DDP+T GPD  SK +G+AQG
Sbjct  40   THLHFFFHDVVTGPKPSMVFVAEPNGKAKDALPFGTVVAMDDPLTVGPDHDSKLVGKAQG  99

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFRFVKG  301
            +Y +   +  GL +V ++ FT+GE+ GS++ + G + I +   RE ++V GTG FRF +G
Sbjct  100  IYTSISQEEMGLMMVMTMAFTDGEFNGSTISVLGRNMIMSEPVREMAIVGGTGAFRFARG  159

Query  300  FGIMTTEFMDIPNLKAILKLDITVRHY  220
            +       +D     AI++ D+ V HY
Sbjct  160  YAQAKFYSVDFTKGDAIVEYDVFVNHY  186



>ref|XP_006841312.1| hypothetical protein AMTR_s00134p00124080 [Amborella trichopoda]
 gb|ERN02987.1| hypothetical protein AMTR_s00134p00124080 [Amborella trichopoda]
Length=206

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 83/148 (56%), Gaps = 0/148 (0%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + T L FY HD +S    +AI VA  D    S   FG I  +DDP+TEGP+  SK IGRA
Sbjct  56   KVTHLHFYFHDIVSCPKPTAIQVARADSTNKSATGFGAIVMIDDPLTEGPEVSSKLIGRA  115

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y  +  +  GL +  + +F EG+YKGS+L + G +      RE ++V G G FR  +
Sbjct  116  QGIYALAAQEEVGLLMTLNYVFVEGKYKGSTLSVLGRNAVFSGVREMAIVGGGGAFRLAR  175

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+ +  T   +     A+++ ++ V HY
Sbjct  176  GYALAKTHTFNSSTGDAVVEYNVVVLHY  203



>ref|XP_009601995.1| PREDICTED: dirigent protein 21-like [Nicotiana tomentosiformis]
Length=192

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 90/151 (60%), Gaps = 2/151 (1%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + TK  FY HD LSG+N +AI +A  +    S   FG +  +DDP+T GP+P S  +G
Sbjct  41   KQKVTKFHFYFHDILSGKNPTAIQIARSNTTAKSPTLFGGVAMMDDPLTVGPEPNSTIVG  100

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGAD-IFNMKEREFSVVSGTGFFR  313
            RAQG+Y ++      L +  + +FT G+Y GS+L + G + +FN + RE  +V G+G FR
Sbjct  101  RAQGIYGSADQKEAALLMNLNFVFTTGKYNGSTLSVLGRNPVFN-QYREMPIVGGSGVFR  159

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
              +G     T + ++ +  A+++ ++ VRHY
Sbjct  160  LAQGIATAKTVWFNLTSGDAVVEYNVIVRHY  190



>gb|KDO65648.1| hypothetical protein CISIN_1g043734mg [Citrus sinensis]
Length=175

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 88/154 (57%), Gaps = 6/154 (4%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDG---PKTSVLQFGTITAVDDPVTEGPDPKSK  499
            K + T++ FY+HD +SG   +A+ VAGR     P      FG++  +D+P+T  PDP S 
Sbjct  24   KSKVTRMQFYMHDIVSGPTATAVPVAGRSNFTSPDPIKAMFGSVFVMDNPLTMTPDPNST  83

Query  498  EIGRAQGLY-INSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTG  322
             IGRAQG+Y ++SQ D   L +  +  FT G Y GSS  + G +    + RE  +V GTG
Sbjct  84   VIGRAQGIYAMSSQQDEFSLLMTLTYGFTSGPYNGSSFSVLGRNPVMSEVREMPIVGGTG  143

Query  321  FFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             FR  +G+ +  T  MD   + A++  ++T+ HY
Sbjct  144  IFRLARGYCLAKTSSMD--QMDAVIGYNVTLLHY  175



>ref|XP_009379877.1| PREDICTED: dirigent protein 21-like [Musa acuminata subsp. malaccensis]
Length=175

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 88/154 (57%), Gaps = 7/154 (5%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSV---LQFGTITAVDDPVTEGPDPKSK  499
            K   T+L FY+HD +S  N +A+ VA  +GP+TS    + FG I  VDD +T GP P S 
Sbjct  24   KEPTTRLHFYMHDKISNPNATAVRVA--EGPQTSTGPGINFGDIYVVDDLLTTGPSPSSP  81

Query  498  EIGRAQGLYINSQLDGKGLHLVFSV--IFTEGEYKGSSLEIQGADIFNMKEREFSVVSGT  325
             +GRAQG Y  +  D   + L+ +V  +FTEGEYKGS+L I   D      RE  VV G+
Sbjct  82   LVGRAQGFYAMASQDPADVALMLTVNLVFTEGEYKGSTLAILSRDAIFSPVRELPVVGGS  141

Query  324  GFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            G FR  +G+ +M T   +     A+L+ D+ V H
Sbjct  142  GAFRLARGYVLMKTYSFNQTLGDAVLEWDVYVMH  175



>ref|XP_002967407.1| hypothetical protein SELMODRAFT_87141 [Selaginella moellendorffii]
 gb|EFJ32006.1| hypothetical protein SELMODRAFT_87141 [Selaginella moellendorffii]
Length=164

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 83/144 (58%), Gaps = 5/144 (3%)
 Frame = -1

Query  657  TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRAQG  478
            +++ FY+HD  +    + + VAG      S   FG +  +DD +T+GP P S+ +GRAQG
Sbjct  25   SRMQFYMHDNFNLSPRTVLRVAG---SANSTAAFGAVMVIDDLLTQGPSPASQPVGRAQG  81

Query  477  LYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVKGF  298
             Y+ S LDG  L L F+ +F+ G   GS++   GAD F + ERE +V+ GTG FR  +GF
Sbjct  82   TYMISALDGSSLLLTFTAVFSRGSENGSTISFHGADRFLLAEREIAVIGGTGKFRMARGF  141

Query  297  GIMTTEFMDIPNLKAILKLDITVR  226
             ++ T      N   I+  D+T++
Sbjct  142  AVLNTT--SNTNRATIVGFDVTLQ  163



>gb|ABR27721.1| dirigent-like protein [Picea sitchensis]
Length=175

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 91/147 (62%), Gaps = 6/147 (4%)
 Frame = -1

Query  660  QTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE---IG  490
            +  +V Y+HD L+G + ++  VAG +G  ++  +FGT+  + D +T+ P   +     +G
Sbjct  26   EMNIVVYMHDNLTGRHQTSFPVAGLNGSSSNPGKFGTLVVISDAITKRPYVNTNPGNIVG  85

Query  489  RAQGLYINSQ-LDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFR  313
            RAQG Y+N+  + G    +VF++IF   EY GS+LEIQG D F+  + E++VV GTG FR
Sbjct  86   RAQGTYVNTNPVTGLDFFMVFTLIFQNMEYNGSTLEIQGTDRFDQPQCEYAVVGGTGKFR  145

Query  312  FVKGFGIMTTEFMDIPNLKAILKLDIT  232
            F +G+ ++T E    PN  A+LK + T
Sbjct  146  FARGYAVVTVESASGPN--AVLKFNTT  170



>dbj|BAJ89677.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=176

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (57%), Gaps = 1/148 (1%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSG-ENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGR  487
            ++T+L  Y HD +SG  N   + VA       S   FGT+  +DDP+TEGP+  S+ +GR
Sbjct  28   KETRLRVYWHDVVSGGPNARVVQVAQAPSSNASATGFGTVLVIDDPLTEGPNLTSRLLGR  87

Query  486  AQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFV  307
            AQG+Y+++  D   L +  + +F +G Y GSS+ I G +  +   RE  VV GTG FRF 
Sbjct  88   AQGIYVSAGKDSLSLLMAMNFVFVDGAYNGSSIAIIGPNQADRAVREMPVVGGTGVFRFA  147

Query  306  KGFGIMTTEFMDIPNLKAILKLDITVRH  223
            +G+  + T + D     A ++  I +RH
Sbjct  148  RGYCQLRTHWFDAKTGDATVEYKIHLRH  175



>gb|KEH41749.1| disease resistance response protein [Medicago truncatula]
Length=192

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = -1

Query  672  HKPRQ-TKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKE  496
            HKP++ + + FY HD + G+N +A+ VA     + S   FG++  +DDP+T  P+  S+ 
Sbjct  43   HKPQKLSHIRFYFHDIIGGKNQTAVRVASSPTTEKSPTGFGSVVMMDDPLTARPESNSEV  102

Query  495  IGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFF  316
            +GRAQG+Y ++     G  +V +  FT+G+Y GS+L I G +      RE  VV G+G F
Sbjct  103  VGRAQGIYASASQSEVGFLMVLNFAFTQGKYNGSNLSILGRNTIESAVREMPVVGGSGLF  162

Query  315  RFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            RF +G+   +T    I  L+AI++ ++ V HY
Sbjct  163  RFARGYAQASTH--SINALEAIVEYNVYVFHY  192



>ref|XP_004505770.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=187

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 86/152 (57%), Gaps = 2/152 (1%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGR-DGPKTSVLQFGTITAVDDPVTEGPDPKSK  499
            ++K   TKL FY HD +SG+N SA+ VA   D  K+    FG I   DDP+TE  DP SK
Sbjct  37   KNKETVTKLQFYFHDTVSGKNPSAVKVAEPVDKSKSFSTLFGNIMMADDPLTETSDPNSK  96

Query  498  EIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGF  319
             +GRAQG+Y +S  +  GL +  S  F +G Y GSS  + G +      RE +VV GTG 
Sbjct  97   LVGRAQGMYGSSCQEELGLLMALSYSFVDGPYNGSSFTVVGKNSIMNPVREMAVVGGTGL  156

Query  318  FRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
            FR  +G+ I  T + D     AI+  ++T+ H
Sbjct  157  FRMARGYAIAQTHWFDNRG-DAIVGYNVTLVH  187



>ref|XP_006416145.1| hypothetical protein EUTSA_v10008857mg [Eutrema salsugineum]
 gb|ESQ34498.1| hypothetical protein EUTSA_v10008857mg [Eutrema salsugineum]
Length=189

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = -1

Query  675  RHKP-RQTKLVFYVHDYLSGENTSAISVAGRDGPKTS-VLQFGTITAVDDPVTEGPDPKS  502
            RHKP + T L FY HD +SG+  +AI V       +S V  FG +   D+ +TEGPD  S
Sbjct  39   RHKPEKHTHLHFYFHDVISGDKPTAIRVTKPTVTNSSAVSSFGVVVIADNLLTEGPDRTS  98

Query  501  KEIGRAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTG  322
            KE+GR QG+Y ++ ++     +VF+++FTEGE+ GS++ + G +   ++ RE  ++ GTG
Sbjct  99   KEVGRGQGMYASTDMNALTFTMVFNLVFTEGEFNGSTVAMYGRNSVMLEVREMPIIGGTG  158

Query  321  FFRFVKGFGIMTTEFMDIPNLKAILKLDITVRH  223
             FRF +G+       +D   L A+++ ++ + H
Sbjct  159  AFRFARGYAQAKNYKLD--GLDAVVEYNVFILH  189



>gb|KDP20413.1| hypothetical protein JCGZ_06372 [Jatropha curcas]
Length=182

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (57%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            K + T L FY HD  SG + +AI +A  +    S   FG  T +DDP+TEGP+  SKE+G
Sbjct  33   KQKVTHLHFYFHDTFSGPSPTAIVIARSNMTDKSPTLFGLTTMIDDPLTEGPELDSKEVG  92

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG Y +S     GL +  +++FT  EY GS+L + G +      RE  +V GTG FR 
Sbjct  93   RAQGFYGSSGQKTVGLLMATTLVFTGKEYNGSTLTVLGRNPALEPHRELPIVGGTGVFRL  152

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +GF ++ T   +     AI++  +TV HY
Sbjct  153  ARGFAMLKTYSFNSTTGDAIVEYHVTVIHY  182



>ref|XP_007199411.1| hypothetical protein PRUPE_ppa026244mg [Prunus persica]
 gb|EMJ00610.1| hypothetical protein PRUPE_ppa026244mg [Prunus persica]
Length=189

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = -1

Query  675  RHKPRQTKLVFYVHDYLSGENTSAISVAGRDGPK--TSVLQFGTITAVDDPVTEGPDPKS  502
            RH+ + T+L FY+ D +SG   SA+ VA   G K   S   FG++ A+DD + EGP+  S
Sbjct  33   RHREKVTRLHFYLFDIISGTKPSAVEVARPKGAKYDKSATPFGSVWAIDDALREGPEFTS  92

Query  501  KEIGRAQGLYINSQLDGKGLHLVFSVI--FTEGEYKGSSLEIQGAD-IFNMKEREFSVVS  331
            K +G AQGLY++S  D   L LV      FT G++ GSS  +   + I    ERE +VV 
Sbjct  93   KVVGNAQGLYLSSVQDENSLGLVMYADFGFTTGKFNGSSFSVFSRNPIMEPGERELAVVG  152

Query  330  GTGFFRFVKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G G FR  KGF  + T+F+++ N  AIL+  +T+ HY
Sbjct  153  GRGRFRMAKGFVKVKTQFLNVTNGDAILEYRVTLVHY  189



>ref|XP_002280817.1| PREDICTED: dirigent protein 2 [Vitis vinifera]
 emb|CBI29981.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (57%), Gaps = 3/148 (2%)
 Frame = -1

Query  663  RQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIGRA  484
            + + L FY HD +SG   +A+ VA       S   FG +  +DDP+T GP+P SK +GRA
Sbjct  45   KLSHLHFYFHDIISGPKPTAVRVAEAAMTNKSATMFGAVLMMDDPLTVGPEPSSKLVGRA  104

Query  483  QGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRFVK  304
            QG+Y ++  +  GL +V +  F EG+Y GS+L + G +    K RE  +V G+G FRF +
Sbjct  105  QGIYASASQEEMGLLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRFAR  164

Query  303  GFGIMTTEFMDIPNLKAILKLDITVRHY  220
            G+    T      NL  +++ ++ V HY
Sbjct  165  GYAQARTRTF---NLDVVVEYNVYVFHY  189



>gb|ABR27716.1| dirigent-like protein [Picea sitchensis]
Length=186

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 88/150 (59%), Gaps = 0/150 (0%)
 Frame = -1

Query  669  KPRQTKLVFYVHDYLSGENTSAISVAGRDGPKTSVLQFGTITAVDDPVTEGPDPKSKEIG  490
            + + + L FY HD +SG+N + + VA      +S   FGT+  +DD +TEGP+  SK +G
Sbjct  37   REKISHLHFYFHDLVSGKNVTTVKVASAPTSNSSATLFGTVMVMDDWLTEGPEATSKMLG  96

Query  489  RAQGLYINSQLDGKGLHLVFSVIFTEGEYKGSSLEIQGADIFNMKEREFSVVSGTGFFRF  310
            RAQG+Y++S  +   L +  + +F  G+Y GS+L + G +    + RE  +V G+G FR 
Sbjct  97   RAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEQVREMPIVGGSGLFRL  156

Query  309  VKGFGIMTTEFMDIPNLKAILKLDITVRHY  220
             +G+ +  T   ++    A+++ ++TV HY
Sbjct  157  ARGYALARTHSWELNTGNAVVEYNVTVLHY  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1651846923090