BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78442_g1_i1 len=708 path=[686:0-707]

Length=708
                                                                      Score     E

ref|YP_004347414.1|  coat protein/movement protein                    64.7    1e-08   
emb|CAA49471.1|  18,9 KDa ABA-induced protein                         57.8    3e-07   Hordeum vulgare [barley]
gb|EMT16924.1|  hypothetical protein F775_32343                       55.1    3e-06   
gb|AAA79871.1|  ORF I                                                 55.8    1e-05   Cassava vein mosaic virus
ref|NP_056846.1|  coat protein/movement protein                       55.5    1e-05   Cassava vein mosaic virus



>ref|YP_004347414.1| coat protein/movement protein [Sweet potato caulimo-like virus]
 gb|AEA36696.1| coat protein/movement protein [Sweet potato caulimo-like virus]
Length=1264

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +1

Query  73   QVDAAKLPVSSYRR-RGLTYATFQPFEVLDDAADLSNNQLNWTNLFLWNKFGKSLSAADA  249
            ++   KLP++S+ +  G T+ATF P+ V+ DA D  + QLNWTN FLWNK G   +    
Sbjct  16   KISENKLPINSFLKWPGYTHATFTPYVVIGDAGDYPHRQLNWTNKFLWNKLGNLNNNDIN  75

Query  250  EAAKNIMT  273
               K I+T
Sbjct  76   ILRKPIIT  83



>emb|CAA49471.1| 18,9 KDa ABA-induced protein [Hordeum vulgare subsp. vulgare]
 emb|CAC17774.1| stress responsive protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85371.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90622.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91415.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (48%), Gaps = 6/132 (5%)
 Frame = +1

Query  46   LPESTLYRVQVDAAKLPVSSYRRRGLTYATFQPFEVLDDAADLSNNQLNWTNLFLWNKFG  225
            LP++ +     +  +LP +SY   G  Y  F PF +  +     + QLNWTNLFL NK G
Sbjct  5    LPQAGVRTSNFERRELPSNSYLDLGGPYGKFVPFIIAGEGGFGEHKQLNWTNLFLLNKLG  64

Query  226  KSLSAADAEAAKNIMTIKTVDDITLAQVKKMGKTLSD-----EFLEVKKIIEEMKVSSDD  390
              + +   E    I   K V+ I    +K++ + +S+     E  E   I+ ++  + D 
Sbjct  65   SDIGSDHDEVINQIKVEKDVEKIK-ELIKRLPREISEQLEGHETHEQVAILADLSRNMDQ  123

Query  391  DLTKLQTAVRNV  426
             ++ L T +R +
Sbjct  124  RMSYLSTEIRRL  135



>gb|EMT16924.1| hypothetical protein F775_32343 [Aegilops tauschii]
Length=165

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 2/114 (2%)
 Frame = +1

Query  46   LPESTLYRVQVDAAKLPVSSYRRRGLTYATFQPFEVLDDAADLSNNQLNWTNLFLWNKFG  225
            LP + +     +A +LP +SY   G  Y  F PF +  +     + QLNWTNLFL NK G
Sbjct  5    LPLAGVRTSNYEARELPSNSYLDLGGPYGKFVPFIIAGEGGFGEHKQLNWTNLFLLNKLG  64

Query  226  KSLSAADAEAAKNIMTIKTVDDITLAQVKKMGKTLSDEFLEVKKIIEEMKVSSD  387
              +     E    I   K V+ I    ++++ + ++ E LE  +  E++++ +D
Sbjct  65   SDIDRDHQEVIDQIKAEKDVEKIK-ELIERLPREIA-EHLEGHETHEQVEILAD  116



>gb|AAA79871.1| ORF I [Cassava vein mosaic virus]
Length=1372

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +1

Query  73   QVDAAKLPVSSY-RRRGLTYATFQPFEVLDDAADLSNNQLNWTNLFLWNKFGK  228
            +V+  KLP+ SY +  G TYA F P+ +  D     + QLNWTN  LWNK GK
Sbjct  17   KVNTQKLPIDSYIQYGGFTYANFTPYIIHGDDGFGEHKQLNWTNKLLWNKLGK  69



>ref|NP_056846.1| coat protein/movement protein [Cassava vein mosaic virus]
 sp|Q66283.1|CP_CSVMV RecName: Full=Putative Polyprotein CP; Contains: RecName: Full=Capsid 
protein; AltName: Full=Coat protein; Short=CP; Contains: 
RecName: Full=Movement protein; Short=Mov; AltName: Full=Cell-to-cell 
transport protein [Cassava vein mosaic virus]
 gb|AAB03325.1| ORF 1 [Cassava vein mosaic virus]
Length=1372

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = +1

Query  73   QVDAAKLPVSSY-RRRGLTYATFQPFEVLDDAADLSNNQLNWTNLFLWNKFGK  228
            +V+  KLP+ SY +  G TYA F P+ +  D     + QLNWTN  LWNK GK
Sbjct  17   KVNREKLPIDSYIQYGGFTYANFTPYIIHGDDGFGEHKQLNWTNKLLWNKLGK  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1141669978128