BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78457_g1_i1 len=596 path=[1:0-595]

Length=596
                                                                      Score     E

gb|ABA98491.1|  retrotransposon protein, putative, unclassified       92.8    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53315.2|  retrotransposon protein, putative, unclassified       92.4    8e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18736.1|AC092548_14  putative reverse transcriptase             92.4    8e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEE50824.1|  hypothetical protein OsJ_31232                        92.4    8e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007210131.1|  hypothetical protein PRUPE_ppa022959mg           84.3    1e-16   
gb|EEC71228.1|  hypothetical protein OsI_03168                        85.9    9e-16   Oryza sativa Indica Group [Indian rice]
gb|EEE55133.1|  hypothetical protein OsJ_02920                        85.5    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008245614.1|  PREDICTED: uncharacterized protein LOC103343753  81.3    5e-15   
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...  82.8    1e-14   
gb|EEC84982.1|  hypothetical protein OsI_32248                        82.0    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860  81.6    3e-14   
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052  80.5    6e-14   
gb|EEE67582.1|  hypothetical protein OsJ_25113                        79.3    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg           79.3    2e-13   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg           79.3    2e-13   
emb|CAE01608.2|  OSJNBa0052O21.12                                     77.8    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115737.1|  PREDICTED: uncharacterized protein LOC103840975  79.0    2e-13   
ref|XP_009103405.1|  PREDICTED: uncharacterized protein LOC103829494  78.6    2e-13   
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...  78.6    2e-13   
gb|EAZ29765.1|  hypothetical protein OsJ_13823                        77.8    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559  78.6    3e-13   
ref|XP_009108660.1|  PREDICTED: putative ribonuclease H protein A...  77.8    3e-13   
gb|EEE64617.1|  hypothetical protein OsJ_19469                        75.5    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66057.1|  hypothetical protein OsJ_22054                        77.8    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010689466.1|  PREDICTED: uncharacterized protein LOC104903167  75.1    7e-13   
gb|EEC79287.1|  hypothetical protein OsI_20089                        77.0    7e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002468588.1|  hypothetical protein SORBIDRAFT_01g048580        76.3    8e-13   Sorghum bicolor [broomcorn]
ref|XP_009149621.1|  PREDICTED: uncharacterized protein LOC103872937  77.0    8e-13   
gb|EEC76774.1|  hypothetical protein OsI_14862                        77.4    8e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg           77.0    8e-13   
gb|AAT58873.1|  hypothetical protein                                  77.0    9e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010512944.1|  PREDICTED: uncharacterized protein LOC104788863  76.6    9e-13   
ref|NP_001174443.1|  Os05g0434000                                     77.0    9e-13   
emb|CCA66036.1|  hypothetical protein                                 77.0    1e-12   
ref|XP_010681662.1|  PREDICTED: uncharacterized protein LOC104896592  76.6    1e-12   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...  76.6    1e-12   
gb|EEC81735.1|  hypothetical protein OsI_25376                        73.6    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010236480.1|  PREDICTED: uncharacterized protein LOC104584065  76.6    1e-12   
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...  76.6    1e-12   
gb|EMT07196.1|  Tubulin--tyrosine ligase-like protein 12              76.6    1e-12   
ref|XP_002454941.1|  hypothetical protein SORBIDRAFT_03g001780        76.3    1e-12   Sorghum bicolor [broomcorn]
ref|XP_010463319.1|  PREDICTED: uncharacterized protein LOC104743986  76.3    1e-12   
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...  76.3    1e-12   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947  76.6    1e-12   
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...  76.3    2e-12   
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015  76.3    2e-12   
gb|AAD40135.1|AF149413_16  contains similarity to retrotransposon...  72.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102306.1|  PREDICTED: putative ribonuclease H protein A...  75.5    2e-12   
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg           75.9    2e-12   
ref|XP_007200757.1|  hypothetical protein PRUPE_ppa023318mg           72.8    2e-12   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       75.5    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  75.5    3e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81442.1|  hypothetical protein VITISV_011546                   75.5    3e-12   Vitis vinifera
ref|XP_008340459.1|  PREDICTED: putative ribonuclease H protein A...  74.7    3e-12   
ref|XP_008387184.1|  PREDICTED: putative ribonuclease H protein A...  75.1    3e-12   
ref|XP_008228453.1|  PREDICTED: putative ribonuclease H protein A...  74.7    3e-12   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...  75.5    3e-12
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase            75.1    4e-12   
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg           75.1    4e-12   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  75.1    4e-12   
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)   74.3    4e-12   Medicago truncatula
ref|XP_004292011.1|  PREDICTED: uncharacterized protein LOC101291306  75.1    4e-12   
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160  74.7    4e-12   
ref|XP_010229884.1|  PREDICTED: uncharacterized protein LOC100821562  74.7    4e-12   
ref|XP_010462630.1|  PREDICTED: uncharacterized protein LOC104743220  74.3    5e-12   
ref|XP_009102778.1|  PREDICTED: uncharacterized protein LOC103828890  74.7    5e-12   
ref|XP_010667928.1|  PREDICTED: uncharacterized protein LOC104884923  74.3    5e-12   
ref|XP_010445339.1|  PREDICTED: uncharacterized protein LOC104727990  74.7    5e-12   
ref|XP_009150103.1|  PREDICTED: uncharacterized protein LOC103873447  73.9    5e-12   
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...  74.7    5e-12   
ref|XP_009114416.1|  PREDICTED: uncharacterized protein LOC103839673  74.7    6e-12   
gb|EEE54705.1|  hypothetical protein OsJ_02026                        73.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852  74.3    6e-12   
ref|XP_010671945.1|  PREDICTED: uncharacterized protein LOC104888619  73.9    7e-12   
ref|XP_007201931.1|  hypothetical protein PRUPE_ppa017480mg           71.6    7e-12   
ref|XP_010463143.1|  PREDICTED: uncharacterized protein LOC104743796  73.9    7e-12   
gb|EEC67968.1|  hypothetical protein OsI_35722                        71.6    8e-12   Oryza sativa Indica Group [Indian rice]
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase   74.3    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295858.1|  PREDICTED: uncharacterized protein LOC101314838  74.3    8e-12   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase   73.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818  73.9    8e-12   
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847  73.9    8e-12   
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...  73.9    9e-12   
ref|XP_010692677.1|  PREDICTED: uncharacterized protein LOC104905754  73.9    9e-12   
ref|XP_009105597.1|  PREDICTED: uncharacterized protein LOC103831468  73.6    1e-11   
ref|XP_010513448.1|  PREDICTED: uncharacterized protein LOC104789452  73.6    1e-11   
ref|XP_002464513.1|  hypothetical protein SORBIDRAFT_01g019890        71.6    1e-11   Sorghum bicolor [broomcorn]
ref|XP_008378183.1|  PREDICTED: putative ribonuclease H protein A...  72.0    1e-11   
ref|XP_009110782.1|  PREDICTED: uncharacterized protein LOC103836292  73.6    1e-11   
ref|XP_010673355.1|  PREDICTED: uncharacterized protein LOC104889755  73.6    1e-11   
gb|ABA97563.1|  retrotransposon protein, putative, unclassified       73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107779.1|  PREDICTED: putative ribonuclease H protein A...  73.2    1e-11   
gb|EAZ08016.1|  hypothetical protein OsI_30282                        73.2    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574  73.6    1e-11   
ref|XP_009123425.1|  PREDICTED: uncharacterized protein LOC103848222  73.2    1e-11   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717  73.6    1e-11   
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...  73.2    1e-11   
ref|XP_010463221.1|  PREDICTED: uncharacterized protein LOC104743884  70.9    1e-11   
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase   73.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666096.1|  PREDICTED: uncharacterized protein LOC104883306  73.2    1e-11   
ref|XP_008393342.1|  PREDICTED: putative ribonuclease H protein A...  72.8    2e-11   
emb|CAN68400.1|  hypothetical protein VITISV_041172                   73.2    2e-11   Vitis vinifera
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg           73.2    2e-11   
ref|XP_007214818.1|  hypothetical protein PRUPE_ppa024509m2g          71.6    2e-11   
gb|ABN08841.1|  RNA-directed DNA polymerase (Reverse transcriptase)   72.0    2e-11   Medicago truncatula
ref|XP_008349700.1|  PREDICTED: uncharacterized protein LOC103412975  72.8    2e-11   
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...  72.8    2e-11   
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...  72.8    2e-11   
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331  72.8    2e-11   
ref|XP_010469706.1|  PREDICTED: uncharacterized protein LOC104749719  72.8    2e-11   
ref|XP_010236428.1|  PREDICTED: uncharacterized protein LOC104584030  72.0    2e-11   
ref|XP_009148761.1|  PREDICTED: uncharacterized protein LOC103872163  72.4    2e-11   
ref|XP_010473903.1|  PREDICTED: uncharacterized protein LOC104753332  72.4    3e-11   
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357  72.4    3e-11   
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...  72.4    3e-11   
gb|EEC70040.1|  hypothetical protein OsI_00627                        72.4    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010675126.1|  PREDICTED: uncharacterized protein LOC104891166  72.4    3e-11   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  72.0    3e-11   
gb|EEE51789.1|  hypothetical protein OsJ_33245                        72.0    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010418809.1|  PREDICTED: uncharacterized protein LOC104704411  72.0    3e-11   
emb|CAN61532.1|  hypothetical protein VITISV_017628                   72.0    3e-11   Vitis vinifera
ref|XP_008387110.1|  PREDICTED: uncharacterized protein LOC103449564  71.6    3e-11   
gb|EEC83100.1|  hypothetical protein OsI_28249                        72.0    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_007221149.1|  hypothetical protein PRUPE_ppa019822mg           69.7    3e-11   
gb|ABA91837.2|  retrotransposon protein, putative, unclassified       72.0    3e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein             72.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAX95129.1|  retrotransposon protein, putative, unclassified       72.0    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010431573.1|  PREDICTED: uncharacterized protein LOC104715904  72.0    3e-11   
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254  72.0    3e-11   
ref|XP_008345114.1|  PREDICTED: putative ribonuclease H protein A...  72.0    4e-11   
ref|XP_008367519.1|  PREDICTED: putative ribonuclease H protein A...  72.0    4e-11   
ref|XP_009113456.1|  PREDICTED: uncharacterized protein LOC103838755  72.0    4e-11   
emb|CAN72933.1|  hypothetical protein VITISV_020615                   71.6    4e-11   Vitis vinifera
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725  72.0    4e-11   
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431  72.0    4e-11   
gb|EEE68778.1|  hypothetical protein OsJ_27492                        72.0    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009123659.1|  PREDICTED: uncharacterized protein LOC103848514  71.6    4e-11   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695  72.0    4e-11   
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388  72.0    4e-11   
gb|AAD32950.1|  putative non-LTR retroelement reverse transcriptase   71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EEC72938.1|  hypothetical protein OsI_06800                        71.2    5e-11   Oryza sativa Indica Group [Indian rice]
emb|CAN82017.1|  hypothetical protein VITISV_003416                   70.9    5e-11   Vitis vinifera
emb|CAN61260.1|  hypothetical protein VITISV_043608                   71.6    5e-11   Vitis vinifera
ref|XP_009103531.1|  PREDICTED: uncharacterized protein LOC103829604  70.9    5e-11   
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698  71.6    5e-11   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           71.6    5e-11   
ref|XP_008346419.1|  PREDICTED: uncharacterized protein LOC103409384  71.2    5e-11   
emb|CAE04866.2|  OSJNBa0086O06.14                                     71.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61581.1|  hypothetical protein OsJ_15963                        71.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010424289.1|  PREDICTED: uncharacterized protein LOC104709359  71.2    6e-11   
ref|XP_010233096.1|  PREDICTED: uncharacterized protein LOC104583080  71.2    6e-11   
emb|CAN69053.1|  hypothetical protein VITISV_022963                   71.2    6e-11   Vitis vinifera
ref|XP_009138115.1|  PREDICTED: putative ribonuclease H protein A...  71.2    6e-11   
emb|CAE04660.2|  OSJNBa0061G20.16                                     71.2    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAF69169.1|AC007915_21  F27F5.21                                   71.2    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417186.1|  PREDICTED: uncharacterized protein LOC104702947  71.2    7e-11   
ref|XP_009125042.1|  PREDICTED: uncharacterized protein LOC103850087  70.9    7e-11   
ref|XP_009107553.1|  PREDICTED: uncharacterized protein LOC103833206  70.9    7e-11   
ref|XP_010667771.1|  PREDICTED: uncharacterized protein LOC104884775  70.9    7e-11   
ref|XP_009118154.1|  PREDICTED: putative ribonuclease H protein A...  70.5    8e-11   
ref|XP_010687189.1|  PREDICTED: uncharacterized protein LOC104901325  70.5    8e-11   
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873  70.9    8e-11   
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169  70.9    8e-11   
gb|EEE66599.1|  hypothetical protein OsJ_23164                        70.9    8e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83582.1|  hypothetical protein VITISV_001564                   70.9    8e-11   Vitis vinifera
ref|XP_009122881.1|  PREDICTED: putative ribonuclease H protein A...  70.9    8e-11   
ref|XP_010468816.1|  PREDICTED: uncharacterized protein LOC104748941  70.9    8e-11   
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg           70.9    9e-11   
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           70.5    9e-11   
ref|XP_010026542.1|  PREDICTED: uncharacterized protein LOC104416906  70.5    9e-11   
emb|CAN71912.1|  hypothetical protein VITISV_018965                   70.9    9e-11   Vitis vinifera
ref|XP_008373306.1|  PREDICTED: uncharacterized protein LOC103436642  70.5    1e-10   
emb|CAN67355.1|  hypothetical protein VITISV_002170                   70.9    1e-10   Vitis vinifera
gb|ABA97040.1|  retrotransposon protein, putative, unclassified       70.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191  70.9    1e-10   
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159  70.9    1e-10   
ref|XP_010513530.1|  PREDICTED: uncharacterized protein LOC104789549  70.5    1e-10   
emb|CAN70698.1|  hypothetical protein VITISV_029728                   70.5    1e-10   Vitis vinifera
ref|XP_010495271.1|  PREDICTED: uncharacterized protein LOC104772340  70.5    1e-10   
emb|CAN70374.1|  hypothetical protein VITISV_006751                   69.3    1e-10   Vitis vinifera
ref|XP_009111228.1|  PREDICTED: uncharacterized protein LOC103836687  70.5    1e-10   
gb|EEC75230.1|  hypothetical protein OsI_11503                        70.1    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010238942.1|  PREDICTED: uncharacterized protein LOC100831270  70.5    1e-10   
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608  70.5    1e-10   
gb|EEC83650.1|  hypothetical protein OsI_29398                        70.5    1e-10   Oryza sativa Indica Group [Indian rice]
gb|EEE59033.1|  hypothetical protein OsJ_10782                        70.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008338205.1|  PREDICTED: putative ribonuclease H protein A...  70.1    1e-10   
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...  70.1    1e-10   
gb|ABF95850.1|  retrotransposon protein, putative, unclassified       70.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009149305.1|  PREDICTED: putative ribonuclease H protein A...  70.1    1e-10   
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832  70.1    1e-10   
emb|CAN65248.1|  hypothetical protein VITISV_024218                   70.5    1e-10   Vitis vinifera
ref|XP_010678308.1|  PREDICTED: uncharacterized protein LOC104893877  69.7    1e-10   
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622  70.1    1e-10   
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184  70.1    1e-10   
emb|CAN79131.1|  hypothetical protein VITISV_034693                   69.7    1e-10   Vitis vinifera
dbj|BAF01759.1|  putative non-LTR retroelement reverse transcriptase  68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430664.1|  PREDICTED: uncharacterized protein LOC104714891  70.1    2e-10   
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...  70.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686886.1|  PREDICTED: uncharacterized protein LOC104901041  70.1    2e-10   
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605  70.1    2e-10   
ref|XP_010495217.1|  PREDICTED: uncharacterized protein LOC104772285  70.1    2e-10   
ref|XP_010419021.1|  PREDICTED: uncharacterized protein LOC104704671  70.1    2e-10   
ref|XP_009757737.1|  PREDICTED: uncharacterized protein LOC104210...  67.4    2e-10   
gb|AAL78659.1|AF405557_1  reverse transcriptase                       66.2    2e-10   Fagus sylvatica
ref|XP_010419407.1|  PREDICTED: uncharacterized protein LOC104705120  69.7    2e-10   
emb|CAN83601.1|  hypothetical protein VITISV_033095                   69.7    2e-10   Vitis vinifera
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378  69.7    2e-10   
emb|CAN72707.1|  hypothetical protein VITISV_043786                   69.7    2e-10   Vitis vinifera
ref|XP_010665123.1|  PREDICTED: transposon TX1 uncharacterized 14...  69.3    2e-10   
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579  69.7    2e-10   
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079  69.7    2e-10   
ref|XP_009757736.1|  PREDICTED: uncharacterized protein LOC104210...  67.0    2e-10   
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...  69.7    2e-10   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160  69.7    2e-10   
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249  69.7    2e-10   
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152  69.7    2e-10   
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884  69.7    2e-10   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342  69.7    2e-10   
ref|XP_010495329.1|  PREDICTED: uncharacterized protein LOC104772406  69.7    2e-10   
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964  69.7    2e-10   
ref|XP_010513760.1|  PREDICTED: uncharacterized protein LOC104789816  69.3    2e-10   
ref|XP_009776546.1|  PREDICTED: uncharacterized protein LOC104226294  65.9    2e-10   
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588  69.7    2e-10   
emb|CCA66054.1|  hypothetical protein                                 69.7    2e-10   
ref|XP_010039996.1|  PREDICTED: uncharacterized protein LOC104428743  69.7    2e-10   
ref|XP_008384443.1|  PREDICTED: uncharacterized protein LOC103447050  69.7    2e-10   
gb|EEC77887.1|  hypothetical protein OsI_17181                        69.3    2e-10   Oryza sativa Indica Group [Indian rice]
emb|CAN72456.1|  hypothetical protein VITISV_026051                   69.3    2e-10   Vitis vinifera
ref|XP_010419086.1|  PREDICTED: uncharacterized protein LOC104704751  69.3    2e-10   
ref|XP_010478572.1|  PREDICTED: uncharacterized protein LOC104757...  68.9    2e-10   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753  69.7    2e-10   
gb|AAD17398.1|  putative non-LTR retroelement reverse transcriptase   69.3    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478571.1|  PREDICTED: uncharacterized protein LOC104757...  68.9    3e-10   
ref|XP_010473596.1|  PREDICTED: uncharacterized protein LOC104753020  68.9    3e-10   
emb|CAN74183.1|  hypothetical protein VITISV_034261                   69.3    3e-10   Vitis vinifera
gb|AAV43830.1|  hypothetical protein                                  68.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70803.1|  hypothetical protein VITISV_044067                   69.3    3e-10   Vitis vinifera
gb|EEE52364.1|  hypothetical protein OsJ_34428                        69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010436509.1|  PREDICTED: uncharacterized protein LOC104720274  67.8    3e-10   
ref|XP_010684899.1|  PREDICTED: uncharacterized protein LOC104899410  69.3    3e-10   
emb|CAN72557.1|  hypothetical protein VITISV_013403                   69.3    3e-10   Vitis vinifera
emb|CAN78577.1|  hypothetical protein VITISV_020585                   69.3    3e-10   Vitis vinifera
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345  69.3    3e-10   
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568  69.3    3e-10   
ref|XP_010669873.1|  PREDICTED: uncharacterized protein LOC104886993  69.3    3e-10   
emb|CAN62252.1|  hypothetical protein VITISV_027357                   68.6    3e-10   Vitis vinifera
ref|XP_009121250.1|  PREDICTED: uncharacterized protein LOC103846083  68.9    3e-10   
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.3    3e-10   
ref|XP_010468391.1|  PREDICTED: uncharacterized protein LOC104748447  68.9    3e-10   
ref|XP_009101684.1|  PREDICTED: uncharacterized protein LOC103827880  68.9    3e-10   
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase   68.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502011.1|  PREDICTED: uncharacterized protein LOC104779357  68.9    4e-10   
ref|XP_008375282.1|  PREDICTED: uncharacterized protein LOC103438524  67.8    4e-10   
emb|CAN80785.1|  hypothetical protein VITISV_022938                   67.8    4e-10   Vitis vinifera
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030  68.9    4e-10   
emb|CAN83054.1|  hypothetical protein VITISV_027927                   68.9    4e-10   Vitis vinifera
ref|XP_010436427.1|  PREDICTED: uncharacterized protein LOC104720173  67.8    4e-10   
ref|XP_009762742.1|  PREDICTED: uncharacterized protein LOC104214731  66.2    4e-10   
ref|XP_010481232.1|  PREDICTED: uncharacterized protein LOC104760080  68.2    4e-10   
emb|CAN67183.1|  hypothetical protein VITISV_007528                   68.9    4e-10   Vitis vinifera
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017  68.6    4e-10   
ref|XP_008368534.1|  PREDICTED: putative ribonuclease H protein A...  67.8    4e-10   
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...  68.6    4e-10   
ref|XP_002450843.1|  hypothetical protein SORBIDRAFT_05g019526        68.6    4e-10   Sorghum bicolor [broomcorn]
emb|CAN77052.1|  hypothetical protein VITISV_002154                   68.9    4e-10   Vitis vinifera
emb|CAN69917.1|  hypothetical protein VITISV_044429                   68.2    4e-10   Vitis vinifera
gb|AAS55787.1|  hypothetical protein                                  68.6    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378  68.6    5e-10   
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184  68.6    5e-10   
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404  68.6    5e-10   
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890  68.6    5e-10   
ref|XP_010677018.1|  PREDICTED: uncharacterized protein LOC104892729  68.6    5e-10   
emb|CAN60474.1|  hypothetical protein VITISV_028414                   68.2    5e-10   Vitis vinifera
emb|CAN77360.1|  hypothetical protein VITISV_011015                   68.6    5e-10   Vitis vinifera
ref|XP_009113015.1|  PREDICTED: putative ribonuclease H protein A...  68.2    5e-10   
ref|XP_010683403.1|  PREDICTED: uncharacterized protein LOC104898091  68.2    5e-10   
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940  68.6    5e-10   
emb|CAN72139.1|  hypothetical protein VITISV_017106                   68.6    5e-10   Vitis vinifera
emb|CAN60595.1|  hypothetical protein VITISV_015221                   68.2    5e-10   
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296  68.6    6e-10   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932  68.6    6e-10   
ref|XP_010674612.1|  PREDICTED: uncharacterized protein LOC104890735  68.6    6e-10   
emb|CAN64222.1|  hypothetical protein VITISV_037395                   68.2    6e-10   
ref|XP_008364539.1|  PREDICTED: putative ribonuclease H protein A...  67.8    6e-10   
emb|CAN79293.1|  hypothetical protein VITISV_001048                   67.4    6e-10   
emb|CAN79574.1|  hypothetical protein VITISV_017342                   68.2    6e-10   
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...  67.8    6e-10   
ref|XP_008385035.1|  PREDICTED: putative ribonuclease H protein A...  68.2    6e-10   
ref|XP_010425346.1|  PREDICTED: uncharacterized protein LOC104710431  67.4    6e-10   
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...  68.2    7e-10   
ref|XP_010468192.1|  PREDICTED: uncharacterized protein LOC104748214  67.8    7e-10   
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948  68.2    7e-10   
ref|XP_010674016.1|  PREDICTED: uncharacterized protein LOC104890294  67.8    7e-10   
emb|CAN76892.1|  hypothetical protein VITISV_005356                   68.2    7e-10   
ref|XP_010446022.1|  PREDICTED: uncharacterized protein LOC104728786  68.2    7e-10   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg           67.8    7e-10   
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048  67.8    7e-10   
emb|CAN80388.1|  hypothetical protein VITISV_000106                   67.8    7e-10   
ref|XP_010468796.1|  PREDICTED: uncharacterized protein LOC104748915  67.8    8e-10   
emb|CAN62052.1|  hypothetical protein VITISV_016642                   67.8    8e-10   
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...  67.8    8e-10   
ref|XP_010694891.1|  PREDICTED: uncharacterized protein LOC104907631  67.8    8e-10   
ref|XP_010644016.1|  PREDICTED: uncharacterized protein LOC104877459  67.8    8e-10   
ref|XP_010468814.1|  PREDICTED: uncharacterized protein LOC104748940  67.8    8e-10   
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882  67.8    8e-10   
ref|XP_009108635.1|  PREDICTED: putative ribonuclease H protein A...  67.4    8e-10   
emb|CAN60433.1|  hypothetical protein VITISV_020389                   67.8    8e-10   
emb|CCA66050.1|  hypothetical protein                                 67.8    8e-10   
ref|XP_009139326.1|  PREDICTED: uncharacterized protein LOC103863321  67.8    8e-10   
ref|XP_010478574.1|  PREDICTED: uncharacterized protein LOC104757...  67.0    8e-10   
emb|CAN77820.1|  hypothetical protein VITISV_043441                   67.8    8e-10   
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...  67.8    9e-10   
gb|EEE54811.1|  hypothetical protein OsJ_02230                        67.8    9e-10   
emb|CAN68113.1|  hypothetical protein VITISV_023356                   67.8    9e-10   
gb|EAZ03196.1|  hypothetical protein OsI_25347                        67.4    9e-10   
ref|XP_007219413.1|  hypothetical protein PRUPE_ppa021914mg           66.6    9e-10   
ref|XP_010513742.1|  PREDICTED: uncharacterized protein LOC104789794  67.8    9e-10   
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187  67.8    9e-10   
ref|XP_008382176.1|  PREDICTED: uncharacterized protein LOC103444987  65.5    9e-10   
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...  67.4    9e-10   
gb|EEC70889.1|  hypothetical protein OsI_02427                        67.8    9e-10   
ref|XP_010692445.1|  PREDICTED: uncharacterized protein LOC104905555  67.8    9e-10   
emb|CAN74354.1|  hypothetical protein VITISV_012842                   67.8    9e-10   
ref|XP_009139334.1|  PREDICTED: putative ribonuclease H protein A...  67.4    9e-10   
ref|XP_010495286.1|  PREDICTED: uncharacterized protein LOC104772356  67.8    9e-10   
ref|XP_010480729.1|  PREDICTED: uncharacterized protein LOC104759515  67.8    9e-10   
ref|XP_010696021.1|  PREDICTED: uncharacterized protein LOC104908596  67.4    9e-10   
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536  67.4    9e-10   
ref|XP_004305133.1|  PREDICTED: putative ribonuclease H protein A...  67.0    9e-10   
gb|EAZ20803.1|  hypothetical protein OsJ_36426                        67.4    1e-09   
ref|XP_009349611.1|  PREDICTED: uncharacterized protein LOC103941142  67.8    1e-09   
ref|XP_010681977.1|  PREDICTED: uncharacterized protein LOC104896888  67.4    1e-09   
ref|XP_010507233.1|  PREDICTED: uncharacterized protein LOC104783828  67.4    1e-09   
gb|ABA98898.1|  retrotransposon protein, putative, unclassified       67.4    1e-09   
ref|XP_007219602.1|  hypothetical protein PRUPE_ppa023113mg           67.4    1e-09   
ref|XP_004295829.1|  PREDICTED: uncharacterized protein LOC101302635  67.4    1e-09   
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258  67.4    1e-09   
emb|CAN77369.1|  hypothetical protein VITISV_033118                   67.4    1e-09   
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359  67.4    1e-09   
emb|CAN82456.1|  hypothetical protein VITISV_010028                   67.8    1e-09   
emb|CAN69965.1|  hypothetical protein VITISV_039410                   67.0    1e-09   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671  67.4    1e-09   
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360  67.4    1e-09   
ref|XP_008356403.1|  PREDICTED: uncharacterized protein LOC103420114  67.4    1e-09   
ref|XP_010495406.1|  PREDICTED: uncharacterized protein LOC104772500  67.4    1e-09   
emb|CAN75888.1|  hypothetical protein VITISV_023640                   67.4    1e-09   
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...  67.0    1e-09   
emb|CAN76026.1|  hypothetical protein VITISV_027817                   67.4    1e-09   
emb|CAN82440.1|  hypothetical protein VITISV_006122                   67.4    1e-09   
ref|XP_008348735.1|  PREDICTED: uncharacterized protein LOC103411900  67.0    1e-09   
gb|EEE52912.1|  hypothetical protein OsJ_35521                        67.0    1e-09   
gb|ABA96650.1|  retrotransposon protein, putative, unclassified       67.0    1e-09   
ref|XP_010686132.1|  PREDICTED: uncharacterized protein LOC104900412  67.0    1e-09   
ref|XP_010679283.1|  PREDICTED: uncharacterized protein LOC104894690  67.4    1e-09   
emb|CAN68550.1|  hypothetical protein VITISV_027787                   67.0    1e-09   
emb|CAN79792.1|  hypothetical protein VITISV_021866                   66.6    1e-09   
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004  67.0    1e-09   
ref|XP_007216189.1|  hypothetical protein PRUPE_ppa015905mg           67.0    1e-09   
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743  67.0    1e-09   
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422  67.0    1e-09   
gb|AAD15377.1|  putative non-LTR retroelement reverse transcriptase   67.0    1e-09   
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...  67.0    1e-09   
emb|CAN66833.1|  hypothetical protein VITISV_030891                   67.0    1e-09   
emb|CAN65298.1|  hypothetical protein VITISV_008130                   67.0    1e-09   
ref|XP_010451785.1|  PREDICTED: uncharacterized protein LOC104733961  67.0    1e-09   
gb|ABB46931.2|  retrotransposon protein, putative, unclassified       67.0    2e-09   
gb|AAM01179.2|AC113336_31  Putative retroelement                      67.0    2e-09   
emb|CAN67208.1|  hypothetical protein VITISV_002056                   66.6    2e-09   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  67.0    2e-09   
gb|EEE53388.1|  hypothetical protein OsJ_36435                        66.6    2e-09   
ref|XP_009590870.1|  PREDICTED: uncharacterized protein LOC104087975  63.5    2e-09   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714  66.6    2e-09   
ref|XP_010681708.1|  PREDICTED: uncharacterized protein LOC104896636  66.6    2e-09   
ref|XP_010513001.1|  PREDICTED: uncharacterized protein LOC104788939  67.0    2e-09   
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955  66.6    2e-09   
ref|XP_010694673.1|  PREDICTED: uncharacterized protein LOC104907438  66.6    2e-09   
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...  66.6    2e-09   
ref|XP_009107566.1|  PREDICTED: uncharacterized protein LOC103833219  66.6    2e-09   
ref|XP_008351105.1|  PREDICTED: uncharacterized protein LOC103414509  66.6    2e-09   
emb|CAN69474.1|  hypothetical protein VITISV_014375                   66.6    2e-09   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768  66.6    2e-09   
emb|CAN76571.1|  hypothetical protein VITISV_030217                   66.2    2e-09   
ref|XP_009110618.1|  PREDICTED: uncharacterized protein LOC103836135  66.2    2e-09   
emb|CCA66044.1|  hypothetical protein                                 66.6    2e-09   
ref|XP_009759435.1|  PREDICTED: uncharacterized protein LOC104211974  64.7    2e-09   
emb|CAN70538.1|  hypothetical protein VITISV_040070                   66.6    2e-09   
ref|XP_008390254.1|  PREDICTED: putative ribonuclease H protein A...  66.2    2e-09   
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925  66.6    2e-09   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.6    2e-09   
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638  66.6    2e-09   
ref|XP_004306191.1|  PREDICTED: putative ribonuclease H protein A...  66.2    2e-09   
emb|CAN68584.1|  hypothetical protein VITISV_043904                   66.6    2e-09   
emb|CAN77480.1|  hypothetical protein VITISV_021632                   66.6    2e-09   
ref|XP_009363712.1|  PREDICTED: uncharacterized protein LOC103953670  66.2    2e-09   
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949  66.2    2e-09   
ref|XP_010451645.1|  PREDICTED: uncharacterized protein LOC104733795  66.2    2e-09   
ref|XP_010695270.1|  PREDICTED: uncharacterized protein LOC104907939  66.6    2e-09   
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164  66.2    2e-09   
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094  66.2    2e-09   
ref|XP_010645162.1|  PREDICTED: uncharacterized protein LOC104877807  66.6    2e-09   
ref|XP_009124790.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.6    2e-09   
ref|XP_010480636.1|  PREDICTED: uncharacterized protein LOC104759401  66.2    2e-09   
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg           66.2    2e-09   
emb|CAN76071.1|  hypothetical protein VITISV_004551                   66.2    2e-09   
ref|XP_010692745.1|  PREDICTED: uncharacterized protein LOC104905807  66.2    2e-09   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...  66.2    2e-09   
ref|XP_008359713.1|  PREDICTED: uncharacterized protein LOC103423419  65.1    2e-09   
emb|CAN74986.1|  hypothetical protein VITISV_008771                   66.2    2e-09   
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509  66.2    2e-09   
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929  66.2    3e-09   
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254  66.2    3e-09   
ref|XP_009587735.1|  PREDICTED: uncharacterized protein LOC104085422  64.7    3e-09   
ref|XP_009145278.1|  PREDICTED: uncharacterized protein LOC103868985  66.2    3e-09   
gb|EEC80620.1|  hypothetical protein OsI_22990                        65.5    3e-09   
emb|CAN80960.1|  hypothetical protein VITISV_014609                   65.9    3e-09   
emb|CAN68609.1|  hypothetical protein VITISV_012924                   66.2    3e-09   
emb|CAN75529.1|  hypothetical protein VITISV_043602                   64.7    3e-09   
ref|XP_009115728.1|  PREDICTED: uncharacterized protein LOC103840963  65.9    3e-09   
ref|XP_006353602.1|  PREDICTED: putative ribonuclease H protein A...  65.5    3e-09   
emb|CAN82300.1|  hypothetical protein VITISV_036567                   65.5    3e-09   
gb|EEC79647.1|  hypothetical protein OsI_20882                        66.2    3e-09   
ref|XP_010424608.1|  PREDICTED: uncharacterized protein LOC104709742  65.9    3e-09   
ref|XP_010687204.1|  PREDICTED: uncharacterized protein LOC104901340  66.2    3e-09   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455  66.2    3e-09   
ref|XP_009142123.1|  PREDICTED: putative ribonuclease H protein A...  65.9    3e-09   
emb|CAN77417.1|  hypothetical protein VITISV_000477                   65.1    3e-09   
emb|CAN82037.1|  hypothetical protein VITISV_033902                   65.9    3e-09   
emb|CAN77850.1|  hypothetical protein VITISV_020834                   66.2    3e-09   
ref|XP_010490312.1|  PREDICTED: uncharacterized protein LOC104768075  65.9    3e-09   
ref|XP_010667631.1|  PREDICTED: uncharacterized protein LOC104884643  65.9    3e-09   
ref|XP_007224290.1|  hypothetical protein PRUPE_ppa020085mg           65.9    3e-09   
ref|XP_007202950.1|  hypothetical protein PRUPE_ppa016504mg           65.9    3e-09   
ref|XP_010446251.1|  PREDICTED: uncharacterized protein LOC104729051  65.9    3e-09   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...  65.9    4e-09   
emb|CAN83807.1|  hypothetical protein VITISV_026962                   65.5    4e-09   
ref|XP_010501997.1|  PREDICTED: uncharacterized protein LOC104779341  65.1    4e-09   
ref|XP_004301203.1|  PREDICTED: uncharacterized protein LOC101302660  65.5    4e-09   
emb|CAN77614.1|  hypothetical protein VITISV_035196                   65.9    4e-09   
ref|XP_010472251.1|  PREDICTED: uncharacterized protein LOC104751896  65.9    4e-09   
ref|NP_001064277.2|  Os10g0191000                                     65.1    4e-09   
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...  65.5    4e-09   
emb|CAN61231.1|  hypothetical protein VITISV_041719                   65.5    4e-09   
gb|ABA98911.1|  retrotransposon protein, putative, unclassified, ...  65.5    4e-09   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             65.5    4e-09   
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034  65.9    4e-09   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  65.5    4e-09   
emb|CAN77166.1|  hypothetical protein VITISV_029835                   65.9    4e-09   
ref|XP_010667214.1|  PREDICTED: uncharacterized protein LOC104884289  65.5    4e-09   
gb|EEC68711.1|  hypothetical protein OsI_37193                        65.9    4e-09   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385  65.9    4e-09   
ref|XP_010671909.1|  PREDICTED: uncharacterized protein LOC104888584  65.9    4e-09   
pir||S65812  RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW1...  65.5    4e-09
ref|XP_007206246.1|  hypothetical protein PRUPE_ppa015607mg           65.5    4e-09   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743  65.5    4e-09   
ref|XP_010674286.1|  PREDICTED: uncharacterized protein LOC104890473  65.5    4e-09   
ref|XP_008355518.1|  PREDICTED: putative ribonuclease H protein A...  65.5    4e-09   
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940  65.5    4e-09   
ref|XP_010695571.1|  PREDICTED: uncharacterized protein LOC104908184  65.5    4e-09   
gb|AAP12989.1|  putative reverse transcriptase                        65.5    4e-09   
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764  65.5    4e-09   
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...  65.5    4e-09   
ref|XP_010419203.1|  PREDICTED: uncharacterized protein LOC104704888  65.5    4e-09   
emb|CAN70866.1|  hypothetical protein VITISV_027609                   65.5    4e-09   
ref|XP_009118503.1|  PREDICTED: uncharacterized protein LOC103843513  65.5    4e-09   
emb|CAN70290.1|  hypothetical protein VITISV_019345                   65.5    4e-09   
emb|CAN76562.1|  hypothetical protein VITISV_010091                   65.5    4e-09   
emb|CAN60637.1|  hypothetical protein VITISV_022223                   65.5    5e-09   
ref|XP_007207581.1|  hypothetical protein PRUPE_ppa018489mg           65.5    5e-09   
gb|AAM93462.1|  putative reverse transcriptase                        65.1    5e-09   
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...  65.1    5e-09   
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902  65.1    5e-09   
emb|CAN73960.1|  hypothetical protein VITISV_023007                   65.1    5e-09   
ref|XP_008348379.1|  PREDICTED: uncharacterized protein LOC103411530  64.3    5e-09   
ref|XP_009119800.1|  PREDICTED: putative ribonuclease H protein A...  65.1    5e-09   
ref|XP_010672380.1|  PREDICTED: uncharacterized protein LOC104888963  63.9    6e-09   
ref|XP_008385416.1|  PREDICTED: putative ribonuclease H protein A...  65.1    6e-09   
emb|CAN70195.1|  hypothetical protein VITISV_001356                   65.1    6e-09   
ref|XP_010518602.1|  PREDICTED: uncharacterized protein LOC104793875  64.3    6e-09   
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526  65.1    6e-09   
ref|XP_009148188.1|  PREDICTED: uncharacterized protein LOC103871664  64.7    6e-09   
ref|XP_010681283.1|  PREDICTED: uncharacterized protein LOC104896266  65.1    6e-09   
ref|XP_010692615.1|  PREDICTED: uncharacterized protein LOC104905704  65.1    6e-09   
emb|CAN70399.1|  hypothetical protein VITISV_023214                   64.7    6e-09   
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473  65.1    6e-09   
emb|CAN60022.1|  hypothetical protein VITISV_007671                   65.1    7e-09   
emb|CAN72914.1|  hypothetical protein VITISV_034007                   65.1    7e-09   
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337  65.1    7e-09   
ref|XP_007212580.1|  hypothetical protein PRUPE_ppa015871mg           65.1    7e-09   
ref|XP_007210994.1|  hypothetical protein PRUPE_ppa021032mg           64.7    7e-09   
gb|EEC75227.1|  hypothetical protein OsI_11496                        64.7    7e-09   
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493  65.1    7e-09   
ref|XP_008340956.1|  PREDICTED: uncharacterized protein LOC103403885  64.7    7e-09   
ref|XP_007206948.1|  hypothetical protein PRUPE_ppb018012mg           63.5    7e-09   
gb|EPS72636.1|  hypothetical protein M569_02121                       65.1    7e-09   
ref|XP_008340329.1|  PREDICTED: uncharacterized protein LOC103403287  62.8    7e-09   
ref|XP_010682478.1|  PREDICTED: uncharacterized protein LOC104897316  64.7    7e-09   
ref|XP_007212886.1|  hypothetical protein PRUPE_ppa021750mg           64.7    7e-09   
ref|NP_001175161.1|  Os07g0417700                                     64.7    8e-09   
emb|CAN60702.1|  hypothetical protein VITISV_015869                   65.1    8e-09   



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVSTVTY + + GE    F P RG+RQGD LSPYLFLL  +GFS++L 
Sbjct  853  GFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPGRGLRQGDPLSPYLFLLCAEGFSALLS  912

Query  377  RREEIGGIHAIRI  339
            + EE G +H IRI
Sbjct  913  KTEEEGRLHGIRI  925



>gb|AAP53315.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1505

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVSTVTY + + GE    F P RG+RQGD LSPYLFLL  +GFS++L 
Sbjct  794  GFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQGDPLSPYLFLLCAEGFSALLS  853

Query  377  RREEIGGIHAIRI  339
            + EE G +H IRI
Sbjct  854  KTEEEGRLHGIRI  866



>gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1509

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVSTVTY + + GE    F P RG+RQGD LSPYLFLL  +GFS++L 
Sbjct  798  GFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQGDPLSPYLFLLCAEGFSALLS  857

Query  377  RREEIGGIHAIRI  339
            + EE G +H IRI
Sbjct  858  KTEEEGRLHGIRI  870



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVSTVTY + + GE    F P RG+RQGD LSPYLFLL  +GFS++L 
Sbjct  826  GFHTDWVNLIMKCVSTVTYRIRVNGELSESFSPERGLRQGDPLSPYLFLLCAEGFSALLS  885

Query  377  RREEIGGIHAIRI  339
            + EE G +H IRI
Sbjct  886  KTEEEGRLHGIRI  898



>ref|XP_007210131.1| hypothetical protein PRUPE_ppa022959mg, partial [Prunus persica]
 gb|EMJ11330.1| hypothetical protein PRUPE_ppa022959mg, partial [Prunus persica]
Length=196

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CV++V+Y VL +G+    F P RG+RQGD LSP+LFLL  KGFSSIL+
Sbjct  106  GFAPWWVTLIMKCVTSVSYSVLWKGQSSTIFKPQRGLRQGDPLSPFLFLLSTKGFSSILK  165

Query  377  RREEIGGIHAIRIA  336
            + E  G I  + +A
Sbjct  166  QAETHGAICGVSVA  179



>gb|EEC71228.1| hypothetical protein OsI_03168 [Oryza sativa Indica Group]
Length=995

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS ++ CV++V Y V + GE  R  IP RGIRQGD +SPYLFLL ++G S +L+
Sbjct  336  GFAPAWVSSVMRCVTSVRYAVRINGELTRPVIPSRGIRQGDPVSPYLFLLCIEGLSYLLQ  395

Query  377  RREEIGGIHAIR  342
            R+E +G +H IR
Sbjct  396  RKESLGLLHGIR  407



>gb|EEE55133.1| hypothetical protein OsJ_02920 [Oryza sativa Japonica Group]
Length=1049

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS ++ CV++V Y V + GE  R  IP RGIRQGD +SPYLFLL  +G S +L+
Sbjct  336  GFAPAWVSSVMRCVTSVRYAVRINGELTRLVIPSRGIRQGDPVSPYLFLLCTEGLSCLLQ  395

Query  377  RREEIGGIHAIR  342
            R+E +G +H IR
Sbjct  396  RKESLGLLHGIR  407



>ref|XP_008245614.1| PREDICTED: uncharacterized protein LOC103343753 [Prunus mume]
Length=333

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = -1

Query  557  GFG---CHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            GFG   CHW   I+ C+STVTY V++ GE   H +P RG+RQGD LSP+LFL+  +G ++
Sbjct  161  GFGETLCHW---IMECISTVTYSVMINGEATSHIVPSRGLRQGDPLSPFLFLICAEGLTA  217

Query  386  ILRRREEIGGIHAIRI  339
            +LR+ EE   IH  +I
Sbjct  218  LLRKYEEDRLIHGFQI  233



>ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria 
italica]
Length=950

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVSLIL C+STVTY V + G       P RG+RQGD LSPYLFLL  +GFSS+L 
Sbjct  172  GFSRRWVSLILCCISTVTYRVKVNGVLTEEIKPTRGLRQGDPLSPYLFLLCAEGFSSMLN  231

Query  377  RREEIGGIHAIRI  339
              EE G +  I I
Sbjct  232  VAEEAGRLQGISI  244



>gb|EEC84982.1| hypothetical protein OsI_32248 [Oryza sativa Indica Group]
 gb|EEE62926.1| hypothetical protein OsJ_17731 [Oryza sativa Japonica Group]
Length=893

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV LI+ CVSTVTY + + G+     IP RG+RQGD +SPYLFL+  +GFSS+L 
Sbjct  272  GFAEGWVKLIMRCVSTVTYRIKVNGDLTDQIIPSRGLRQGDPISPYLFLICAEGFSSLLY  331

Query  377  RREEIGGIHAIRI  339
              EE G +  +++
Sbjct  332  AAEERGDLSGVKV  344



>ref|XP_004310201.1| PREDICTED: uncharacterized protein LOC101298860 [Fragaria vesca 
subsp. vesca]
Length=1164

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  ++ C+ TV+Y  +L GE + +  P RG+RQGDS+SPYLFLL  KG S +L 
Sbjct  557  GFHGVWIGWVMRCIKTVSYSFILNGEPRGNHTPTRGLRQGDSISPYLFLLCAKGLSRMLT  616

Query  377  RREEIGGIHAIRIA  336
              E  GGIH + IA
Sbjct  617  YAEMRGGIHGVSIA  630



>ref|XP_010054717.1| PREDICTED: uncharacterized protein LOC104443052 [Eucalyptus grandis]
Length=916

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV L++ CV+T+TY V   GE+  +F P +G+RQGD LSPYLF++V    SS+++
Sbjct  178  GFDEKWVKLVMQCVTTITYSVKFNGEQLPYFQPSKGLRQGDPLSPYLFIIVANVLSSLMK  237

Query  377  RREEIGGIHAIRI  339
            + EE G I  I++
Sbjct  238  QAEENGTIKGIKL  250



>gb|EEE67582.1| hypothetical protein OsJ_25113 [Oryza sativa Japonica Group]
Length=915

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W  LI+ C+++V+Y + + GE    F+P RG+ QGD LSPYLFLL  +GFS++L 
Sbjct  809  GFNQVWTQLIMKCITSVSYKIRVNGELTEEFLPGRGLHQGDPLSPYLFLLCAEGFSALLS  868

Query  377  RREEIGGIHAIR  342
            + EE G I  +R
Sbjct  869  QAEEEGLIQGVR  880



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV +++ CV+TV+Y  L+ GE  R   P RG+RQGD LSPYLFLL  +GF+++L 
Sbjct  561  GFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQGDPLSPYLFLLCAEGFTTLLS  620

Query  377  RREEIGGIHAIRI  339
            + E  G +  I I
Sbjct  621  KAERQGQLQGIVI  633



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WV +++ CV+TV+Y  L+ GE  R   P RG+RQGD LSPYLFLL  +GF+++L 
Sbjct  1015  GFPILWVRMVMDCVTTVSYSFLVNGEPTRILYPTRGLRQGDPLSPYLFLLCAEGFTTLLS  1074

Query  377   RREEIGGIHAIRI  339
             + E  G +  I I
Sbjct  1075  KAERQGQLQGIVI  1087



>emb|CAE01608.2| OSJNBa0052O21.12 [Oryza sativa Japonica Group]
Length=427

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  ++ CV++V Y V + GE      P RG+RQGD +SPYLFLL  +G SSIL+
Sbjct  21   GFADPWIQTVMRCVTSVRYAVRINGELTNPVTPSRGLRQGDPISPYLFLLCTEGLSSILQ  80

Query  377  RREEIGGIHAIR  342
            ++E +G I  IR
Sbjct  81   KKESMGVIQGIR  92



>ref|XP_009115737.1| PREDICTED: uncharacterized protein LOC103840975 [Brassica rapa]
Length=863

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I  C+S+VTY +L+ GE K H  P RGIRQGD LSP+LF+++ +   S ++
Sbjct  97   GFSAQWVSWIYFCLSSVTYQILINGEAKGHIAPSRGIRQGDPLSPFLFIILTEALISQIQ  156

Query  377  RREEIGGIHAIRIA  336
              E  G I  ++IA
Sbjct  157  GAEREGRITGLKIA  170



>ref|XP_009103405.1| PREDICTED: uncharacterized protein LOC103829494 [Brassica rapa]
Length=704

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  ++V  I++CV++VTY VL+ GEEK    P RG+RQGD LSP+LF L  +G S +L 
Sbjct  97   GFEKNFVDWIMYCVTSVTYSVLINGEEKGSITPKRGLRQGDPLSPFLFDLCTEGLSHLLN  156

Query  377  RREEIGGIHAIRIA  336
            + E IG I  I+ +
Sbjct  157  KAESIGAIEGIKFS  170



>ref|XP_008233458.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=811

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  +W+ LI+ CVSTV++ V++ G+  R F P RG+RQGD LSPYLFLLV +  S  L 
Sbjct  21   GFARNWIQLIMDCVSTVSFSVIVNGKPGRFFKPSRGLRQGDPLSPYLFLLVSEALSMNLT  80

Query  377  RREEIGGIHAIRIA  336
            +    G I  ++IA
Sbjct  81   KAVARGNIMGVKIA  94



>gb|EAZ29765.1| hypothetical protein OsJ_13823 [Oryza sativa Japonica Group]
Length=490

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  ++ CV++V Y V + GE      P RG+RQGD +SPYLFLL  +G SSIL+
Sbjct  84   GFADPWIQTVMRCVTSVRYAVRINGELTNPVTPSRGLRQGDPISPYLFLLCTEGLSSILQ  143

Query  377  RREEIGGIHAIR  342
            ++E +G I  IR
Sbjct  144  KKESMGVIQGIR  155



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  ++ C+S+VTY   L G  + H IP RG+RQGD LSPYLFLL  + FS++L 
Sbjct  574  GFCVDWVRRVMECLSSVTYAFKLNGRVEGHIIPSRGLRQGDPLSPYLFLLCAEAFSALLS  633

Query  377  RREEIGGIHAIRI  339
            +  + G IH  R+
Sbjct  634  KAADDGRIHGARV  646



>ref|XP_009108660.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=655

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LI+ C+S+VTY +L+ G  +   IP RGIRQGD LSPY+F+L  +  S +  
Sbjct  27   GFHHLWIGLIMQCISSVTYSLLINGSPRGKVIPSRGIRQGDPLSPYIFILCSEVLSGLCN  86

Query  377  RREEIGGIHAIRIA  336
            + +E G I  IR+A
Sbjct  87   KAQEEGRIQGIRVA  100



>gb|EEE64617.1| hypothetical protein OsJ_19469 [Oryza sativa Japonica Group]
Length=294

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I+ CV++V Y V L G     F P RG+RQGD LSPYLFL +  G S IL 
Sbjct  213  GFGDVWRKWIMACVTSVRYSVRLNGNMTEPFCPTRGLRQGDPLSPYLFLFIADGLSKILE  272

Query  377  RREEIGGIHAIRIALAV  327
            RR+  G I  +++  A 
Sbjct  273  RRKVEGLIQPLKVCRAA  289



>gb|EEE66057.1| hypothetical protein OsJ_22054 [Oryza sativa Japonica Group]
Length=940

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  ++ CV++V Y V + GE      P RG+RQGD +SPYLFLL  +G SSIL+
Sbjct  227  GFADPWIQTVMRCVTSVRYAVRINGELTYPVTPSRGLRQGDPISPYLFLLCTEGLSSILQ  286

Query  377  RREEIGGIHAIR  342
            ++E +G I  IR
Sbjct  287  KKESMGVIQGIR  298



>ref|XP_010689466.1| PREDICTED: uncharacterized protein LOC104903167 [Beta vulgaris 
subsp. vulgaris]
Length=346

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  WV+L+++CV+T+TY  ++         P RG+RQGD LSP+LF+LV   FS +L+
Sbjct  145  GFGGRWVNLVMNCVTTMTYSFVINRRVCGSVTPSRGLRQGDPLSPFLFILVADAFSQMLQ  204

Query  377  RREEIGGIHAIRIAL  333
            ++ +IG IH  +  L
Sbjct  205  QKVDIGEIHGAKANL  219



>gb|EEC79287.1| hypothetical protein OsI_20089 [Oryza sativa Indica Group]
Length=892

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+L++ CV++VTY + + GE      P RG+RQGD LSPYLF++  +G S++L+
Sbjct  680  GFHDQWVNLVMKCVTSVTYRIKINGEHSDQIYPQRGLRQGDPLSPYLFIICAEGLSALLQ  739

Query  377  RREEIGGIHAIRI  339
            + +  G I  I++
Sbjct  740  KAQADGKIEGIKV  752



>ref|XP_002468588.1| hypothetical protein SORBIDRAFT_01g048580 [Sorghum bicolor]
 gb|EER95586.1| hypothetical protein SORBIDRAFT_01g048580 [Sorghum bicolor]
Length=517

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LI+ CV+TV+Y + + GE     +P RG RQGD LSPYLF+L  +G S++L+
Sbjct  21   GFHDKWIHLIMKCVTTVSYRINVNGEYTDQIVPKRGSRQGDPLSPYLFILCAEGLSAMLQ  80

Query  377  RREEIGGIHAIRI  339
              E  G I  I+I
Sbjct  81   SAENAGKIEGIKI  93



>ref|XP_009149621.1| PREDICTED: uncharacterized protein LOC103872937 [Brassica rapa]
Length=884

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I  CVS+V+Y +LL GE K +  P RG+RQGD LS +LF+L+ K   S LR
Sbjct  376  GFAEAWVSWIRWCVSSVSYQILLNGEPKGNIQPSRGLRQGDPLSSFLFILLTKALISQLR  435

Query  377  RREEIGGIHAIRIALA  330
              EE G I  ++IA A
Sbjct  436  GAEEEGRITGLKIARA  451



>gb|EEC76774.1| hypothetical protein OsI_14862 [Oryza sativa Indica Group]
Length=1860

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   W+  ++ CV++V Y V + GE      P RG+RQGD +SPYLFLL  +G SSIL+
Sbjct  1371  GFADPWIQTVMRCVTSVRYAVRINGELTNPVTPSRGLRQGDPISPYLFLLCTEGLSSILQ  1430

Query  377   RREEIGGIHAIR  342
             ++E +G I  IR
Sbjct  1431  KKESMGVIQGIR  1442



>ref|XP_007207799.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica]
 gb|EMJ08998.1| hypothetical protein PRUPE_ppa024472mg, partial [Prunus persica]
Length=920

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HWV LI+ CVS+V+Y VL+ G+    F P RG+RQGD LSPYLFLLV   FS  L 
Sbjct  178  GFCDHWVRLIMACVSSVSYSVLINGKPGPTFRPSRGLRQGDPLSPYLFLLVSDVFSKNLS  237

Query  377  RREEIGGIHAIRIA  336
            +    G I  I++A
Sbjct  238  KCISGGWIKGIKMA  251



>gb|AAT58873.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1264

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WV+L++ CV++VTY + + GE      P RG+RQGD LSPYLF++  +G S++L+
Sbjct  945   GFHDQWVNLVMKCVTSVTYRIKINGEHSDQIYPQRGLRQGDPLSPYLFIICAEGLSALLQ  1004

Query  377   RREEIGGIHAIRI  339
             + +  G I  I++
Sbjct  1005  KAQADGKIEGIKV  1017



>ref|XP_010512944.1| PREDICTED: uncharacterized protein LOC104788863 [Camelina sativa]
Length=876

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+SL++ CVS+V+Y VL+ GE K + IP RG+RQGD LSP+LF+L  +   + L 
Sbjct  147  GFDEKWISLLMCCVSSVSYRVLINGEAKENIIPSRGLRQGDPLSPFLFILCTEALIAQLH  206

Query  377  RREEIGGIHAIRIA  336
              E  G I  ++IA
Sbjct  207  GAENEGRITGLKIA  220



>ref|NP_001174443.1| Os05g0434000 [Oryza sativa Japonica Group]
 dbj|BAH93171.1| Os05g0434000 [Oryza sativa Japonica Group]
Length=1478

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WV+L++ CV++VTY + + GE      P RG+RQGD LSPYLF++  +G S++L+
Sbjct  945   GFHDQWVNLVMKCVTSVTYRIKINGEHSDQIYPQRGLRQGDPLSPYLFIICAEGLSALLQ  1004

Query  377   RREEIGGIHAIRI  339
             + +  G I  I++
Sbjct  1005  KAQADGKIEGIKV  1017



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +  L+++CV++  + VL+ G+  R+F P RG+RQGD LSP+LF++  +G S++LR
Sbjct  606  GFPTRYTKLVMNCVTSARFSVLVNGQPSRNFFPSRGLRQGDPLSPFLFVVCAEGLSTLLR  665

Query  377  RREEIGGIHAIRIA  336
              EE   IH ++I 
Sbjct  666  DAEEKKVIHGVKIG  679



>ref|XP_010681662.1| PREDICTED: uncharacterized protein LOC104896592 [Beta vulgaris 
subsp. vulgaris]
Length=695

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +V LIL CV + ++ +L+ G+  R F P RG+RQGD LSP+LF+L  +G SS+LR
Sbjct  524  GFPMVYVRLILKCVKSPSFSILVNGQPSRRFFPSRGLRQGDPLSPFLFILCAEGLSSLLR  583

Query  377  RREEIGGIHAIRIALAV  327
              E    IH ++I   V
Sbjct  584  DAEAKREIHGLKIGKKV  600



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   ++ LI+ CV+TV+Y +L++G      IP RG+RQGD +SPYLFL+V + FS++L+
Sbjct  197  GFPIRFIQLIMGCVTTVSYSLLIQGRPFGRIIPSRGLRQGDPISPYLFLIVAEAFSALLQ  256

Query  377  RREEIGGIHAIRIA  336
            + E    +H + IA
Sbjct  257  QAERDSRLHGVSIA  270



>gb|EEC81735.1| hypothetical protein OsI_25376 [Oryza sativa Indica Group]
Length=235

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W +LI+ CV++V+Y + + GE    F P RG+RQGD LSPYLFLL  +GFS++L+
Sbjct  42   GFDEGWTNLIMQCVTSVSYRIKVNGELTDVFHPGRGLRQGDPLSPYLFLLCAEGFSALLK  101

Query  377  RREEIG  360
            + E  G
Sbjct  102  QAENEG  107



>ref|XP_010236480.1| PREDICTED: uncharacterized protein LOC104584065 [Brachypodium 
distachyon]
Length=1155

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV LI+ CVS+V Y V L       F P RGIRQGD LSPYLFLL  +G SS+L 
Sbjct  408  GFDPRWVKLIMACVSSVRYRVKLNSNVIEGFTPTRGIRQGDPLSPYLFLLCAEGLSSLLN  467

Query  377  RREEIGGIHAIRI  339
              E  G +  +R+
Sbjct  468  HAETSGDLVGVRV  480



>ref|XP_009125370.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=943

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ CVSTVTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  220  GFHTKWIAWIMQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCN  279

Query  377  RREEIGGIHAIRIA  336
            + +E G +  IR+A
Sbjct  280  KAQEDGSLKGIRVA  293



>gb|EMT07196.1| Tubulin--tyrosine ligase-like protein 12 [Aegilops tauschii]
Length=1087

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFL----LVMKGFS  390
            GF   WV+LI+ CV+TV Y V +  EE   F P RG+RQGD LSPYLFL    L  +G +
Sbjct  88   GFRREWVNLIMQCVTTVEYRVRINAEENESFKPTRGLRQGDPLSPYLFLYLFRLCTEGLN  147

Query  389  SILRRREEIGGIHAIRI  339
            ++L   EE G I  +++
Sbjct  148  ALLSHAEENGNISGVKV  164



>ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor]
 gb|EES00061.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor]
Length=631

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV LI+ CV+TVTY + +     +   P RG+RQGD LSPYLF++  +G S++L+
Sbjct  178  GFDEKWVQLIMKCVTTVTYKIKVNDSYTQKIFPQRGLRQGDPLSPYLFIICAEGLSAMLQ  237

Query  377  RREEIGGIHAIRI  339
            + E+ G I  I+I
Sbjct  238  KAEQKGKIEGIKI  250



>ref|XP_010463319.1| PREDICTED: uncharacterized protein LOC104743986 [Camelina sativa]
Length=741

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+V+Y VLL G+ +   +P RG+RQGD LSPYLF+L MK   + ++
Sbjct  21   GFDQKWISWIMWCVSSVSYQVLLNGQPRGTILPQRGLRQGDPLSPYLFILCMKVLIANIK  80

Query  377  RREEIGGIHAIRIA  336
            + E+   I  I+IA
Sbjct  81   KAEQEQKIMCIKIA  94



>ref|XP_009132673.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=824

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  +WV L++ CVSTVTY  L+ G  +    P RGIRQGD LSPYLF+L  +  S +  
Sbjct  77   GFHENWVCLVMQCVSTVTYSFLINGSPRGKVTPSRGIRQGDPLSPYLFILCSEVLSGLCN  136

Query  377  RREEIGGIHAIRIA  336
            + +E G +  I IA
Sbjct  137  KAQEEGSLKGISIA  150



>ref|XP_009140970.1| PREDICTED: uncharacterized protein LOC103864947 [Brassica rapa]
Length=1547

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ +I+ CVSTVTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  802  GFHETWIKMIMQCVSTVTYSFLINGSPRGRVQPSRGIRQGDPLSPYIFILCSEVLSGLCN  861

Query  377  RREEIGGIHAIRIALA  330
            R  E G +  IR+A A
Sbjct  862  RASEEGSLKGIRVARA  877



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ IL CVS+VTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  346  GFHSRWIAWILECVSSVTYAFLINGSPRGKVSPSRGIRQGDPLSPYIFILCSEVLSGLCN  405

Query  377  RREEIGGIHAIRIA  336
            R +E G +  IR+A
Sbjct  406  RAQETGQLTGIRVA  419



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   ++ LI+ CV+TV+Y +L++G      IP RG+RQGD +SPYLFL+V + FS++L+
Sbjct  997   GFPIRFIQLIMGCVTTVSYSLLIQGRPFGRIIPSRGLRQGDPISPYLFLIVAEAFSALLQ  1056

Query  377   RREEIGGIHAIRIA  336
             + E    +H + IA
Sbjct  1057  QAERDSRLHGVSIA  1070



>gb|AAD40135.1|AF149413_16 contains similarity to retrotransposon Ta11-1 [Arabidopsis thaliana]
Length=220

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV L++ CV+TV+Y VL+ G      +P RG+RQGD LSP+LF+L  +G S +L 
Sbjct  97   GFHNDWVELVMSCVTTVSYTVLVNGHPHGLVVPQRGLRQGDPLSPFLFVLCTEGLSHLLN  156

Query  377  RREEIGGIHAIRIA  336
            R E+ G I  +R +
Sbjct  157  RAEQQGLISGMRFS  170



>ref|XP_009102306.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=703

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ CVS+V YHVL  G+ + +  P RG+RQGD LSP++F+L  +   S+L 
Sbjct  27   GFSDTWIEWIMRCVSSVKYHVLFNGQPRGNITPQRGLRQGDPLSPFIFILCTEALVSLLN  86

Query  377  RREEIGGIHAIRIALA  330
              E  G I  IR++ A
Sbjct  87   HAENQGKITGIRVSRA  102



>ref|XP_007207773.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
 gb|EMJ08972.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
Length=1060

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS ++ C+ST T+ VL +G    H +P RG+RQG  LSPYLFL+  +GFS +LR
Sbjct  300  GFSATWVSKVMDCISTTTFSVLWKGTPVGHIMPQRGLRQGCPLSPYLFLICTEGFSCLLR  359

Query  377  RREEIGGIHAIRIA  336
              E  G +  +++A
Sbjct  360  GAERRGDLVGVQVA  373



>ref|XP_007200757.1| hypothetical protein PRUPE_ppa023318mg, partial [Prunus persica]
 gb|EMJ01956.1| hypothetical protein PRUPE_ppa023318mg, partial [Prunus persica]
Length=263

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HWV+L++ CV  VT+ V++ G+ +RHF P +GI QGD +SPYLFL V +  S ++ 
Sbjct  152  GFDDHWVNLVMRCVKFVTFAVMINGQPRRHFYPSKGIHQGDQISPYLFLFVSEVLSLMIS  211

Query  377  RREEIGGIHAIRI  339
            +      +  I++
Sbjct  212  KEINPNVLQGIKL  224



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ ++ CVS+V Y V + GE  +  +P RGIRQGD +SPYLFLL  +G S +L 
Sbjct  569  GFSQDWINTVMRCVSSVRYAVKINGELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLH  628

Query  377  RREEIGGIHAIR  342
            ++E  G +  I+
Sbjct  629  KKEVAGELQGIK  640



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ ++ CVS+V Y V + GE  +  +P RGIRQGD +SPYLFLL  +G S +L 
Sbjct  612  GFSQDWINTVMRCVSSVRYAVKINGELTKPVVPSRGIRQGDPISPYLFLLCTEGLSCLLH  671

Query  377  RREEIGGIHAIR  342
            ++E  G +  I+
Sbjct  672  KKEVAGELQGIK  683



>emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera]
Length=843

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W S IL C+STV   VL+ G   + F   RG+RQGD LSPYLF+L+M+ FSS++ 
Sbjct  235  GFXPKWRSWILFCISTVRMAVLVNGTPTKFFSTYRGLRQGDPLSPYLFVLIMEAFSSLIS  294

Query  377  RREEIGGIHAIRI  339
            + EE G I   R+
Sbjct  295  KAEEKGFIRGFRV  307



>ref|XP_008340459.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=536

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LI+ CV+TV+Y VL+ G  + + +P RG+RQGD LSPYLF+L  +G S+++ 
Sbjct  2    GFSQTWIKLIMLCVTTVSYSVLVNGCPRGYILPSRGLRQGDPLSPYLFILCAEGLSALIA  61

Query  377  RREEIGGIHAIRI  339
             RE  G I+ I I
Sbjct  62   LRERRGLINGISI  74



>ref|XP_008387184.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=887

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +   I  C++TV+Y VLL G       P RG+RQGD +SP+LFL+  +G S++LR
Sbjct  184  GFPHEFCKRIEECITTVSYSVLLNGSATGFIQPKRGLRQGDPMSPFLFLICAEGLSAMLR  243

Query  377  RREEIGGIHAIRI  339
            +REE G +H IR+
Sbjct  244  KREEHGSLHGIRV  256



>ref|XP_008228453.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=658

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV LI+ CV+TVTY  L+ G    +  P RG+RQGD LSPYLF+L  +GFSS L 
Sbjct  21   GFVEQWVRLIMTCVTTVTYSFLVHGSPCGYVNPSRGLRQGDPLSPYLFILCAQGFSSFLT  80

Query  377  RREEIGGIHAIRI  339
              E  G +  + I
Sbjct  81   HAERDGRLKGVSI  93



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I++CV++V+Y VL+ G+   H IP RGIRQGD LSP LF+L  +    IL 
Sbjct  596  GFNNKWISWIMNCVTSVSYSVLINGQPYGHIIPTRGIRQGDPLSPALFVLCTEALIHILN  655

Query  377  RREEIGGIHAIR  342
            + E+ G I  I+
Sbjct  656  KAEQAGKITGIQ  667



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +V LI+ CV +VTY VLL+G       P RG+RQGD +SPYLFL+V +G S+++R
Sbjct  885  GFPDRFVFLIMDCVKSVTYSVLLQGAPFGKIKPSRGLRQGDPISPYLFLIVAEGLSALIR  944

Query  377  RREEIGGIHAIRIA  336
            + E    IH + IA
Sbjct  945  KAEREQQIHGVAIA  958



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -1

Query  563   GRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSI  384
             G GF   W+ LI+ CV+TV+Y  +L G    + IP RG+RQGD LSPYLFLL  +  SS+
Sbjct  958   GMGFAPRWIQLIMECVTTVSYSFMLNGNPVGYVIPQRGLRQGDPLSPYLFLLCAEALSSL  1017

Query  383   LRRREEIGGIHAIRI  339
             + + E    +H + +
Sbjct  1018  ILQAERRNLLHGVNL  1032



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -1

Query  581   LRVR*GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVM  402
             LR   G  GF   W   I+ CV +V Y V+L GE+    IP RG+RQGD LSPYLF++  
Sbjct  1013  LRSIMGKMGFCSKWSEWIMMCVESVDYSVILNGEKIGPIIPGRGLRQGDPLSPYLFIICA  1072

Query  401   KGFSSILRRREEIGGIHAIRI  339
             +G SS++R+ E  G I   +I
Sbjct  1073  EGLSSLIRQAEGSGTISGAKI  1093



>gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago 
truncatula]
Length=573

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S ++ C+STV YHV+  G+     IP RG+RQG  LSPYL+++  +G S+I++
Sbjct  157  GFSPQWISWMMMCISTVEYHVIFNGDRIGPIIPGRGLRQGCPLSPYLYIICAEGLSAIIK  216

Query  377  RREEIGGIHAIRI  339
              E  G IH +RI
Sbjct  217  NHEFRGKIHGVRI  229



>ref|XP_004292011.1| PREDICTED: uncharacterized protein LOC101291306 [Fragaria vesca 
subsp. vesca]
Length=948

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+L+L CVS+V++ ++L G+  R+F P RG+RQGD LSPYLFL+V +  S  LR
Sbjct  250  GFARPWVNLVLACVSSVSFSIVLNGKPGRYFSPSRGLRQGDPLSPYLFLIVSEALS--LR  307

Query  377  RREEIGGIHAIRIALAVG  324
              + +   H + I L  G
Sbjct  308  LTKAVNEKHLLGIKLCRG  325



>ref|XP_008242862.1| PREDICTED: uncharacterized protein LOC103341160 [Prunus mume]
Length=872

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ L++ C+ TV++ VL+ G+    F+P RG+RQGD LSPYLFLLV +  S  L 
Sbjct  173  GFHSGWIRLVMLCIRTVSFSVLVNGQPGSSFLPSRGLRQGDPLSPYLFLLVCEALSCNLT  232

Query  377  RREEIGGIHAIRIA  336
            +  + G I+ IR++
Sbjct  233  KLVQDGVINGIRVS  246



>ref|XP_010229884.1| PREDICTED: uncharacterized protein LOC100821562 [Brachypodium 
distachyon]
Length=894

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ CV+TV Y V   G+    F P RG+RQGD LSP+LFL V+ G S++L+
Sbjct  752  GFAKQWVEWIMVCVTTVNYSVKFNGKLLESFAPTRGLRQGDPLSPFLFLFVVDGLSALLK  811

Query  377  RREEIGGIHAIRI  339
            R   +  I  +++
Sbjct  812  RESALNNISPLKV  824



>ref|XP_010462630.1| PREDICTED: uncharacterized protein LOC104743220 [Camelina sativa]
Length=746

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ CVSTVTY  L+ G+ K   IP RG+RQGD LSPYLF+L  +  S + +
Sbjct  5    GFSNTWIEWIMECVSTVTYSYLINGDAKGQVIPSRGLRQGDPLSPYLFILCTEVLSGLCK  64

Query  377  RREEIGGIHAIRIA  336
            + +  G +  +++A
Sbjct  65   QAQLDGSLPGVKVA  78



>ref|XP_009102778.1| PREDICTED: uncharacterized protein LOC103828890 [Brassica rapa]
Length=1302

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ C+S+V Y VL+ GE + + +P RG+RQGD LSP++F+L  +  +S+L 
Sbjct  607  GFSEIWIAWIMRCISSVKYKVLMNGEPRGNIVPGRGLRQGDPLSPFIFILCTEALASLLN  666

Query  377  RREEIGGIHAIRIALA  330
              E  G I  +R+  A
Sbjct  667  HAESQGKITGMRVTRA  682



>ref|XP_010667928.1| PREDICTED: uncharacterized protein LOC104884923 [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVS+V+Y +++ G    H +P RG+RQGD LSPYLF+LV   FS +++
Sbjct  158  GFDGRWVNLIMCCVSSVSYSLIINGGVCGHIVPTRGLRQGDPLSPYLFILVADVFSKMIQ  217

Query  377  RREEIGGIHAIR  342
            R+ ++  I+  +
Sbjct  218  RKVQMKQIYGAK  229



>ref|XP_010445339.1| PREDICTED: uncharacterized protein LOC104727990 [Camelina sativa]
Length=1030

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HW ++ + C+++V+Y  LL G+ K    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  361  GFHPHWTNIFMQCITSVSYSYLLNGQAKGMVKPSRGIRQGDPLSPYIFILCSEVLSGLCN  420

Query  377  RREEIGGIHAIRIA  336
            + +  G +H IR+A
Sbjct  421  KAQVHGKLHGIRVA  434



>ref|XP_009150103.1| PREDICTED: uncharacterized protein LOC103873447 [Brassica rapa]
Length=617

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ C+S+VTY VL+ GE + + +P RG+RQGD LSP++F+L  +   S+L 
Sbjct  382  GFSELWIEWIMRCISSVTYKVLMNGEPRGNIVPGRGLRQGDPLSPFIFILCTEALVSLLN  441

Query  377  RREEIGGIHAIR  342
            + E  G I  +R
Sbjct  442  QAENQGKITGMR  453



>ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=1152

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -1

Query  587  CSLRVR*GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLL  408
            C L    G  GFG  +V  I+HC++TV+Y  L+ GE     IP RG+RQGD++SPYLFLL
Sbjct  345  CFLEKVLGKLGFGDTFVRWIMHCITTVSYSFLVNGEPCGKLIPTRGLRQGDAISPYLFLL  404

Query  407  VMKGFSSILRRREEIGGIHAIRI  339
              +  S ++++ E  G I  +++
Sbjct  405  CAEVLSRMIKQAETNGEIQGVKV  427



>ref|XP_009114416.1| PREDICTED: uncharacterized protein LOC103839673 [Brassica rapa]
Length=1267

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HWV L++ C+S+V Y VLL G+ +   IP RG+RQGD LSPYLF+L  +   + ++
Sbjct  542  GFDTHWVKLMMACISSVQYRVLLNGQPRGLIIPQRGLRQGDPLSPYLFILCTEALIANIK  601

Query  377  RREEIGGIHAIRIALA  330
            + E    +  +++A A
Sbjct  602  KAERENQLTGMKVARA  617



>gb|EEE54705.1| hypothetical protein OsJ_02026 [Oryza sativa Japonica Group]
Length=644

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ CV+TV + V   G     F P RG+RQGD LSPYLFL V +G SS+L 
Sbjct  118  GFCRQWVDWIMECVTTVKFSVNFNGSLLEAFSPTRGLRQGDPLSPYLFLFVAEGLSSVLN  177

Query  377  RREEIGGIHAIRI  339
            R  E G +  +++
Sbjct  178  REVEAGRLTELKV  190



>ref|XP_009103791.1| PREDICTED: uncharacterized protein LOC103829852 [Brassica rapa]
Length=1374

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +V  I+ CV++VTY VL+ GEEK +  P RG+RQGD LSP+LF L  +G S +L 
Sbjct  599  GFDKKFVDWIMFCVTSVTYSVLINGEEKGNINPKRGLRQGDPLSPFLFDLCTEGLSYLLN  658

Query  377  RREEIGGIHAIRIA  336
            + E +G I  I+ +
Sbjct  659  KAESMGEIEGIKFS  672



>ref|XP_010671945.1| PREDICTED: uncharacterized protein LOC104888619 [Beta vulgaris 
subsp. vulgaris]
Length=734

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+L++ CVS+V+Y  +L G      IP RG+RQGD LSPYLF+LV   FS +++
Sbjct  97   GFDGRWVNLVMDCVSSVSYSFILNGRVCGEVIPQRGLRQGDPLSPYLFILVADAFSHMIQ  156

Query  377  RREEIGGIHAIR  342
            R+ +   IH  +
Sbjct  157  RKVQERKIHGAK  168



>ref|XP_007201931.1| hypothetical protein PRUPE_ppa017480mg [Prunus persica]
 gb|EMJ03130.1| hypothetical protein PRUPE_ppa017480mg [Prunus persica]
Length=268

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             F   WV LI+ C+STVTY V + G      +P RG+RQGD LSPYLFL+ ++G S++L 
Sbjct  165  DFNDRWVKLIMDCISTVTYSVQVRGVASGMIVPSRGLRQGDPLSPYLFLICVEGLSALLS  224

Query  377  RREEIGGIHAIRIA  336
                I  I  I +A
Sbjct  225  NALRIKRISGIFVA  238



>ref|XP_010463143.1| PREDICTED: uncharacterized protein LOC104743796 [Camelina sativa]
Length=761

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W + ++ C++TV+Y VL+ G   +  IP RG+RQGD LSPYL+LL  +G SS++ 
Sbjct  27   GFADKWCNWVMKCITTVSYSVLINGSPSKKIIPQRGLRQGDPLSPYLYLLCTEGLSSLIS  86

Query  377  RREEIGGIHAIR  342
               +   IH  R
Sbjct  87   TSVKANHIHGFR  98



>gb|EEC67968.1| hypothetical protein OsI_35722 [Oryza sativa Indica Group]
Length=301

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ CV++V Y V   G   R FIP RG+RQGD LSP+LFL V  G S +L+
Sbjct  210  GFAHRWVRWIMSCVTSVRYSVKFNGTLLRSFIPSRGLRQGDPLSPFLFLFVADGLSLLLK  269

Query  377  RREEIGGIHAIRI  339
             + E   +  I+I
Sbjct  270  EKVEQNILTPIKI  282



>gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1715

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WV  I+ CV++V+Y VL+ G       P RGIRQGD LSPYLFL   +  S++LR
Sbjct  959   GFAPRWVKWIMTCVTSVSYEVLINGSPYGKIFPSRGIRQGDPLSPYLFLFCAEVLSNMLR  1018

Query  377   RREEIGGIHAIRI  339
             + E    IH ++I
Sbjct  1019  KAEVNKQIHGMKI  1031



>ref|XP_004295858.1| PREDICTED: uncharacterized protein LOC101314838 [Fragaria vesca 
subsp. vesca]
Length=1524

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GFG + +  +++CV TV+Y  L+ GE  R  IP RG+RQGD++SPYLFL+  +  S I+ 
Sbjct  1087  GFGGNLLRWVMNCVRTVSYSFLVNGEPSREVIPTRGLRQGDAISPYLFLVCAEVLSRIIN  1146

Query  377   RREEIGGIHAIRI---ALAVGKF*VG*RCIIMMDLQLKRMHNRLSLNFIM*ICCRLIIQD  207
               E    IH IR+   A  V          I +  +++ +   LS+  I     R+  Q 
Sbjct  1147  EAEARDQIHGIRVCTGAPVVNHLFFADDSFIFLKAEVEDV---LSMKQIFVAYERMSGQQ  1203

Query  206   IN---ACLSLFANVHLR  165
             IN   +C+S   NV  R
Sbjct  1204  INYDKSCISFSRNVPFR  1220



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  563  GRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSI  384
            G GF  HW+ LI+ CV +V Y VL+ G      IP RG+RQGD LSPYLF++  +    +
Sbjct  595  GLGFADHWIRLIMECVKSVRYQVLINGTPHGEIIPSRGLRQGDPLSPYLFVICTEMLVKM  654

Query  383  LRRREEIGGIHAIRIA  336
            L+  E+   I  +++A
Sbjct  655  LQSAEQKNQITGLKVA  670



>ref|XP_009103763.1| PREDICTED: uncharacterized protein LOC103829818 [Brassica rapa]
Length=1304

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVSTVTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  573  GFHPKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCS  632

Query  377  RREEIGGIHAIRIA  336
            + +E G +  I+++
Sbjct  633  KAQEEGSLKGIKVS  646



>ref|XP_009118875.1| PREDICTED: uncharacterized protein LOC103843847 [Brassica rapa]
Length=1319

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVSTVTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  573  GFHPKWISWIIQCVSTVTYSFLINGSPRGRVTPSRGIRQGDPLSPYIFILCSEVLSGLCS  632

Query  377  RREEIGGIHAIRIA  336
            + +E G +  I+++
Sbjct  633  KAQEEGSLKGIKVS  646



>ref|XP_008244613.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=930

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++LI++C+STV++ V++ G+  + F P RG+RQGD LSP LFLLV +  S  L 
Sbjct  144  GFARVWINLIMNCISTVSFAVIINGQPGKFFKPTRGLRQGDPLSPCLFLLVSEALSRNLS  203

Query  377  RREEIGGIHAIRIA  336
                 G I  IRIA
Sbjct  204  SAVHNGEIKGIRIA  217



>ref|XP_010692677.1| PREDICTED: uncharacterized protein LOC104905754 [Beta vulgaris 
subsp. vulgaris]
Length=965

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HW++LI  C+STVTYH+L+ G+    F P  G+RQGD +SPYLFL  M   S +L 
Sbjct  204  GFPAHWITLIHQCISTVTYHILINGQVSEAFTPTCGLRQGDPISPYLFLFCMDILSRMLS  263

Query  377  RREEI  363
               +I
Sbjct  264  LATDI  268



>ref|XP_009105597.1| PREDICTED: uncharacterized protein LOC103831468 [Brassica rapa]
Length=773

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ CVSTVTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  27   GFHSRWINWIMECVSTVTYSFLINGSPRGRVKPSRGIRQGDPLSPYIFILCSEVLSGLCN  86

Query  377  RREEIGGIHAIRIA  336
            R  E G +  I++A
Sbjct  87   RAHETGLLAGIQVA  100



>ref|XP_010513448.1| PREDICTED: uncharacterized protein LOC104789452 [Camelina sativa]
Length=1025

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+S I+ CV++V Y VLL G+     +P RG+RQGD LSPYLF+L  +   + +R
Sbjct  324  GFGGTWISRIMFCVTSVEYKVLLNGQSNGRIVPERGLRQGDPLSPYLFILCKEVLVANIR  383

Query  377  RREEIGGIHAIRIA  336
            R E    I  I++A
Sbjct  384  RAERDKQIIGIKVA  397



>ref|XP_002464513.1| hypothetical protein SORBIDRAFT_01g019890 [Sorghum bicolor]
 gb|EER91511.1| hypothetical protein SORBIDRAFT_01g019890 [Sorghum bicolor]
Length=323

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W  L++ CVS+V Y + + GE     IP RG+RQGD LSPYLF++  +G S++L 
Sbjct  21   GFKQQWADLVMRCVSSVNYRIKINGEYTEPIIPQRGLRQGDPLSPYLFIMCAEGLSAMLE  80

Query  377  RRE---EIGGIHAI  345
            + E   +I GI  I
Sbjct  81   KAEAEHKIVGIKKI  94



>ref|XP_008378183.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=336

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   + S I  C+STV++ V++ G     F P RG+RQGD LSP+LFLL  +GFS ++R
Sbjct  27   GFAPLFCSWIKECISTVSFSVIINGSPTGFFRPNRGLRQGDPLSPFLFLLCTEGFSMLIR  86

Query  377  RREEIGGIHAIRIA  336
            R  E G +H  +++
Sbjct  87   RSLERGALHGFKLS  100



>ref|XP_009110782.1| PREDICTED: uncharacterized protein LOC103836292 [Brassica rapa]
Length=767

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ CVS+V+Y  L+ G  +   +P RGIRQGD LSPYLF+L  +  S + R
Sbjct  21   GFDPIWVDWIMECVSSVSYSFLINGSPRGRVLPSRGIRQGDPLSPYLFILCTEVLSGLCR  80

Query  377  RREEIGGIHAIRIA  336
            + +E G +  +++A
Sbjct  81   QAQERGSLPGLKVA  94



>ref|XP_010673355.1| PREDICTED: uncharacterized protein LOC104889755 [Beta vulgaris 
subsp. vulgaris]
Length=1001

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  554  FGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRR  375
            F   WV+ I+ CV+ V+Y VL+ GE    F+P  G+RQGD LS Y+F+L M+  S  L R
Sbjct  271  FPAKWVNWIMQCVTAVSYSVLVNGEPSTPFVPRAGLRQGDPLSSYIFILCMEVLSRNLTR  330

Query  374  REEIGGIHAIRIA  336
             ++IG +  +RIA
Sbjct  331  MQQIGELEGLRIA  343



>gb|ABA97563.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=839

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W  LI+ C++ VTY + + GE      P RG++Q D LSPYLFLL  +GFS+++R
Sbjct  475  GFNQEWTQLIMKCITFVTYRIRVNGELIEVIQPERGLQQRDPLSPYLFLLCAEGFSALIR  534

Query  377  RREEIGGIHAIR  342
            + EE G +  +R
Sbjct  535  KAEEEGSLQGVR  546



>ref|XP_009107779.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=651

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ C+++V Y VL+ GE + + +P RG+RQGD LSP++F+L  +   S+L 
Sbjct  2    GFSEMWIDWIMRCITSVKYKVLMNGEPRGNIVPGRGLRQGDPLSPFIFILCTEALVSLLN  61

Query  377  RREEIGGIHAIRIALA  330
            + E  G I  +R A A
Sbjct  62   QAENQGKITGMRAARA  77



>gb|EAZ08016.1| hypothetical protein OsI_30282 [Oryza sativa Indica Group]
Length=632

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  581  LRVR*GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVM  402
            LR   G  GF   W+++++  VSTV+Y + + G+     IP RG+RQGD LSPYLFLL  
Sbjct  150  LRRMMGKLGFCQEWINIVMGFVSTVSYRIKVNGDLTEQIIPQRGLRQGDPLSPYLFLLCA  209

Query  401  KGFSSILRRREEIGGIHAIR  342
            + FS +L   E+ G I  +R
Sbjct  210  EAFSCLLNSAEDRGDIEGVR  229



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   W+ L++ CV TV Y VL+ G   R   P RG+RQGD LSPYLF++  +    +L 
Sbjct  1046  GFSGSWIRLVMECVKTVEYQVLINGVPYRDIQPTRGLRQGDPLSPYLFVICTEMLVRMLN  1105

Query  377   RREEIGGIHAIRIA  336
             + EE G I  ++IA
Sbjct  1106  KAEEEGKITGLKIA  1119



>ref|XP_009123425.1| PREDICTED: uncharacterized protein LOC103848222 [Brassica rapa]
Length=851

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ C+++V Y VL+ G+ + + +P RG+RQGD LSP++F+L  +  +S+L 
Sbjct  178  GFSEIWISWIMRCITSVKYKVLINGQPRGNIVPGRGLRQGDPLSPFIFILCTEALASLLN  237

Query  377  RREEIGGIHAIRIALA  330
              E  G I  +R+  A
Sbjct  238  HAENQGKITGMRVTRA  253



>ref|XP_010667704.1| PREDICTED: uncharacterized protein LOC104884717 [Beta vulgaris 
subsp. vulgaris]
Length=1578

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W   ++ CV +V++ +L+ G+    F P RGIRQGD LSPYLF+L  + FS +LR
Sbjct  852  GFDSGWRCRVMDCVRSVSFSILVNGKPTNDFTPHRGIRQGDPLSPYLFILCAEVFSHLLR  911

Query  377  RREEIGGIHAIRIA  336
            + EE   +  I++A
Sbjct  912  KAEERNSLKGIKVA  925



>ref|XP_009115910.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=869

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ CVS+V++ VL+ G  + H +P RGIRQGD LSPY+F+L  +  S ++ 
Sbjct  97   GFDTRWIKWIMACVSSVSFSVLINGAPEGHIVPERGIRQGDPLSPYIFILCAEVLSHMMN  156

Query  377  RREEIGGIHAIRIAL  333
            R  E   I  +++AL
Sbjct  157  RAMEDRSILGVKVAL  171



>ref|XP_010463221.1| PREDICTED: uncharacterized protein LOC104743884 [Camelina sativa]
Length=298

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I+ C S+V Y VLL G+     +P RG+RQGD LSPYLF+L  K   + +R
Sbjct  2    GFGEKWIGWIMFCASSVEYRVLLNGQPNALIVPERGLRQGDPLSPYLFILCTKVLIAKIR  61

Query  377  RREEIGGIHAIRIA  336
            + E+   I  I++A
Sbjct  62   KMEQDKLITGIKVA  75



>gb|AAB84340.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1094

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ ++ CVS+V+Y VL+ G+   H  P RG+RQGD LSP+LF+L  +    IL 
Sbjct  326  GFNSTWINWMMACVSSVSYSVLINGQPFGHITPHRGLRQGDPLSPFLFVLCTEALIHILN  385

Query  377  RREEIGGIHAIR  342
            + E+IG I  I+
Sbjct  386  QAEKIGKISGIQ  397



>ref|XP_010666096.1| PREDICTED: uncharacterized protein LOC104883306 [Beta vulgaris 
subsp. vulgaris]
Length=1365

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HW+ LI  C+STVTY VL+ G     F+P  G+RQGD LSPYLFL  M   S +  
Sbjct  609  GFPPHWIQLIRECISTVTYRVLINGVATPSFVPSCGLRQGDPLSPYLFLFCMDILSRMTT  668

Query  377  RREEIGGIHAIRIAL  333
               +I     IR+ L
Sbjct  669  LATDISKFKGIRVHL  683



>ref|XP_008393342.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=749

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W +LI++CV+TV + VLL G+    F P RGIRQGD LSP LFLLV    S +++
Sbjct  2    GFCRGWTNLIMNCVTTVEFAVLLNGKPGHRFTPSRGIRQGDPLSPXLFLLVSDVLSRLIQ  61

Query  377  RREEIGGIHAIRIALA  330
            R  E G +  +R+ L+
Sbjct  62   RGVEDGLLTGVRMNLS  77



>emb|CAN68400.1| hypothetical protein VITISV_041172 [Vitis vinifera]
Length=1944

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GFG  W   I  C+STV + VL+ GE    F   +G+RQGD LSPYLF++ M+  S+++R
Sbjct  1519  GFGVKWREWIWSCISTVKFSVLINGEPAGFFSSSKGLRQGDPLSPYLFIMGMEVLSALIR  1578

Query  377   RREEIGGIHAIRIALAVGK  321
             R  E G I   RI    G+
Sbjct  1579  RAMERGCISGCRIRRGXGQ  1597


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = -1

Query  560   RGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSIL  381
             +GF   W   +  C+STV+Y VL+ G  K      RG+RQGD LS +LF LV    S +L
Sbjct  1149  KGFSPRWRKWMSGCLSTVSYAVLVNGNAKGWVKASRGLRQGDPLSIFLFTLVADVLSRML  1208

Query  380   RRREEIGGIHAIRIA  336
              R ++   +   R+ 
Sbjct  1209  LRADKRNLLEDFRVG  1223



>ref|XP_007212800.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
 gb|EMJ13999.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
Length=1072

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS ++ C+ST T+ VL +G    H +P RG+RQG  LSPYLFL+  +GFS +L 
Sbjct  550  GFSATWVSKVMDCISTTTFSVLWKGTPVGHIMPQRGLRQGCPLSPYLFLICTEGFSCLLH  609

Query  377  RREEIGGIHAIRIA  336
              E  G +  +++A
Sbjct  610  GAERRGDLVGVQVA  623



>ref|XP_007214818.1| hypothetical protein PRUPE_ppa024509m2g, partial [Prunus persica]
 gb|EMJ16017.1| hypothetical protein PRUPE_ppa024509m2g, partial [Prunus persica]
Length=360

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -1

Query  563  GRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSI  384
            G GF   W+ LI+ C++TV+Y  +L G    + IP RG+RQGD +SPYLFLL ++  SS+
Sbjct  279  GMGFAPRWIQLIMECMTTVSYCFMLNGNPVGYVIPQRGLRQGDPVSPYLFLLCVEALSSL  338

Query  383  LRRREEIGGIHAIRI  339
            + + E    +H + +
Sbjct  339  ILQAEPRNLLHGVNL  353



>gb|ABN08841.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago 
truncatula]
Length=462

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I+ CV TV Y VL+ G      +P R +RQGD LSPYLF++ ++G SS+LR
Sbjct  259  GFSSRWVSWIMLCVETVDYSVLVNGASVGPIVPGRDLRQGDPLSPYLFIICVEGLSSLLR  318

Query  377  RREEIGGIHA  348
              E    I A
Sbjct  319  EAERCNDIRA  328



>ref|XP_008349700.1| PREDICTED: uncharacterized protein LOC103412975 [Malus domestica]
Length=701

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ CV+TVTY     G+      P RGIRQGD LSP+LF++  +G S++L 
Sbjct  329  GFAEEWINWIMMCVTTVTYSFKFNGDPVGFVHPKRGIRQGDPLSPFLFVICAEGLSALLD  388

Query  377  RREEIGGIHAIRIAL  333
              E  G IHAI++ L
Sbjct  389  DWEAQGQIHAIKVIL  403



>ref|XP_008226782.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=963

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++L+L CV +V++ ++L G+    F P RG+RQGD LSPYLFLLV +  S  L 
Sbjct  178  GFNSRWINLVLGCVRSVSFSIILNGKPGGFFRPSRGLRQGDPLSPYLFLLVSEALSLNLS  237

Query  377  RREEIGGIHAIRIA  336
            +    G I  I++A
Sbjct  238  KLIRDGNIQGIKLA  251



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +   I  C+S+V+  +LL G    +  P RG+RQGD LSPYLFLL  +GFS ++R
Sbjct  175  GFDQRFCDRIKECISSVSLSILLNGNPTGYIKPQRGLRQGDPLSPYLFLLCTEGFSXLIR  234

Query  377  RREEIGGIHAIRIA  336
            +  E G +H IR++
Sbjct  235  KGLENGSLHGIRVS  248



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ C+S+V+Y   L G+   + IP RG+RQGD LSPYLFLL  + FS++L 
Sbjct  449  GFCDSWVRRIMVCLSSVSYAFKLNGKVTGNIIPSRGLRQGDPLSPYLFLLCAEAFSTLLA  508

Query  377  RREEIGGIHAIRI  339
            +  + G IH  R+
Sbjct  509  KASDDGRIHGARV  521



>ref|XP_010469706.1| PREDICTED: uncharacterized protein LOC104749719 [Camelina sativa]
Length=1474

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+V+Y VLL G+ +   +P RG+ QGD LSPYLF+L  +   + ++
Sbjct  436  GFDSRWISWIMWCVSSVSYQVLLNGQPRGSILPKRGLWQGDPLSPYLFILCTEVLIANIK  495

Query  377  RREEIGGIHAIRIA  336
            + E  G I  I+IA
Sbjct  496  KAEREGKISGIKIA  509



>ref|XP_010236428.1| PREDICTED: uncharacterized protein LOC104584030 [Brachypodium 
distachyon]
Length=653

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CV++V Y + L G     F P RG+RQGD LSP LFL V  G S++L+
Sbjct  346  GFATQWISWIMACVTSVRYSIKLNGNLLESFSPTRGLRQGDPLSPLLFLFVADGLSALLQ  405

Query  377  RREEIGGIHAIRI  339
            +  ++  I  I I
Sbjct  406  KEAQLNRISPIHI  418



>ref|XP_009148761.1| PREDICTED: uncharacterized protein LOC103872163 [Brassica rapa]
Length=746

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W S ++ C+++V Y VL+ GE + +  P RG+RQGD LSP++F+L  +  +S+L 
Sbjct  158  GFSEIWTSWVMRCITSVKYKVLMNGEPRENITPGRGLRQGDPLSPFIFILCTEALASLLN  217

Query  377  RREEIGGIHAIRIALA  330
              E  G I  +R+  A
Sbjct  218  HAENQGRITGMRVTRA  233



>ref|XP_010473903.1| PREDICTED: uncharacterized protein LOC104753332 [Camelina sativa]
Length=1107

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W   I+ C+S+V+Y VLL GE K    P RG+RQGD LSP+LF+++ +   S L+
Sbjct  417  GFCEKWRRWIMSCISSVSYKVLLNGEAKWSITPSRGLRQGDPLSPFLFIILTEALISQLK  476

Query  377  RREEIGGIHAIRIA  336
              EE G I  ++IA
Sbjct  477  GAEEEGRITGLKIA  490



>ref|XP_009115101.1| PREDICTED: uncharacterized protein LOC103840357 [Brassica rapa]
Length=918

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ CVS+V+Y VL+ GE K   +P RG+RQGD LSP+LF+L  +   S ++
Sbjct  178  GFDARWIHWIICCVSSVSYQVLINGEAKGRIVPSRGLRQGDPLSPFLFILCTEVLISQIQ  237

Query  377  RREEIGGIHAIRIALA  330
              E    I  I+IA A
Sbjct  238  HAEAEKKITGIKIARA  253



>ref|XP_008366311.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=812

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +   I  C++TV+Y VLL G       P RG+RQGD +SP+LFL+  +G S++LR
Sbjct  169  GFLHEFCKRIKECITTVSYSVLLNGSATGFIQPKRGLRQGDPMSPFLFLICAEGLSAVLR  228

Query  377  RREEIGGIHAIRIA  336
            +REE G +H IR+ 
Sbjct  229  KREEQGYLHGIRVT  242



>gb|EEC70040.1| hypothetical protein OsI_00627 [Oryza sativa Indica Group]
Length=1499

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV L++ CV++V+Y V   G     F P RG+RQGD LSPYLFL V  G S+ L 
Sbjct  907  GFCSQWVQLLMTCVTSVSYAVRFNGSMLESFKPTRGLRQGDPLSPYLFLFVADGLSTALS  966

Query  377  RREEIGGIHAIRI  339
              E  G +  +++
Sbjct  967  EAERSGRLQPLKV  979



>ref|XP_010675126.1| PREDICTED: uncharacterized protein LOC104891166 [Beta vulgaris 
subsp. vulgaris]
Length=1404

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W  +I+ C+S+V+Y VL+ GE  R F P  G+RQGD LSPYLF+L M+  S  + 
Sbjct  647  GFPSKWTHIIMECISSVSYSVLVNGEATRSFSPKAGLRQGDPLSPYLFILCMEVLSRKIT  706

Query  377  RREEIGGIHAIRI  339
            +++  G I  +++
Sbjct  707  QQQNQGLIKGLKV  719



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  ++  VSTV+Y +   G +  + IP RG+RQGD LSPYLF++V +G S++LR
Sbjct  21   GFSFDWVLKVMRMVSTVSYRISHAGRDFGNIIPSRGLRQGDPLSPYLFIIVAEGLSALLR  80

Query  377  RREEIGGIHAIRI  339
               + G +H ++I
Sbjct  81   CYVQSGTLHGVKI  93



>gb|EEE51789.1| hypothetical protein OsJ_33245 [Oryza sativa Japonica Group]
Length=825

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  +WV +++ CV++VTY + + GE      P  G+RQGD +SPYLF +  +GFS++L 
Sbjct  555  GFDRNWVFIVMKCVTSVTYRIKVNGEFTEQINPTGGLRQGDPISPYLFFICAEGFSTLLN  614

Query  377  RREEIGGIHAIRI  339
              EE G +  I++
Sbjct  615  AAEERGDLSVIKV  627



>ref|XP_010418809.1| PREDICTED: uncharacterized protein LOC104704411 [Camelina sativa]
Length=792

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I+ CV+TV Y VL+ G+      P RG+RQGD LSPYLF+L  +   +  R
Sbjct  27   GFCDKWVSWIMSCVTTVQYKVLINGQAHGSITPFRGLRQGDPLSPYLFILCTEALIAQFR  86

Query  377  RREEIGGIHAIRIALA  330
            + E++  I  I+++ A
Sbjct  87   KAEQLKLITGIKVSTA  102



>emb|CAN61532.1| hypothetical protein VITISV_017628 [Vitis vinifera]
Length=696

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+ST ++ VL+ G     F   RG+RQGD LSPYLF++VM+ FS+ L+
Sbjct  186  GFGEKWIRWIKRCISTASFSVLVNGTPTGFFQSSRGLRQGDPLSPYLFVIVMEVFSAFLK  245

Query  377  RREEIGGIHAIRI  339
            R  E G +   R+
Sbjct  246  RAVEGGFLSGCRV  258



>ref|XP_008387110.1| PREDICTED: uncharacterized protein LOC103449564 [Malus domestica]
Length=495

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ CV+TVTY     G+      P RGIRQGD LSP+LF++  +G S++L 
Sbjct  262  GFAEEWINWIMMCVTTVTYSFKXNGDPVGFVHPKRGIRQGDPLSPFLFVICAEGLSALLD  321

Query  377  RREEIGGIHAIRI  339
              E  G IHAI++
Sbjct  322  DWEAQGQIHAIKV  334



>gb|EEC83100.1| hypothetical protein OsI_28249 [Oryza sativa Indica Group]
Length=1300

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I+ C++TV Y +   G     F P RG+RQGD LSP+LFL V  G S +L 
Sbjct  519  GFAHRWVSWIMSCITTVRYAIKFNGTLLSTFAPTRGLRQGDPLSPFLFLFVADGLSLLLE  578

Query  377  RREEIGGIHAIRI  339
             +   G I  +RI
Sbjct  579  EKVNQGAISPVRI  591



>ref|XP_007221149.1| hypothetical protein PRUPE_ppa019822mg, partial [Prunus persica]
 gb|EMJ22348.1| hypothetical protein PRUPE_ppa019822mg, partial [Prunus persica]
Length=273

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV L++ C+S V + VLL G     F P RGI QGD +SPY F+LV    SS+L 
Sbjct  155  GFARDWVQLVMECISLVRFSVLLNGRSGTSFKPSRGITQGDPISPYFFILVSDVLSSMLN  214

Query  377  RREEIGGIHAIR  342
            +  E G +  I+
Sbjct  215  KAVEKGLVQGIK  226



>gb|ABA91837.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1301

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF  +WV +++ CV++VTY + + GE      P  G+RQGD +SPYLF +  +GFS++L 
Sbjct  1031  GFDRNWVFIVMKCVTSVTYRIKVNGEFTEQINPTGGLRQGDPISPYLFFICAEGFSTLLN  1090

Query  377   RREEIGGIHAIRI  339
               EE G +  I++
Sbjct  1091  AAEERGDLSVIKV  1103



>emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
 emb|CAB78094.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana]
Length=1274

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  ++ CV TV+Y  L+ G  +   +P RG+RQGD LSPYLF+L  +  S + R
Sbjct  538  GFHDKWIRWVMQCVCTVSYSFLINGSPQGSVVPSRGLRQGDPLSPYLFILCTEVLSGLCR  597

Query  377  RREEIGGIHAIRIA  336
            + +E G +  IR+A
Sbjct  598  KAQEKGVMVGIRVA  611



>gb|AAX95129.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|AAX95232.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1324

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF  +WV +++ CV++VTY + + GE      P  G+RQGD +SPYLF +  +GFS++L 
Sbjct  1054  GFDRNWVFIVMKCVTSVTYRIKVNGEFTEQINPTGGLRQGDPISPYLFFICAEGFSTLLN  1113

Query  377   RREEIGGIHAIRI  339
               EE G +  I++
Sbjct  1114  AAEERGDLSVIKV  1126



>ref|XP_010431573.1| PREDICTED: uncharacterized protein LOC104715904 [Camelina sativa]
Length=1211

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -1

Query  554  FGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRR  375
            F  H++SLI  C+ST ++ + + GE   HF   +G+RQGDS+SPYLF+LVM+ FS +LR+
Sbjct  612  FPAHFISLIKQCISTASFSICINGELCGHFTGSKGLRQGDSISPYLFVLVMEVFSQMLRK  671

Query  374  --REEIGGIHA  348
                 + G HA
Sbjct  672  AYNNSLIGAHA  682



>ref|XP_009102116.1| PREDICTED: uncharacterized protein LOC103828254 [Brassica rapa]
Length=1131

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HWV L+  C+S+V Y VLL G+ +   IP RG+RQGD LSPYLF++  +     ++
Sbjct  424  GFDPHWVKLMQECISSVQYRVLLNGQPRGLIIPKRGLRQGDPLSPYLFIMCTEALIMNIK  483

Query  377  RREEIGGIHAIRIALA  330
            + E +  +  +++A A
Sbjct  484  KAERMKQLTGMKVARA  499



>ref|XP_008345114.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1067

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  548  CHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRRRE  369
            C W+     CVS+ +Y +L+ G  K + +P  G+RQGD LSPYLFLL  +G S+++R+  
Sbjct  103  CXWIK---ECVSSXSYXILMNGTPKGYILPQXGLRQGDXLSPYLFLLCTEGLSALIRKGX  159

Query  368  EIGGIHAIRI  339
            E G +H +++
Sbjct  160  EXGXLHGVKV  169



>ref|XP_008367519.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=822

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  548  CHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRRRE  369
            C W+     CVS+ +Y +L+ G  K + +P  G+RQGD LSPYLFLL  +G S+++R+  
Sbjct  103  CXWIK---ECVSSTSYSILMNGTPKGYILPQXGLRQGDXLSPYLFLLCTEGLSALIRKGX  159

Query  368  EIGGIHAIRI  339
            E G +H +++
Sbjct  160  EXGXLHGVKV  169



>ref|XP_009113456.1| PREDICTED: uncharacterized protein LOC103838755 [Brassica rapa]
Length=1143

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ C+++V Y VL+ GE + + +P RG+RQGD LSP++F+L  +   S+L 
Sbjct  326  GFSETWITWIMRCITSVKYKVLMNGEPRGNIVPGRGLRQGDPLSPFIFILCTEALVSLLN  385

Query  377  RREEIGGIHAIRIALA  330
              E  G I  +R+  A
Sbjct  386  HAEIQGKITGMRVTRA  401



>emb|CAN72933.1| hypothetical protein VITISV_020615 [Vitis vinifera]
Length=705

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W + IL C+STV   VL+       F   RG+RQGD LSPYLF+L+M+ FS+++ 
Sbjct  293  GFGXKWRNXILFCISTVRMTVLVNDTPTEFFSTFRGLRQGDXLSPYLFVLIMEVFSNLIS  352

Query  377  RREEIGGIHAIRI  339
            R EE G I   ++
Sbjct  353  RAEEKGFIKGFKV  365



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+VTY VL+ G+ +   IP RG+RQGD LSPYLF+L  +   + ++
Sbjct  498  GFAQKWISWIMWCVSSVTYQVLMNGQPRGSIIPQRGLRQGDPLSPYLFILCTEVLIANIK  557

Query  377  RREEIGGIHAIRIA  336
            + E    +  I IA
Sbjct  558  KAERDKKLTGISIA  571



>ref|XP_010667378.1| PREDICTED: uncharacterized protein LOC104884431 [Beta vulgaris 
subsp. vulgaris]
Length=1243

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVS+V+Y  ++ G  +   +P RG+RQGD LSPYLF+LV   FS +++
Sbjct  490  GFDGRWVNLIMCCVSSVSYSFIINGGVRGSVVPERGLRQGDPLSPYLFILVADVFSKMIQ  549

Query  377  RREEIGGIHAIR  342
            R+ +   IH  +
Sbjct  550  RKTQEKLIHGAK  561



>gb|EEE68778.1| hypothetical protein OsJ_27492 [Oryza sativa Japonica Group]
Length=1170

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W S I+ CV++V Y+V   G     F P RG+RQGD LSPYLFLLV  G S+I++
Sbjct  462  GFCDKWRSWIMACVTSVQYNVRFNGHLLEPFSPTRGLRQGDPLSPYLFLLVADGLSNIIK  521

Query  377  RREEIGGIHAIRI  339
              E  G I  +++
Sbjct  522  SNESEGLIQPLKV  534



>ref|XP_009123659.1| PREDICTED: uncharacterized protein LOC103848514 [Brassica rapa]
Length=820

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LI+ C+S+VTY  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  69   GFHHLWIGLIMQCISSVTYSFLINGSPRGKVTPSRGIRQGDPLSPYIFILCSEVLSGLCN  128

Query  377  RREEIGGIHAIRIA  336
            + +E G I  I+++
Sbjct  129  KAQENGLIQGIQVS  142



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  566  GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            G  GF   WV  I+ C+S+V+Y   L G  + + IP RG+RQGD LSPYLFLL  + FS+
Sbjct  560  GRLGFCEGWVRRIMECLSSVSYSFKLNGSVEGNIIPSRGLRQGDPLSPYLFLLCAEAFSA  619

Query  386  ILRRREEIGGIHAIRI  339
            +L +    G IH  R+
Sbjct  620  LLSKAAGDGLIHGARV  635



>ref|XP_009140393.1| PREDICTED: uncharacterized protein LOC103864388 [Brassica rapa]
Length=1377

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I+ CV +V+Y V+L G+   HF P RGIRQGD LSP+LF+L  +     + 
Sbjct  605  GFHQRWVSWIMLCVRSVSYSVILNGQSYGHFTPERGIRQGDPLSPFLFILCAEALVHTMS  664

Query  377  RREEIGGIHAIRIA  336
            + E+ G +  +++A
Sbjct  665  KAEQEGVLTGMKLA  678



>gb|AAD32950.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=773

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W + I+ C++T TY +L+ G+  R  IP RGIRQGD +SPYL+LL  +G S++++
Sbjct  52   GFSEKWCNWIMTCITTTTYSILINGQPVRRIIPKRGIRQGDPISPYLYLLCTEGLSALIQ  111

Query  377  ---RREEIGGIHAIRIALAV  327
               + +++ G  A R   A+
Sbjct  112  ASIKAKQLHGFKASRNGPAI  131



>gb|EEC72938.1| hypothetical protein OsI_06800 [Oryza sativa Indica Group]
Length=556

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  +WV  I+ C+++V Y V L G     F P RG+RQGD LSP+LFL V  G S +L 
Sbjct  5    GFAHYWVKWIMACITSVRYAVKLNGTLLNTFAPSRGLRQGDPLSPFLFLFVADGLSLLLE  64

Query  377  RREEIGGIHAIRI  339
             + + G ++ I+I
Sbjct  65   EKVDQGAMNPIQI  77



>emb|CAN82017.1| hypothetical protein VITISV_003416 [Vitis vinifera]
Length=469

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+STV + VL+ G     F   RG+RQGD LSPYLF++ M+ FSS+LR
Sbjct  2    GFGERWIKWIDWCISTVKFSVLINGSPSPFFQSSRGLRQGDPLSPYLFVIAMEVFSSMLR  61

Query  377  RREEIGGIHAIRIA  336
            R    G +   R++
Sbjct  62   RAISGGYLSGWRVS  75



>emb|CAN61260.1| hypothetical protein VITISV_043608 [Vitis vinifera]
Length=831

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+STV Y VL+ G     F   RG+RQGD LSPYLF++VM+ FS ++R
Sbjct  148  GFGERWIKWIEWCISTVRYSVLINGSPSXFFQSSRGLRQGDPLSPYLFVIVMEVFSCLMR  207

Query  377  R  375
            R
Sbjct  208  R  208



>ref|XP_009103531.1| PREDICTED: uncharacterized protein LOC103829604 [Brassica rapa]
Length=466

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  566  GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            G  GF   W+ LI+ CVS+V+Y VL+ GE K    P RG+RQGD LSP+LF+L      S
Sbjct  18   GKMGFDPRWIHLIMRCVSSVSYQVLINGEAKGSITPSRGLRQGDPLSPFLFILCTDVLIS  77

Query  386  ILRRREEIGGIHAIRIALA  330
             +++ E+      + IA A
Sbjct  78   QIKQAEQENKFTGMIIARA  96



>ref|XP_010507122.1| PREDICTED: uncharacterized protein LOC104783698 [Camelina sativa]
Length=1200

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+S I+ CV++V Y VLL G+     +P RG+RQGD LSPYLF+L  +   + ++
Sbjct  563  GFGEIWISRIMFCVTSVEYKVLLNGQPNGRIVPERGLRQGDPLSPYLFILCTEVLVANIK  622

Query  377  RREEIGGIHAIRIA  336
            R E    I  I++A
Sbjct  623  RAEREKQITGIKVA  636



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ L+L C+STV+Y  ++ G       P RG+RQGD LSPYLFLL  +G ++++ 
Sbjct  242  GFAEQWIQLMLTCISTVSYSFVINGTPHGFLHPSRGLRQGDPLSPYLFLLCAEGLTALIA  301

Query  377  RREEIGGIHAIRI  339
            ++E  G +  + I
Sbjct  302  QKEREGFLKGVSI  314



>ref|XP_008346419.1| PREDICTED: uncharacterized protein LOC103409384 [Malus domestica]
Length=636

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  566  GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            G  GF   W  LI+ CVS+V + +LL G+  + F P RG+RQGD LSP+LFLLV + FS 
Sbjct  207  GKMGFCNRWXQLIMGCVSSVQFAILLNGQPGKRFAPSRGLRQGDXLSPFLFLLVGEVFSX  266

Query  386  ILRR  375
            ++++
Sbjct  267  LIQK  270



>emb|CAE04866.2| OSJNBa0086O06.14 [Oryza sativa Japonica Group]
Length=1205

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I+ CV++V Y V L G     F P RG+R+GD L+PYLFL +  G S+IL+
Sbjct  585  GFGNIWRKWIMSCVTSVRYSVRLNGNMLEPFYPTRGLREGDPLNPYLFLFIADGLSNILQ  644

Query  377  RREEIGGIHAIRI  339
            RR +   I  +++
Sbjct  645  RRRDERQIQPLKV  657



>gb|EEE61581.1| hypothetical protein OsJ_15963 [Oryza sativa Japonica Group]
Length=1494

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I+ CV++V Y V L G     F P RG+R+GD L+PYLFL +  G S+IL+
Sbjct  849  GFGNIWRKWIMSCVTSVRYSVRLNGNMLEPFYPTRGLREGDPLNPYLFLFIADGLSNILQ  908

Query  377  RREEIGGIHAIRI  339
            RR +   I  +++
Sbjct  909  RRRDERQIQPLKV  921



>ref|XP_010424289.1| PREDICTED: uncharacterized protein LOC104709359 [Camelina sativa]
Length=974

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I+ CVS+V Y VLL G+     IP RG+RQGD LSPYLF+L  +   + +R
Sbjct  321  GFDARWIGWIMFCVSSVEYKVLLNGQPNGLIIPERGLRQGDPLSPYLFILCTEVLIANIR  380

Query  377  RREEIGGIHAIRIA  336
            + EE   I  I++A
Sbjct  381  KAEENKLITGIKVA  394



>ref|XP_010233096.1| PREDICTED: uncharacterized protein LOC104583080 [Brachypodium 
distachyon]
Length=877

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -1

Query  560  RGFGCH--WVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            + FG H  W+S I+ CV +V Y V + G     F P RG+ QGD LSP+LFL V+ G SS
Sbjct  480  KKFGFHHTWISWIMTCVKSVRYAVKMNGHVLESFQPSRGLSQGDPLSPFLFLFVVDGLSS  539

Query  386  ILRRREEIGGIHAIRI  339
            ++ R  E   +H ++I
Sbjct  540  LITREIEAASLHDLKI  555



>emb|CAN69053.1| hypothetical protein VITISV_022963 [Vitis vinifera]
Length=2021

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  554   FGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRR  375
             FG  W   I +C+STV   VL+ G     F   RG+RQGD LSPYLF+L+M+G SS++ R
Sbjct  1408  FGPKWRKWIFYCISTVRMAVLVNGTPTDFFSTFRGLRQGDPLSPYLFVLIMEGLSSLISR  1467

Query  374   REEIGGIHAIR  342
              EE G I   +
Sbjct  1468  AEENGFIRGFK  1478



>ref|XP_009138115.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1081

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+ I+ C+S+VTY VLL G +     P RGIRQGD LSP+LF+L  +   + L 
Sbjct  303  GFDRKWVTWIMSCISSVTYSVLLNGRQHGFIKPERGIRQGDPLSPFLFILCAEALVNTLN  362

Query  377  RREEIGGIHAIRIA  336
            + E  G ++ +R++
Sbjct  363  QAEASGKLNGVRLS  376



>emb|CAE04660.2| OSJNBa0061G20.16 [Oryza sativa Japonica Group]
Length=1285

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WVS I+ CV+TV Y V   G   R F P RG+RQGD LSP+LFL V  G S +L+
Sbjct  1149  GFAHRWVSWIMSCVTTVRYSVKFNGTLLRSFAPTRGLRQGDPLSPFLFLFVADGLSLLLK  1208

Query  377   RR  372
              +
Sbjct  1209  EK  1210



>gb|AAF69169.1|AC007915_21 F27F5.21 [Arabidopsis thaliana]
Length=1023

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ C++TV Y VLL G+ +   +P RG+RQGD LSPYLF+L  +   + +R
Sbjct  447  GFCEKWISWIMWCITTVQYRVLLNGQPRGLIVPKRGLRQGDPLSPYLFILCTEVLIANIR  506

Query  377  RREEIGGIHAIRIALA  330
            + E+   I  I++A A
Sbjct  507  KAEQEKLITGIKVATA  522



>ref|XP_010417186.1| PREDICTED: uncharacterized protein LOC104702947 [Camelina sativa]
Length=1296

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   W+SLI+ CV TV+Y VL+ G      +P RG+RQGD LSPYLF+L  +    +L+
Sbjct  1078  GFSKKWISLIMSCVGTVSYQVLINGSPYGEIVPTRGLRQGDPLSPYLFVLCSEVLVRMLQ  1137

Query  377   RREEIGGIHAIRIA  336
               E    I  +++A
Sbjct  1138  DAESEDKISGLKVA  1151



>ref|XP_009125042.1| PREDICTED: uncharacterized protein LOC103850087 [Brassica rapa]
Length=741

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LI+ C+STV Y  L+ G  +    P RGIRQGD LSPY+F+L  +  S +  
Sbjct  27   GFHHQWIGLIMQCISTVKYSFLINGSPRGKVKPSRGIRQGDPLSPYIFILCSEVLSGLCN  86

Query  377  RREEIGGIHAIRIA  336
            + +  G I  I++A
Sbjct  87   KAQAEGRIEGIKVA  100



>ref|XP_009107553.1| PREDICTED: uncharacterized protein LOC103833206 [Brassica rapa]
Length=800

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF    V LI+ CV++++Y V++ GE +   IP RG+RQGD LSP+LF+L  +   S+L+
Sbjct  97   GFAEKLVDLIMFCVTSISYQVIINGEPRGKIIPTRGLRQGDPLSPFLFILCTEALISLLK  156

Query  377  RREEIGGIHAIRIALA  330
              E+   I  +R+A A
Sbjct  157  GAEDEKRILGLRVARA  172



>ref|XP_010667771.1| PREDICTED: uncharacterized protein LOC104884775 [Beta vulgaris 
subsp. vulgaris]
Length=977

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 6/71 (8%)
 Frame = -1

Query  545  HWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSIL---RR  375
            HW   I+ CVSTV+Y VL+ GE  R F P  G+RQGD LSPYLF++VM+ FS ++   + 
Sbjct  536  HW---IMQCVSTVSYSVLINGEVTRRFKPKCGLRQGDPLSPYLFIMVMEVFSRMIMQAQE  592

Query  374  REEIGGIHAIR  342
            R +I GI   R
Sbjct  593  RRQIVGIQLSR  603



>ref|XP_009118154.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=538

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+   + C+STVTY  L+ G  +   +P RGIRQGD LSPY+F++  +  S +  
Sbjct  27   GFHRDWIRATMQCISTVTYSFLINGLPREKVVPSRGIRQGDPLSPYIFIMCSEVLSGLCN  86

Query  377  RREEIGGIHAIRIA  336
            R +E G +  +++A
Sbjct  87   RAQEEGSLQGLQVA  100



>ref|XP_010687189.1| PREDICTED: uncharacterized protein LOC104901325 [Beta vulgaris 
subsp. vulgaris]
Length=584

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -1

Query  554  FGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRR  375
            F  +WV  I+ C++TVTY +L+ GE  + F P  G+RQGD LS Y+F+L M+  S  L +
Sbjct  439  FPENWVQWIMQCITTVTYSILINGEPSKVFKPLAGLRQGDPLSSYIFILCMEVLSRSLTQ  498

Query  374  REEIGGIHAIRIALAVGK  321
             ++I  +  ++IA    K
Sbjct  499  AQDIKTLEGLKIARNAPK  516



>ref|XP_009102759.1| PREDICTED: uncharacterized protein LOC103828873 [Brassica rapa]
Length=1081

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I  C+S+V+Y+VL+ GE K +  P RGIRQGD LSP+LF+++ +   S ++
Sbjct  464  GFTDRWIAWIHLCISSVSYNVLINGEPKGNITPSRGIRQGDPLSPFLFIILTEALISQIQ  523

Query  377  RREEIGGIHAIRIA  336
              E  G I  ++IA
Sbjct  524  GAEREGRITGLKIA  537



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W  LI+ CVS+V + VLL G+    F P RG+RQGD LSPYLFLLV +  S +++
Sbjct  550  GFGSSWRKLIMGCVSSVNFAVLLNGQPGEKFAPSRGLRQGDPLSPYLFLLVGEVLSKMIQ  609



>gb|EEE66599.1| hypothetical protein OsJ_23164 [Oryza sativa Japonica Group]
Length=813

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = -1

Query  590  MCSLRVR*GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFL  411
            MC L       GF   W+  I+ C+S+V Y +   G     F P RG+RQGD LSP+LFL
Sbjct  667  MCKL-------GFAPRWIKWIMTCLSSVRYSIKFNGTLLDTFAPSRGLRQGDPLSPFLFL  719

Query  410  LVMKGFSSILRRREEIGGIHAIRI  339
             V  GFS ++  R   G I  ++I
Sbjct  720  FVADGFSRLMEERVAAGDITPVKI  743



>emb|CAN83582.1| hypothetical protein VITISV_001564 [Vitis vinifera]
Length=1199

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F   +G+RQGD LSPYLF++ M+  S+++R
Sbjct  365  GFGAKWREWIWSCISTTKFSVLVNGEPAGFFSSSKGLRQGDPLSPYLFIMGMEVLSALIR  424

Query  377  RREEIGGIHAIRIALAVGK  321
            R  E G I   RI    G+
Sbjct  425  RAVEGGCISGCRIQRGRGQ  443



>ref|XP_009122881.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=744

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LIL CV+TV++  L+    K   +P RGIRQGD LSPY+F+L  +  S +  
Sbjct  2    GFHQKWIQLILQCVTTVSFSFLINDAAKGRVVPERGIRQGDPLSPYIFILCSEVLSGLCA  61

Query  377  RREEIGGIHAIRIA  336
            R +  G +  IR+A
Sbjct  62   RAQIDGSLQGIRVA  75



>ref|XP_010468816.1| PREDICTED: uncharacterized protein LOC104748941 [Camelina sativa]
Length=988

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+V+Y VLL G+ + +  P RG+RQGD LSPYLF+L  +   + ++
Sbjct  101  GFDRKWISWIMWCVSSVSYQVLLNGQPRGYIKPQRGLRQGDPLSPYLFILCTEVLIANIK  160

Query  377  RREEIGGIHAIRIA  336
            + E    I  I+IA
Sbjct  161  KAEREHRISGIKIA  174



>ref|XP_007224193.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica]
 gb|EMJ25392.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica]
Length=916

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -1

Query  563  GRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSI  384
            G GF   W+ LI+  V+TV+Y  +L G    + IP RG+RQGD LSPYLFLL  +  SS+
Sbjct  478  GMGFAPRWIQLIMEYVTTVSYSFMLNGNPVGYVIPQRGLRQGDPLSPYLFLLCAEALSSL  537

Query  383  LRRREEIGGIHAIRI  339
            + + E    +H + +
Sbjct  538  ILQAERRNLLHGVNL  552



>ref|XP_007212995.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
Length=887

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -1

Query  566  GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            G  GF   W++L+L C+S+V+Y  L+ G    +  P RG+RQGD LSPYLFL   +G S+
Sbjct  175  GKLGFNARWINLVLTCISSVSYSFLINGILTGYLHPSRGLRQGDPLSPYLFLFCAEGLST  234

Query  386  ILRRRE  369
            ++ ++E
Sbjct  235  LIAKKE  240



>ref|XP_010026542.1| PREDICTED: uncharacterized protein LOC104416906 [Eucalyptus grandis]
Length=870

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+HCVS+ +  V   GE    F P RG+RQGD LSPYLF+LV    SS++ 
Sbjct  195  GFQDKWISWIMHCVSSTSLSVKFNGELLPSFQPSRGLRQGDPLSPYLFILVANLLSSLIL  254

Query  377  RREEIGGIHAIRI  339
            +  ++G +  I++
Sbjct  255  QAIDMGSLRGIKL  267



>emb|CAN71912.1| hypothetical protein VITISV_018965 [Vitis vinifera]
Length=1856

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F   +G+RQGD LSPYLF++ M+  S+++R
Sbjct  722  GFGTKWKEWIWSCISTAKFSVLVNGEPAGFFSSSKGLRQGDPLSPYLFIMGMEVLSALIR  781

Query  377  RREEIGGIHAIRIALAVGK  321
            R  E G I   RI    G+
Sbjct  782  RAVEGGCISGYRIQRGRGQ  800



>ref|XP_008373306.1| PREDICTED: uncharacterized protein LOC103436642 [Malus domestica]
Length=847

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  566  GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSS  387
            G  GF   W  LI+ CVS+V + +LL G+  + F P RG+RQGD LSP+LFLLV + FS 
Sbjct  207  GKMGFCNRWQQLIMGCVSSVQFAILLNGQPGKRFAPSRGLRQGDPLSPFLFLLVGEVFSX  266

Query  386  ILRR  375
            ++++
Sbjct  267  LIQK  270



>emb|CAN67355.1| hypothetical protein VITISV_002170 [Vitis vinifera]
Length=1385

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F   RG+RQGD LSPYLF++ M+  S+ +R
Sbjct  813  GFGVKWREWIWSCISTAKFSVLINGEPAGFFSSSRGLRQGDPLSPYLFIMGMEVLSAFIR  872

Query  377  RREEIGGIHAIRIALAVGK  321
            R  E G I   RI    G+
Sbjct  873  RAVEGGCISGCRIQRGRGQ  891



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = -1

Query  590   MCSLRVR*GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFL  411
             MC L       GF   W+  I+ C+S+V Y +   G     F P RG+RQGD LSP+LFL
Sbjct  1168  MCKL-------GFAPRWIKWIMTCLSSVRYSIKFNGTLLDTFAPSRGLRQGDPLSPFLFL  1220

Query  410   LVMKGFSSILRRREEIGGIHAIRI  339
              V  GFS ++  R   G I  ++I
Sbjct  1221  FVADGFSRLMEERVAAGDITPVKI  1244



>ref|XP_010418618.1| PREDICTED: uncharacterized protein LOC104704191 [Camelina sativa]
Length=1833

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  563   GRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSI  384
             G GF   WV L++ CV++VTY VL+ G+      P RG+RQGD LSP LF+L  +G + +
Sbjct  1061  GLGFHQRWVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTHL  1120

Query  383   LRRREEIGGIHAIRIA  336
             L + E  G I+ I+ +
Sbjct  1121  LNKAESEGKIYGIQFS  1136



>ref|XP_010419439.1| PREDICTED: uncharacterized protein LOC104705159 [Camelina sativa]
Length=1840

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -1

Query  563   GRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSI  384
             G GF   WV L++ CV++VTY VL+ G+      P RG+RQGD LSP LF+L  +G + +
Sbjct  1061  GLGFHQRWVQLVMFCVTSVTYTVLINGQPFGIINPQRGLRQGDPLSPALFVLCAEGLTHL  1120

Query  383   LRRREEIGGIHAIRIA  336
             L + E  G I+ I+ +
Sbjct  1121  LNKAESEGKIYGIQFS  1136



>ref|XP_010513530.1| PREDICTED: uncharacterized protein LOC104789549 [Camelina sativa]
Length=972

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+S I+ CV++V Y VLL G+     +P RG+RQGD LSPYLF+L  +   + ++
Sbjct  311  GFGEIWISRIMFCVTSVEYKVLLNGQPNGRIVPERGLRQGDPLSPYLFILCTEVLVANIK  370

Query  377  RREEIGGIHAIRIA  336
            R E    I  I+ A
Sbjct  371  RAEREKQITGIKFA  384



>emb|CAN70698.1| hypothetical protein VITISV_029728 [Vitis vinifera]
Length=762

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+STV + VL+ G     F   RG++QGD LSPYLF++ M+ FSS+LR
Sbjct  455  GFGERWIKWIDWCISTVKFSVLINGSPSGFFQSSRGLKQGDPLSPYLFMIAMEVFSSMLR  514

Query  377  RREEIGGIHAIRIA  336
            R    G +   R++
Sbjct  515  RAISGGYLSGWRVS  528



>ref|XP_010495271.1| PREDICTED: uncharacterized protein LOC104772340 [Camelina sativa]
Length=906

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV +++ CV+TVTY VL+ G+      P RGIRQGD LSP LF+L  +G + +L 
Sbjct  150  GFHRKWVDMVMFCVTTVTYTVLINGQPFGLINPQRGIRQGDPLSPALFVLCAEGLTHLLN  209

Query  377  RREEIGGIHAIRIA  336
            + E  G I+ I+ +
Sbjct  210  KAEAAGQINGIQFS  223



>emb|CAN70374.1| hypothetical protein VITISV_006751 [Vitis vinifera]
Length=368

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F+  +G+RQGD LSPYLF++ M+  S+++R
Sbjct  291  GFGTKWREWIWSCISTAKFSVLVNGEPAGFFLSSKGLRQGDPLSPYLFIMGMEVLSALIR  350

Query  377  RREEIGGIHAIRIALAVG  324
            R  E G I   RI    G
Sbjct  351  RAVEGGCITGCRIQRGRG  368



>ref|XP_009111228.1| PREDICTED: uncharacterized protein LOC103836687 [Brassica rapa]
Length=878

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -1

Query  554  FGCH--WVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSIL  381
            FG H  W+S ++ CVS+V+Y  L+ GE +   +P RGIRQGD LSPYLF+L  +  S + 
Sbjct  161  FGFHEIWISWVMACVSSVSYSYLVNGEAQGCVLPSRGIRQGDPLSPYLFILCTEVLSGLC  220

Query  380  RRREEIGGIHAIRIA  336
            R+ +  G +  +++A
Sbjct  221  RKAQLKGEVIGVKVA  235



>gb|EEC75230.1| hypothetical protein OsI_11503 [Oryza sativa Indica Group]
Length=746

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  ++ CV+TV Y V   G     F P RG+RQGD LSPYLFL V  G S+IL 
Sbjct  215  GFCSTWVEWVMACVTTVKYSVSFNGNLLEPFSPSRGLRQGDPLSPYLFLFVADGLSTILS  274

Query  377  RREEIGGIHAIRI  339
            +  + G +  +++
Sbjct  275  QDVQAGRLEELKV  287



>ref|XP_010238942.1| PREDICTED: uncharacterized protein LOC100831270 [Brachypodium 
distachyon]
Length=1468

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+ I+ CV +V+Y V   G     F P RG+RQGD LSPYLFLLV +G S+ ++
Sbjct  118  GFHSRWVNWIMECVCSVSYSVRFNGNLLEKFNPSRGLRQGDPLSPYLFLLVAEGLSASIQ  177

Query  377  RREEIGGIHAIRI  339
             +   G +  ++I
Sbjct  178  SKTASGMLEDLKI  190



>ref|XP_010673168.1| PREDICTED: uncharacterized protein LOC104889608 [Beta vulgaris 
subsp. vulgaris]
Length=1712

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WV  ++ CVS+V Y  ++ G+     IP RG+RQGD +SPYLF+LV   FS+++R
Sbjct  984   GFADSWVKCVMDCVSSVRYSFVVNGDVCGSVIPSRGLRQGDPISPYLFILVADAFSALVR  1043

Query  377   RREEIGGIHAIR  342
             +      IH I+
Sbjct  1044  KAVADKSIHGIQ  1055



>gb|EEC83650.1| hypothetical protein OsI_29398 [Oryza sativa Indica Group]
Length=1212

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W S I+ CV++V Y V   G     F P RG+RQGD LSPYLFLLV  G S+I++
Sbjct  578  GFCDKWQSWIMACVTSVQYSVRFNGHLLEPFSPTRGLRQGDPLSPYLFLLVADGLSNIIK  637

Query  377  RREEIGGIHAIR  342
              E  G I  ++
Sbjct  638  SNESEGLIQPLK  649



>gb|EEE59033.1| hypothetical protein OsJ_10782 [Oryza sativa Japonica Group]
Length=850

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  ++ CV+TV Y V   G     F P RG+RQGD LSPYLFL V  G S+IL 
Sbjct  320  GFCSTWVEWVMACVTTVKYSVSFNGNLLEPFSPSRGLRQGDPLSPYLFLFVADGLSTILS  379

Query  377  RREEIGGIHAIRI  339
            +  + G +  +++
Sbjct  380  QDVQAGRLEELKV  392



>ref|XP_008338205.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=950

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  548  CHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRRRE  369
            C WV   + CV TV+Y V++ GE   +  P RGI+QGD LSP+LFL+  +GF+S+L   E
Sbjct  248  CQWV---MACVKTVSYXVVVNGETTGYIKPRRGIQQGDXLSPFLFLICAEGFTSLLHNXE  304

Query  368  EIGGIHAIRI  339
            E+G +  + +
Sbjct  305  EMGRLRGMSV  314



>ref|XP_004301927.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=968

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF    V LI+ CV +V++ VL  GE      P RG+RQGD LSPYLFL+V +G + +L+
Sbjct  226  GFDEKLVELIMRCVRSVSFSVLWNGEAVGLINPTRGLRQGDPLSPYLFLMVSEGLTGLLQ  285

Query  377  RREEIGGIHAIRIAL  333
            + +  G IH ++ A+
Sbjct  286  KADREGMIHGVKAAV  300



>gb|ABF95850.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=940

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  ++ CV+TV Y V   G     F P RG+RQGD LSPYLFL V  G S+IL 
Sbjct  320  GFCSTWVEWVMACVTTVKYSVSFNGNLLEPFSPSRGLRQGDPLSPYLFLFVADGLSTILS  379

Query  377  RREEIGGIHAIRI  339
            +  + G +  +++
Sbjct  380  QDVQAGRLEELKV  392



>ref|XP_009149305.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=963

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ L + CV TV+Y VL+ G    +F P RG+RQGD++SPYLFLL ++  S +L 
Sbjct  227  GFDPQWIELTMECVQTVSYSVLINGLPYGNFRPSRGLRQGDAMSPYLFLLCVEVLSQMLD  286

Query  377  RREEI  363
            R +++
Sbjct  287  RAQDL  291



>ref|XP_010507236.1| PREDICTED: uncharacterized protein LOC104783832 [Camelina sativa]
Length=1127

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV LI+ CV++VTY VL+ G+      P RG+RQGD LSP+LF+L  +G + +L 
Sbjct  430  GFHSSWVDLIIKCVTSVTYTVLINGQPHGMVFPERGLRQGDPLSPFLFVLCAEGLTHLLN  489

Query  377  RREE  366
            + E+
Sbjct  490  KAEQ  493



>emb|CAN65248.1| hypothetical protein VITISV_024218 [Vitis vinifera]
Length=1384

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  +  C+S V++ +L+ G    +F   RG+RQGD LSPYLF+++M+ FSS+LR
Sbjct  755  GFGEKWIRWMKWCISIVSFSILVNGSSSGYFQSSRGLRQGDPLSPYLFVMIMEAFSSLLR  814

Query  377  RREEIGGIHAIR  342
               + G + A +
Sbjct  815  SAVDGGFVLACK  826



>ref|XP_010678308.1| PREDICTED: uncharacterized protein LOC104893877 [Beta vulgaris 
subsp. vulgaris]
Length=581

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  560  RGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSIL  381
            +GF   WV+LI++CVS+V+Y  ++ G       P RG+RQGD LSPYLF+L++  FS+++
Sbjct  24   KGFDGRWVNLIMNCVSSVSYSFIINGGVCGSVTPGRGLRQGDPLSPYLFILIVDAFSNMI  83

Query  380  RRREEIGGIH  351
            + + +   IH
Sbjct  84   QSKVQEKQIH  93



>ref|XP_010684019.1| PREDICTED: uncharacterized protein LOC104898622 [Beta vulgaris 
subsp. vulgaris]
Length=1162

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+L ++CVS+VTY  ++ G      +P RG+RQGD LSPYLF+++   FS +++
Sbjct  522  GFDGRWVNLSMNCVSSVTYSFIINGGVCGSVVPARGLRQGDPLSPYLFIMIADAFSKMIQ  581

Query  377  RREEIGGIHAIR  342
            ++ +   IH  +
Sbjct  582  KKVQDKQIHGAK  593



>ref|XP_009121338.1| PREDICTED: uncharacterized protein LOC103846184 [Brassica rapa]
Length=1285

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W  LI+ CVSTV+Y  L+         P RGIRQGD LSPYLF+L  +  S + +
Sbjct  561  GFHSKWSQLIMQCVSTVSYSYLINDSVHGSVTPQRGIRQGDPLSPYLFILCGQVLSGLCQ  620

Query  377  RREEIGGIHAIRIA  336
            + E+ G +  IR+A
Sbjct  621  KAEKEGTLQGIRVA  634



>emb|CAN79131.1| hypothetical protein VITISV_034693 [Vitis vinifera]
Length=558

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F   RG+RQGD LSPYLF++ M+  S+ +R
Sbjct  356  GFGVKWREWIWSCISTAKFSVLINGEPAGFFSSSRGLRQGDPLSPYLFIMGMEVLSAFIR  415

Query  377  RREEIGGIHAIRIALAVGK  321
            R  E G I   RI    G+
Sbjct  416  RAVEGGCISGCRIQRGRGQ  434



>dbj|BAF01759.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=400

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ C+S+V+Y +LL G  K    P RGIRQGD +SP+LF+L  +   + L+
Sbjct  178  GFAQKWVDWIIFCISSVSYKILLNGSPKGFIKPSRGIRQGDPISPFLFILCTEALVAKLK  237

Query  377  RREEIGGIHAIRIALA  330
              E  G I  ++I+ A
Sbjct  238  DAEWHGRIQGLQISRA  253



>ref|XP_010430664.1| PREDICTED: uncharacterized protein LOC104714891 [Camelina sativa]
Length=1271

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+V Y VL+  +     +P RG+RQGD LSPYLF+L M+   + +R
Sbjct  564  GFAEIWISWIMFCVSSVEYKVLINRQPNGQIVPARGLRQGDPLSPYLFILCMEVLIANIR  623

Query  377  RREEIGGIHAIRIA  336
            + E    I +I++A
Sbjct  624  KAEADKRITSIKVA  637



>gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana]
Length=1142

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ C++TV Y VL+ G+ K   IP RG+RQGD LSPYLF+L  +   + +R
Sbjct  381  GFCEKWISWIMWCITTVQYKVLINGQPKGLIIPERGLRQGDPLSPYLFILCTEVLIANIR  440

Query  377  RREEIGGIHAIRIA  336
            + E    I  I++A
Sbjct  441  KAERQNLITGIKVA  454



>ref|XP_010686886.1| PREDICTED: uncharacterized protein LOC104901041 [Beta vulgaris 
subsp. vulgaris]
Length=1205

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HW++++  C+STV+Y +L+ G+  + F P  G+RQGD LSPYLFL  M   S +  
Sbjct  477  GFPDHWLTMVKECISTVSYRILINGDTSQPFTPTCGLRQGDPLSPYLFLFCMDILSRMTT  536

Query  377  RREEIGGIHAIRIA  336
               ++  +  IRI 
Sbjct  537  LATDLRHLQGIRIG  550



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 7/88 (8%)
 Frame = -1

Query  593  IMCSLRVR*GGRGFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLF  414
            +MCSL       GF   +   I  C+S+V++ VL+ G     F P RG+RQGD LSP+LF
Sbjct  595  MMCSL-------GFAPLFXKWIKECISSVSFSVLINGSPTGXFRPNRGLRQGDXLSPFLF  647

Query  413  LLVMKGFSSILRRREEIGGIHAIRIALA  330
            LL  +G   ++RR  E G +H  +I+ A
Sbjct  648  LLCTEGLXMLIRRGLERGVLHGFKISXA  675



>ref|XP_010495217.1| PREDICTED: uncharacterized protein LOC104772285 [Camelina sativa]
Length=1122

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I++CVS+V Y VLL G+      P RG+RQGD LSPYLF+L  +   + +R
Sbjct  395  GFSDRWISWIMYCVSSVDYKVLLNGQPHGFIQPARGLRQGDPLSPYLFILCTEVLIANVR  454

Query  377  RREEIGGIHAIRIA  336
            + E    I  I++A
Sbjct  455  KAEREKLITGIKVA  468



>ref|XP_010419021.1| PREDICTED: uncharacterized protein LOC104704671 [Camelina sativa]
Length=1180

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+ LI+ C+ +V Y VL+        IP RG RQGD LSPYLF+L  +    +L+
Sbjct  609  GFSAKWIHLIMSCMESVNYQVLINFTPYGEIIPTRGFRQGDPLSPYLFVLCTEMLVRMLQ  668

Query  377  RREEIGGIHAIRIA  336
            R EE G I  + +A
Sbjct  669  RAEEEGRISGLTVA  682



>ref|XP_009757737.1| PREDICTED: uncharacterized protein LOC104210521 isoform X2 [Nicotiana 
sylvestris]
Length=247

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             FG  W+  I +C+STV   +L+ G  +  F   RG+RQGD LSP LF LVM+ FS +L+
Sbjct  53   NFGDKWIEWINYCISTVRCSILINGNPRGFFKSHRGLRQGDPLSPCLFTLVMEAFSMMLK  112

Query  377  RREEIGGIHAI  345
            R E +G I  +
Sbjct  113  RAENLGWIKGM  123



>gb|AAL78659.1|AF405557_1 reverse transcriptase [Fagus sylvatica]
Length=168

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  WV  +  CVSTV Y V++ G     F   RG+RQGD LSP LFL++M+  + +LR
Sbjct  91   GFGRKWVCWMKACVSTVRYSVIVNGSPTGFFDSSRGLRQGDPLSPLLFLVIMEVLNPMLR  150

Query  377  RREE  366
            R EE
Sbjct  151  RTEE  154



>ref|XP_010419407.1| PREDICTED: uncharacterized protein LOC104705120 [Camelina sativa]
Length=676

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  I  CVSTV+Y  L+ G  + H  P RG+RQGD LSPYLF+   +  S + R
Sbjct  97   GFHQKWIQWIHQCVSTVSYSFLINGSSQGHLTPSRGLRQGDPLSPYLFIQCSEALSGLCR  156

Query  377  RREEIGGIHA  348
            + ++ G + A
Sbjct  157  KAQQDGTLPA  166



>emb|CAN83601.1| hypothetical protein VITISV_033095 [Vitis vinifera]
Length=775

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+STV Y VL+ G     F   RG+RQGD LSPYLF++V++ FS ++R
Sbjct  297  GFGERWIKWIEWCISTVRYFVLINGSPSGFFRSSRGLRQGDPLSPYLFVIVIEVFSCLMR  356

Query  377  R  375
            R
Sbjct  357  R  357



>ref|XP_010495306.1| PREDICTED: uncharacterized protein LOC104772378 [Camelina sativa]
Length=885

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S ++ C+S+V Y VL+ G+     +P RG+RQGD LSPYLF+L  +   + +R
Sbjct  167  GFAERWISWMMFCISSVEYKVLINGQPNGRIVPARGLRQGDPLSPYLFILCTEVLIANIR  226

Query  377  RREEIGGIHAIRIA  336
            + E    I  I++A
Sbjct  227  KAEADKRITGIKVA  240



>emb|CAN72707.1| hypothetical protein VITISV_043786 [Vitis vinifera]
Length=1372

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F   +G+RQGD LSPYLF++ M+  S++LR
Sbjct  757  GFGTKWREWIWSCISTAKFSVLVNGEPAGFFPSSKGLRQGDPLSPYLFIMGMEVLSALLR  816

Query  377  RREEIGGIHAIRIALA  330
            R  E G I   R+  A
Sbjct  817  RAVEGGCITGCRMQRA  832



>ref|XP_010665123.1| PREDICTED: transposon TX1 uncharacterized 149 kDa protein [Vitis 
vinifera]
Length=629

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+STV Y VL+ G     F   RG+RQGD LSPYLF++VM+ F+ ++R
Sbjct  355  GFGERWIKWIEWCISTVRYSVLINGSPSGFFQSSRGLRQGDPLSPYLFVIVMEVFNCLMR  414

Query  377  RREEIGGIHAIRI  339
            R    G +   R+
Sbjct  415  RAISGGFLSGWRV  427



>ref|XP_008393387.1| PREDICTED: uncharacterized protein LOC103455579 [Malus domestica]
Length=876

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  548  CHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRRRE  369
            C WV   + CV TV+Y V++ GE   +  P RGI+QGD LSP+LFL+  +GF+S+L   E
Sbjct  164  CQWV---MACVKTVSYXVVVNGETTGYIKPRRGIQQGDXLSPFLFLICAEGFTSLLHNAE  220

Query  368  EIGGIHAIRI  339
            E+G +  + +
Sbjct  221  EMGRLRGMSV  230



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+ CVS+V+Y  ++ G  +   +P RG+RQGD LSPYLF+LV   FS +++
Sbjct  515  GFDGRWVNLIMWCVSSVSYSFIINGRVRGSVVPNRGLRQGDPLSPYLFILVADIFSKMIQ  574

Query  377  RREEIGGIHAIR  342
            ++ +   +H  +
Sbjct  575  KKVQEKRLHGAK  586



>ref|XP_009757736.1| PREDICTED: uncharacterized protein LOC104210521 isoform X1 [Nicotiana 
sylvestris]
Length=250

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             FG  W+  I +C+STV   +L+ G  +  F   RG+RQGD LSP LF LVM+ FS +L+
Sbjct  53   NFGDKWIEWINYCISTVRCSILINGNPRGFFKSHRGLRQGDPLSPCLFTLVMEAFSMMLK  112

Query  377  RREEIGGIHAI  345
            R E +G I  +
Sbjct  113  RAENLGWIKGM  123



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W  LI+ CVS+V + VLL G+    F    G+RQGD LSPYLFLLV K  S +++
Sbjct  183  GFGISWRKLIMGCVSSVNFAVLLNGQPGEKFAHSHGLRQGDPLSPYLFLLVGKVLSRMIQ  242

Query  377  RREEIGGIHAIRIALA  330
               E   +  +++++A
Sbjct  243  EAVERRQLEGVKLSVA  258



>ref|XP_010474601.1| PREDICTED: uncharacterized protein LOC104754160 [Camelina sativa]
Length=1368

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HW ++I+ CVS+V Y VL+ G       P RG+RQGD LSPYLFL+  +    + +
Sbjct  589  GFSEHWRAMIMECVSSVQYQVLINGSPYGDIRPTRGLRQGDPLSPYLFLICTEMLVKMFQ  648

Query  377  RREEIGGIHAIRIA  336
              E  G I  +++A
Sbjct  649  HAENNGKITGLQVA  662



>ref|XP_009126341.1| PREDICTED: uncharacterized protein LOC103851249 [Brassica rapa]
Length=1160

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ CV+TVTY VLL G+   +  P RG+RQGD +SP+LF+L  +G + ++ 
Sbjct  435  GFDNIWVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGDPISPFLFVLCTEGLTHMMN  494

Query  377  RREEIGGIHAIRIALA  330
            +    G +  I+  LA
Sbjct  495  QASLRGDLKGIQFNLA  510



>ref|XP_009150816.1| PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]
Length=1205

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ CV+TVTY VLL G+   +  P RG+RQGD +SP+LF+L  +G + ++ 
Sbjct  435  GFDNIWVKWIMSCVTTVTYSVLLNGQSYGYISPQRGLRQGDPISPFLFVLCTEGLTHMMN  494

Query  377  RREEIGGIHAIRIALA  330
            +    G +  I+  LA
Sbjct  495  QASLRGDLKGIQFNLA  510



>ref|XP_006485451.1| PREDICTED: uncharacterized protein LOC102622884 [Citrus sinensis]
Length=1160

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+SLI+ C+S+V++ V++ G  K    P RG+RQG  +SPYLF+   + FSS+L+
Sbjct  368  GFSHQWISLIMRCISSVSFSVIINGSVKGFIKPQRGLRQGCPISPYLFITCAEAFSSLLQ  427

Query  377  RREEIGGIHAI  345
            + E+   IH +
Sbjct  428  QAEQQRLIHGL  438



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI++CV+TV Y  ++ G+ +    P RG+RQGD LSPYLF+LV   FS +L 
Sbjct  404  GFDGRWVNLIMNCVTTVQYSFVINGQVRGAVSPSRGLRQGDPLSPYLFILVADAFSKMLL  463

Query  377  RREEIGGIHAIR  342
               +   IH  +
Sbjct  464  NAVQEKRIHGAK  475



>ref|XP_010495329.1| PREDICTED: uncharacterized protein LOC104772406 [Camelina sativa]
Length=1131

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+V Y VL+ G+     IP RG+RQGD LSPYLF+L  +   + +R
Sbjct  535  GFAEKWISWIMLCVSSVQYQVLVNGQPHGQIIPERGLRQGDPLSPYLFILCTEVLIANIR  594

Query  377  RREEIGGIHAIRIA  336
            + E    I  I++A
Sbjct  595  KAEVDKRITGIKVA  608



>ref|XP_010041058.1| PREDICTED: uncharacterized protein LOC104429964 [Eucalyptus grandis]
Length=1350

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I  C+STV+  +   G++  +F P RGIRQGD LSPYLF+L+    S+++ 
Sbjct  606  GFHPQWVQWIFQCISTVSISIKFNGQQLDYFRPTRGIRQGDPLSPYLFILLTNLLSNLIH  665

Query  377  RREEIGGIHAIRI  339
            R  ++G +  +++
Sbjct  666  RAIDMGQLTGVKL  678



>ref|XP_010513760.1| PREDICTED: uncharacterized protein LOC104789816 [Camelina sativa]
Length=950

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV +I++CVS+V+Y VL+ G+      P RG+RQGD LSP LF+L  +G + +L 
Sbjct  191  GFQRRWVDMIMYCVSSVSYTVLINGQPFGLINPQRGLRQGDPLSPALFVLCAEGLTHLLN  250

Query  377  RREEIGGIHAIRIA  336
            R E  G ++ I+ +
Sbjct  251  RAELDGSLNGIQFS  264



>ref|XP_009776546.1| PREDICTED: uncharacterized protein LOC104226294, partial [Nicotiana 
sylvestris]
Length=158

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -1

Query  554  FGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRR  375
            FG  W+  I +C+STV + VL+ G  + +F   RG RQ D LSPYLFLL+M+  S +L++
Sbjct  3    FGERWIGWIKYCISTVNFSVLINGCPQGYFKSYRGPRQRDPLSPYLFLLMMEILSILLQK  62

Query  374  REEIGGIHAIR  342
             E +G I  ++
Sbjct  63   AENLGWIRGLK  73



>ref|XP_010692477.1| PREDICTED: uncharacterized protein LOC104905588 [Beta vulgaris 
subsp. vulgaris]
Length=1260

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+  VS+VTY  ++ G      +P RG+RQGD LSPYLF++V   FS +++
Sbjct  506  GFDGRWVNLIMEFVSSVTYSFIINGSVCGSVVPARGLRQGDPLSPYLFIMVADAFSKMIQ  565

Query  377  RREEIGGIHAIR  342
            R+ +   +H  +
Sbjct  566  RKVQDKQLHGAK  577



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+LI+  VS+VTY  ++ G      +P RG+RQGD LSPYLF++V   FS +++
Sbjct  601  GFDGRWVNLIMEFVSSVTYSFIINGSVCGSVVPARGLRQGDPLSPYLFIMVADAFSKMIQ  660

Query  377  RREEIGGIHAIR  342
            R+ +   +H  +
Sbjct  661  RKVQDKQLHGAK  672



>ref|XP_010039996.1| PREDICTED: uncharacterized protein LOC104428743 [Eucalyptus grandis]
Length=1237

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV L++ C++T +  V   GE+   F P RG+RQGD LSPY+F+L+    S+++ 
Sbjct  473  GFNDRWVRLVMACITTTSLSVRFNGEQLASFQPSRGLRQGDPLSPYIFILLANALSTLIT  532

Query  377  RREEIGGIHAIRIALA  330
            +  E+G +  I+   A
Sbjct  533  QAVEMGQLQGIKFNRA  548



>ref|XP_008384443.1| PREDICTED: uncharacterized protein LOC103447050 [Malus domestica]
Length=1379

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   +   I   +S+V++ +L+ G    H  P  G+RQGD LSP+LFLL  +GFSS++R
Sbjct  27   GFAPMFCDRIKEYISSVSFSILINGSPTGHIYPEMGLRQGDPLSPFLFLLCTEGFSSLIR  86

Query  377  RREEIGGIHAIRI  339
            R  E G +H I++
Sbjct  87   RSMERGSLHGIKL  99



>gb|EEC77887.1| hypothetical protein OsI_17181 [Oryza sativa Indica Group]
Length=1026

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I+ CV++V Y V L G     F P RG+R+GD L+PYLF+ +  G S+IL+
Sbjct  454  GFGNIWRKWIMSCVTSVRYSVRLNGNMLEPFYPTRGLREGDPLNPYLFIFIADGLSNILQ  513

Query  377  RREEIGGIHAIR  342
            RR +   I  ++
Sbjct  514  RRRDERQIQPLK  525



>emb|CAN72456.1| hypothetical protein VITISV_026051 [Vitis vinifera]
Length=1130

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+ST  + VL+ GE    F   +G+RQGD LSPYLF++ M+  S+++R
Sbjct  634  GFGTKWREWIWSCISTTKFSVLVNGEPTGFFSSSKGLRQGDPLSPYLFIMGMEVLSALIR  693

Query  377  RREEIGGIHAIRIALAVGK  321
            R  E G I   RI    G+
Sbjct  694  RAMEGGCITRCRIQRGRGQ  712



>ref|XP_010419086.1| PREDICTED: uncharacterized protein LOC104704751 [Camelina sativa]
Length=1113

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WVS I+ CVS+V+Y V+L G+ K    P RG+RQGD LSPYLF L  + F + ++
Sbjct  245  GFDRKWVSWIMWCVSSVSYQVILNGQPKGFIKPQRGLRQGDPLSPYLFSLCTEVFIANIK  304

Query  377  ---RREEIGGIHAIR  342
               R + I GI+  R
Sbjct  305  KAEREQRISGINLFR  319



>ref|XP_010478572.1| PREDICTED: uncharacterized protein LOC104757523 isoform X2 [Camelina 
sativa]
Length=630

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W + I+ C+ST +Y VL+ G+   H  P RGIRQGD +SPY++LL  +  S++++
Sbjct  319  GFSEVWCNWIMKCISTTSYSVLINGQPVCHIKPHRGIRQGDPISPYIYLLCTEALSALIQ  378

Query  377  RREEIGGIHAIR  342
                +G +H  +
Sbjct  379  ENIRLGKLHGFK  390



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV L++ C++T +  V   GE+   F P RG+RQGD LSPY+F+L+    S+++ 
Sbjct  733  GFNDRWVRLVMACITTTSLSVRFNGEQLASFQPSRGLRQGDPLSPYIFILLANALSTLIT  792

Query  377  RREEIGGIHAIRIALA  330
            +  E+G +  I+   A
Sbjct  793  QAVEMGQLQGIKFNRA  808



>gb|AAD17398.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1225

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV  I+ C+S+V+Y +LL G  K    P RGIRQGD +SP+LF+L  +   + L+
Sbjct  544  GFAQKWVDWIIFCISSVSYKILLNGSPKGFIKPSRGIRQGDPISPFLFILCTEALVAKLK  603

Query  377  RREEIGGIHAIRIALA  330
              E  G I  ++I+ A
Sbjct  604  DAEWHGRIQGLQISRA  619



>ref|XP_010478571.1| PREDICTED: uncharacterized protein LOC104757523 isoform X1 [Camelina 
sativa]
Length=653

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W + I+ C+ST +Y VL+ G+   H  P RGIRQGD +SPY++LL  +  S++++
Sbjct  342  GFSEVWCNWIMKCISTTSYSVLINGQPVCHIKPHRGIRQGDPISPYIYLLCTEALSALIQ  401

Query  377  RREEIGGIHAIR  342
                +G +H  +
Sbjct  402  ENIRLGKLHGFK  413



>ref|XP_010473596.1| PREDICTED: uncharacterized protein LOC104753020 [Camelina sativa]
Length=560

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W++ I+ CVS+V+Y VL  G+ +   +P RG+RQGD LSPYLF+L  +   + ++
Sbjct  21   GFDSRWITWIMWCVSSVSYQVLFNGQPRGSILPKRGLRQGDPLSPYLFILCTEVLIANIK  80

Query  377  RREEIGGIHAIRIA  336
            + E    +  I IA
Sbjct  81   KAERENKLTGISIA  94



>emb|CAN74183.1| hypothetical protein VITISV_034261 [Vitis vinifera]
Length=1201

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W   I  C+STV   VL+ G     F   RG+RQGD LSPYLF+L+M+  SS++ 
Sbjct  585  GFGPKWRKWIFCCISTVRMAVLVNGTPTDFFSTFRGLRQGDPLSPYLFVLIMEALSSLIS  644

Query  377  RREEIGGIHAIR  342
            R EE G I   +
Sbjct  645  RAEENGFIRGFK  656



>gb|AAV43830.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAV43906.1| hypothetical protein [Oryza sativa Japonica Group]
Length=697

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W    + C+++V Y + L G     F P RG+RQGD LSPYLFL +  G S IL 
Sbjct  166  GFGESWRKWTMSCMTSVRYSICLNGNLLDPFTPTRGLRQGDPLSPYLFLFITDGLSHILE  225

Query  377  RREEIGGIHAIR  342
            ++   G I  I+
Sbjct  226  KKSLEGSIQPIK  237



>emb|CAN70803.1| hypothetical protein VITISV_044067 [Vitis vinifera]
Length=1850

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GFG  W+  I  C+ST ++ VL+ G  K  F   RG+RQGD LSPYLF++ M+ FSS L+
Sbjct  1264  GFGEKWLGWIKWCISTASFSVLINGTPKGFFQSSRGLRQGDPLSPYLFVIAMEVFSSFLK  1323

Query  377   RREEIGGIHAIRI  339
             R  + G I   ++
Sbjct  1324  RAVDNGYISGCQV  1336



>gb|EEE52364.1| hypothetical protein OsJ_34428 [Oryza sativa Japonica Group]
Length=1102

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GF   WVS I+ CV+TV Y V   G     F P RG+RQGD LSP+LFL V  G S +L 
Sbjct  1017  GFAHRWVSWIMSCVTTVRYSVKFNGTLLSAFAPTRGLRQGDPLSPFLFLFVADGLSLLLE  1076

Query  377   RREEIGGI  354
              +   G I
Sbjct  1077  EKVRQGAI  1084



>ref|XP_010436509.1| PREDICTED: uncharacterized protein LOC104720274 [Camelina sativa]
Length=322

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I+ CVS+V+Y VLL G+ +    P RG+RQGD LSPYLF++  +   + ++
Sbjct  21   GFDRKWISWIMWCVSSVSYQVLLNGQPRGLIKPQRGLRQGDPLSPYLFIICTEVLIANIK  80

Query  377  RREEIGGIHAIRIA  336
            + E    I +I++A
Sbjct  81   KAERESRITSIKLA  94



>ref|XP_010684899.1| PREDICTED: uncharacterized protein LOC104899410 [Beta vulgaris 
subsp. vulgaris]
Length=1029

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+L++ CV+TV+Y  ++ G       P RG+RQGD LSP+LF+LV   FS +++
Sbjct  832  GFDGRWVNLVMSCVATVSYSFIINGRLCGSVAPSRGLRQGDPLSPFLFILVADAFSQMVK  891

Query  377  RREEIGGIHA  348
            ++  +  IH 
Sbjct  892  QKVAMKEIHG  901



>emb|CAN72557.1| hypothetical protein VITISV_013403 [Vitis vinifera]
Length=1557

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GFG  W+  I  C+STV + VL+ G     F   RG+RQGD LSPYLF++ M+ FS +LR
Sbjct  1148  GFGERWIKWIEWCISTVRFSVLINGSPSGFFQSSRGLRQGDPLSPYLFVIAMEVFSCLLR  1207

Query  377   R  375
             R
Sbjct  1208  R  1208



>emb|CAN78577.1| hypothetical protein VITISV_020585 [Vitis vinifera]
Length=1848

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  557   GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
             GFG  W+  I  C+ST ++ VL+ G  K  F   RG+RQGD LSPYLF++ M+ FSS L 
Sbjct  1234  GFGEKWLGWIKWCISTASFSVLINGTPKGFFQSSRGLRQGDPLSPYLFVIXMEVFSSFLN  1293

Query  377   RREEIGGIHAIRI  339
             R  + G I   ++
Sbjct  1294  RAVDNGYISGCQV  1306



>ref|XP_008351907.1| PREDICTED: uncharacterized protein LOC103415345 [Malus domestica]
Length=1736

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  548   CHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILRRRE  369
             C WV   + CV TV+Y V++ GE   +  P RGI+QGD LSP+LFL+  +GF+S+L   E
Sbjct  997   CQWV---MACVKTVSYXVVVNGETTGYIKPRRGIQQGDXLSPFLFLICAEGFTSLLHNXE  1053

Query  368   EIGGIHAIRI  339
             E+G +  + +
Sbjct  1054  EMGRLRGMSV  1063



>ref|XP_010058710.1| PREDICTED: uncharacterized protein LOC104446568 [Eucalyptus grandis]
Length=1356

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+ ++ CV+TV++ +   GE   +F P RG+RQGD LSPYLF+L+    S+ L 
Sbjct  624  GFNDSWVTRVMACVTTVSFSIRFNGEPLPYFKPTRGLRQGDPLSPYLFILLANALSTTLT  683

Query  377  RREEIGGIHAIR  342
            +   +G I  I+
Sbjct  684  QAMAMGHIKGIQ  695



>ref|XP_010669873.1| PREDICTED: uncharacterized protein LOC104886993 [Beta vulgaris 
subsp. vulgaris]
Length=1547

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF  HW+ LI  C+S VTY +L+ G+    F P  G+RQGD +SPYLFL  M   S +L 
Sbjct  815  GFPEHWLRLIQQCISIVTYRILVNGQVSEAFTPHYGLRQGDPISPYLFLFCMDILSRMLT  874

Query  377  RREEI---GGIHAIRIA  336
            +  +I    GI A R A
Sbjct  875  QATDIRQFDGIKAHRYA  891



>emb|CAN62252.1| hypothetical protein VITISV_027357 [Vitis vinifera]
Length=583

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GFG  W+  I  C+STV + VL+ G     F   RG+RQGD LSPYLF++ M+ FSS++R
Sbjct  235  GFGERWIKWIDWCISTVKFSVLVNGSPSGFFQSTRGLRQGDPLSPYLFVIAMEVFSSMMR  294

Query  377  R  375
            R
Sbjct  295  R  295



>ref|XP_009121250.1| PREDICTED: uncharacterized protein LOC103846083 [Brassica rapa]
Length=773

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   WV+ I+ C+STV+Y  L+    +   +P RGIRQGD LSPY+F+L  +  S +  
Sbjct  27   GFSAIWVNWIMQCISTVSYSFLINDTAREMVVPDRGIRQGDPLSPYIFILCGEVLSGLCC  86

Query  377  RREEIGGIHAIRIA  336
            R +  G +  IR+A
Sbjct  87   RAQNSGDLTRIRVA  100



>ref|XP_009124289.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103849230 
[Brassica rapa]
Length=1774

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+  ++ C+++V Y VL+ GE + + IP RG+RQGD  SP++F+L  +   S+L 
Sbjct  549  GFSETWIGWVMRCITSVKYKVLMNGEPRGNIIPGRGLRQGDPXSPFIFILCTEALVSLLN  608

Query  377  RREEIGGIHAIRIALA  330
              E  G I  +R+  A
Sbjct  609  HAEIQGKITGMRVTRA  624



>ref|XP_010468391.1| PREDICTED: uncharacterized protein LOC104748447 [Camelina sativa]
Length=850

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -1

Query  557  GFGCHWVSLILHCVSTVTYHVLLEGEEKRHFIPCRGIRQGDSLSPYLFLLVMKGFSSILR  378
            GF   W+S I  CVS+V+Y  L+ G  +   IP RG+RQGD LSPYLF+L  +  S +  
Sbjct  163  GFSERWISWISACVSSVSYSFLINGSPQGQVIPSRGLRQGDPLSPYLFILCTEVLSGLCV  222

Query  377  RREEIGGIHAIRIALA  330
            + ++ G +  I+++ A
Sbjct  223  KAQDQGILSGIKVSRA  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 717231537738