BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78410_g1_i1 len=1421 path=[1:0-1420]

Length=1421
                                                                      Score     E

ref|XP_011096791.1|  PREDICTED: phosphatase IMPL1, chloroplastic        547   0.0      
ref|XP_009353946.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    537   0.0      
ref|XP_008225806.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    536   0.0      
ref|XP_006362592.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    535   0.0      
ref|XP_007211451.1|  hypothetical protein PRUPE_ppa007303mg             535   0.0      
ref|XP_004233230.1|  PREDICTED: phosphatase IMPL1, chloroplastic        533   0.0      
ref|XP_004293748.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    533   0.0      
ref|XP_010276157.1|  PREDICTED: phosphatase IMPL1, chloroplastic        532   0.0      
ref|XP_010109814.1|  Phosphatase IMPL1                                  525   0.0      
ref|XP_002276697.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    525   0.0      Vitis vinifera
gb|KDP23150.1|  hypothetical protein JCGZ_00142                         524   0.0      
ref|XP_006377017.1|  inositol monophosphatase family protein            524   0.0      
gb|EYU43684.1|  hypothetical protein MIMGU_mgv1a008196mg                523   1e-180   
ref|XP_007024922.1|  Myo-inositol monophosphatase like 1 isoform 1      522   2e-180   
ref|XP_006448721.1|  hypothetical protein CICLE_v10015670mg             521   6e-180   
ref|XP_009773134.1|  PREDICTED: phosphatase IMPL1, chloroplastic        520   1e-179   
ref|XP_010648756.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    520   1e-179   
ref|XP_006468454.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    520   1e-179   
ref|XP_011001341.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    519   4e-179   
ref|XP_008225805.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    520   5e-179   
ref|XP_002524125.1|  myo inositol monophosphatase, putative             516   7e-178   Ricinus communis
ref|XP_010518990.1|  PREDICTED: phosphatase IMPL1, chloroplastic        515   9e-178   
emb|CDP11230.1|  unnamed protein product                                507   3e-175   
ref|XP_006415360.1|  hypothetical protein EUTSA_v10007962mg             509   4e-175   
ref|XP_008801573.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    508   4e-175   
ref|XP_010927091.1|  PREDICTED: phosphatase IMPL1, chloroplastic        506   3e-174   
ref|NP_564376.1|  myo-inositol monophosphatase like 1                   501   4e-172   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44916.1|  hypothetical protein AALP_AA1G319500                    501   4e-172   
gb|AAK62447.1|AF387002_1  Unknown protein                               501   5e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056605.1|  PREDICTED: phosphatase IMPL1, chloroplastic        499   2e-171   
gb|AAM61548.1|  unknown                                                 498   5e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893832.1|  inositol monophosphatase family protein            496   2e-170   
ref|XP_006853338.1|  hypothetical protein AMTR_s00032p00084330          497   2e-170   
ref|XP_010478562.1|  PREDICTED: phosphatase IMPL1, chloroplastic        495   6e-170   
ref|XP_008463623.1|  PREDICTED: phosphatase IMPL1, chloroplastic        494   5e-169   
ref|XP_010499669.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    493   8e-169   
emb|CDY02366.1|  BnaA09g25360D                                          486   4e-166   
emb|CDY51621.1|  BnaCnng21130D                                          485   5e-166   
ref|XP_009385039.1|  PREDICTED: phosphatase IMPL1, chloroplastic        484   2e-165   
ref|XP_003527163.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    483   3e-165   
ref|XP_011000209.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatase ...    483   5e-165   
ref|XP_009115008.1|  PREDICTED: phosphatase IMPL1, chloroplastic        481   1e-164   
ref|XP_004489671.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    480   2e-164   
gb|KEH16547.1|  inositol monophosphatase family protein                 478   2e-163   
gb|EPS71146.1|  hypothetical protein M569_03612                         476   6e-163   
ref|XP_010695784.1|  PREDICTED: phosphatase IMPL1, chloroplastic        477   1e-162   
gb|AFK33475.1|  unknown                                                 474   9e-162   
ref|XP_003570111.1|  PREDICTED: phosphatase IMPL1, chloroplastic        469   6e-160   
dbj|BAJ85005.1|  predicted protein                                      469   1e-159   
ref|XP_006646937.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    468   2e-159   
ref|NP_001046024.1|  Os02g0169900                                       467   6e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677691.1|  PREDICTED: uncharacterized protein LOC100384...    463   3e-157   
ref|NP_001170418.1|  uncharacterized protein LOC100384405               460   6e-157   Zea mays [maize]
ref|XP_009590605.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    458   2e-156   
ref|XP_009590607.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    458   2e-156   
ref|XP_009590604.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    458   3e-156   
ref|XP_002451616.1|  hypothetical protein SORBIDRAFT_04g004700          460   3e-156   Sorghum bicolor [broomcorn]
ref|XP_004951772.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    458   1e-155   
ref|XP_006415359.1|  hypothetical protein EUTSA_v10009483mg             456   2e-155   
ref|XP_002322371.2|  hypothetical protein POPTR_0015s15480g             454   8e-154   Populus trichocarpa [western balsam poplar]
gb|KHG20254.1|  Phosphatase IMPL1, chloroplastic -like protein          448   9e-152   
ref|XP_006582085.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    444   2e-151   
ref|XP_004951771.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    444   2e-149   
gb|AAD21685.1|  Contains similarity to gi|1653332 extragenic supp...    437   1e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008356139.1|  PREDICTED: phosphatase IMPL1, chloroplastic        433   5e-147   
ref|XP_007138402.1|  hypothetical protein PHAVU_009G2057000g            429   2e-144   
gb|ABK21079.1|  unknown                                                 420   6e-142   Picea sitchensis
ref|XP_002965765.1|  hypothetical protein SELMODRAFT_167524             421   3e-141   
ref|XP_007024923.1|  Myo-inositol monophosphatase like 1 isoform 2      414   9e-139   
ref|XP_002975831.1|  hypothetical protein SELMODRAFT_104473             403   6e-134   
ref|XP_008801574.1|  PREDICTED: phosphatase IMPL1, chloroplastic ...    402   8e-134   
ref|XP_006305376.1|  hypothetical protein CARUB_v10009767mg             399   5e-133   
gb|KCW73406.1|  hypothetical protein EUGRSUZ_E01881                     397   2e-132   
gb|EMT10539.1|  Pentatricopeptide repeat-containing protein             414   2e-131   
ref|XP_005850411.1|  hypothetical protein CHLNCDRAFT_34459              379   8e-125   
ref|XP_005650085.1|  inositol monophosphatase                           363   4e-119   
gb|AAW82030.1|  inositol monophosphatase                                350   2e-113   Chlamydomonas incerta
ref|XP_001699711.1|  inositol monophosphatase                           345   2e-111   Chlamydomonas reinhardtii
gb|KFM29121.1|  Phosphatase IMPL1, chloroplastic                        315   3e-98    
ref|XP_001701734.1|  predicted protein                                  301   2e-94    Chlamydomonas reinhardtii
ref|XP_008366583.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatase ...    281   2e-87    
gb|ABZ07807.1|  putative inositol monophosphatase family protein        263   5e-81    uncultured marine microorganism HF4000_ANIW141I9
ref|WP_029748565.1|  hypothetical protein                               257   1e-78    
gb|KGN65049.1|  hypothetical protein Csa_1G183590                       244   5e-74    
gb|KGN65051.1|  hypothetical protein Csa_1G185090                       234   7e-71    
ref|XP_004172467.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    209   5e-61    
ref|XP_008372106.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatase ...    214   5e-61    
ref|WP_014559933.1|  Myo-inositol-monophosphatase                       209   2e-60    
ref|WP_020877033.1|  inositol monophosphatase                           208   9e-60    
ref|WP_008318872.1|  inositol monophosphatase/fructose-1,6-bispho...    208   1e-59    
ref|WP_023073951.1|  inositol monophosphatase fructose- -bisphosp...    207   2e-59    
ref|WP_011342203.1|  histidinol-phosphate phosphatase                   207   3e-59    
gb|KEI68457.1|  ImpA                                                    206   7e-59    
ref|XP_004139538.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    201   9e-59    
ref|WP_015204936.1|  inositol-phosphate phosphatase                     206   1e-58    
ref|WP_026786233.1|  MULTISPECIES: inositol monophosphatase             205   2e-58    
ref|WP_017294269.1|  hypothetical protein                               205   2e-58    
ref|WP_014856459.1|  Inositol-1-monophosphatase (IMPase) (Inosito...    204   3e-58    
ref|WP_015199905.1|  inositol-phosphate phosphatase                     204   3e-58    
ref|WP_023174101.1|  inositol monophosphatase                           204   4e-58    
ref|WP_023068568.1|  inositol monophosphatase family protein            204   4e-58    
ref|WP_015218348.1|  inositol-phosphate phosphatase                     204   5e-58    
ref|WP_015147712.1|  inositol monophosphatase/fructose-1,6-bispho...    204   6e-58    
ref|WP_006621515.1|  MULTISPECIES: inositol monophosphatase             204   6e-58    
ref|WP_027248740.1|  inositol monophosphatase                           203   8e-58    
ref|WP_009783914.1|  inositol monophosphatase                           203   1e-57    
ref|XP_008371877.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    199   1e-57    
ref|WP_008057189.1|  inositol monophosphatase                           202   1e-57    
ref|WP_006518715.1|  inositol monophosphatase/fructose-1,6-bispho...    202   2e-57    
ref|WP_006618759.1|  inositol monophosphatase                           201   5e-57    
ref|WP_024124707.1|  myo-inositol-1-phosphate phosphatase SuhB          201   6e-57    
ref|WP_033378094.1|  MULTISPECIES: histidinol phosphate phosphatase     200   7e-57    
ref|WP_033374645.1|  inositol monophosphatase                           201   8e-57    
ref|WP_021834376.1|  Inositol-1-monophosphatase                         201   1e-56    
ref|WP_008276397.1|  inositol monophosphatase                           200   2e-56    
ref|WP_011141322.1|  inositol monophosphatase                           199   2e-56    
ref|WP_016873198.1|  inositol monophosphatase                           199   3e-56    
ref|WP_007310101.1|  inositol monophosphatase                           199   3e-56    
ref|WP_007304705.1|  inositol monophosphatase                           199   3e-56    
dbj|BAP18025.1|  inositol monophophatase                                199   3e-56    
ref|WP_017659711.1|  hypothetical protein                               199   3e-56    
ref|WP_017746306.1|  inositol monophosphatase                           199   5e-56    
ref|WP_008231301.1|  Inositol-1-monophosphatase                         199   5e-56    
ref|WP_017317072.1|  inositol monophosphatase                           199   5e-56    
ref|WP_015161231.1|  inositol monophosphatase/fructose-1,6-bispho...    198   1e-55    
ref|WP_015145708.1|  inositol monophosphatase/fructose-1,6-bispho...    198   2e-55    
ref|XP_010460930.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    192   2e-55    
ref|WP_015120363.1|  inositol monophosphatase/fructose-1,6-bispho...    197   2e-55    
ref|WP_015131078.1|  inositol-phosphate phosphatase                     197   2e-55    
ref|WP_015171146.1|  inositol monophosphatase                           197   3e-55    
ref|WP_011057494.1|  inositol monophosphatase                           197   3e-55    
ref|WP_015174953.1|  Inositol-phosphate phosphatase                     196   3e-55    
ref|WP_038086003.1|  inositol monophosphatase                           196   3e-55    
ref|WP_008232548.1|  Inositol-1-monophosphatase                         196   3e-55    
ref|WP_019492350.1|  inositol monophosphatase                           196   4e-55    
gb|KIH76427.1|  histidinol phosphate phosphatase                        196   4e-55    
ref|WP_028954158.1|  inositol monophosphatase                           196   5e-55    
ref|WP_039753200.1|  inositol monophosphatase                           196   6e-55    
ref|WP_026099087.1|  inositol monophosphatase                           196   9e-55    
ref|WP_009544530.1|  MULTISPECIES: inositol monophosphatase             195   1e-54    
ref|WP_027403655.1|  inositol monophosphatase                           195   1e-54    
ref|WP_037215872.1|  inositol monophosphatase                           195   1e-54    
ref|WP_013190313.1|  inositol monophosphatase                           194   2e-54    
ref|WP_039200561.1|  inositol monophosphatase                           194   2e-54    
ref|WP_035149247.1|  inositol monophosphatase                           194   2e-54    
ref|WP_028082831.1|  inositol monophosphatase                           194   2e-54    
ref|WP_036616256.1|  inositol monophosphatase                           194   2e-54    
ref|WP_015226006.1|  inositol monophosphatase                           194   2e-54    
ref|WP_015230984.1|  inositol monophosphatase/fructose-1,6-bispho...    194   2e-54    
ref|WP_026734702.1|  inositol monophosphatase                           194   2e-54    
ref|WP_006635698.1|  inositol monophosphatase                           195   2e-54    
ref|WP_008178066.1|  inositol monophosphatase                           194   3e-54    
ref|WP_015212626.1|  Inositol-phosphate phosphatase                     194   4e-54    
emb|CDR34580.1|  Inositol-1-monophosphatase                             194   4e-54    
gb|EKQ69058.1|  inositol monophosphatase/fructose-1,6-bisphosphat...    194   4e-54    
ref|WP_036483658.1|  inositol monophosphatase                           193   5e-54    
ref|WP_010997068.1|  inositol monophosphatase                           193   5e-54    
ref|WP_006454598.1|  inositol monophosphatase                           193   7e-54    
ref|WP_019500429.1|  hypothetical protein                               193   7e-54    
ref|WP_015206213.1|  inositol monophosphatase/fructose-1,6-bispho...    193   8e-54    
ref|WP_015079254.1|  inositol monophosphatase                           192   8e-54    
ref|WP_022608882.1|  fructose-1,6-bisphosphatase                        193   1e-53    
ref|WP_011317835.1|  inositol monophosphatase                           192   1e-53    
ref|WP_029101839.1|  hypothetical protein                               192   1e-53    
ref|WP_017286126.1|  hypothetical protein                               192   1e-53    
ref|WP_035999471.1|  inositol monophosphatase                           192   2e-53    
ref|WP_028672900.1|  hypothetical protein                               191   2e-53    
ref|WP_006277150.1|  inositol monophosphatase                           192   2e-53    
ref|WP_012407906.1|  inositol monophosphatase                           192   2e-53    
ref|WP_027714936.1|  histidinol phosphate phosphatase                   191   3e-53    
ref|WP_015192679.1|  Inositol-phosphate phosphatase                     191   3e-53    
ref|WP_012593906.1|  MULTISPECIES: inositol monophosphatase             191   4e-53    
ref|WP_011418156.1|  histidinol-phosphate phosphatase                   191   6e-53    
ref|WP_026100308.1|  inositol monophosphatase                           190   6e-53    
ref|WP_029949366.1|  hypothetical protein                               190   7e-53    
ref|WP_009628658.1|  Inositol-phosphate phosphatase                     191   8e-53    
ref|WP_019504277.1|  inositol monophosphatase                           190   8e-53    
ref|WP_012629273.1|  inositol monophosphatase                           190   8e-53    
ref|WP_029637532.1|  inositol monophosphatase [                         190   9e-53    
ref|WP_007356489.1|  MULTISPECIES: inositol monophosphatase             190   1e-52    
ref|WP_027845578.1|  inositol monophosphatase                           190   1e-52    
ref|WP_006196791.1|  inositol monophosphatase                           189   1e-52    
gb|EKE02731.1|  hypothetical protein ACD_20C00337G0002                  189   2e-52    
ref|WP_015124576.1|  inositol monophosphatase/fructose-1,6-bispho...    190   2e-52    
ref|WP_020252747.1|  MULTISPECIES: hypothetical protein                 189   2e-52    
ref|WP_011733974.1|  histidinol-phosphate phosphatase                   189   2e-52    
ref|WP_017311811.1|  inositol monophosphatase                           189   2e-52    
ref|WP_029412620.1|  hypothetical protein                               189   2e-52    
ref|WP_015136731.1|  inositol monophosphatase/fructose-1,6-bispho...    189   2e-52    
ref|WP_026100862.1|  inositol monophosphatase                           189   3e-52    
ref|WP_015188644.1|  Inositol-phosphate phosphatase                     189   4e-52    
ref|WP_026720730.1|  inositol monophosphatase                           188   4e-52    
ref|WP_038038587.1|  histidinol phosphate phosphatase                   188   4e-52    
ref|WP_015115459.1|  inositol-phosphate phosphatase                     188   4e-52    
ref|WP_039728768.1|  inositol monophosphatase                           188   6e-52    
ref|WP_012875162.1|  inositol monophosphatase                           187   8e-52    
ref|WP_011431458.1|  inositol monophosphatase                           187   9e-52    
ref|WP_009456177.1|  MULTISPECIES: inositol monophosphatase             187   1e-51    
emb|CBX30354.1|  Inositol-1-monophosphatase                             186   1e-51    
ref|WP_011522862.1|  inositol monophosphatase                           187   1e-51    
ref|XP_008342752.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    183   2e-51    
dbj|GAM08117.1|  inositol-1-monophosphatase                             186   2e-51    
ref|WP_015837967.1|  histidinol-phosphate phosphatase                   186   2e-51    
ref|WP_016869344.1|  inositol monophosphatase                           186   3e-51    
ref|WP_013321174.1|  inositol monophosphatase                           186   3e-51    
ref|WP_004268128.1|  inositol monophosphatase                           186   3e-51    
ref|WP_016862025.1|  inositol monophosphatase                           186   4e-51    
ref|WP_015182249.1|  inositol monophosphatase/fructose-1,6-bispho...    186   4e-51    
ref|WP_012529943.1|  histidinol-phosphate phosphatase                   185   4e-51    
ref|WP_009342688.1|  inositol monophosphatase                           185   5e-51    
ref|WP_006927781.1|  inositol monophosphatase                           185   5e-51    
ref|WP_015168036.1|  inositol monophosphatase/fructose-1,6-bispho...    186   6e-51    
ref|WP_035496786.1|  histidinol phosphate phosphatase                   184   6e-51    
ref|WP_016515851.1|  Inositol-1-monophosphatase                         185   6e-51    
ref|WP_011433751.1|  inositol monophosphatase                           185   6e-51    
ref|WP_006511974.1|  inositol monophosphatase/fructose-1,6-bispho...    185   8e-51    
ref|WP_017323604.1|  inositol monophosphatase                           185   9e-51    
ref|WP_014101520.1|  histidinol-phosphate phosphatase                   184   1e-50    
ref|WP_024970828.1|  inositol monophosphatase                           184   2e-50    
ref|WP_013246772.1|  histidinol-phosphate phosphatase                   184   2e-50    
ref|WP_005009368.1|  Inositol-phosphate phosphatase                     184   2e-50    
ref|WP_002736852.1|  inositol monophosphatase                           184   2e-50    
ref|WP_039714995.1|  inositol monophosphatase                           184   2e-50    
ref|WP_026099518.1|  inositol monophosphatase                           184   2e-50    
ref|WP_012814273.1|  histidinol-phosphate phosphatase                   183   2e-50    
ref|WP_002794377.1|  inositol monophosphatase                           184   2e-50    
ref|WP_012597922.1|  inositol monophosphatase                           184   2e-50    
ref|WP_002745870.1|  inositol monophosphatase family protein            184   3e-50    
gb|AIE72720.1|  Inositol-1-monophosphatase                              184   3e-50    
ref|WP_011243838.1|  inositol monophosphatase                           183   3e-50    
ref|WP_006528747.1|  inositol monophosphatase/fructose-1,6-bispho...    183   3e-50    
ref|WP_012641591.1|  histidinol-phosphate phosphatase                   183   4e-50    
ref|WP_011958020.1|  histidinol-phosphate phosphatase                   182   4e-50    
ref|WP_013179221.1|  myo-inositol-1-monophosphatase                     182   4e-50    
ref|WP_028324287.1|  hypothetical protein                               182   5e-50    
ref|WP_010475015.1|  inositol monophosphatase                           183   5e-50    
ref|WP_012173433.1|  inositol-phosphate phosphatase                     182   5e-50    
ref|WP_025323069.1|  hypothetical protein                               182   6e-50    
ref|WP_015222591.1|  inositol monophosphatase                           182   7e-50    
ref|WP_008197778.1|  inositol monophosphatase                           182   8e-50    
ref|WP_002768969.1|  inositol monophosphatase                           182   9e-50    
ref|WP_038507684.1|  histidinol phosphate phosphatase                   181   1e-49    
ref|WP_002795757.1|  inositol monophosphatase                           182   1e-49    
ref|WP_012266817.1|  inositol monophosphatase                           181   1e-49    
ref|WP_002781271.1|  Inositol-1-monophosphatase                         182   1e-49    
ref|WP_011125089.1|  MULTISPECIES: inositol monophosphatase             182   1e-49    
ref|WP_016952094.1|  inositol monophosphatase                           181   1e-49    
dbj|GAL94478.1|  inositol-1-monophosphatase                             181   2e-49    
ref|WP_032138353.1|  inositol monophosphatase                           181   2e-49    
ref|WP_008481279.1|  histidinol-phosphate phosphatase                   181   2e-49    
ref|WP_018040899.1|  hypothetical protein                               181   2e-49    
ref|WP_013457521.1|  myo-inositol-1-monophosphatase                     181   2e-49    
ref|WP_012569979.1|  inositol monophosphatase                           181   2e-49    
ref|WP_011933147.1|  inositol monophosphatase                           182   2e-49    
ref|WP_012164329.1|  inositol monophosphatase                           181   2e-49    
ref|WP_012871400.1|  histidinol-phosphate phosphatase                   181   3e-49    
ref|WP_009616159.1|  extragenic suppressor protein SuhB                 181   3e-49    
ref|WP_036534710.1|  inositol monophosphatase                           181   3e-49    
emb|CCB92213.1|  Inositol-1-monophosphatase                             180   3e-49    
gb|EAY58089.1|  Inositol monophosphatase                                180   4e-49    Leptospirillum rubarum
ref|WP_013182802.1|  inositol monophosphatase                           180   4e-49    
ref|WP_015249030.1|  inositol monophosphatase                           180   5e-49    
gb|AHF16286.1|  inositol monophosphatase                                179   5e-49    
ref|WP_011128139.1|  inositol monophosphatase                           181   5e-49    
ref|WP_014809155.1|  inositol monophosphatase/fructose-1,6-bispho...    180   6e-49    
emb|CDF82399.1|  Inositol-1-monophosphatase                             180   6e-49    
ref|WP_015423672.1|  inositol-1-monophosphatase                         179   6e-49    
ref|WP_015478510.1|  extragenic suppressor protein SuhB                 180   6e-49    
ref|WP_012220522.1|  inositol monophosphatase                           179   7e-49    
ref|WP_010958026.1|  inositol monophosphatase                           179   7e-49    
ref|WP_035994448.1|  inositol monophosphatase                           180   7e-49    
ref|WP_006100816.1|  inositol monophosphatase                           179   7e-49    
ref|WP_005768415.1|  inositol monophosphatase                           179   8e-49    
ref|WP_011996983.1|  inositol monophosphatase                           179   8e-49    
ref|WP_003162597.1|  Inositol-1-monophosphatase                         179   1e-48    
ref|WP_024762950.1|  inositol monophosphatase                           179   1e-48    
emb|CDM65811.1|  inositol monophosphatase/fructose-1,6-bisphospha...    178   1e-48    
ref|WP_036081206.1|  histidinol phosphate phosphatase                   178   1e-48    
ref|WP_003122098.1|  MULTISPECIES: inositol monophosphatase             179   2e-48    
ref|WP_031755460.1|  inositol monophosphatase                           179   2e-48    
ref|WP_011610577.1|  inositol monophosphatase                           179   2e-48    
ref|WP_002788946.1|  inositol monophosphatase                           179   2e-48    
ref|WP_017522297.1|  inositol monophosphatase                           178   2e-48    
gb|AAT51071.1|  PA3818                                                  178   2e-48    
ref|WP_013157989.1|  myo-inositol-1-monophosphatase                     178   2e-48    
ref|WP_034033779.1|  inositol monophosphatase                           178   2e-48    
ref|WP_034028357.1|  inositol monophosphatase                           178   2e-48    
ref|WP_006041369.1|  inositol monophosphatase                           179   2e-48    
ref|WP_003092845.1|  MULTISPECIES: inositol monophosphatase             178   3e-48    
gb|EAU71688.1|  Inositol-1(or 4)-monophosphatase                        179   3e-48    
ref|WP_017148420.1|  inositol monophosphatase                           178   3e-48    
ref|WP_007330534.1|  inositol monophosphatase                           178   3e-48    
ref|WP_033980665.1|  inositol monophosphatase                           178   3e-48    
gb|EDZ39934.1|  Inositol monophosphatase                                178   3e-48    
gb|KGA94779.1|  Inositol-1-monophosphatase                              177   3e-48    
emb|CDM44173.1|  extragenic suppressor protein SuhB                     178   3e-48    
ref|WP_034081194.1|  inositol monophosphatase                           178   3e-48    
ref|WP_015165449.1|  inositol monophosphatase                           178   4e-48    
ref|WP_002752818.1|  inositol monophosphatase                           177   4e-48    
ref|WP_034403179.1|  hypothetical protein                               177   4e-48    
ref|WP_008661192.1|  Inositol monophosphatase                           177   4e-48    
ref|WP_015152433.1|  inositol monophosphatase                           177   5e-48    
ref|WP_017850457.1|  inositol phosphatase                               177   5e-48    
ref|WP_011120572.1|  inositol monophosphatase                           177   5e-48    
ref|WP_003150721.1|  inositol monophosphatase                           177   5e-48    
ref|WP_017300780.1|  hypothetical protein                               177   5e-48    
ref|WP_014962166.1|  inositol monophosphatase                           176   5e-48    
ref|WP_011997597.1|  histidinol-phosphate phosphatase                   177   5e-48    
ref|WP_008665246.1|  Inositol monophosphatase                           177   6e-48    
ref|WP_034011326.1|  inositol monophosphatase                           177   6e-48    
ref|WP_028952077.1|  inositol monophosphatase                           177   8e-48    
ref|WP_035040760.1|  inositol monophosphatase                           177   8e-48    
ref|WP_012468501.1|  histidinol-phosphate phosphatase                   176   8e-48    
ref|WP_010872869.1|  inositol monophosphatase                           177   8e-48    
ref|WP_037988310.1|  inositol monophosphatase                           177   8e-48    
ref|WP_014450525.1|  inositol monophosphatase                           176   9e-48    
ref|WP_007329751.1|  inositol monophosphatase                           177   1e-47    
ref|WP_002760812.1|  inositol monophosphatase                           176   1e-47    
ref|WP_020766981.1|  MULTISPECIES: inositol monophosphatase famil...    176   1e-47    
ref|WP_013706794.1|  inositol-phosphate phosphatase                     176   1e-47    
gb|EAU73797.1|  Inositol-1(or 4)-monophosphatase                        177   2e-47    
ref|WP_008245943.1|  inositol phosphatase                               176   2e-47    
ref|WP_032125835.1|  inositol monophosphatase                           176   2e-47    
ref|WP_004778816.1|  inositol monophosphatase family protein            176   2e-47    
ref|WP_038024135.1|  inositol monophosphatase                           177   2e-47    
ref|WP_004764224.1|  inositol monophosphatase family protein            176   2e-47    
gb|EKR28719.1|  inositol monophosphatase family protein                 176   2e-47    
ref|WP_007337504.1|  Inositol monophosphatase                           176   2e-47    
ref|WP_004451514.1|  inositol monophosphatase family protein            176   2e-47    
ref|XP_008346095.1|  PREDICTED: phosphatase IMPL1, chloroplastic-...    174   2e-47    
ref|WP_006171509.1|  inositol monophosphatase                           176   2e-47    
ref|WP_000050901.1|  inositol phosphatase                               176   2e-47    
ref|WP_004755310.1|  inositol phosphatase                               176   2e-47    
gb|ETR74281.1|  myo-inositol-1(or 4)-monophosphatase                    175   2e-47    
ref|WP_000050899.1|  inositol phosphatase                               176   2e-47    
ref|WP_001046972.1|  inositol phosphatase                               176   2e-47    
ref|WP_012547484.1|  inositol-1-monophosphatase                         175   2e-47    
ref|WP_000050897.1|  inositol phosphatase                               176   3e-47    
ref|WP_008698363.1|  inositol-1-monophosphatase                         175   3e-47    
ref|WP_037384720.1|  histidinol phosphate phosphatase                   175   3e-47    
ref|WP_036251140.1|  inositol monophosphatase                           177   3e-47    
ref|WP_011830424.1|  inositol monophosphatase                           177   3e-47    
ref|WP_000050900.1|  inositol phosphatase                               175   4e-47    
ref|WP_035265624.1|  inositol monophosphatase                           174   4e-47    
ref|WP_004419981.1|  inositol phosphatase                               175   4e-47    
ref|WP_013943279.1|  inositol-1-monophosphatase                         175   4e-47    
ref|WP_015719672.1|  histidinol-phosphate phosphatase                   175   4e-47    
ref|WP_004457046.1|  inositol monophosphatase family protein            175   4e-47    
ref|WP_011359880.1|  inositol monophosphatase                           176   5e-47    
ref|WP_004435892.1|  inositol monophosphatase family protein            174   5e-47    
ref|WP_037485506.1|  inositol monophosphatase                           175   6e-47    
ref|WP_008689331.1|  Inositol monophosphatase                           174   6e-47    
ref|WP_002179380.1|  inositol monophosphatase family protein            174   6e-47    
ref|WP_008543625.1|  inositol monophosphatase                           174   6e-47    
ref|WP_032515448.1|  inositol monophosphatase                           175   6e-47    
ref|WP_003246238.1|  inositol monophosphatase                           174   6e-47    
ref|WP_009096557.1|  Inositol monophosphatase                           174   6e-47    
ref|WP_038006623.1|  histidinol phosphate phosphatase                   174   6e-47    
gb|EXI90811.1|  Inositol-1-monophosphatase                              174   7e-47    
ref|WP_015896110.1|  inositol monophosphatase                           175   7e-47    
ref|WP_037001941.1|  inositol monophosphatase                           174   8e-47    
dbj|BAL55803.1|  myo-inositol-1(or 4)-monophosphatase                   174   8e-47    
ref|WP_021327733.1|  Myo-inositol-1(Or 4)-monophosphatase               174   8e-47    
ref|WP_028818312.1|  inositol monophosphatase                           174   8e-47    
ref|WP_026462457.1|  inositol-1-monophosphatase                         174   8e-47    
ref|WP_006340702.1|  inositol monophosphatase                           174   9e-47    
dbj|BAL58825.1|  myo-inositol-1(or 4)-monophosphatase                   174   9e-47    
ref|WP_028318459.1|  hypothetical protein                               174   9e-47    
gb|KIA76659.1|  Inositol-1-monophosphatase                              174   9e-47    
ref|WP_013924058.1|  inositol monophosphatase                           174   9e-47    
ref|WP_017364249.1|  inositol monophosphatase                           174   1e-46    
ref|WP_015255823.1|  myo-inositol-1(or 4)-monophosphatase               174   1e-46    
ref|WP_004446643.1|  inositol monophosphatase family protein            174   1e-46    
ref|WP_012346249.1|  inositol-phosphate phosphatase                     178   1e-46    
ref|WP_002757187.1|  inositol monophosphatase family protein            174   1e-46    
ref|WP_020983698.1|  inositol monophosphatase family protein            173   1e-46    
ref|WP_028988910.1|  inositol monophosphatase                           173   1e-46    
dbj|BAL53249.1|  myo-inositol-1(or 4)-monophosphatase                   173   2e-46    
ref|WP_030005875.1|  inositol monophosphatase                           174   2e-46    
ref|WP_009551984.1|  inositol monophosphatase                           175   2e-46    
ref|WP_006163139.1|  inositol monophosphatase                           173   2e-46    
gb|AAM75410.1|  extragenic suppressor protein SuhB                      173   2e-46    
ref|WP_002147168.1|  inositol monophosphatase family protein            173   2e-46    
ref|WP_024309263.1|  inositol monophosphatase                           173   2e-46    
ref|WP_010853167.1|  Inositol-1-monophosphatase                         173   2e-46    
ref|WP_012801436.1|  inositol monophosphatase                           172   2e-46    
ref|WP_029407972.1|  inositol monophosphatase                           173   2e-46    
ref|WP_004426735.1|  inositol monophosphatase family protein            173   2e-46    
ref|WP_038706773.1|  inositol monophosphatase                           173   2e-46    
ref|WP_002634754.1|  MULTISPECIES: inositol phosphatase                 173   2e-46    
ref|WP_013559017.1|  inositol-1-monophosphatase                         172   2e-46    
ref|WP_027360590.1|  hypothetical protein                               172   3e-46    
ref|WP_026369160.1|  hypothetical protein                               172   3e-46    
ref|WP_013716864.1|  inositol monophosphatase                           172   3e-46    
ref|WP_009682045.1|  MULTISPECIES: inositol monophosphatase             172   3e-46    
ref|WP_004784549.1|  inositol phosphatase                               172   3e-46    
ref|WP_010572953.1|  inositol phosphatase                               172   3e-46    
ref|WP_026032700.1|  inositol monophosphatase                           173   3e-46    
gb|KDB50602.1|  inositol-phosphate phosphatase                          176   3e-46    
ref|WP_027595538.1|  inositol monophosphatase                           172   3e-46    
ref|WP_023382218.1|  MULTISPECIES: inositol-phosphate phosphatase       172   4e-46    
ref|WP_008900039.1|  inositol monophosphatase                           172   4e-46    
ref|WP_011671147.1|  inositol phosphatase                               172   4e-46    
ref|WP_020712516.1|  inositol monophosphatase                           173   4e-46    
ref|WP_011293842.1|  inositol monophosphatase                           172   5e-46    
ref|WP_028689585.1|  inositol monophosphatase                           172   5e-46    
ref|WP_003459681.1|  inositol monophosphatase                           172   5e-46    
gb|EAQ69270.1|  Inositol-1(or 4)-monophosphatase                        172   5e-46    
ref|WP_038652532.1|  inositol monophosphatase                           172   5e-46    
ref|WP_036897841.1|  inositol monophosphatase                           172   5e-46    
ref|WP_011823665.1|  inositol monophosphatase                           172   5e-46    
ref|WP_033701193.1|  inositol monophosphatase                           172   5e-46    
ref|WP_038001348.1|  inositol monophosphatase                           172   6e-46    
ref|WP_002732543.1|  inositol monophosphatase family protein            172   6e-46    
ref|WP_011376455.1|  inositol monophosphatase                           172   6e-46    
ref|WP_025972137.1|  inositol monophosphatase                           172   6e-46    
ref|WP_028997566.1|  inositol monophosphatase                           174   6e-46    
ref|WP_007521675.1|  Myo-inositol-monophosphatase                       172   6e-46    
ref|WP_023533392.1|  MULTISPECIES: inositol monophosphatase famil...    172   7e-46    
ref|WP_002741120.1|  MULTISPECIES: inositol monophosphatase famil...    172   7e-46    
ref|WP_012306253.1|  inositol monophosphatase                           172   7e-46    
ref|WP_012270588.1|  inositol monophosphatase                           171   8e-46    
ref|WP_016713212.1|  MULTISPECIES: inositol monophosphatase             171   8e-46    
ref|WP_028487003.1|  inositol monophosphatase                           171   8e-46    
ref|WP_019472646.1|  MULTISPECIES: inositol monophosphatase             171   9e-46    
ref|WP_010961823.1|  inositol monophosphatase                           171   9e-46    
ref|WP_025955704.1|  inositol monophosphatase                           172   9e-46    
ref|WP_012646908.1|  histidinol-phosphate phosphatase                   171   9e-46    
ref|WP_016393981.1|  MULTISPECIES: inositol-phosphate phosphatase       171   1e-45    
ref|WP_037012503.1|  inositol monophosphatase                           171   1e-45    
ref|WP_002972841.1|  inositol monophosphatase family protein            171   1e-45    
ref|WP_033374419.1|  inositol monophosphatase                           171   1e-45    
ref|WP_029935934.1|  inositol monophosphatase                           171   1e-45    
ref|WP_028320639.1|  hypothetical protein                               171   1e-45    
ref|WP_020776778.1|  inositol monophosphatase family protein            171   1e-45    
ref|WP_039604605.1|  inositol monophosphatase                           171   1e-45    
ref|WP_025927534.1|  MULTISPECIES: inositol monophosphatase             171   1e-45    
ref|WP_003257850.1|  MULTISPECIES: inositol monophosphatase             171   1e-45    
ref|WP_026309534.1|  histidinol phosphate phosphatase                   171   1e-45    
ref|WP_015766509.1|  inositol monophosphatase                           171   1e-45    
ref|WP_002763176.1|  inositol monophosphatase family protein            171   1e-45    
ref|WP_035959419.1|  inositol monophosphatase                           171   1e-45    
ref|WP_013971013.1|  inositol monophosphatase                           171   2e-45    
ref|WP_012316148.1|  inositol monophosphatase                           171   2e-45    
ref|WP_015043082.1|  MULTISPECIES: inositol monophosphatase             171   2e-45    
ref|WP_009426491.1|  inositol monophosphatase family protein            171   2e-45    
ref|WP_017675186.1|  MULTISPECIES: inositol monophosphatase             171   2e-45    
ref|WP_014853421.1|  inositol monophosphatase                           171   2e-45    
ref|WP_015436431.1|  myo-inositol-1(or 4)-monophosphatase               170   2e-45    
gb|EXI78174.1|  Inositol-1-monophosphatase                              171   2e-45    
gb|AHD12974.1|  inositol monophosphatase                                171   2e-45    
gb|ABE11467.1|  putative myo-inositol-1(or 4)-monophosphatase           171   2e-45    
ref|WP_011467892.1|  inositol monophosphatase                           170   2e-45    
ref|WP_003001873.1|  inositol monophosphatase family protein            171   2e-45    
ref|WP_013567737.1|  inositol monophosphatase                           171   2e-45    
ref|WP_008092580.1|  inositol monophosphatase                           170   2e-45    
ref|WP_014394783.1|  histidinol-phosphate phosphatase                   170   2e-45    
ref|WP_011370035.1|  inositol monophosphatase                           170   2e-45    
ref|WP_003248548.1|  inositol monophosphatase                           170   2e-45    
ref|WP_037049615.1|  inositol monophosphatase                           170   2e-45    
ref|WP_014755385.1|  inositol monophosphatase                           170   2e-45    
ref|WP_015006070.1|  MULTISPECIES: inositol monophosphatase             170   2e-45    
ref|WP_007342351.1|  inositol monophosphatase                           170   3e-45    
ref|WP_029613659.1|  inositol monophosphatase                           170   3e-45    
ref|WP_002724358.1|  inositol monophosphatase family protein            170   3e-45    
ref|WP_027190794.1|  histidinol phosphate phosphatase                   169   3e-45    
gb|AHL32355.1|  inositol monophosphatase                                170   3e-45    
ref|WP_036917654.1|  MULTISPECIES: inositol monophosphatase             170   3e-45    
ref|WP_002626748.1|  Inositol-1-monophosphatase                         170   3e-45    
ref|WP_028631597.1|  inositol monophosphatase                           170   3e-45    
ref|WP_011532332.1|  inositol monophosphatase                           170   3e-45    
ref|WP_018399521.1|  hypothetical protein                               170   3e-45    
ref|WP_025921503.1|  inositol monophosphatase                           170   3e-45    
ref|WP_016390160.1|  inositol monophosphatase                           169   4e-45    
ref|WP_015680865.1|  inositol monophosphatase family protein            169   4e-45    
ref|WP_010797316.1|  MULTISPECIES: inositol-1-monophosphatase           169   4e-45    
ref|WP_020402160.1|  hypothetical protein                               169   4e-45    
ref|WP_005615756.1|  inositol monophosphatase                           169   4e-45    
ref|WP_017937320.1|  inositol monophosphatase                           169   4e-45    
ref|WP_038544749.1|  inositol monophosphatase                           170   4e-45    
ref|WP_012390187.1|  inositol phosphatase                               169   4e-45    
ref|WP_025968043.1|  inositol monophosphatase                           170   4e-45    
ref|WP_016484968.1|  inositol monophosphatase                           169   4e-45    
ref|WP_002976014.1|  inositol monophosphatase family protein            169   5e-45    
ref|WP_003380594.1|  MULTISPECIES: inositol monophosphatase             169   5e-45    
ref|WP_025969818.1|  inositol monophosphatase                           169   5e-45    
ref|WP_019448509.1|  inositol monophosphatase                           169   5e-45    
ref|WP_012583263.1|  inositol-1-monophosphatase                         169   5e-45    
dbj|BAO29392.1|  inositol monophosphatase/fructose-1,6-bisphospha...    169   5e-45    
ref|WP_026188870.1|  inositol monophosphatase                           169   5e-45    
gb|EKD39899.1|  hypothetical protein ACD_75C00257G0001                  169   5e-45    
ref|WP_022806884.1|  inositol-phosphate phosphatase                     169   5e-45    
ref|WP_025852543.1|  myo-inositol-1-monophosphatase                     169   5e-45    
ref|WP_026596481.1|  inositol monophosphatase                           169   5e-45    
ref|WP_012007695.1|  inositol monophosphatase                           169   6e-45    
ref|WP_002805109.1|  inositol monophosphatase                           169   6e-45    
ref|WP_018717284.1|  hypothetical protein                               169   6e-45    
gb|KDO01294.1|  inositol monophosphatase family protein                 169   6e-45    
ref|WP_025165056.1|  inositol monophosphatase                           169   6e-45    
ref|WP_010223469.1|  MULTISPECIES: inositol monophosphatase             169   6e-45    



>ref|XP_011096791.1| PREDICTED: phosphatase IMPL1, chloroplastic [Sesamum indicum]
Length=378

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/372 (70%), Positives = 307/372 (83%), Gaps = 7/372 (2%)
 Frame = -2

Query  1393  LVSTAMSPLRFSHRPITILPCNRSNFPF---LNANLQPLRYGFERIL----SLRRSICAK  1235
             L S+ ++P R S +P +ILP  R  F F   L AN QPL+ GF R L    S  R+   K
Sbjct  7     LSSSTLNPSRISPKPTSILPFERLRFSFPSSLPANSQPLKCGFCRTLPSTFSCGRAFSTK  66

Query  1234  AVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTD  1055
             A++SE  S+++Y ++GA+STG IPSDQLL++++ AAKTGA+V+MDAVNKPRNI YKG TD
Sbjct  67    AILSETPSQRQYFKVGAESTGPIPSDQLLDVIETAAKTGAQVIMDAVNKPRNITYKGLTD  126

Query  1054  LVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYAS  875
             LVTDTDK SE AILD+VRKNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y S
Sbjct  127   LVTDTDKMSEDAILDMVRKNFQDHLILGEEGGLIGDSSSDYLWCIDPLDGTTNFAHCYPS  186

Query  874   FAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSL  695
             FAVS+ +L++GKPAA+TVVEFVGGP CW+TRT+TAA GKGA+ NG+K+ V+ TDKVE+SL
Sbjct  187   FAVSIGVLYKGKPAAATVVEFVGGPKCWNTRTFTAAAGKGAFCNGEKIHVSQTDKVERSL  246

Query  694   LVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWD  515
             LVTG+GY+ DD+WATN+ELFKEFT +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD
Sbjct  247   LVTGFGYEHDDAWATNLELFKEFTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWD  306

Query  514   NAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFS  335
              AAGVLIVEEAGG VS  DG K+CVFDRSV+ SNG LH KLLE+IGPATEKLK KG+DFS
Sbjct  307   MAAGVLIVEEAGGTVSCMDGGKFCVFDRSVVVSNGVLHAKLLERIGPATEKLKGKGIDFS  366

Query  334   LWYKPEAYKTDF  299
             LWYKPE Y T+ 
Sbjct  367   LWYKPENYLTEL  378



>ref|XP_009353946.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009376387.1| PREDICTED: phosphatase IMPL1, chloroplastic [Pyrus x bretschneideri]
Length=373

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/372 (69%), Positives = 302/372 (81%), Gaps = 4/372 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFER----ILSLRRSICA  1238
             MG  LV +   PLR S  P +ILP NR N   L  + Q L+YGF+R    I    RS+C 
Sbjct  1     MGRSLVFSPNVPLRISQIPRSILPPNRPNHSLLLNSKQKLQYGFQRFGLSIAKPARSLCT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KAV+SE+ +++ Y+++GA+STG IP  QL+ +V+ AAKTGAEVVM+AVNKPRNI YKG T
Sbjct  61    KAVLSEIPNQELYVKVGANSTGPIPIGQLVGVVEKAAKTGAEVVMEAVNKPRNITYKGLT  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT+TDKKSE AIL+VVRKNF DHL+LGEEGG TGD SSDY+WCIDPLDGTTNF H Y 
Sbjct  121   DLVTETDKKSEAAILEVVRKNFKDHLILGEEGGITGDTSSDYMWCIDPLDGTTNFAHGYP  180

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +LFRGKPAA+ VVEFVGGPMCW+TR ++A+ G GA+ NGQK+ V+ TD+V +S
Sbjct  181   SFAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSASAGGGAFCNGQKIHVSQTDEVGRS  240

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD+W TN+ELFKEFT +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+PW
Sbjct  241   LLVTGFGYEHDDAWITNIELFKEFTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPW  300

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V+  DG K+ VFDRSVL SNG LH KLLE+I PATEKLK KG+DF
Sbjct  301   DMAAGVLIVEEAGGKVTCMDGGKFSVFDRSVLVSNGVLHGKLLERIAPATEKLKGKGIDF  360

Query  337   SLWYKPEAYKTD  302
             SLWYKPE Y TD
Sbjct  361   SLWYKPEDYTTD  372



>ref|XP_008225806.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X2 [Prunus 
mume]
Length=373

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/373 (68%), Positives = 303/373 (81%), Gaps = 4/373 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI-LSL---RRSICA  1238
             MG  LV +   P+RFS  P +ILP N+ N      + + L++GF+R  LS     R++C 
Sbjct  1     MGRSLVFSPNLPVRFSQIPRSILPPNQPNQSLSLNSREQLQHGFQRFGLSFAKPTRTLCT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KAV+SE+ ++K Y+++GA STG IP  QL+E+V+ AAKTGAEVVMDAVNKPRNI YKG T
Sbjct  61    KAVLSEIPNQKTYVKVGAKSTGPIPISQLIEVVEKAAKTGAEVVMDAVNKPRNITYKGLT  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDKKSE  IL+VVRKNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  121   DLVTDTDKKSEATILEVVRKNFKDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYP  180

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +LFRGKPAA+ VVEFVGGPMCW++R ++A+ G GA+ NGQK+ V+ TD+VE+S
Sbjct  181   SFAVSVGVLFRGKPAAAAVVEFVGGPMCWNSRIFSASAGGGAFCNGQKIHVSQTDEVERS  240

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD+W TN+ELFKEFT +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+PW
Sbjct  241   LLVTGFGYEHDDAWTTNIELFKEFTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPW  300

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V+R DG  +CVFDRSVL SNG LH KLLE+I PATEKLK+KG+ F
Sbjct  301   DMAAGVLIVEEAGGKVTRMDGGNFCVFDRSVLVSNGVLHGKLLERIAPATEKLKSKGIVF  360

Query  337   SLWYKPEAYKTDF  299
             SLWYKP+ Y TD 
Sbjct  361   SLWYKPDDYTTDI  373



>ref|XP_006362592.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X1 [Solanum 
tuberosum]
Length=363

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/369 (71%), Positives = 297/369 (80%), Gaps = 8/369 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFP-FLNANLQPLRYGFERILSLRRSICAKAV  1229
             MG  L+S+ +S LR    P   LP     FP   + N Q   YGF   LS     C KA 
Sbjct  1     MGRCLLSSTISSLRICQLPRIRLPA----FPKSCSTNSQ---YGFCTSLSTSGGFCTKAA  53

Query  1228  MSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLV  1049
             +SEV  KKEY +I ADSTGSIPS +LL++V+AAAKTGA+VVMDAVNKPRN+ YKG TDLV
Sbjct  54    LSEVGIKKEYSKIAADSTGSIPSSELLQVVEAAAKTGAQVVMDAVNKPRNVTYKGLTDLV  113

Query  1048  TDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFA  869
             TDTDK SE+AIL+VVRKNFPDHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y SFA
Sbjct  114   TDTDKNSEVAILEVVRKNFPDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYPSFA  173

Query  868   VSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLV  689
             VSV +LFRGKPAA+ VVEFVGGPMCW+TR ++AA GKGA+ANG+K+ V+ TDKVEQSLLV
Sbjct  174   VSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSAAAGKGAFANGEKIHVSRTDKVEQSLLV  233

Query  688   TGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNA  509
             TG+GY+ DD WATNMELFKEFT VSRGVRRLGAA+VD CHVALGI EAYWEYRL+PWD A
Sbjct  234   TGFGYEHDDPWATNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAEAYWEYRLKPWDMA  293

Query  508   AGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLW  329
             AGVLIVEEAGG VS  DG  + VFDRSVL SNG LH KLLEKIGPATE LK+KG+DFS+W
Sbjct  294   AGVLIVEEAGGTVSCMDGGSFSVFDRSVLVSNGLLHAKLLEKIGPATENLKSKGIDFSVW  353

Query  328   YKPEAYKTD  302
             +KPE Y T+
Sbjct  354   FKPENYHTE  362



>ref|XP_007211451.1| hypothetical protein PRUPE_ppa007303mg [Prunus persica]
 gb|EMJ12650.1| hypothetical protein PRUPE_ppa007303mg [Prunus persica]
Length=373

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/373 (68%), Positives = 302/373 (81%), Gaps = 4/373 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI-LSL---RRSICA  1238
             MG  LV +   P+RFS  P +ILP N+ N      + + L++GF+R  LS     R++C 
Sbjct  1     MGRSLVFSPNLPVRFSQIPRSILPPNQPNQSLSLNSREQLQHGFQRFGLSFAKPTRTLCT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KAV+SE+ ++K Y+++GA STG IP  QL+E+V+ AAKTGAEVVMDAVNKPRNI YKG T
Sbjct  61    KAVLSEIPNQKLYVKVGAKSTGPIPISQLIEVVEKAAKTGAEVVMDAVNKPRNITYKGLT  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDKKSE  IL+VVRKNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  121   DLVTDTDKKSEATILEVVRKNFKDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYP  180

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +LFRGKPAA+ VVEFVGGPMCW+TR ++A+ G GA+ NGQK+ V+ TD+VE+S
Sbjct  181   SFAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSASAGGGAFCNGQKIHVSQTDEVERS  240

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD+W TN+ELFKEFT +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+PW
Sbjct  241   LLVTGFGYEHDDAWTTNIELFKEFTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPW  300

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V+R DG  +CVFDRSVL SNG LH  LLE+I PATEKLK+KG+ F
Sbjct  301   DMAAGVLIVEEAGGQVTRMDGGNFCVFDRSVLVSNGVLHGNLLERIAPATEKLKSKGIVF  360

Query  337   SLWYKPEAYKTDF  299
             SLWYKP+ Y TD 
Sbjct  361   SLWYKPDDYTTDI  373



>ref|XP_004233230.1| PREDICTED: phosphatase IMPL1, chloroplastic [Solanum lycopersicum]
Length=363

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/368 (70%), Positives = 294/368 (80%), Gaps = 6/368 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERILSLRRSICAKAVM  1226
             MG  L+S+ +S LR    P   LP       F  +     +YGF   LS     C KA +
Sbjct  1     MGRCLLSSTISSLRICQLPRIRLPV------FPKSRSTNSQYGFCTSLSTGGGFCTKAAL  54

Query  1225  SEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVT  1046
             SEV  KKEY ++ ADSTGSIPS +LL++V+AAAKTGA+VVMDAVNKPRN+ YKG TDLVT
Sbjct  55    SEVGIKKEYSKVAADSTGSIPSSELLKVVEAAAKTGAQVVMDAVNKPRNVTYKGLTDLVT  114

Query  1045  DTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAV  866
             DTDK SE AIL+VVRKNFPDHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y SFAV
Sbjct  115   DTDKNSEFAILEVVRKNFPDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYPSFAV  174

Query  865   SVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVT  686
             SV +LFRGKPAA+ VVEFVGGPMCW+TR ++AA GKGA+ANG+K+ V+ TDKVEQSLLVT
Sbjct  175   SVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSAAAGKGAFANGEKIHVSRTDKVEQSLLVT  234

Query  685   GYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAA  506
             G+GY+ DD WATNMELFKEFT VSRGVRRLGAA+VD CHVALGI EAYWEYRL+PWD AA
Sbjct  235   GFGYEHDDPWATNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAEAYWEYRLKPWDMAA  294

Query  505   GVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWY  326
             GVLIVEEAGG VS  DG  + VFDRSVL SNG LH KLLEKIGPATE LK+KG+DFS+W+
Sbjct  295   GVLIVEEAGGTVSCMDGGSFSVFDRSVLVSNGLLHAKLLEKIGPATENLKSKGIDFSVWF  354

Query  325   KPEAYKTD  302
             KPE Y T+
Sbjct  355   KPENYHTE  362



>ref|XP_004293748.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=373

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/375 (68%), Positives = 307/375 (82%), Gaps = 8/375 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCN--RSNFPFLNANLQPLRYGFER----ILSLRRSI  1244
             MG  L+ +    LRFS +P +ILP +    + P LN+ LQ L+ G +R    I    R++
Sbjct  1     MGRSLIFSTNFALRFSQKPRSILPPSLLSQSIP-LNSKLQ-LQNGSQRFGLPIPKPARTL  58

Query  1243  CAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKG  1064
             C KAV+SE+ ++K+Y+++GA STG IP+ QL+E+V+ AAKTGAEVVMDAVNKPRN+ YKG
Sbjct  59    CTKAVLSEIPNQKQYVKVGAQSTGHIPASQLIEVVEKAAKTGAEVVMDAVNKPRNVTYKG  118

Query  1063  FTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHS  884
              TDLVTDTDKKSE AIL+VV++NF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H 
Sbjct  119   LTDLVTDTDKKSEAAILEVVKENFGDHLILGEEGGIIGDTSSDYLWCIDPLDGTTNFAHG  178

Query  883   YASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVE  704
             Y SFAVSV +LFRGKPAA+ VVEFVGGPMCW+TR ++A+ G GA+ NGQK+  + TDKVE
Sbjct  179   YPSFAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSASAGGGAFCNGQKIHASQTDKVE  238

Query  703   QSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLR  524
             +SLLVTG+GY+ DD WATN+ELFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+
Sbjct  239   RSLLVTGFGYEHDDPWATNIELFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLK  298

Query  523   PWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGV  344
             PWD AAGVLIVEEAGG+V+  DG K+C+FDRSVL SNG LHDKLLE+I PATE LK+K +
Sbjct  299   PWDMAAGVLIVEEAGGVVTCMDGGKFCIFDRSVLVSNGVLHDKLLERIAPATENLKSKKI  358

Query  343   DFSLWYKPEAYKTDF  299
             DFSLWYKPE Y+T+ 
Sbjct  359   DFSLWYKPENYRTEL  373



>ref|XP_010276157.1| PREDICTED: phosphatase IMPL1, chloroplastic [Nelumbo nucifera]
Length=381

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 305/381 (80%), Gaps = 12/381 (3%)
 Frame = -2

Query  1405  MGERLVS--TAMSPLRFSHRPITILPCNRSNFPF-LN-----ANLQPLRYGFERIL----  1262
             MG+ L+S  T    LR    P ++LP  + N    LN      + + L +GF RI+    
Sbjct  1     MGQSLISSTTFSQSLRHCQIPKSVLPLIQQNLLLPLNFTRGYCSFRSLEHGFPRIIPCAT  60

Query  1261  SLRRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPR  1082
             +  R  C K+++SE+ ++K Y ++GA+STG IPS QLLE+V+ AAKTGAEVVMDAVNKPR
Sbjct  61    TPTRRFCTKSLLSEIPNEKRYSKVGAESTGPIPSKQLLEVVENAAKTGAEVVMDAVNKPR  120

Query  1081  NINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGT  902
             NINYKG TDLVTDTDK SE AIL V+RKNF +HL+LGEEGG  GD SSDYLWCIDPLDGT
Sbjct  121   NINYKGLTDLVTDTDKMSEAAILGVLRKNFEEHLILGEEGGLIGDTSSDYLWCIDPLDGT  180

Query  901   TNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVT  722
             TNF H Y SFAVSV +LFRGKPAA+ VVEFVGGPMCW+TR ++A+ G GA+ NG+K+ V+
Sbjct  181   TNFAHGYPSFAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSASAGGGAFCNGKKIHVS  240

Query  721   DTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAY  542
              T+KVE SLLVTG+GY+ DD+WATNM+LFKEFT VSRGVRRLGAA+VD CHVALGIVE+Y
Sbjct  241   HTEKVEHSLLVTGFGYEHDDAWATNMDLFKEFTDVSRGVRRLGAAAVDMCHVALGIVESY  300

Query  541   WEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEK  362
             WEYRL+PWD AAGVL+VEEAGG V+R DG K+CVFDRSVL SNG LH KLLE+IGPATEK
Sbjct  301   WEYRLKPWDMAAGVLMVEEAGGAVTRMDGGKFCVFDRSVLVSNGLLHAKLLERIGPATEK  360

Query  361   LKNKGVDFSLWYKPEAYKTDF  299
             LKNKG+DFSLW+KPE Y TDF
Sbjct  361   LKNKGIDFSLWFKPENYSTDF  381



>ref|XP_010109814.1| Phosphatase IMPL1 [Morus notabilis]
 gb|EXC24757.1| Phosphatase IMPL1 [Morus notabilis]
Length=374

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/374 (67%), Positives = 301/374 (80%), Gaps = 5/374 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPF-LNANLQPLRYGFERILSL----RRSIC  1241
             M + L      PLR S  P +I   N++N    L++  +  R+GF+RIL       RS+C
Sbjct  1     MAKSLFFPGNVPLRLSQIPRSISSHNQTNSSLPLSSTTKQFRHGFQRILHFDAKSTRSLC  60

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SE+ +++ Y ++GA STG IP+ QLL++V+ AAKTGA+VVM+AVNKP+NI+YKG 
Sbjct  61    TKAVISEIPNQRYYPKVGAHSTGPIPASQLLQVVETAAKTGAQVVMEAVNKPQNISYKGV  120

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             TDLVTDTDK SE AILDVV KNF DHLVLGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  121   TDLVTDTDKMSEAAILDVVNKNFGDHLVLGEEGGIIGDSSSDYLWCIDPLDGTTNFAHCY  180

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +LFRGKPAA++VVEFVGGPMCW+TRT++A  G GA+ NG+K+ V+ T++VE+
Sbjct  181   PSFAVSVGVLFRGKPAAASVVEFVGGPMCWNTRTFSATAGGGAFCNGKKIHVSQTEQVER  240

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             SLLVTG+GY+ D +WATNMELFKEFT +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+P
Sbjct  241   SLLVTGFGYEHDHAWATNMELFKEFTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKP  300

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG ++R DG K+CVFDRSVL SNGALH +LLEKI PATEKLK++  +
Sbjct  301   WDMAAGVLIVEEAGGAITRMDGGKFCVFDRSVLVSNGALHARLLEKIAPATEKLKSENFE  360

Query  340   FSLWYKPEAYKTDF  299
              SLW+KPE Y TD 
Sbjct  361   HSLWFKPENYTTDL  374



>ref|XP_002276697.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X2 [Vitis 
vinifera]
 emb|CBI27169.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/372 (68%), Positives = 294/372 (79%), Gaps = 7/372 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPF---LNANLQPLRYGFERILSLRRSICAK  1235
             MG  L+S+ + P+RF   P +I P NRS  P       N Q +R GF       ++ C K
Sbjct  1     MGRSLLSSTVIPVRFPQIPKSIPPFNRSIHPIPPTFAPNYQRIR-GFS---IPTKTFCTK  56

Query  1234  AVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTD  1055
             AV+SE  + K Y ++G+DS G IP  QL+++V+ AA TGA+VVM+AVNKPRN+ YKG TD
Sbjct  57    AVLSESPNPKRYPKMGSDSVGPIPPSQLIQVVEHAANTGAQVVMEAVNKPRNVTYKGLTD  116

Query  1054  LVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYAS  875
             LVTDTDK SE AIL+VVRKNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y S
Sbjct  117   LVTDTDKMSEAAILEVVRKNFGDHLILGEEGGLIGDTSSDYLWCIDPLDGTTNFAHCYPS  176

Query  874   FAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSL  695
             FAVSV +LFRGKPAA+ VVEFVGGPMCW+TR ++A  G GA+ NGQK+  + TD VEQSL
Sbjct  177   FAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSATTGGGAFCNGQKIHASQTDLVEQSL  236

Query  694   LVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWD  515
             LVTG+GY+ DD+WATN++LFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD
Sbjct  237   LVTGFGYEHDDAWATNIDLFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWD  296

Query  514   NAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFS  335
              AAGVLIVEEAGG V+  DG K+CVFDRSVL SNG LH KLLE+IGPATEKLK KG+DFS
Sbjct  297   MAAGVLIVEEAGGTVTCMDGGKFCVFDRSVLVSNGVLHSKLLERIGPATEKLKKKGIDFS  356

Query  334   LWYKPEAYKTDF  299
             LWYKPE Y TDF
Sbjct  357   LWYKPENYNTDF  368



>gb|KDP23150.1| hypothetical protein JCGZ_00142 [Jatropha curcas]
Length=362

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/361 (69%), Positives = 295/361 (82%), Gaps = 3/361 (1%)
 Frame = -2

Query  1372  PLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI---LSLRRSICAKAVMSEVESKKE  1202
             PLRFSH P +  P N  N  F     +  + G+  I   L  +R++C KAV+SE  ++K+
Sbjct  2     PLRFSHIPRSFPPSNYLNQCFPQRYSENSQCGYGSIHLKLKPKRNLCTKAVVSEFPNQKQ  61

Query  1201  YLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSEL  1022
             Y ++GA STG IP+ QL+++V+ AAKTGAEVVMDAVNKPRNI+YKG TDLVT+TDK SE 
Sbjct  62    YPKVGAQSTGPIPTSQLIQVVETAAKTGAEVVMDAVNKPRNISYKGLTDLVTETDKMSEA  121

Query  1021  AILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRG  842
             AIL+VVRKNF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y SFAVSV +L+RG
Sbjct  122   AILEVVRKNFGDHLILGEEGGVVGDTLSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLYRG  181

Query  841   KPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDD  662
              P A+ VVEFVGG M W+TR ++A  G GA+ NGQK+ V+ TDKVE+SLLVTG+GYD DD
Sbjct  182   HPTAAAVVEFVGGHMAWNTRLFSATAGGGAFCNGQKIYVSQTDKVERSLLVTGFGYDHDD  241

Query  661   SWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEA  482
             +WATN+ELFKE+T +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD AAGVL+VEEA
Sbjct  242   AWATNIELFKEYTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWDMAAGVLMVEEA  301

Query  481   GGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             GG V+R DGEK+C+FDRSVL SNG LH KLLEKIGPATEKLK+KG+DFSLWYKPE Y+TD
Sbjct  302   GGTVTRMDGEKFCLFDRSVLVSNGVLHAKLLEKIGPATEKLKSKGIDFSLWYKPENYRTD  361

Query  301   F  299
             F
Sbjct  362   F  362



>ref|XP_006377017.1| inositol monophosphatase family protein [Populus trichocarpa]
 gb|ERP54814.1| inositol monophosphatase family protein [Populus trichocarpa]
Length=373

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 296/373 (79%), Gaps = 4/373 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI----LSLRRSICA  1238
             MG  LV +   PL FS  P +    + S   F    ++  + G+++I    L L R++C 
Sbjct  1     MGRSLVFSTNIPLEFSQNPRSFSLLHHSKLCFPQRFIENSQSGYKKIQLLNLKLARNVCT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KA +SE+ ++++Y ++GA STG I ++QL+++V+ AAKTGAEVVMDAVNKPRNI YKG T
Sbjct  61    KAALSEITNERKYPKVGAPSTGPISANQLIQVVETAAKTGAEVVMDAVNKPRNITYKGLT  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDK SE AIL+VVR+NF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y 
Sbjct  121   DLVTDTDKMSEAAILEVVRRNFGDHLILGEEGGIIGDTLSDYLWCIDPLDGTTNFAHGYP  180

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +LFRG PAA+ VVEFVGGPM W+TRT+TA  G GA+ NGQK+  + TD+VEQS
Sbjct  181   SFAVSVGVLFRGNPAAAAVVEFVGGPMAWNTRTFTAIAGGGAFCNGQKIHASQTDRVEQS  240

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD WATN+ELFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+PW
Sbjct  241   LLVTGFGYEHDDPWATNIELFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPW  300

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG VS  DG K+CVFDRSVL SNG LH KLLE+I PATEKLK+KG+DF
Sbjct  301   DMAAGVLIVEEAGGTVSCMDGGKFCVFDRSVLVSNGVLHAKLLERIAPATEKLKSKGIDF  360

Query  337   SLWYKPEAYKTDF  299
             SLWYKPE Y+TD 
Sbjct  361   SLWYKPENYRTDL  373



>gb|EYU43684.1| hypothetical protein MIMGU_mgv1a008196mg [Erythranthe guttata]
 gb|EYU43685.1| hypothetical protein MIMGU_mgv1a008196mg [Erythranthe guttata]
Length=381

 Score =   523 bits (1347),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 242/336 (72%), Positives = 285/336 (85%), Gaps = 4/336 (1%)
 Frame = -2

Query  1294  QPLRYGFERIL----SLRRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAA  1127
             + ++YGF + +    S  R+    AV+S+V  + +Y ++GA+STGSIPSDQLL +++ AA
Sbjct  46    RQIKYGFCKTVPSNSSSTRAFTTNAVLSDVPQRNQYFKVGAESTGSIPSDQLLHVIETAA  105

Query  1126  KTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGD  947
             KTGA+V+MDAVNKPRNI YKG TDLVTDTDK SE+AILDVVRKNFPDHL+LGEEGG  GD
Sbjct  106   KTGAQVIMDAVNKPRNITYKGLTDLVTDTDKMSEIAILDVVRKNFPDHLILGEEGGLVGD  165

Query  946   PSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAA  767
              SSDYLWCIDPLDGTTNF H Y SFAVS+++L++GKPAA+TVVEFVGGP CW+TRT+TAA
Sbjct  166   SSSDYLWCIDPLDGTTNFAHCYPSFAVSISVLYKGKPAAATVVEFVGGPKCWNTRTFTAA  225

Query  766   VGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAA  587
              GKGA+ NG+K+  + TD VE+SLLVTG+GY+ DD+WATN+ELFKEFT VSRGVRRLGAA
Sbjct  226   AGKGAFCNGEKIHASSTDMVERSLLVTGFGYEHDDAWATNIELFKEFTDVSRGVRRLGAA  285

Query  586   SVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGA  407
             +VD CHVALGIVE YWEYRL+PWD AAGVLIVEEAGG VS  DG K+CVFDRSVL SNG 
Sbjct  286   AVDMCHVALGIVEGYWEYRLKPWDMAAGVLIVEEAGGTVSCMDGGKFCVFDRSVLVSNGV  345

Query  406   LHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             LH KLLE+IGPATEKLK KG+DFSLWYKPE Y T+ 
Sbjct  346   LHAKLLERIGPATEKLKGKGIDFSLWYKPENYHTEL  381



>ref|XP_007024922.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 ref|XP_007024924.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 ref|XP_007024925.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 ref|XP_007024926.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 gb|EOY27544.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 gb|EOY27546.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 gb|EOY27547.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
 gb|EOY27548.1| Myo-inositol monophosphatase like 1 isoform 1 [Theobroma cacao]
Length=373

 Score =   522 bits (1345),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 253/374 (68%), Positives = 296/374 (79%), Gaps = 6/374 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSN----FPFL-NANLQPLRYGFERILSLRRSIC  1241
             MG  LV +   PLRFS  P +I P    N    + F  N+ L   + GF    S R+ +C
Sbjct  1     MGRSLVFSTNIPLRFSQTPRSISPRVHPNQYQPYKFTANSPLGHQKVGFLSTNSTRK-LC  59

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
               A++SEV ++++Y ++GA STG IP  QL+E+V+ AAK GAEVVMDAVNKPRNI YKG 
Sbjct  60    TGALLSEVSNQRQYPKVGAKSTGPIPPSQLIEVVETAAKAGAEVVMDAVNKPRNITYKGL  119

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             TDLVTDTDK SE AIL+VV++NF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  120   TDLVTDTDKMSEAAILEVVKRNFGDHLILGEEGGIIGDTSSDYLWCIDPLDGTTNFAHCY  179

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +LFRG PAA++VVEFVGGPMCW+TRT++A  G GA+ NGQK+  + TDKVEQ
Sbjct  180   PSFAVSVGVLFRGNPAAASVVEFVGGPMCWNTRTFSATAGGGAFCNGQKIHPSHTDKVEQ  239

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             SLLVTG+GY+ DD+W TN+ELFKEFT +SRGVRRLGAA+VD CHVALG+ EAYWEY L+P
Sbjct  240   SLLVTGFGYEHDDAWITNIELFKEFTDISRGVRRLGAAAVDMCHVALGVAEAYWEYCLKP  299

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG V+R DG K+CVFDRSVL SNGALH KLLE+I PATEKLKNKG+D
Sbjct  300   WDMAAGVLIVEEAGGAVTRMDGGKFCVFDRSVLVSNGALHAKLLERIAPATEKLKNKGID  359

Query  340   FSLWYKPEAYKTDF  299
             FSLWYKPE Y TD 
Sbjct  360   FSLWYKPENYLTDL  373



>ref|XP_006448721.1| hypothetical protein CICLE_v10015670mg [Citrus clementina]
 ref|XP_006448722.1| hypothetical protein CICLE_v10015670mg [Citrus clementina]
 gb|ESR61961.1| hypothetical protein CICLE_v10015670mg [Citrus clementina]
 gb|ESR61962.1| hypothetical protein CICLE_v10015670mg [Citrus clementina]
Length=369

 Score =   521 bits (1341),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 256/374 (68%), Positives = 295/374 (79%), Gaps = 10/374 (3%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRS---NFPFLNANLQPLRYGFERILSL--RRSIC  1241
             MG  LVS    PLRFS  P +    N S     P  NAN     Y   R+L+   RR+ C
Sbjct  1     MGRSLVSFTNVPLRFSQVPRSFPAPNHSTQCQVPRHNAN-SFSGYQKARVLTAKPRRTFC  59

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SE+     Y ++GA STG IP+ QL+++V++AAKTGAEVVMDAVNKPRNI YKG 
Sbjct  60    TKAVLSEIP----YQKVGAKSTGPIPTSQLIQVVESAAKTGAEVVMDAVNKPRNITYKGL  115

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             TDLVTDTDK SE A+L+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  116   TDLVTDTDKASEAAVLEVVKKNFVDHLILGEEGGVIGDSSSDYLWCIDPLDGTTNFAHGY  175

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +LF+G PAA++VVEFVGGPMCW+TRT++A  G GA+ NGQK+  +  DKVEQ
Sbjct  176   PSFAVSVGVLFQGNPAAASVVEFVGGPMCWNTRTFSATAGGGAFCNGQKIHASQIDKVEQ  235

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             SLLVTG+GYD DD+WATN+ELFKEFT +S GVRRLGAA+VD CHVALGIVEAYWEYRL+P
Sbjct  236   SLLVTGFGYDHDDAWATNIELFKEFTDISLGVRRLGAAAVDMCHVALGIVEAYWEYRLKP  295

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG VS  DG K+CVFDRSVL SNGALH KLLE+I PATEKLK+KG++
Sbjct  296   WDMAAGVLIVEEAGGAVSCMDGSKFCVFDRSVLVSNGALHAKLLERIAPATEKLKSKGIN  355

Query  340   FSLWYKPEAYKTDF  299
             FS WYKPE Y TDF
Sbjct  356   FSPWYKPENYHTDF  369



>ref|XP_009773134.1| PREDICTED: phosphatase IMPL1, chloroplastic [Nicotiana sylvestris]
Length=359

 Score =   520 bits (1338),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 257/372 (69%), Positives = 294/372 (79%), Gaps = 18/372 (5%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPF---LNANLQPLRYGFERI-LSLRRSICA  1238
             MG  L+S+ +S         T LPCN     F    +AN     +GF         + C 
Sbjct  1     MGRCLLSSTVS---------TFLPCNLPKLAFPKSFSANSAFSHHGFCSTGAKTGGAFCT  51

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KA +S V     Y +IGADSTGSIPS++LL++V+AAAKTGA+VVMDAVNKPRN+ YKG T
Sbjct  52    KAALSNV-----YSKIGADSTGSIPSNELLQVVEAAAKTGAQVVMDAVNKPRNVTYKGLT  106

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDK SE+AIL+VVRKNFPDHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  107   DLVTDTDKSSEVAILEVVRKNFPDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYP  166

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +LFRGKPAA+TVVEFVGGPMCW+TR ++AA GKGA+ANG+K+ V+ TDKVEQS
Sbjct  167   SFAVSVGVLFRGKPAAATVVEFVGGPMCWNTRIFSAAAGKGAFANGEKIHVSGTDKVEQS  226

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD WATNMELFK+FT VSRGVRRLGAA+VD CHVALGI EAYWEYRL+PW
Sbjct  227   LLVTGFGYEHDDPWATNMELFKDFTDVSRGVRRLGAAAVDMCHVALGIAEAYWEYRLKPW  286

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG VS  DG K+ VFDRSVL SNG LH KLLEKIGPATE LK KG+DF
Sbjct  287   DMAAGVLIVEEAGGKVSCMDGGKFSVFDRSVLVSNGLLHAKLLEKIGPATENLKGKGIDF  346

Query  337   SLWYKPEAYKTD  302
             S+W+KPE Y T+
Sbjct  347   SVWFKPENYHTE  358



>ref|XP_010648756.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis 
vinifera]
 ref|XP_010648759.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis 
vinifera]
 ref|XP_010648764.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis 
vinifera]
 ref|XP_010648771.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis 
vinifera]
Length=369

 Score =   520 bits (1339),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 253/373 (68%), Positives = 294/373 (79%), Gaps = 8/373 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPF---LNANLQPLRYGFERILSLRRSICAK  1235
             MG  L+S+ + P+RF   P +I P NRS  P       N Q +R GF       ++ C K
Sbjct  1     MGRSLLSSTVIPVRFPQIPKSIPPFNRSIHPIPPTFAPNYQRIR-GFS---IPTKTFCTK  56

Query  1234  AVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTD  1055
             AV+SE  + K Y ++G+DS G IP  QL+++V+ AA TGA+VVM+AVNKPRN+ YKG TD
Sbjct  57    AVLSESPNPKRYPKMGSDSVGPIPPSQLIQVVEHAANTGAQVVMEAVNKPRNVTYKGLTD  116

Query  1054  LVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYAS  875
             LVTDTDK SE AIL+VVRKNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y S
Sbjct  117   LVTDTDKMSEAAILEVVRKNFGDHLILGEEGGLIGDTSSDYLWCIDPLDGTTNFAHCYPS  176

Query  874   FAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSL  695
             FAVSV +LFRGKPAA+ VVEFVGGPMCW+TR ++A  G GA+ NGQK+  + TD VEQSL
Sbjct  177   FAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRIFSATTGGGAFCNGQKIHASQTDLVEQSL  236

Query  694   LVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWD  515
             LVTG+GY+ DD+WATN++LFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD
Sbjct  237   LVTGFGYEHDDAWATNIDLFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWD  296

Query  514   NAAGVL-IVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
              AAGVL IVEEAGG V+  DG K+CVFDRSVL SNG LH KLLE+IGPATEKLK KG+DF
Sbjct  297   MAAGVLQIVEEAGGTVTCMDGGKFCVFDRSVLVSNGVLHSKLLERIGPATEKLKKKGIDF  356

Query  337   SLWYKPEAYKTDF  299
             SLWYKPE Y TDF
Sbjct  357   SLWYKPENYNTDF  369



>ref|XP_006468454.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468455.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X2 [Citrus 
sinensis]
 gb|KDO77405.1| hypothetical protein CISIN_1g017597mg [Citrus sinensis]
 gb|KDO77406.1| hypothetical protein CISIN_1g017597mg [Citrus sinensis]
 gb|KDO77407.1| hypothetical protein CISIN_1g017597mg [Citrus sinensis]
Length=369

 Score =   520 bits (1338),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 255/374 (68%), Positives = 295/374 (79%), Gaps = 10/374 (3%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRS---NFPFLNANLQPLRYGFERILSLR--RSIC  1241
             MG  LVS    PLRFS  P +  P N S     P  NAN     Y   R+L+ +  R+ C
Sbjct  1     MGRSLVSFTNVPLRFSQVPRSFPPPNHSTQCQVPRHNAN-SFSGYQKARVLTAKPTRTFC  59

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SE+     Y ++GA STG IP  QL+++V++AAKTGAEVVMDAVNKPRNI YKG 
Sbjct  60    TKAVLSEIP----YQKVGAKSTGPIPPSQLIQVVESAAKTGAEVVMDAVNKPRNITYKGL  115

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             TDLVTDTDK SE A+L+VV+KNF +HL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  116   TDLVTDTDKASEAAVLEVVQKNFANHLILGEEGGVIGDSSSDYLWCIDPLDGTTNFAHGY  175

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSVA+LF+G PAA++VVEFVGGPMCW+TRT++A  G GA+ NGQK+  +  DKVEQ
Sbjct  176   PSFAVSVAVLFQGNPAAASVVEFVGGPMCWNTRTFSATAGGGAFCNGQKIHASQIDKVEQ  235

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             SLLVTG+GYD DD+WATN+ELFKEFT +S GVRRLGAA+VD CHVALGIVEAYWEYRL+P
Sbjct  236   SLLVTGFGYDHDDAWATNIELFKEFTDISLGVRRLGAAAVDMCHVALGIVEAYWEYRLKP  295

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG VS  DG K+CVFDRSVL SNGALH KLLE+I PATEKLK+KG++
Sbjct  296   WDMAAGVLIVEEAGGAVSCMDGGKFCVFDRSVLVSNGALHAKLLERIAPATEKLKSKGIN  355

Query  340   FSLWYKPEAYKTDF  299
             FS WYKPE Y T F
Sbjct  356   FSPWYKPENYHTGF  369



>ref|XP_011001341.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Populus euphratica]
Length=373

 Score =   519 bits (1336),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 248/373 (66%), Positives = 294/373 (79%), Gaps = 4/373 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI----LSLRRSICA  1238
             MG  LV +   PL FS  P +    N S   F    ++  + G+++I    L L R++C 
Sbjct  1     MGRSLVFSTNIPLEFSQNPRSFSLLNHSKLCFPQRFIENSQSGYKKIQLLNLKLARNVCT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KA +SE+ ++++Y ++GA STG I + QL+++V+ AAKTGAEVVMDAVNKPRNI YKG T
Sbjct  61    KAALSEITNERKYPKVGAPSTGPISATQLIQVVETAAKTGAEVVMDAVNKPRNITYKGLT  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDK SE AIL+VVR+NF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y 
Sbjct  121   DLVTDTDKMSEAAILEVVRRNFGDHLILGEEGGIIGDTLSDYLWCIDPLDGTTNFAHGYP  180

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +LFRG PAA+ VVEFVGGPM W+TRT+TA  G GA+ NGQK+  + T++VEQS
Sbjct  181   SFAVSVGVLFRGNPAAAAVVEFVGGPMAWNTRTFTAIAGGGAFCNGQKIHASQTNRVEQS  240

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD WATN+ELFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+PW
Sbjct  241   LLVTGFGYEHDDPWATNIELFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPW  300

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V   +G K+CVFDRSVL SNG LH KLLE+I PATEKLK+KG+DF
Sbjct  301   DMAAGVLIVEEAGGAVFWMEGGKFCVFDRSVLVSNGVLHAKLLERIAPATEKLKSKGIDF  360

Query  337   SLWYKPEAYKTDF  299
             SLWYKPE Y+TD 
Sbjct  361   SLWYKPENYRTDL  373



>ref|XP_008225805.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Prunus 
mume]
Length=398

 Score =   520 bits (1338),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 254/398 (64%), Positives = 302/398 (76%), Gaps = 29/398 (7%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI-LSL---RRSICA  1238
             MG  LV +   P+RFS  P +ILP N+ N      + + L++GF+R  LS     R++C 
Sbjct  1     MGRSLVFSPNLPVRFSQIPRSILPPNQPNQSLSLNSREQLQHGFQRFGLSFAKPTRTLCT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KAV+SE+ ++K Y+++GA STG IP  QL+E+V+ AAKTGAEVVMDAVNKPRNI YKG T
Sbjct  61    KAVLSEIPNQKTYVKVGAKSTGPIPISQLIEVVEKAAKTGAEVVMDAVNKPRNITYKGLT  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLD----------  908
             DLVTDTDKKSE  IL+VVRKNF DHL+LGEEGG  GD SSDYLWCIDPL           
Sbjct  121   DLVTDTDKKSEATILEVVRKNFKDHLILGEEGGIIGDSSSDYLWCIDPLGLYLLRYRFCK  180

Query  907   ---------------GTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYT  773
                            GTTNF H Y SFAVSV +LFRGKPAA+ VVEFVGGPMCW++R ++
Sbjct  181   FLFTMRKNLLGLENYGTTNFAHGYPSFAVSVGVLFRGKPAAAAVVEFVGGPMCWNSRIFS  240

Query  772   AAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLG  593
             A+ G GA+ NGQK+ V+ TD+VE+SLLVTG+GY+ DD+W TN+ELFKEFT +SRGVRRLG
Sbjct  241   ASAGGGAFCNGQKIHVSQTDEVERSLLVTGFGYEHDDAWTTNIELFKEFTDISRGVRRLG  300

Query  592   AASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASN  413
             AA+VD CHVALGIVEAYWEYRL+PWD AAGVLIVEEAGG V+R DG  +CVFDRSVL SN
Sbjct  301   AAAVDMCHVALGIVEAYWEYRLKPWDMAAGVLIVEEAGGKVTRMDGGNFCVFDRSVLVSN  360

Query  412   GALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             G LH KLLE+I PATEKLK+KG+ FSLWYKP+ Y TD 
Sbjct  361   GVLHGKLLERIAPATEKLKSKGIVFSLWYKPDDYTTDI  398



>ref|XP_002524125.1| myo inositol monophosphatase, putative [Ricinus communis]
 gb|EEF38236.1| myo inositol monophosphatase, putative [Ricinus communis]
Length=374

 Score =   516 bits (1328),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 251/377 (67%), Positives = 297/377 (79%), Gaps = 11/377 (3%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPF---LNANLQPLRYGFERI----LSLRRS  1247
             MG  L+ +    L FS  P ++ P +  N       NAN    R G+  I     S+RR+
Sbjct  1     MGTSLLFSTNISLNFSRLPTSLSPPSYPNQCLPQRFNANS---RCGYASINFNTKSIRRN  57

Query  1246  ICAKAVMSEV-ESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINY  1070
             +C  AV+SE   ++++Y R+GA STG +P  QL+++V+ AAKTGAEVVMDAVNKPRNI+Y
Sbjct  58    LCPNAVLSETPRNQRQYARVGAQSTGPVPLSQLIQVVETAAKTGAEVVMDAVNKPRNISY  117

Query  1069  KGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFT  890
             KG TDLVTDTDK SE AIL+VVRKNF +HL+LGEEGG  GD  SDYLWCIDPLDGTTNF 
Sbjct  118   KGLTDLVTDTDKMSEAAILEVVRKNFGNHLILGEEGGIIGDTLSDYLWCIDPLDGTTNFA  177

Query  889   HSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDK  710
             H Y SFAVSV +LFRG PAA+ VVEFVGGPM W+TR ++A  G GA+ NGQ++ V+ TDK
Sbjct  178   HGYPSFAVSVGVLFRGNPAAAAVVEFVGGPMAWNTRIFSATAGGGAFCNGQRIHVSQTDK  237

Query  709   VEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYR  530
             VEQSLLVTG+GY+ DD+WATN+ELFKE+T VSRGVRRLGAA+VD CHVALGIVEAYWEYR
Sbjct  238   VEQSLLVTGFGYEHDDAWATNIELFKEYTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYR  297

Query  529   LRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNK  350
             L+PWD AAGVLIVEEAGG V+R DG K+CVFDRS L SNG LH KLLE+IGPATEKLK+K
Sbjct  298   LKPWDMAAGVLIVEEAGGTVTRMDGGKFCVFDRSALVSNGVLHSKLLERIGPATEKLKSK  357

Query  349   GVDFSLWYKPEAYKTDF  299
             G+DFSLW+KPE Y TDF
Sbjct  358   GIDFSLWFKPENYHTDF  374



>ref|XP_010518990.1| PREDICTED: phosphatase IMPL1, chloroplastic [Tarenaya hassleriana]
Length=364

 Score =   515 bits (1326),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 249/366 (68%), Positives = 289/366 (79%), Gaps = 11/366 (3%)
 Frame = -2

Query  1396  RLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERILSLRRSICAKAVMSEV  1217
             R+    MSPL  ++R  +  PC     P L+ N    R GF RI       C++AV+SEV
Sbjct  10    RISRFPMSPLPLTNRNPS--PCR---IPALSRNF---RRGFSRI---SPHFCSRAVLSEV  58

Query  1216  ESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTD  1037
                K+Y R+GA STG IP  QLL +V+ AAKTGAEVVMDAVNKPRNI YKG TDLVTDTD
Sbjct  59    SGPKQYPRVGAKSTGPIPPSQLLHVVETAAKTGAEVVMDAVNKPRNITYKGLTDLVTDTD  118

Query  1036  KKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVA  857
             K SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y SFAVSV 
Sbjct  119   KASEAAILEVVKKNFGDHLILGEEGGVIGDSSSDYLWCIDPLDGTTNFAHGYPSFAVSVG  178

Query  856   ILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYG  677
             +LFRG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQ++ V+  D +E++LL+TG+G
Sbjct  179   VLFRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQRIHVSKNDAIERALLITGFG  238

Query  676   YDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVL  497
             Y+ DD W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+PWD AAGVL
Sbjct  239   YEHDDPWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPWDMAAGVL  298

Query  496   IVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPE  317
             IVEEAGG V+R DG ++CVFDRSVL SNGALH KLLE+I PATEKLK+KG+DFSLWYKPE
Sbjct  299   IVEEAGGAVTRMDGGEFCVFDRSVLVSNGALHSKLLERISPATEKLKSKGIDFSLWYKPE  358

Query  316   AYKTDF  299
              Y TD 
Sbjct  359   NYHTDL  364



>emb|CDP11230.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   507 bits (1306),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 238/323 (74%), Positives = 277/323 (86%), Gaps = 1/323 (0%)
 Frame = -2

Query  1264  LSLRRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKP  1085
             +  RR  C  +V SEV ++K++ ++GA+STG IPS +LL++VQ AA+TGA+VVMD VNKP
Sbjct  1     MPTRRLCCKASVFSEVSNQKQFFKVGAESTGPIPSKKLLQVVQTAAETGAKVVMDTVNKP  60

Query  1084  RNINYK-GFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLD  908
             R I YK G +DLVTDTDK SE AILDVVR NF DHL+LGEEGG  GD SSDYLWCIDPLD
Sbjct  61    RTIAYKIGLSDLVTDTDKMSEAAILDVVRNNFQDHLILGEEGGLIGDSSSDYLWCIDPLD  120

Query  907   GTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLS  728
             GTTNF H Y SF+VSVA+LFRGKPAA+TVVEFVGGPMCW+TRT++AA G+GA+ANG+K+ 
Sbjct  121   GTTNFAHGYPSFSVSVAVLFRGKPAAATVVEFVGGPMCWNTRTFSAASGEGAFANGEKIH  180

Query  727   VTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVE  548
             V+ TDKVE+SLLVTG+GY+ DD+WATN++LFKEFT VSRGVRRLGAASVD CHVA GI E
Sbjct  181   VSQTDKVEKSLLVTGFGYEHDDAWATNIDLFKEFTDVSRGVRRLGAASVDMCHVAFGIAE  240

Query  547   AYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPAT  368
             AYWEYRL+PWD AAGVLIVEEAGG VS  DG K+ VFDRSVL SNG LH KLLE+IGPAT
Sbjct  241   AYWEYRLKPWDMAAGVLIVEEAGGAVSCMDGGKFSVFDRSVLVSNGVLHAKLLERIGPAT  300

Query  367   EKLKNKGVDFSLWYKPEAYKTDF  299
             E+LKNKG+DFSLWYKPE Y+TD 
Sbjct  301   ERLKNKGIDFSLWYKPENYRTDI  323



>ref|XP_006415360.1| hypothetical protein EUTSA_v10007962mg [Eutrema salsugineum]
 gb|ESQ33713.1| hypothetical protein EUTSA_v10007962mg [Eutrema salsugineum]
Length=372

 Score =   509 bits (1310),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 293/379 (77%), Gaps = 17/379 (4%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNAN------LQPLRYGFERILS----L  1256
             MG  L+ +    +R SH        +RS+FP  N +       +  R+GF R+LS     
Sbjct  1     MGRSLIFSGNMSMRVSH-------LHRSSFPVTNPSSSCRVLTRNFRHGFSRVLSNSIKS  53

Query  1255  RRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNI  1076
                +  KAV+SEV  +  Y RIGA+STG+I    LL++V+AAAKTGAEVVM+AVNKPRNI
Sbjct  54    TTRLRTKAVLSEVSDQTHYPRIGANSTGTISPAVLLQVVEAAAKTGAEVVMEAVNKPRNI  113

Query  1075  NYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTN  896
              YKG +DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTN
Sbjct  114   TYKGLSDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDTSSDYLWCIDPLDGTTN  173

Query  895   FTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDT  716
             F H Y SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V++T
Sbjct  174   FAHGYPSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSNT  233

Query  715   DKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWE  536
             D VE++LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWE
Sbjct  234   DAVERALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWE  293

Query  535   YRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLK  356
             YRL+PWD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK
Sbjct  294   YRLKPWDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHSKLLERIAPATENLK  353

Query  355   NKGVDFSLWYKPEAYKTDF  299
              KG+DFSLW+KPE Y T+ 
Sbjct  354   TKGIDFSLWFKPEDYHTEL  372



>ref|XP_008801573.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=364

 Score =   508 bits (1308),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 245/369 (66%), Positives = 293/369 (79%), Gaps = 5/369 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERILSLRRSICAKAVM  1226
             MG  L+S++  PLR    PI   P + ++       L+P R          + +  KA++
Sbjct  1     MGRSLLSSSPIPLRLRFPPI---PKSFASVLSPKNGLRPRRMPIHA--KPPKELQIKAII  55

Query  1225  SEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVT  1046
             SE  SK  Y ++GA+STG IP+ +LL++V+ AAKTGAEVVM+AVNKP NINYKG TDLVT
Sbjct  56    SEFPSKNRYSKVGAESTGPIPAAELLQVVETAAKTGAEVVMEAVNKPHNINYKGITDLVT  115

Query  1045  DTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAV  866
             DTD+ SE  IL+VV+KNF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y SF V
Sbjct  116   DTDRMSESTILEVVKKNFKDHLILGEEGGLIGDSMSDYLWCIDPLDGTTNFAHGYPSFGV  175

Query  865   SVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVT  686
             SV +LFRGKPAA++VVEFVGGPMCW+TRT++A+ G GA+ NGQK+ V+ TD+VE+SLLVT
Sbjct  176   SVGVLFRGKPAAASVVEFVGGPMCWNTRTFSASSGGGAFCNGQKIHVSPTDQVERSLLVT  235

Query  685   GYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAA  506
             G+GY+ DD+WATNM LFKEFT +SRGVRRLGAASVD  HVALGIVEAYWEYRL+PWD AA
Sbjct  236   GFGYEHDDAWATNMNLFKEFTDISRGVRRLGAASVDMSHVALGIVEAYWEYRLKPWDMAA  295

Query  505   GVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWY  326
             GVLIVEEAGG+V+R DG K+ VFDRSVL SNG +HDKLLEKIGPATE+LK KG+DFSLW+
Sbjct  296   GVLIVEEAGGVVTRMDGGKFTVFDRSVLVSNGLVHDKLLEKIGPATEELKRKGIDFSLWF  355

Query  325   KPEAYKTDF  299
             KPE Y TDF
Sbjct  356   KPEDYATDF  364



>ref|XP_010927091.1| PREDICTED: phosphatase IMPL1, chloroplastic [Elaeis guineensis]
 ref|XP_010927092.1| PREDICTED: phosphatase IMPL1, chloroplastic [Elaeis guineensis]
 ref|XP_010927093.1| PREDICTED: phosphatase IMPL1, chloroplastic [Elaeis guineensis]
 ref|XP_010927094.1| PREDICTED: phosphatase IMPL1, chloroplastic [Elaeis guineensis]
 ref|XP_010927095.1| PREDICTED: phosphatase IMPL1, chloroplastic [Elaeis guineensis]
Length=363

 Score =   506 bits (1303),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 245/369 (66%), Positives = 294/369 (80%), Gaps = 6/369 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERILSLRRSICAKAVM  1226
             MG  L+S++  PLR       ++P + +  P  N   Q      E+     R+   +A++
Sbjct  1     MGRSLISSSPIPLRLR---FPLIPKSFATVPRSNGLRQRRMPIHEKP---PRNSLIRAII  54

Query  1225  SEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVT  1046
             SE  SK  Y ++GA+STG IP+ +LL++V+ AAKTGAEVVM+AVNKPRNINYKG TDLVT
Sbjct  55    SEFPSKNRYSKVGAESTGPIPAAELLQVVETAAKTGAEVVMEAVNKPRNINYKGITDLVT  114

Query  1045  DTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAV  866
             DTD+ SE AIL+VV+KNF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y SF V
Sbjct  115   DTDRMSESAILEVVKKNFKDHLILGEEGGLIGDSMSDYLWCIDPLDGTTNFAHGYPSFGV  174

Query  865   SVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVT  686
             SV ILFRGKPAA++VVEFVGGPMCW+TR ++A+ G GA+ NGQK+ V+ TD+VE+SLLVT
Sbjct  175   SVGILFRGKPAAASVVEFVGGPMCWNTRIFSASSGGGAFCNGQKIHVSQTDQVERSLLVT  234

Query  685   GYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAA  506
             G+GY+ DD+WATNM LFKEFT +SRGVRRLGAA+VD  HVALGIVEAYWEYRL+PWD  A
Sbjct  235   GFGYEHDDAWATNMNLFKEFTDISRGVRRLGAAAVDMSHVALGIVEAYWEYRLKPWDMTA  294

Query  505   GVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWY  326
             GVLIVEEAGG+V+  DGEK+ VFDRSVL SNG +HDKLLEKIGPATE+LKNKG+DFSLW+
Sbjct  295   GVLIVEEAGGVVTCMDGEKFTVFDRSVLVSNGLVHDKLLEKIGPATEELKNKGLDFSLWF  354

Query  325   KPEAYKTDF  299
             KPE Y TDF
Sbjct  355   KPEDYATDF  363



>ref|NP_564376.1| myo-inositol monophosphatase like 1 [Arabidopsis thaliana]
 sp|Q94F00.2|IMPL1_ARATH RecName: Full=Phosphatase IMPL1, chloroplastic; AltName: Full=Protein 
MYO-INOSITOL MONOPHOSPHATASE-LIKE 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE31327.1| myo-inositol monophosphatase like 1 [Arabidopsis thaliana]
Length=371

 Score =   501 bits (1290),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 287/374 (77%), Gaps = 8/374 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANL-QPLRYGFERILS----LRRSIC  1241
             MG  L+ +    LR SH P + LP      P     + +  RY   RILS        + 
Sbjct  1     MGRSLIFSGNMSLRISHLPRSSLPLQN---PISGRTVNRTFRYRCTRILSNSFKSTTRLQ  57

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SEV  +  Y RIGA +TG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI YKG 
Sbjct  58    TKAVLSEVSDQTRYPRIGAKTTGTISPAHLLEVVELAAKTGAEVVMEAVNKPRNITYKGL  117

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             +DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  118   SDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGY  177

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V+ TD VE+
Sbjct  178   PSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAVER  237

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             +LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+P
Sbjct  238   ALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKP  297

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+KG+D
Sbjct  298   WDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHPKLLERIAPATENLKSKGID  357

Query  340   FSLWYKPEAYKTDF  299
             FSLW+KPE Y T+ 
Sbjct  358   FSLWFKPEDYHTEL  371



>gb|KFK44916.1| hypothetical protein AALP_AA1G319500 [Arabis alpina]
Length=373

 Score =   501 bits (1290),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 237/372 (64%), Positives = 289/372 (78%), Gaps = 4/372 (1%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCN---RSNFPFLNANLQPLRYGFE-RILSLRRSICA  1238
             MG  L+ +    +R S  P +    +   +++F          R+GF     + +  +  
Sbjct  1     MGRSLIFSGNISMRISQLPRSTSSSSLALKNSFSSYRTVTGNFRHGFSSNTFNSKTRLQT  60

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KAV+S+V  +  Y RIGA +TG+I   QLL++V+AAAKTGAEVVM+AVNKPRNI YKG +
Sbjct  61    KAVVSQVSDQTHYPRIGAKTTGTISPSQLLQVVEAAAKTGAEVVMEAVNKPRNITYKGLS  120

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  121   DLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDTSSDYLWCIDPLDGTTNFAHGYP  180

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V++TD VE++
Sbjct  181   SFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSNTDAVERA  240

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+PW
Sbjct  241   LLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPW  300

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK KG+DF
Sbjct  301   DMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHSKLLERIAPATENLKTKGIDF  360

Query  337   SLWYKPEAYKTD  302
             SLW+KPE Y+T+
Sbjct  361   SLWFKPEDYQTE  372



>gb|AAK62447.1|AF387002_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37817.1| At1g31190 [Arabidopsis thaliana]
Length=371

 Score =   501 bits (1289),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 287/374 (77%), Gaps = 8/374 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANL-QPLRYGFERILS----LRRSIC  1241
             MG  L+ +    LR SH P + LP      P     + +  RY   RILS        + 
Sbjct  1     MGRSLIFSGNMSLRISHLPGSSLPLQN---PISGRTVNRTFRYRCTRILSNSFKSTTRLQ  57

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SEV  +  Y RIGA +TG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI YKG 
Sbjct  58    TKAVLSEVSDQTRYPRIGAKTTGTISPAHLLEVVELAAKTGAEVVMEAVNKPRNITYKGL  117

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             +DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  118   SDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGY  177

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V+ TD VE+
Sbjct  178   PSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAVER  237

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             +LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+P
Sbjct  238   ALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKP  297

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+KG+D
Sbjct  298   WDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHPKLLERIAPATENLKSKGID  357

Query  340   FSLWYKPEAYKTDF  299
             FSLW+KPE Y T+ 
Sbjct  358   FSLWFKPEDYHTEL  371



>ref|XP_010056605.1| PREDICTED: phosphatase IMPL1, chloroplastic [Eucalyptus grandis]
 gb|KCW73405.1| hypothetical protein EUGRSUZ_E01881 [Eucalyptus grandis]
Length=371

 Score =   499 bits (1285),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 287/376 (76%), Gaps = 12/376 (3%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCN---RSNFPFLNANLQPLRYGFERILSLR----RS  1247
             MG  LV  A +P++FS     + P     R +FP      Q    GF +  S      R+
Sbjct  1     MGRSLVFLASAPVKFSRELNWVPPLGQKLRQSFP--RTTRQVSLGGFLKFPSFSANQGRT  58

Query  1246  ICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYK  1067
             +  +AV+S   S   Y ++GA STG IP  QL E+V+ AAKTGA+VVMDAVNKPRNI YK
Sbjct  59    LSVRAVVS---SDTSYPKVGATSTGPIPGSQLAEVVETAAKTGAQVVMDAVNKPRNIFYK  115

Query  1066  GFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTH  887
             G TDLVT+TDK SE AILDVVRKNFPDHL+LGEEGG  GD SS YLWCIDPLDGTTNF H
Sbjct  116   GLTDLVTETDKMSEAAILDVVRKNFPDHLILGEEGGIIGDSSSGYLWCIDPLDGTTNFAH  175

Query  886   SYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKV  707
              Y SFAVSV +LF+G PAA+ VVEFVGGPMCW+TR ++A  G GA+ NGQK+  + TD V
Sbjct  176   GYPSFAVSVGVLFQGNPAAAAVVEFVGGPMCWNTRMFSATAGGGAFCNGQKIQSSKTDLV  235

Query  706   EQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRL  527
             EQSLLVTG+GY+ DD WATNMELFK+FT +SRGVRRLGAA+VD CHVALG+ EAYWEYRL
Sbjct  236   EQSLLVTGFGYEHDDPWATNMELFKDFTDISRGVRRLGAAAVDMCHVALGVAEAYWEYRL  295

Query  526   RPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKG  347
             +PWD AAGVLIVEEAGG V+R DG K+CVFDRS+L SNGA+H KLL++I PATEKLK KG
Sbjct  296   KPWDMAAGVLIVEEAGGAVTRMDGGKFCVFDRSLLVSNGAVHGKLLDRIAPATEKLKAKG  355

Query  346   VDFSLWYKPEAYKTDF  299
             +DFSLWYKP+ Y+TD 
Sbjct  356   IDFSLWYKPDNYQTDL  371



>gb|AAM61548.1| unknown [Arabidopsis thaliana]
Length=371

 Score =   498 bits (1282),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 287/374 (77%), Gaps = 8/374 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANL-QPLRYGFERILS----LRRSIC  1241
             MG  L+ +    LR SH P + LP      PF    + +  RY   RILS        + 
Sbjct  1     MGRSLIFSGNMSLRISHLPRSSLPLQN---PFSGRTVNRTFRYRCTRILSNSFKSTTRLQ  57

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SEV  +  Y RIGA +TG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI YKG 
Sbjct  58    TKAVLSEVSDQTRYPRIGAKTTGTISPAHLLEVVELAAKTGAEVVMEAVNKPRNITYKGL  117

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             +DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  118   SDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGY  177

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +L+RG PAA++VVEFVGGPMC +TRT++A  G GA  NGQK+ V+ TD VE+
Sbjct  178   PSFAVSVGVLYRGNPAAASVVEFVGGPMCRNTRTFSATAGGGALCNGQKIHVSKTDAVER  237

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             +LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+P
Sbjct  238   ALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKP  297

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+KG+D
Sbjct  298   WDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHPKLLERIAPATENLKSKGID  357

Query  340   FSLWYKPEAYKTDF  299
             FSLW+KPE Y T+ 
Sbjct  358   FSLWFKPEDYHTEL  371



>ref|XP_002893832.1| inositol monophosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70091.1| inositol monophosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   496 bits (1278),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/363 (66%), Positives = 283/363 (78%), Gaps = 10/363 (3%)
 Frame = -2

Query  1369  LRFSHRPITILP------CNRSNFPFLNANLQPLRYGFERILSLRRSICAKAVMSEVESK  1208
             +R SH P + LP      C  SN  F +     L   F+    L+     KA++SE+  +
Sbjct  6     MRISHLPRSSLPLQNPFSCRTSNRNFRHGCSTILSNSFKSTSRLQ----TKALVSEISDQ  61

Query  1207  KEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKS  1028
               Y RIGA STG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI YKG +DLVTDTDK S
Sbjct  62    THYPRIGAKSTGTISPALLLEVVELAAKTGAEVVMEAVNKPRNITYKGLSDLVTDTDKAS  121

Query  1027  ELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILF  848
             E AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y SFAVSV +L+
Sbjct  122   EAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLY  181

Query  847   RGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDR  668
             RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V++TD VE++LL+TG+GY+ 
Sbjct  182   RGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSETDAVERALLITGFGYEH  241

Query  667   DDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVE  488
             DD+W+TNM+LFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+PWD AAGVLIVE
Sbjct  242   DDAWSTNMDLFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPWDMAAGVLIVE  301

Query  487   EAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
             EAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+KG+DFSLW+KPE Y 
Sbjct  302   EAGGAVTRMDGGKFSVFDRSVLVSNGVLHSKLLERIAPATENLKSKGIDFSLWFKPEEYH  361

Query  307   TDF  299
             T+ 
Sbjct  362   TEL  364



>ref|XP_006853338.1| hypothetical protein AMTR_s00032p00084330 [Amborella trichopoda]
 gb|ERN14805.1| hypothetical protein AMTR_s00032p00084330 [Amborella trichopoda]
Length=378

 Score =   497 bits (1279),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/356 (67%), Positives = 292/356 (82%), Gaps = 8/356 (2%)
 Frame = -2

Query  1360  SHRPITILPCNRSNFPFLNANLQPLRYGFERIL---SLRRSICAKAVMSEVESKKEYLRI  1190
             SHR    LP  R+  P  +     L++G +      S+    C  A++S+VE ++ Y +I
Sbjct  27    SHR----LPNYRNLLPRTHEPSLRLKHGIQLSFDTNSMGGFRCG-AILSDVERERNYRKI  81

Query  1189  GADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILD  1010
             G+ STGS+ ++QLLE+V+AAAKTGA+VVM+AVNKPR+I YKG TDLVTDTDK+SELAIL+
Sbjct  82    GSQSTGSLSANQLLELVEAAAKTGAQVVMEAVNKPRSITYKGTTDLVTDTDKRSELAILE  141

Query  1009  VVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAA  830
             VVR NF DHL+LGEEGG  G+ SSDYLWCIDPLDGTTNF H Y SFAVSV +LFRG+PAA
Sbjct  142   VVRDNFNDHLILGEEGGLIGNTSSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLFRGRPAA  201

Query  829   STVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWAT  650
             + VVEFVGGPMCW+TRT++AA G GA+ NG+++ V+ TD+VEQSLLVTG+GY+ DD+WAT
Sbjct  202   AAVVEFVGGPMCWNTRTFSAATGGGAFCNGKRIHVSATDQVEQSLLVTGFGYEHDDAWAT  261

Query  649   NMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLV  470
             N++LFKEFT +SRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD AAGVLIVEEAGG V
Sbjct  262   NIDLFKEFTDISRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWDMAAGVLIVEEAGGSV  321

Query  469   SRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             +  DG  +CVFDRSVL SNGALH KLLE+IGPATEKLK+KG++FS W+KPE Y +D
Sbjct  322   TCMDGGNFCVFDRSVLVSNGALHGKLLERIGPATEKLKSKGINFSHWFKPENYNSD  377



>ref|XP_010478562.1| PREDICTED: phosphatase IMPL1, chloroplastic [Camelina sativa]
Length=370

 Score =   495 bits (1275),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 244/375 (65%), Positives = 289/375 (77%), Gaps = 13/375 (3%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLN--ANLQPLRYGFERILS--LRRS---  1247
             MG  L+ +    +R SH P        S+ P  N  +      +G  RILS  L +S   
Sbjct  1     MGRSLIFSGNMSMRISHIP------RSSSLPLQNPFSCRTVTGHGCWRILSNSLSKSTTR  54

Query  1246  ICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYK  1067
             +  KA++SEV  +  Y RIGA STG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI YK
Sbjct  55    LQTKALVSEVSDQTRYPRIGAKSTGTISPSHLLEVVELAAKTGAEVVMEAVNKPRNITYK  114

Query  1066  GFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTH  887
             G TDLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H
Sbjct  115   GLTDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAH  174

Query  886   SYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKV  707
              Y SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V+ TD V
Sbjct  175   GYPSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAV  234

Query  706   EQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRL  527
             E++LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI ++YWEYRL
Sbjct  235   ERALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIADSYWEYRL  294

Query  526   RPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKG  347
             +PWD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+KG
Sbjct  295   KPWDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGILHSKLLERIAPATENLKSKG  354

Query  346   VDFSLWYKPEAYKTD  302
             +DFSLW+KPE Y T+
Sbjct  355   IDFSLWFKPEDYHTE  369



>ref|XP_008463623.1| PREDICTED: phosphatase IMPL1, chloroplastic [Cucumis melo]
Length=398

 Score =   494 bits (1272),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 229/313 (73%), Positives = 264/313 (84%), Gaps = 0/313 (0%)
 Frame = -2

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KA +SE+  +K+Y ++GA S G IP   L+++V+ AA TGAEVVMDAVNKPRN+ YKG T
Sbjct  86    KAALSEISYRKQYPKVGAKSIGPIPPSHLIQVVENAANTGAEVVMDAVNKPRNVEYKGLT  145

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT+TDK SE AIL VVRKNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  146   DLVTETDKMSEAAILKVVRKNFKDHLILGEEGGVIGDSSSDYLWCIDPLDGTTNFAHGYP  205

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +L+RG PAA+ VVEFVGGPMCW+TR +TA  G GA+ NGQK++V+ T +VE+S
Sbjct  206   SFAVSVGVLYRGNPAAAAVVEFVGGPMCWNTRIFTATAGGGAFCNGQKINVSQTSQVERS  265

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD W TNM+LFKEFT VSRGVRRLGAA+VD  HVALGIVEAYWEYRL+PW
Sbjct  266   LLVTGFGYEHDDPWTTNMDLFKEFTDVSRGVRRLGAAAVDMSHVALGIVEAYWEYRLKPW  325

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG +HDKLLEKIGPATEKLK KG++F
Sbjct  326   DMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVVHDKLLEKIGPATEKLKGKGIEF  385

Query  337   SLWYKPEAYKTDF  299
             SLWYKPE Y+TDF
Sbjct  386   SLWYKPENYQTDF  398



>ref|XP_010499669.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Camelina sativa]
Length=372

 Score =   493 bits (1268),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 244/377 (65%), Positives = 287/377 (76%), Gaps = 15/377 (4%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFE---RIL---SLRRS-  1247
             MG  L+ +    +R SH P        S+ P  N        G     RIL   SL +S 
Sbjct  1     MGRSLIFSGNMSMRISHIP------RSSSLPLQNPFSCRTVTGHGSSWRILLSNSLSKST  54

Query  1246  --ICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNIN  1073
               +  KAV+SEV  +  Y RIGA STG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI 
Sbjct  55    TRLQTKAVVSEVSDQTRYPRIGAKSTGTISPAHLLEVVELAAKTGAEVVMEAVNKPRNIT  114

Query  1072  YKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNF  893
             YKG TDLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD +SDYLWCIDPLDGTTNF
Sbjct  115   YKGLTDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSASDYLWCIDPLDGTTNF  174

Query  892   THSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTD  713
              H Y SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V+ TD
Sbjct  175   AHGYPSFAVSVGVLYRGTPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTD  234

Query  712   KVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEY  533
              VE++LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI ++YWEY
Sbjct  235   AVERALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIADSYWEY  294

Query  532   RLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKN  353
             RL+PWD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+
Sbjct  295   RLKPWDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGILHSKLLERIAPATENLKS  354

Query  352   KGVDFSLWYKPEAYKTD  302
             KG+DFSLW+KPE Y T+
Sbjct  355   KGIDFSLWFKPEDYHTE  371



>emb|CDY02366.1| BnaA09g25360D [Brassica napus]
Length=372

 Score =   486 bits (1250),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 237/374 (63%), Positives = 284/374 (76%), Gaps = 7/374 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCN---RSNFPFLNANLQPL--RYGFERILSLRRSIC  1241
             MG  L+ +    +R +H P + LP      S     N   + L  R       S    + 
Sbjct  1     MGRSLIFSGSMSMRIAHLPRSSLPLTTLFSSQTVTRNFRHEFLCWRISSNSFKSSTTRLR  60

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+S+    + + RIGA +TG I   QLL++V+AAAKTGAEVVM+AVNKPRNI YKG 
Sbjct  61    TKAVLSD--QNQRFPRIGAKTTGPISPAQLLQVVEAAAKTGAEVVMEAVNKPRNITYKGL  118

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             +DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  119   SDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGY  178

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V++TD VE+
Sbjct  179   PSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSNTDAVER  238

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             +LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+P
Sbjct  239   ALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKP  298

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVD  341
             WD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLL++I PATE LK KG+D
Sbjct  299   WDMAAGVLIVEEAGGAVTRMDGGKFTVFDRSVLVSNGVLHSKLLDRIAPATENLKTKGID  358

Query  340   FSLWYKPEAYKTDF  299
             FSLW+KPE Y T+ 
Sbjct  359   FSLWFKPEDYHTEL  372



>emb|CDY51621.1| BnaCnng21130D [Brassica napus]
Length=370

 Score =   485 bits (1249),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 237/373 (64%), Positives = 285/373 (76%), Gaps = 7/373 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFE-RILSLRRSIC---A  1238
             MG  L+ +    +R SH   + LP   + F       +  R+G     +S   S      
Sbjct  1     MGRSLIFSGSMSMRISHLSRSSLPLT-TPFSCRAVVTRDFRHGLLCSTISSNGSTTRLRT  59

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KAV+S+   K+ Y RIGA +TG I    LL++V+AAAKTGAE+VM+AVNKPRNI YKG +
Sbjct  60    KAVLSD--QKQHYPRIGAKTTGPISPAHLLQVVEAAAKTGAELVMEAVNKPRNITYKGLS  117

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  118   DLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYP  177

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V++TD VE++
Sbjct  178   SFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGASCNGQKIHVSNTDAVERA  237

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+PW
Sbjct  238   LLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPW  297

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLL++I PATE LK KG+DF
Sbjct  298   DMAAGVLIVEEAGGAVTRMDGGKFTVFDRSVLVSNGVLHSKLLDRIAPATENLKTKGIDF  357

Query  337   SLWYKPEAYKTDF  299
             SLW+KPE Y T+ 
Sbjct  358   SLWFKPEDYHTEL  370



>ref|XP_009385039.1| PREDICTED: phosphatase IMPL1, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   484 bits (1245),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 225/318 (71%), Positives = 270/318 (85%), Gaps = 0/318 (0%)
 Frame = -2

Query  1255  RRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNI  1076
             R S    A +SE  + + + R+ A+STG IP+ +LL++V+ AA+TGAEVVM+AVNKPRNI
Sbjct  42    RGSRTRAAAVSESPTGRLFPRVAAESTGPIPAAELLKVVETAARTGAEVVMEAVNKPRNI  101

Query  1075  NYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTN  896
             NYKG TDLVTDTDK SE  IL+VV+KNF DHL+LGEEGG  GD  S+YLWCIDPLDGTTN
Sbjct  102   NYKGITDLVTDTDKLSESVILEVVKKNFKDHLILGEEGGLIGDSLSEYLWCIDPLDGTTN  161

Query  895   FTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDT  716
             F H Y SFAVSV +LFRGKPAA++VVEFVGGPMCW+TRT+ A+ G GA+ NGQK+ V+ T
Sbjct  162   FAHGYPSFAVSVGVLFRGKPAAASVVEFVGGPMCWNTRTFCASSGGGAFCNGQKIHVSQT  221

Query  715   DKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWE  536
             D+VE+SLLVTG+GY+ DD+WATN+ LFKEFT +SRGVRRLGAA+VD  HVALGIVEAYWE
Sbjct  222   DQVERSLLVTGFGYEHDDAWATNINLFKEFTDISRGVRRLGAAAVDMSHVALGIVEAYWE  281

Query  535   YRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLK  356
             YRL+PWD AAGVL+VEEAGG+V+R DG K+ VFDRSVL SNG +H+KLLE+IGPATE+LK
Sbjct  282   YRLKPWDMAAGVLMVEEAGGVVTRMDGGKFTVFDRSVLVSNGIVHEKLLERIGPATEELK  341

Query  355   NKGVDFSLWYKPEAYKTD  302
              KG+DFSLW+KPE Y TD
Sbjct  342   KKGIDFSLWFKPENYSTD  359



>ref|XP_003527163.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X1 [Glycine 
max]
 gb|KHN17275.1| Phosphatase IMPL1, chloroplastic [Glycine soja]
Length=359

 Score =   483 bits (1243),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 232/352 (66%), Positives = 284/352 (81%), Gaps = 7/352 (2%)
 Frame = -2

Query  1345  TILPCNRSNFPFLN-ANLQPLRY---GFERILSLRRSICAKAVMSEVESKKEYLRIGADS  1178
             T+ P +R  FP L+ ++  P ++   G+   LS  R+   + +++      ++  +G+ S
Sbjct  10    TLSPRSRLLFPPLSFSHTYPTKFHRNGWHPSLSKSRT---QPLITNSLLSDKFPTVGSLS  66

Query  1177  TGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRK  998
             TG IPS  L+E+V+ AA+TGA+VVM+AVNKPRNI YKG TDLVT+TDK SE AIL+VV+K
Sbjct  67    TGPIPSTHLIEVVKTAAQTGAQVVMEAVNKPRNITYKGLTDLVTETDKMSEAAILEVVKK  126

Query  997   NFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVV  818
             NF DHL+LGEEGG  GD +SDYLWCIDPLDGTTNF H Y SFAVSV +L+RG PAA+ VV
Sbjct  127   NFEDHLILGEEGGVIGDAASDYLWCIDPLDGTTNFAHGYPSFAVSVGVLYRGNPAAAAVV  186

Query  817   EFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMEL  638
             EFVGG MCW+TR ++A  G GA+ NGQ++ V+ T++VE+SLLVTG+GYD DD+WATN++L
Sbjct  187   EFVGGSMCWNTRLFSATAGGGAFCNGQRIQVSATNQVERSLLVTGFGYDHDDAWATNIDL  246

Query  637   FKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTD  458
             FKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD AAGVL+VEEAGG VSR D
Sbjct  247   FKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWDMAAGVLMVEEAGGTVSRMD  306

Query  457   GEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             G K+CVFDRSVL SNG LH KLLE+IGPATEKLKNKG+DFSLWYKPE Y+ D
Sbjct  307   GGKFCVFDRSVLVSNGQLHAKLLERIGPATEKLKNKGIDFSLWYKPENYRAD  358



>ref|XP_011000209.1| PREDICTED: LOW QUALITY PROTEIN: phosphatase IMPL1, chloroplastic 
[Populus euphratica]
Length=377

 Score =   483 bits (1243),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 237/380 (62%), Positives = 282/380 (74%), Gaps = 20/380 (5%)
 Frame = -2

Query  1408  EMGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRY------GFERI----LS  1259
             EM   +V +   PL+FS +P +    N S        L P R+      G +R     + 
Sbjct  8     EMSRSVVFSTNIPLKFSQKPRSFSLLNHSK------TLVPQRFSENSQCGLQRFQLLSMK  61

Query  1258  LRRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRN  1079
             L R++C KA +SE++    Y ++ A STG IP  QL+++V+ AAKTGAEVVMDAVNKPRN
Sbjct  62    LARNVCIKAALSEMK----YPKVAASSTGPIPPSQLIQVVETAAKTGAEVVMDAVNKPRN  117

Query  1078  INYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTT  899
             I YKG TDLVTD DK SE AIL+VV +NF DHL+LGEEGG  GD  SDYLWCIDPLDGTT
Sbjct  118   ITYKGLTDLVTDADKMSEAAILEVVTRNFGDHLILGEEGGIIGDTLSDYLWCIDPLDGTT  177

Query  898   NFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTD  719
             NF H Y SFAVSV +LF+G PAA++VVEFV  PM W T T++A  G GA+ NGQK+  + 
Sbjct  178   NFAHGYPSFAVSVGVLFQGNPAAASVVEFVSDPMAWDTCTFSATAGGGAFCNGQKIHASP  237

Query  718   TDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYW  539
             T +VEQSLL+TG+GY+ DD WA N+ELFKEFT VSRGV+RLGAA+VD CHVALGIVEAYW
Sbjct  238   TAQVEQSLLMTGFGYEHDDPWAANIELFKEFTDVSRGVQRLGAAAVDMCHVALGIVEAYW  297

Query  538   EYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKL  359
             EYRL+PWD AAGVLIVEEAGG V R DG K+C FDRSVL SNG LH KLLE+I PATEKL
Sbjct  298   EYRLKPWDMAAGVLIVEEAGGTVYRMDGGKFCGFDRSVLVSNGVLHAKLLERIAPATEKL  357

Query  358   KNKGVDFSLWYKPEAYKTDF  299
             K++ +DFSLWYKPE Y+TD 
Sbjct  358   KSEVIDFSLWYKPENYRTDL  377



>ref|XP_009115008.1| PREDICTED: phosphatase IMPL1, chloroplastic [Brassica rapa]
Length=370

 Score =   481 bits (1239),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 236/375 (63%), Positives = 286/375 (76%), Gaps = 11/375 (3%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANL--QPLRYGF----ERILSLRRSI  1244
             MG  L+ +    +R SH   + LP      PF +  +  +  R+G         S    +
Sbjct  1     MGRLLIFSGSMTMRVSHLSRSSLPLTN---PFSSRAVVTRDSRHGLLCSTISSNSSTTRL  57

Query  1243  CAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKG  1064
               KAV+S+   K+ + RIGA +TG I   QLL++V+AAAKTGAEVVM+AVNKPRNI YKG
Sbjct  58    RTKAVLSD--QKQHFPRIGAKTTGPISPAQLLQVVEAAAKTGAEVVMEAVNKPRNITYKG  115

Query  1063  FTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHS  884
              +DLVTDTDK SE AIL+ V+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H 
Sbjct  116   LSDLVTDTDKASEAAILEEVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHG  175

Query  883   YASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVE  704
             Y SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A+ G GA   GQK+ V++TD VE
Sbjct  176   YPSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSASAGGGALCKGQKIHVSNTDAVE  235

Query  703   QSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLR  524
             ++LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+
Sbjct  236   RALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLK  295

Query  523   PWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGV  344
             PWD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLL++I PATE LK KG+
Sbjct  296   PWDMAAGVLIVEEAGGAVTRMDGGKFTVFDRSVLVSNGVLHSKLLDRIAPATENLKTKGI  355

Query  343   DFSLWYKPEAYKTDF  299
             DFSLW+KPE Y T+ 
Sbjct  356   DFSLWFKPEDYHTEL  370



>ref|XP_004489671.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Cicer arietinum]
Length=347

 Score =   480 bits (1236),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 223/321 (69%), Positives = 267/321 (83%), Gaps = 3/321 (1%)
 Frame = -2

Query  1264  LSLRRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKP  1085
             L  R   C  ++ S++ ++    R+GA STG I    L+++   AA+TGA+VVMDAVNKP
Sbjct  29    LKSRIQSCKNSLQSDIYTQH---RVGARSTGPIQPTHLIQVATTAAQTGAQVVMDAVNKP  85

Query  1084  RNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDG  905
             RNI YKG TDLVT+TDK SE AIL+VV+KNF DHL+LGEEGG  G+ +SDYLWCIDPLDG
Sbjct  86    RNITYKGLTDLVTETDKMSEAAILEVVKKNFDDHLILGEEGGIIGEAASDYLWCIDPLDG  145

Query  904   TTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSV  725
             TTNF H Y SFAVSV +L+RG PAA+TVVEFVGGPMCW+TR +TA  G GA+ NGQ++ V
Sbjct  146   TTNFAHGYPSFAVSVGVLYRGNPAAATVVEFVGGPMCWNTRIFTATAGGGAFCNGQRIHV  205

Query  724   TDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEA  545
             + T++VEQSLLVTG+GY+ D++WATN+ELFKEFT VSRGVRRLGAA+VD CHVALGIVEA
Sbjct  206   SATNQVEQSLLVTGFGYEHDEAWATNIELFKEFTDVSRGVRRLGAAAVDMCHVALGIVEA  265

Query  544   YWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATE  365
             YWEYRL+PWD AAGVL+VEEAGG VSR DG K+CVFDRSVL SNG LH +LLE+IGPATE
Sbjct  266   YWEYRLKPWDMAAGVLMVEEAGGTVSRMDGGKFCVFDRSVLVSNGVLHTELLERIGPATE  325

Query  364   KLKNKGVDFSLWYKPEAYKTD  302
             +LK+KG+DFSLWYKPE Y+ D
Sbjct  326   ELKSKGIDFSLWYKPEDYRAD  346



>gb|KEH16547.1| inositol monophosphatase family protein [Medicago truncatula]
Length=350

 Score =   478 bits (1230),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -2

Query  1243  CAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKG  1064
             C  ++ SE   +K Y R+GA STG +    LLE+   AA+TGA+VVMDAVNKPR+I YKG
Sbjct  39    CKNSLKSE---EKLYSRVGALSTGPVQPAILLEVATTAAQTGAKVVMDAVNKPRSITYKG  95

Query  1063  FTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHS  884
              TDLVT+TDK SE AIL+VV+KNF DHL+LGEEGG  GD +SDYLWCIDPLDGTTNF H 
Sbjct  96    LTDLVTETDKMSEAAILEVVKKNFEDHLILGEEGGIIGDVASDYLWCIDPLDGTTNFAHG  155

Query  883   YASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVE  704
             Y SFAVSV +L+RG P A+TVVEFVGGPMCW+TR +TA  G GA+ NGQ++ V+ TD+VE
Sbjct  156   YPSFAVSVGVLYRGNPTAATVVEFVGGPMCWNTRIFTATAGGGAFCNGQRIEVSVTDQVE  215

Query  703   QSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLR  524
             +SLLVTG+GY+ D++WATN+ELFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+
Sbjct  216   RSLLVTGFGYEHDEAWATNIELFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLK  275

Query  523   PWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGV  344
             PWD AAGVL+VEEAGG VSR DG K+CVFDRSVL SNG +H KLLE+IGPATE LK+KG+
Sbjct  276   PWDMAAGVLMVEEAGGTVSRMDGGKFCVFDRSVLVSNGVIHAKLLERIGPATEGLKSKGI  335

Query  343   DFSLWYKPEAYKTD  302
             DFSLWYKPE Y+ D
Sbjct  336   DFSLWYKPEDYRAD  349



>gb|EPS71146.1| hypothetical protein M569_03612, partial [Genlisea aurea]
Length=331

 Score =   476 bits (1225),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 265/320 (83%), Gaps = 1/320 (0%)
 Frame = -2

Query  1255  RRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVV-MDAVNKPRN  1079
             R S   +A+ SEV    +  ++G++S G IP D+LL + + AAKTGA+VV MDAVN+PRN
Sbjct  12    RLSFGTRAISSEVSPHDQRFKVGSESAGPIPLDELLHVAETAAKTGAQVVIMDAVNEPRN  71

Query  1078  INYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTT  899
             I YKG TDLVTDTDK SE+AILDVVR +FP HL+LGEEGG  G+  SDYLWCIDPLDGTT
Sbjct  72    ITYKGLTDLVTDTDKMSEVAILDVVRNSFPGHLILGEEGGVIGNSYSDYLWCIDPLDGTT  131

Query  898   NFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTD  719
             NF H Y SFAVSV +L+RG+PA +TVVEF+GGP CW+TRT+TAA GKG+  NGQK+ V+ 
Sbjct  132   NFAHCYPSFAVSVGVLYRGRPAVATVVEFLGGPFCWNTRTFTAAAGKGSSCNGQKIHVSQ  191

Query  718   TDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYW  539
             TDKVE+SLL+TG+GY+ DD+WATN+ELFK+FT +SRGVRRLGAASVD CHVALGI EAYW
Sbjct  192   TDKVEKSLLITGFGYEHDDAWATNIELFKQFTDISRGVRRLGAASVDMCHVALGIAEAYW  251

Query  538   EYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKL  359
             EYRL+PWD AAGVLIVEEAGG VSR DG K+CVFDRSVL SNG +H +LLE+I  +TEKL
Sbjct  252   EYRLKPWDMAAGVLIVEEAGGEVSRMDGGKFCVFDRSVLVSNGLVHSQLLERIATSTEKL  311

Query  358   KNKGVDFSLWYKPEAYKTDF  299
             K KG+DFS W+KPE Y+T+ 
Sbjct  312   KEKGIDFSPWFKPENYRTEL  331



>ref|XP_010695784.1| PREDICTED: phosphatase IMPL1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=379

 Score =   477 bits (1228),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 282/392 (72%), Gaps = 36/392 (9%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERILSLRRSI------  1244
             MG  L+S++++P +F   P        ++FP  N         F R L   +S+      
Sbjct  1     MGRCLISSSITPSKFHQLP--------TSFPSFNHKTHQ-SSAFSRYLKFSKSLKNGIFG  51

Query  1243  -----------------CAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGA  1115
                              C  AV+SE +    + ++GA STG IP ++LL +V+ AAKTGA
Sbjct  52    GALSLNPSPSSSSRVSLCTSAVLSETQ----FPKVGAQSTGPIPVNELLRVVEKAAKTGA  107

Query  1114  EVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSD  935
             EVVMDAVNKPR I+YKG TDLVT+TDK SE AIL+VV  NF DHL+LGEEGG  G+ SSD
Sbjct  108   EVVMDAVNKPRKISYKGLTDLVTETDKMSEAAILEVVGANFKDHLILGEEGGIIGEASSD  167

Query  934   YLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKG  755
             YLWCIDPLDGTTNF H Y SFAVSV +LFRG+P A+ VVEFVGG MCW+TRT+TA  G G
Sbjct  168   YLWCIDPLDGTTNFAHGYPSFAVSVGVLFRGRPVAAAVVEFVGGAMCWNTRTFTAIAGGG  227

Query  754   AYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDF  575
             A+ NGQ++ V+ TD VE+SLLVTG+GY+ DD+W TN+ LFKEFT +SRGVRRLGAA+VD 
Sbjct  228   AFCNGQRIQVSATDLVERSLLVTGFGYEHDDAWVTNINLFKEFTDISRGVRRLGAAAVDM  287

Query  574   CHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDK  395
             CHVA+G+ +AYWEYRL+PWD AAGVLIVEEAGG V+  DG K+CV+DRSVL SNG LH K
Sbjct  288   CHVAIGVADAYWEYRLKPWDMAAGVLIVEEAGGAVTCMDGGKFCVYDRSVLVSNGLLHSK  347

Query  394   LLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             LLEKI PATE+LK KG+DFS WYKPE Y TD 
Sbjct  348   LLEKISPATERLKEKGIDFSWWYKPENYSTDL  379



>gb|AFK33475.1| unknown [Lotus japonicus]
Length=351

 Score =   474 bits (1219),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 218/302 (72%), Positives = 258/302 (85%), Gaps = 0/302 (0%)
 Frame = -2

Query  1207  KEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKS  1028
             + + ++GA STG I +  L+++V  AA+TGA+VVMDAVNKPRNI YKG TDLVT+TDK S
Sbjct  49    ENFPKVGARSTGPIAAGDLIQVVTTAAQTGAQVVMDAVNKPRNITYKGLTDLVTETDKMS  108

Query  1027  ELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILF  848
             E AIL+VV+KNF DHL+LGEEGG  GD +SDYLWCIDPLDGTTNF H Y SFAVSV +L+
Sbjct  109   ESAILEVVKKNFKDHLILGEEGGIIGDAASDYLWCIDPLDGTTNFAHGYPSFAVSVGVLY  168

Query  847   RGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDR  668
             RG PAA++VVEFVGGPMCW+TR ++A  G GA+ NGQ++ V+ T+ VE+SLLVTG+GYD 
Sbjct  169   RGNPAAASVVEFVGGPMCWNTRIFSATAGGGAFCNGQRIQVSATNHVERSLLVTGFGYDH  228

Query  667   DDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVE  488
             D++WATN++LFKEFT VSRGVRRLGAA+VD CHVALGIVEAYWEYRL+PWD AAGVL+VE
Sbjct  229   DEAWATNIDLFKEFTDVSRGVRRLGAAAVDMCHVALGIVEAYWEYRLKPWDMAAGVLMVE  288

Query  487   EAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
             EAGG VSR DG  +CVFDRSVL SNG LH KLLE+IGPATEKLK KG+DFSLWYKPE Y+
Sbjct  289   EAGGTVSRMDGGNFCVFDRSVLVSNGLLHAKLLERIGPATEKLKGKGIDFSLWYKPEDYR  348

Query  307   TD  302
              D
Sbjct  349   AD  350



>ref|XP_003570111.1| PREDICTED: phosphatase IMPL1, chloroplastic [Brachypodium distachyon]
Length=357

 Score =   469 bits (1207),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 221/331 (67%), Positives = 268/331 (81%), Gaps = 8/331 (2%)
 Frame = -2

Query  1267  ILSLR----RSICAKAVMS----EVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAE  1112
             IL+LR    RS  A+ +M+    +  +  ++ ++ A +TG IP+ +LL +++AAAK GAE
Sbjct  27    ILALRSLASRSTQARPIMAVASEQPAAPSKFPKVAAPTTGPIPAAELLGVIEAAAKAGAE  86

Query  1111  VVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDY  932
             VVM+AVNKPRNI YKG  DLVTDTDK SE  IL+VVRKNF DHL+LGEEGG  GD  S+Y
Sbjct  87    VVMEAVNKPRNIQYKGVADLVTDTDKLSESVILEVVRKNFKDHLILGEEGGLIGDSLSEY  146

Query  931   LWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGA  752
             LWCIDPLDGTTNF H Y SF+VS+ +LFRGKPAA+TVVEF GGPMCWSTRT +A+ GKGA
Sbjct  147   LWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPAAATVVEFCGGPMCWSTRTISASSGKGA  206

Query  751   YANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFC  572
             Y NGQK+ V+ TDKVEQSLLVTG+GY+ DD+W TN+ LFKEFT +SRGVRRLG+A+ D  
Sbjct  207   YCNGQKIHVSPTDKVEQSLLVTGFGYEHDDAWLTNINLFKEFTDISRGVRRLGSAAADMS  266

Query  571   HVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             HV LGI EAYWEYRL+PWD AAGVLIVEEAGG+VSR DG ++ VFDRSVL SNG +H++L
Sbjct  267   HVGLGITEAYWEYRLKPWDMAAGVLIVEEAGGVVSRMDGGEFTVFDRSVLVSNGVVHEQL  326

Query  391   LEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             L++I PATE LK KG+DFSLW+KP+ Y TDF
Sbjct  327   LDRIRPATEDLKKKGIDFSLWFKPDKYPTDF  357



>dbj|BAJ85005.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95628.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95845.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86856.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   469 bits (1206),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 267/331 (81%), Gaps = 8/331 (2%)
 Frame = -2

Query  1267  ILSLR----RSICAKAVMSEVESK----KEYLRIGADSTGSIPSDQLLEIVQAAAKTGAE  1112
             IL+LR    RS   +A+M+    +     +Y ++ A +TG +P+D+LL ++QAAAK GAE
Sbjct  29    ILALRTLASRSKHVRAIMAVASDRPAAPSKYPKVAAPTTGPVPADELLGVIQAAAKAGAE  88

Query  1111  VVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDY  932
             VVM+AVNKPRNI YKG  DLVTDTDK SE  IL+VV KNF DHL+LGEEGG  GD  S+Y
Sbjct  89    VVMEAVNKPRNIQYKGVADLVTDTDKLSESVILEVVTKNFRDHLILGEEGGLIGDSLSEY  148

Query  931   LWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGA  752
             LWCIDPLDGTTNF H Y SF+VS+ +L+RGKPAA+TVVEF GGPMCWSTRT +A+ GKGA
Sbjct  149   LWCIDPLDGTTNFAHGYPSFSVSIGVLYRGKPAAATVVEFCGGPMCWSTRTISASSGKGA  208

Query  751   YANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFC  572
             Y NGQK+ V+ T+KVEQSLLVTG+GY+ DD+W TN+ LFKEFT VSRGVRRLG+A+ D  
Sbjct  209   YCNGQKIHVSPTEKVEQSLLVTGFGYEHDDAWLTNINLFKEFTDVSRGVRRLGSAAADMS  268

Query  571   HVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             HV LGI EAYWEYRL+PWD AAGVLIVEEAGG+V+R DG ++ VFDRSVL SNG +HD+L
Sbjct  269   HVGLGITEAYWEYRLKPWDMAAGVLIVEEAGGVVTRMDGGEFTVFDRSVLVSNGVVHDQL  328

Query  391   LEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             LE+I PATE LK KG+DFSLW+KP+ Y TDF
Sbjct  329   LERIRPATEDLKKKGIDFSLWFKPDKYPTDF  359



>ref|XP_006646937.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Oryza brachyantha]
Length=368

 Score =   468 bits (1205),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 267/334 (80%), Gaps = 2/334 (1%)
 Frame = -2

Query  1294  QPLRYGFERILSLRRSIC-AKAVMSEVESKK-EYLRIGADSTGSIPSDQLLEIVQAAAKT  1121
             +P   G   + S     C   AV SE  +   +Y ++ A +TG IP+ +LL ++Q AAK 
Sbjct  35    RPPVLGLRALASRPSKACPVMAVASEQSAATAKYPKVAAPTTGPIPAAELLAVIQDAAKA  94

Query  1120  GAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPS  941
             GAEV+M+AVNKPRNI+YKG  DLVTDTD+ SE  IL+VVRK+FPDHL+LGEEGG  GD  
Sbjct  95    GAEVIMEAVNKPRNIHYKGVADLVTDTDRLSESVILEVVRKSFPDHLILGEEGGLIGDAL  154

Query  940   SDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVG  761
             S+YLWCIDPLDGTTNF H Y SF+VS+ +LFRGKPAASTVVEF GGPMCWSTRT +A+ G
Sbjct  155   SEYLWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPAASTVVEFCGGPMCWSTRTISASSG  214

Query  760   KGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASV  581
              GAY NGQK+ V+ TDKVEQSLLVTG+GY+ DD+W TN+ LFKE+T +SRGVRRLG+A+ 
Sbjct  215   GGAYCNGQKIHVSQTDKVEQSLLVTGFGYEHDDAWLTNINLFKEYTDISRGVRRLGSAAA  274

Query  580   DFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALH  401
             D  HVALGI EAYWEYRL+PWD AAGVLIVEEAGG+VSR DG ++ VFDRSVL SNGA+H
Sbjct  275   DMSHVALGITEAYWEYRLKPWDMAAGVLIVEEAGGVVSRMDGGEFTVFDRSVLVSNGAVH  334

Query  400   DKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             D+LL++IG ATE LK KG+DFSLW+KP+ Y TDF
Sbjct  335   DQLLDRIGHATEDLKKKGIDFSLWFKPDKYPTDF  368



>ref|NP_001046024.1| Os02g0169900 [Oryza sativa Japonica Group]
 dbj|BAD25178.1| putative inositol-1-monophosphatase [Oryza sativa Japonica Group]
 dbj|BAD25730.1| putative inositol-1-monophosphatase [Oryza sativa Japonica Group]
 dbj|BAF07938.1| Os02g0169900 [Oryza sativa Japonica Group]
 dbj|BAG91772.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97417.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72579.1| hypothetical protein OsI_06021 [Oryza sativa Indica Group]
 gb|EEE56398.1| hypothetical protein OsJ_05549 [Oryza sativa Japonica Group]
Length=364

 Score =   467 bits (1202),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 268/331 (81%), Gaps = 8/331 (2%)
 Frame = -2

Query  1267  ILSLR----RSICAKAVMS----EVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAE  1112
             +L LR    R+  A+ VM+    +  ++ +  ++ A +TG IP+ +LL ++Q AA+ GAE
Sbjct  34    VLGLRALASRAGKARPVMAVASEQPAARGKCPKVAAPTTGPIPAAELLGVIQDAARAGAE  93

Query  1111  VVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDY  932
             V+M+AVNKPRNI+YKG  DLVTDTDK SE  IL+VVRK FPDHL+LGEEGG  GD  S+Y
Sbjct  94    VIMEAVNKPRNIHYKGVADLVTDTDKLSESVILEVVRKTFPDHLILGEEGGLIGDALSEY  153

Query  931   LWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGA  752
             LWCIDPLDGTTNF H Y SF+VS+ +LFRGKPAASTVVEF GGPMCWSTRT +A+ G GA
Sbjct  154   LWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPAASTVVEFCGGPMCWSTRTVSASSGGGA  213

Query  751   YANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFC  572
             Y NGQK+ V+ TDKVEQSLLVTG+GY+ DD+W TN+ LFKE+T +SRGVRRLG+A+ D  
Sbjct  214   YCNGQKIHVSKTDKVEQSLLVTGFGYEHDDAWVTNINLFKEYTDISRGVRRLGSAAADMS  273

Query  571   HVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             HVALGI EAYWEYRL+PWD AAGVLIVEEAGG+VSR DG ++ VFDRSVL SNG +HD+L
Sbjct  274   HVALGITEAYWEYRLKPWDMAAGVLIVEEAGGMVSRMDGGEFTVFDRSVLVSNGVVHDQL  333

Query  391   LEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             L++IGPATE LK KG+DFSLW+KP+ Y TDF
Sbjct  334   LDRIGPATEDLKKKGIDFSLWFKPDKYPTDF  364



>ref|XP_008677691.1| PREDICTED: uncharacterized protein LOC100384405 isoform X1 [Zea 
mays]
 gb|AFW66376.1| hypothetical protein ZEAMMB73_656028 [Zea mays]
Length=360

 Score =   463 bits (1191),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 219/336 (65%), Positives = 266/336 (79%), Gaps = 8/336 (2%)
 Frame = -2

Query  1294  QPLRYGFERILSLRRSICAKAVMS----EVESKKEYLRIGADSTGSIPSDQLLEIVQAAA  1127
             +PLR    R L  R S  A+ +M+    +      Y ++ A +TG IP+ +LL +++AAA
Sbjct  29    RPLRL---RALGSRTS-KARHIMAVASEQAAPPARYPKVAAPTTGPIPAAELLGVIEAAA  84

Query  1126  KTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGD  947
             K GA+V+M+AVNKPRNI+YKG  DLVTDTDK SE  IL+VV KNF DHL+LGEEGG  GD
Sbjct  85    KAGADVIMEAVNKPRNIHYKGVADLVTDTDKLSESVILEVVTKNFKDHLILGEEGGLVGD  144

Query  946   PSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAA  767
               S+YLWCIDPLDGTTNF H Y SF+VS+++LFRGKPAASTVVEF GGPMCWSTRT +A+
Sbjct  145   SLSEYLWCIDPLDGTTNFAHGYPSFSVSISVLFRGKPAASTVVEFCGGPMCWSTRTISAS  204

Query  766   VGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAA  587
              G GAY NGQK+ V+ TDKVEQSLLVTG+GY+ DD+W TNM LFKEFT +SRGVRRLG+A
Sbjct  205   AGGGAYCNGQKIHVSQTDKVEQSLLVTGFGYEHDDAWTTNMNLFKEFTDISRGVRRLGSA  264

Query  586   SVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGA  407
             + D  H+ LGI EAYWEYRL+PWD AAGVLIVEEAGG+V+R DG ++ VFDRSVL SNG 
Sbjct  265   AADMSHIGLGITEAYWEYRLKPWDMAAGVLIVEEAGGVVTRMDGGEFTVFDRSVLVSNGL  324

Query  406   LHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             +H +LL++IGP TE LK KG+DFSLW+KP+ Y TDF
Sbjct  325   VHGQLLDRIGPPTEDLKKKGIDFSLWFKPDKYPTDF  360



>ref|NP_001170418.1| uncharacterized protein LOC100384405 [Zea mays]
 gb|ACN36943.1| unknown [Zea mays]
Length=314

 Score =   460 bits (1183),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 214/313 (68%), Positives = 256/313 (82%), Gaps = 1/313 (0%)
 Frame = -2

Query  1234  AVMSE-VESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             AV SE       Y ++ A +TG IP+ +LL +++AAAK GA+V+M+AVNKPRNI+YKG  
Sbjct  2     AVASEQAAPPARYPKVAAPTTGPIPAAELLGVIEAAAKAGADVIMEAVNKPRNIHYKGVA  61

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVTDTDK SE  IL+VV KNF DHL+LGEEGG  GD  S+YLWCIDPLDGTTNF H Y 
Sbjct  62    DLVTDTDKLSESVILEVVTKNFKDHLILGEEGGLVGDSLSEYLWCIDPLDGTTNFAHGYP  121

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SF+VS+++LFRGKPAASTVVEF GGPMCWSTRT +A+ G GAY NGQK+ V+ TDKVEQS
Sbjct  122   SFSVSISVLFRGKPAASTVVEFCGGPMCWSTRTISASAGGGAYCNGQKIHVSQTDKVEQS  181

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+GY+ DD+W TNM LFKEFT +SRGVRRLG+A+ D  H+ LGI EAYWEYRL+PW
Sbjct  182   LLVTGFGYEHDDAWTTNMNLFKEFTDISRGVRRLGSAAADMSHIGLGITEAYWEYRLKPW  241

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDF  338
             D AAGVLIVEEAGG+V+R DG ++ VFDRSVL SNG +H +LL++IGP TE LK KG+DF
Sbjct  242   DMAAGVLIVEEAGGVVTRMDGGEFTVFDRSVLVSNGLVHGQLLDRIGPPTEDLKKKGIDF  301

Query  337   SLWYKPEAYKTDF  299
             SLW+KP+ Y TDF
Sbjct  302   SLWFKPDKYPTDF  314



>ref|XP_009590605.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=294

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/268 (80%), Positives = 236/268 (88%), Gaps = 0/268 (0%)
 Frame = -2

Query  1105  MDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLW  926
             MDAVNKPRN+ YKG TDLVTDTDK SE+AIL+VVRKNFPDHL+LGEEGG  GD SSDYLW
Sbjct  1     MDAVNKPRNVTYKGLTDLVTDTDKSSEVAILEVVRKNFPDHLILGEEGGIIGDSSSDYLW  60

Query  925   CIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYA  746
             CIDPLDGTTNF H Y SFAVSV +LFRGKPAA+TVVEFVGGPMCW+TR ++AA GKGA+A
Sbjct  61    CIDPLDGTTNFAHGYPSFAVSVGVLFRGKPAAATVVEFVGGPMCWNTRIFSAAAGKGAFA  120

Query  745   NGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHV  566
             NG+K+ V+ TDKVEQSLLVTG+GYD DD WATNMELFK+FT VSRGVRRLGAA+VD CHV
Sbjct  121   NGEKIHVSGTDKVEQSLLVTGFGYDHDDPWATNMELFKDFTDVSRGVRRLGAAAVDMCHV  180

Query  565   ALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLE  386
             ALGI EAYWEYRL+PWD AAGVLIVEEAGG VS  DG K+ VFDRSVL SNG LH KLLE
Sbjct  181   ALGIAEAYWEYRLKPWDMAAGVLIVEEAGGTVSCMDGGKFSVFDRSVLVSNGLLHAKLLE  240

Query  385   KIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             KIGPATE LK KG+DFS+W+KPE Y T+
Sbjct  241   KIGPATENLKGKGIDFSVWFKPENYHTE  268



>ref|XP_009590607.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X3 [Nicotiana 
tomentosiformis]
Length=293

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/268 (80%), Positives = 236/268 (88%), Gaps = 0/268 (0%)
 Frame = -2

Query  1105  MDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLW  926
             MDAVNKPRN+ YKG TDLVTDTDK SE+AIL+VVRKNFPDHL+LGEEGG  GD SSDYLW
Sbjct  1     MDAVNKPRNVTYKGLTDLVTDTDKSSEVAILEVVRKNFPDHLILGEEGGIIGDSSSDYLW  60

Query  925   CIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYA  746
             CIDPLDGTTNF H Y SFAVSV +LFRGKPAA+TVVEFVGGPMCW+TR ++AA GKGA+A
Sbjct  61    CIDPLDGTTNFAHGYPSFAVSVGVLFRGKPAAATVVEFVGGPMCWNTRIFSAAAGKGAFA  120

Query  745   NGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHV  566
             NG+K+ V+ TDKVEQSLLVTG+GYD DD WATNMELFK+FT VSRGVRRLGAA+VD CHV
Sbjct  121   NGEKIHVSGTDKVEQSLLVTGFGYDHDDPWATNMELFKDFTDVSRGVRRLGAAAVDMCHV  180

Query  565   ALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLE  386
             ALGI EAYWEYRL+PWD AAGVLIVEEAGG VS  DG K+ VFDRSVL SNG LH KLLE
Sbjct  181   ALGIAEAYWEYRLKPWDMAAGVLIVEEAGGTVSCMDGGKFSVFDRSVLVSNGLLHAKLLE  240

Query  385   KIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             KIGPATE LK KG+DFS+W+KPE Y T+
Sbjct  241   KIGPATENLKGKGIDFSVWFKPENYHTE  268



>ref|XP_009590604.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=314

 Score =   458 bits (1179),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 214/268 (80%), Positives = 236/268 (88%), Gaps = 0/268 (0%)
 Frame = -2

Query  1105  MDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLW  926
             MDAVNKPRN+ YKG TDLVTDTDK SE+AIL+VVRKNFPDHL+LGEEGG  GD SSDYLW
Sbjct  1     MDAVNKPRNVTYKGLTDLVTDTDKSSEVAILEVVRKNFPDHLILGEEGGIIGDSSSDYLW  60

Query  925   CIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYA  746
             CIDPLDGTTNF H Y SFAVSV +LFRGKPAA+TVVEFVGGPMCW+TR ++AA GKGA+A
Sbjct  61    CIDPLDGTTNFAHGYPSFAVSVGVLFRGKPAAATVVEFVGGPMCWNTRIFSAAAGKGAFA  120

Query  745   NGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHV  566
             NG+K+ V+ TDKVEQSLLVTG+GYD DD WATNMELFK+FT VSRGVRRLGAA+VD CHV
Sbjct  121   NGEKIHVSGTDKVEQSLLVTGFGYDHDDPWATNMELFKDFTDVSRGVRRLGAAAVDMCHV  180

Query  565   ALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLE  386
             ALGI EAYWEYRL+PWD AAGVLIVEEAGG VS  DG K+ VFDRSVL SNG LH KLLE
Sbjct  181   ALGIAEAYWEYRLKPWDMAAGVLIVEEAGGTVSCMDGGKFSVFDRSVLVSNGLLHAKLLE  240

Query  385   KIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             KIGPATE LK KG+DFS+W+KPE Y T+
Sbjct  241   KIGPATENLKGKGIDFSVWFKPENYHTE  268



>ref|XP_002451616.1| hypothetical protein SORBIDRAFT_04g004700 [Sorghum bicolor]
 gb|EES04592.1| hypothetical protein SORBIDRAFT_04g004700 [Sorghum bicolor]
Length=364

 Score =   460 bits (1184),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 218/336 (65%), Positives = 264/336 (79%), Gaps = 8/336 (2%)
 Frame = -2

Query  1294  QPLRYGFERILSLRRSICAKAVMS----EVESKKEYLRIGADSTGSIPSDQLLEIVQAAA  1127
             +PLR    R L  R S  A+ +M+    +      Y ++ A +TG IP+ +LL +++AAA
Sbjct  33    RPLRL---RALGSRTS-KARPIMAVASEQAAPAARYPKVAAPTTGPIPAAELLGVIEAAA  88

Query  1126  KTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGD  947
             K GA+V+M+AVNKPRNI YKG  DLVTDTDK SE  IL+VV KNF DHL+LGEEGG  GD
Sbjct  89    KAGADVIMEAVNKPRNIQYKGVADLVTDTDKLSESVILEVVTKNFKDHLILGEEGGLIGD  148

Query  946   PSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAA  767
               S+YLWCIDPLDGTTNF H Y SF+VS+ +LFRGKPAASTVVEF GGPMCWSTRT +A+
Sbjct  149   SQSEYLWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPAASTVVEFCGGPMCWSTRTISAS  208

Query  766   VGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAA  587
              G GAY NGQK+ V+ T+KVEQSLLVTG+GY+ DD+W TN+ LFKEFT +SRGVRRLG+A
Sbjct  209   AGGGAYCNGQKIHVSQTNKVEQSLLVTGFGYEHDDAWTTNINLFKEFTDISRGVRRLGSA  268

Query  586   SVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGA  407
             + D  HV LGI EAYWEYRL+PWD AAGVLIVEEAGG+V+R DG ++ VFDRSVL SNG 
Sbjct  269   AADMSHVGLGITEAYWEYRLKPWDMAAGVLIVEEAGGVVTRMDGGEFTVFDRSVLVSNGL  328

Query  406   LHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             +H +LL++IGP TE LK KG+DFSLW+KP+ Y TDF
Sbjct  329   VHGQLLDRIGPPTEDLKKKGIDFSLWFKPDNYVTDF  364



>ref|XP_004951772.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X2 [Setaria 
italica]
Length=362

 Score =   458 bits (1179),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 218/338 (64%), Positives = 263/338 (78%), Gaps = 5/338 (1%)
 Frame = -2

Query  1300  NLQPLRYGFERILSLRRSICAKAVMS----EVESKKEYLRIGADSTGSIPSDQLLEIVQA  1133
             NL P R    R L   RS  A+ +M+    +      Y ++ A +TG IP+ +LL +++A
Sbjct  26    NLPPSRTLRLRALG-SRSGKARPIMAVASEQAAPAAGYPKVAAPTTGPIPAAELLGVIEA  84

Query  1132  AAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFT  953
             AAK GA+V+M+AVNKPRNI+YKG  DLVTDTDK SE  IL+VV KNF +HL+LGEEGG  
Sbjct  85    AAKAGADVIMEAVNKPRNIHYKGVADLVTDTDKLSESVILEVVMKNFKNHLILGEEGGLI  144

Query  952   GDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYT  773
             GD  S+YLWCIDPLDGTTNF H Y SF+VS+ +LFRGKPAASTVVEF GGP CWSTRT +
Sbjct  145   GDSLSEYLWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPAASTVVEFCGGPFCWSTRTIS  204

Query  772   AAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLG  593
             A+ G GAY NGQK+ V+ TDKVEQSLLVTG+GY+ DD+W TN+ LFKEFT +SRGVRRLG
Sbjct  205   ASAGGGAYCNGQKIHVSQTDKVEQSLLVTGFGYEHDDAWTTNINLFKEFTDISRGVRRLG  264

Query  592   AASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASN  413
             +A+ D  HV LGI EAYWEYRL+PWD AAGVLIVEEAGG+V+R DG  + VFDRSVL SN
Sbjct  265   SAAADMSHVGLGITEAYWEYRLKPWDMAAGVLIVEEAGGVVTRMDGGAFTVFDRSVLVSN  324

Query  412   GALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
             G +H +LL++IGP TE LK KG+DFSLW+KP+ Y TDF
Sbjct  325   GVVHGQLLDRIGPPTEDLKKKGIDFSLWFKPDKYPTDF  362



>ref|XP_006415359.1| hypothetical protein EUTSA_v10009483mg [Eutrema salsugineum]
 gb|ESQ33712.1| hypothetical protein EUTSA_v10009483mg [Eutrema salsugineum]
Length=301

 Score =   456 bits (1173),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 217/308 (70%), Positives = 251/308 (81%), Gaps = 14/308 (5%)
 Frame = -2

Query  1222  EVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTD  1043
             +V  +K YLRIGA STG++   +LLE+V+AAAK GAEVVM+AVNKPRNI YKG +DLVTD
Sbjct  8     QVHDQKHYLRIGAKSTGTVLPSELLEVVEAAAKAGAEVVMEAVNKPRNITYKGLSDLVTD  67

Query  1042  TDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVS  863
             TDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y SFAVS
Sbjct  68    TDKASEDAILEVVKKNFSDHLILGEEGGIIGDTSSDYLWCIDPLDGTTNFAHEYPSFAVS  127

Query  862   VAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTG  683
             V +L+RGKPAA++VVEFVGG               GA  NGQK+ V++T+ VE++LLVTG
Sbjct  128   VGVLYRGKPAAASVVEFVGG--------------GGALCNGQKIHVSNTNAVERALLVTG  173

Query  682   YGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAG  503
             +GY+ DD+W+TNMELFKEFTGVSRGVRRLG A+VD CHVALGIVE YWEYRL+PWD AAG
Sbjct  174   FGYEHDDAWSTNMELFKEFTGVSRGVRRLGGAAVDMCHVALGIVEGYWEYRLKPWDMAAG  233

Query  502   VLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYK  323
             VLIVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK KG+DFSLW+K
Sbjct  234   VLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHSKLLERIAPATENLKTKGIDFSLWFK  293

Query  322   PEAYKTDF  299
             PE Y T+ 
Sbjct  294   PEDYHTEL  301



>ref|XP_002322371.2| hypothetical protein POPTR_0015s15480g [Populus trichocarpa]
 gb|EEF06498.2| hypothetical protein POPTR_0015s15480g [Populus trichocarpa]
Length=360

 Score =   454 bits (1167),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 228/378 (60%), Positives = 269/378 (71%), Gaps = 33/378 (9%)
 Frame = -2

Query  1408  EMGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI----LSLRRSIC  1241
             EM   LV +   PL+FS +PI+    N S         +  + G +R     + L R++C
Sbjct  8     EMSRSLVFSTNIPLKFSQKPISFSLFNHSKLCVPQRFSENSQCGLQRFQLLSMKLARNVC  67

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KA +SE++    Y R+ A STG IP  QL+++V+ AAKTGAEV                
Sbjct  68    TKAALSEMK----YPRVAASSTGPIPPSQLIQVVETAAKTGAEVC---------------  108

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
                   TDK SE AIL+V R+NF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y
Sbjct  109   ------TDKMSEAAILEVGRRNFGDHLILGEEGGIIGDTLSDYLWCIDPLDGTTNFAHGY  162

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDT----D  713
              SFAVSV +LF+G PAA++VVEFVGGPM W+TRT++A  G GA+ NGQK+  + T    D
Sbjct  163   PSFAVSVGVLFQGNPAAASVVEFVGGPMAWNTRTFSATAGGGAFCNGQKIHASPTAQVSD  222

Query  712   KVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEY  533
              VEQSLLVTG+GY+ DD WATN+ELFKEFT VSRGVRRLG A+VD CHVALGIVEAYWEY
Sbjct  223   HVEQSLLVTGFGYEHDDPWATNIELFKEFTDVSRGVRRLGGAAVDMCHVALGIVEAYWEY  282

Query  532   RLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKN  353
             RL+PWD AAGVLIVEEAGG VSR DG K+CVFDRSVL SNG LH KLLE+I PATEKLK+
Sbjct  283   RLKPWDMAAGVLIVEEAGGTVSRMDGGKFCVFDRSVLVSNGVLHAKLLERIAPATEKLKS  342

Query  352   KGVDFSLWYKPEAYKTDF  299
             KG+DFSLWYKPE Y+TD 
Sbjct  343   KGIDFSLWYKPENYRTDL  360



>gb|KHG20254.1| Phosphatase IMPL1, chloroplastic -like protein [Gossypium arboreum]
Length=339

 Score =   448 bits (1152),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 222/379 (59%), Positives = 265/379 (70%), Gaps = 50/379 (13%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRY------GFERI----LSL  1256
             M   LV +   PLRFS  P +I P    N        QP ++      G+ ++     + 
Sbjct  1     MERSLVFSTNIPLRFSRTPRSISPRFHPN------QYQPHKFSAKSSTGYRKVGIFNTNS  54

Query  1255  RRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNI  1076
             +R +C +A++SEV ++++Y ++ A STG IP  QL+E+V+ AAKTGAEVVMDAVNKPRNI
Sbjct  55    KRKLCTRALISEVSNQRQYPKVAAKSTGPIPPSQLIEVVETAAKTGAEVVMDAVNKPRNI  114

Query  1075  NYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTN  896
              YKG TDLVTDTDK SE+AILDVV+ NF DHL+LGEEGG  GD SS YLWCIDPLDGTTN
Sbjct  115   TYKGLTDLVTDTDKMSEVAILDVVKNNFGDHLILGEEGGIIGDTSSGYLWCIDPLDGTTN  174

Query  895   FTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDT  716
             F H Y SFAVSV +LF+G PAA+ VVEFVGGPMCW+TRT+TA  G GA+ NGQK+  + T
Sbjct  175   FAHCYPSFAVSVGVLFQGNPAAAAVVEFVGGPMCWNTRTFTATAGGGAFCNGQKIHPSKT  234

Query  715   DKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWE  536
             DKVEQSLLVTG+GYD DD+W TN+ELFKEFT +SRGVRRLGAA+VD CHVALG+ EAYWE
Sbjct  235   DKVEQSLLVTGFGYDHDDAWITNIELFKEFTDISRGVRRLGAAAVDMCHVALGVAEAYWE  294

Query  535   YRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLK  356
             YRL+PWD AAGVL                                  LLE+I PATEKLK
Sbjct  295   YRLKPWDMAAGVL----------------------------------LLERIAPATEKLK  320

Query  355   NKGVDFSLWYKPEAYKTDF  299
             +KG+DFS WYKPE Y TD 
Sbjct  321   SKGIDFSFWYKPENYVTDL  339



>ref|XP_006582085.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X2 [Glycine 
max]
Length=269

 Score =   444 bits (1142),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 204/268 (76%), Positives = 234/268 (87%), Gaps = 0/268 (0%)
 Frame = -2

Query  1105  MDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLW  926
             M+AVNKPRNI YKG TDLVT+TDK SE AIL+VV+KNF DHL+LGEEGG  GD +SDYLW
Sbjct  1     MEAVNKPRNITYKGLTDLVTETDKMSEAAILEVVKKNFEDHLILGEEGGVIGDAASDYLW  60

Query  925   CIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYA  746
             CIDPLDGTTNF H Y SFAVSV +L+RG PAA+ VVEFVGG MCW+TR ++A  G GA+ 
Sbjct  61    CIDPLDGTTNFAHGYPSFAVSVGVLYRGNPAAAAVVEFVGGSMCWNTRLFSATAGGGAFC  120

Query  745   NGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHV  566
             NGQ++ V+ T++VE+SLLVTG+GYD DD+WATN++LFKEFT VSRGVRRLGAA+VD CHV
Sbjct  121   NGQRIQVSATNQVERSLLVTGFGYDHDDAWATNIDLFKEFTDVSRGVRRLGAAAVDMCHV  180

Query  565   ALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLE  386
             ALGIVEAYWEYRL+PWD AAGVL+VEEAGG VSR DG K+CVFDRSVL SNG LH KLLE
Sbjct  181   ALGIVEAYWEYRLKPWDMAAGVLMVEEAGGTVSRMDGGKFCVFDRSVLVSNGQLHAKLLE  240

Query  385   KIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             +IGPATEKLKNKG+DFSLWYKPE Y+ D
Sbjct  241   RIGPATEKLKNKGIDFSLWYKPENYRAD  268



>ref|XP_004951771.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X1 [Setaria 
italica]
Length=387

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/363 (60%), Positives = 263/363 (72%), Gaps = 30/363 (8%)
 Frame = -2

Query  1300  NLQPLRYGFERILSLRRSICAKAVMS----EVESKKEYLRIGADSTGSIPSDQLLEIVQA  1133
             NL P R    R L   RS  A+ +M+    +      Y ++ A +TG IP+ +LL +++A
Sbjct  26    NLPPSRTLRLRALG-SRSGKARPIMAVASEQAAPAAGYPKVAAPTTGPIPAAELLGVIEA  84

Query  1132  AAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFT  953
             AAK GA+V+M+AVNKPRNI+YKG  DLVTDTDK SE  IL+VV KNF +HL+LGEEGG  
Sbjct  85    AAKAGADVIMEAVNKPRNIHYKGVADLVTDTDKLSESVILEVVMKNFKNHLILGEEGGLI  144

Query  952   GDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYT  773
             GD  S+YLWCIDPLDGTTNF H Y SF+VS+ +LFRGKPAASTVVEF GGP CWSTRT +
Sbjct  145   GDSLSEYLWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPAASTVVEFCGGPFCWSTRTIS  204

Query  772   AAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR------  611
             A+ G GAY NGQK+ V+ TDKVEQSLLVTG+GY+ DD+W TN+ LFKEFT +SR      
Sbjct  205   ASAGGGAYCNGQKIHVSQTDKVEQSLLVTGFGYEHDDAWTTNINLFKEFTDISRVSEYVR  264

Query  610   -------------------GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVE  488
                                GVRRLG+A+ D  HV LGI EAYWEYRL+PWD AAGVLIVE
Sbjct  265   DTELNFLCSPFDNILYLFKGVRRLGSAAADMSHVGLGITEAYWEYRLKPWDMAAGVLIVE  324

Query  487   EAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
             EAGG+V+R DG  + VFDRSVL SNG +H +LL++IGP TE LK KG+DFSLW+KP+ Y 
Sbjct  325   EAGGVVTRMDGGAFTVFDRSVLVSNGVVHGQLLDRIGPPTEDLKKKGIDFSLWFKPDKYP  384

Query  307   TDF  299
             TDF
Sbjct  385   TDF  387



>gb|AAD21685.1| Contains similarity to gi|1653332 extragenic suppressor (SuhB) 
from Synechocystis sp. gb|D90912 and is a member of the Inositol 
monophophatase family PF|00459. EST gb|AA597395 comes 
from this gene [Arabidopsis thaliana]
Length=353

 Score =   437 bits (1125),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/372 (60%), Positives = 264/372 (71%), Gaps = 36/372 (10%)
 Frame = -2

Query  1369  LRFSHRPITILPCNRSNFPFLNANL-QPLRYGFERILS----LRRSICAKAVMSEVESKK  1205
             LR SH P + LP      P     + +  RY   RILS        +  KAV+SEV  + 
Sbjct  3     LRISHLPRSSLPLQN---PISGRTVNRTFRYRCTRILSNSFKSTTRLQTKAVLSEVSDQT  59

Query  1204  EYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSE  1025
              Y RIGA +TG+I    LLE+V+ AAKTGAEV        RN            TDK SE
Sbjct  60    RYPRIGAKTTGTISPAHLLEVVELAAKTGAEV--------RNF----------ITDKASE  101

Query  1024  LAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFR  845
              AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y SFAVSV +L+R
Sbjct  102   AAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLYR  161

Query  844   GKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRD  665
             G PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V+ TD VE++LL+TG+GY+ D
Sbjct  162   GNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAVERALLITGFGYEHD  221

Query  664   DSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVL----  497
             D+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+PWD AAGVL    
Sbjct  222   DAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPWDMAAGVLSLIH  281

Query  496   ------IVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFS  335
                   IVEEAGG V+R DG K+ VFDRSVL SNG LH KLLE+I PATE LK+KG+DFS
Sbjct  282   VRKWTQIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVLHPKLLERIAPATENLKSKGIDFS  341

Query  334   LWYKPEAYKTDF  299
             LW+KPE Y T+ 
Sbjct  342   LWFKPEDYHTEL  353



>ref|XP_008356139.1| PREDICTED: phosphatase IMPL1, chloroplastic, partial [Malus domestica]
Length=267

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 203/267 (76%), Positives = 228/267 (85%), Gaps = 0/267 (0%)
 Frame = -2

Query  1099  AVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCI  920
             AVNKPRN+ YKG TDLVTDTDKKSE  IL+VVRKNF DHL+LGEEGG TGD SSDY+WCI
Sbjct  1     AVNKPRNVTYKGVTDLVTDTDKKSEATILEVVRKNFEDHLILGEEGGITGDASSDYMWCI  60

Query  919   DPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANG  740
             DPLDGTTNF H Y SFAVSV +LFRGKP A+ VVEFVGGPMCW+TR ++A+ G GA+ NG
Sbjct  61    DPLDGTTNFAHGYPSFAVSVGVLFRGKPVAAAVVEFVGGPMCWNTRIFSASAGGGAFCNG  120

Query  739   QKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVAL  560
             QK+ V+ TD+V +SLLVTG+GY+ DD W TN+ELFKEFT VSRGVRRLGAASVD CHVAL
Sbjct  121   QKIHVSQTDEVGRSLLVTGFGYEHDDVWITNIELFKEFTDVSRGVRRLGAASVDMCHVAL  180

Query  559   GIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             GIVEAYWEYRL+PWD AAGVLIVEEAGG V+  DG K+ VFDRSVL SNG LH K+LE+I
Sbjct  181   GIVEAYWEYRLKPWDMAAGVLIVEEAGGKVTCMDGGKFSVFDRSVLVSNGVLHGKVLERI  240

Query  379   GPATEKLKNKGVDFSLWYKPEAYKTDF  299
              PATEKLK+K +DFSLWYKPE Y TD 
Sbjct  241   APATEKLKSKEIDFSLWYKPEDYTTDI  267



>ref|XP_007138402.1| hypothetical protein PHAVU_009G2057000g, partial [Phaseolus vulgaris]
 gb|ESW10396.1| hypothetical protein PHAVU_009G2057000g, partial [Phaseolus vulgaris]
Length=327

 Score =   429 bits (1102),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 244/301 (81%), Gaps = 0/301 (0%)
 Frame = -2

Query  1303  ANLQPLRYGFERILSLRRSICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAK  1124
             +++ PL++   R+L +     A+ +++      ++  +GA STG IP   L+E+V+ AA 
Sbjct  25    SDIYPLKFHRNRLLPILSKSRAQPLIANSLLSDKFPTVGARSTGPIPPSHLIEVVKTAAH  84

Query  1123  TGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDP  944
             TGA+VVM+AVNKPRNI YKG +DLVT+TDK SE AIL+VV+KNF  HL+LGEEGG  GD 
Sbjct  85    TGAQVVMEAVNKPRNITYKGSSDLVTETDKMSEAAILEVVKKNFEGHLILGEEGGIIGDT  144

Query  943   SSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAV  764
             +SDYLWCIDPLDGTTNF H Y SFAVSV +L++G PAA+ VVEFVGGPMCW+TR ++A  
Sbjct  145   TSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLYQGNPAAAAVVEFVGGPMCWNTRLFSATA  204

Query  763   GKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAAS  584
             G GA+ NGQ++ V+ T+KVEQSLLVTG+GYD DD+WATN++LFKEFT VSRGVRRLGAA+
Sbjct  205   GGGAFCNGQRIQVSATNKVEQSLLVTGFGYDHDDAWATNIDLFKEFTDVSRGVRRLGAAA  264

Query  583   VDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGAL  404
             VD CHVALGIVEAYWEYRL+PWD AAGVL+VEEAGG VSR DG K+CVFDRSVL SNG L
Sbjct  265   VDMCHVALGIVEAYWEYRLKPWDMAAGVLMVEEAGGTVSRMDGGKFCVFDRSVLVSNGVL  324

Query  403   H  401
             H
Sbjct  325   H  325



>gb|ABK21079.1| unknown [Picea sitchensis]
Length=269

 Score =   420 bits (1080),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 231/268 (86%), Gaps = 0/268 (0%)
 Frame = -2

Query  1105  MDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLW  926
             MDAV+KPRNI+YKG  +LVTDTD++SELAI +VVR+ F DHL+LGEEGGFTGDP+S+YLW
Sbjct  1     MDAVHKPRNIDYKGTANLVTDTDRRSELAIQEVVREKFKDHLILGEEGGFTGDPTSEYLW  60

Query  925   CIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYA  746
             CIDPLDGTTNF H Y SFAVSV +L+RGKPAA++VVEF GGP+CW TRT++A  G GA+ 
Sbjct  61    CIDPLDGTTNFAHGYPSFAVSVGVLYRGKPAAASVVEFAGGPLCWVTRTFSACAGGGAFC  120

Query  745   NGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHV  566
             NGQ++ V+ T+++E+SLLVTG+GY+ D++WA N+ LFKEFT VSRGVRRLGAA+VD CHV
Sbjct  121   NGQQIHVSSTNEIERSLLVTGFGYEHDEAWAENITLFKEFTDVSRGVRRLGAAAVDMCHV  180

Query  565   ALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLE  386
             ALGIVEAYWEYRL+PWD AAG LIVEEAGG+V+  DG  +CVFDRS+L SNG LH+KLLE
Sbjct  181   ALGIVEAYWEYRLKPWDMAAGALIVEEAGGMVTCMDGSDFCVFDRSILVSNGTLHEKLLE  240

Query  385   KIGPATEKLKNKGVDFSLWYKPEAYKTD  302
             +I P T+KL+  G+D S W+KPE YK+D
Sbjct  241   RIAPPTKKLQQNGMDISHWFKPEDYKSD  268



>ref|XP_002965765.1| hypothetical protein SELMODRAFT_167524 [Selaginella moellendorffii]
 gb|EFJ33185.1| hypothetical protein SELMODRAFT_167524 [Selaginella moellendorffii]
Length=352

 Score =   421 bits (1083),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/298 (67%), Positives = 251/298 (84%), Gaps = 0/298 (0%)
 Frame = -2

Query  1195  RIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAI  1016
             RIGA  +GS+P ++LL   +AAAK G++VV+DA++KPR I+YKG TDLVTDTDKK ELA+
Sbjct  55    RIGAARSGSLPFEELLAGAEAAAKLGSQVVLDALDKPRRIDYKGATDLVTDTDKKCELAV  114

Query  1015  LDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKP  836
             L  +++ FPDHL+LGEEGG  G+ SSDYLWC+DPLDGTTNF H Y SFAVSVA+L++G+P
Sbjct  115   LQEIQRRFPDHLILGEEGGVIGNSSSDYLWCVDPLDGTTNFAHGYPSFAVSVAVLYKGRP  174

Query  835   AASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSW  656
             AA+TVVEF GGP CW TRT+T++ G GA+  G  +SV++TD+VE+SLLVTG+GYD D++W
Sbjct  175   AAATVVEFAGGPFCWVTRTFTSSSGGGAFCEGNPISVSNTDQVERSLLVTGFGYDHDEAW  234

Query  655   ATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGG  476
             ATN+ LFK+FT VSRGVRRLGAA+VD CHV+LGIVEAYWEYRL+PWD AAGVL+VEEAGG
Sbjct  235   ATNISLFKDFTDVSRGVRRLGAAAVDMCHVSLGIVEAYWEYRLKPWDMAAGVLMVEEAGG  294

Query  475   LVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
              V++ DG ++ VFDRSVL SNG +H KLL++I PAT+ L N+G+DFS WYKPE Y  +
Sbjct  295   KVTKMDGGEFSVFDRSVLVSNGVIHPKLLDRISPATKSLVNQGLDFSQWYKPEGYSCN  352



>ref|XP_007024923.1| Myo-inositol monophosphatase like 1 isoform 2 [Theobroma cacao]
 gb|EOY27545.1| Myo-inositol monophosphatase like 1 isoform 2 [Theobroma cacao]
Length=314

 Score =   414 bits (1063),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 240/309 (78%), Gaps = 6/309 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSN----FPFL-NANLQPLRYGFERILSLRRSIC  1241
             MG  LV +   PLRFS  P +I P    N    + F  N+ L   + GF    S R+ +C
Sbjct  1     MGRSLVFSTNIPLRFSQTPRSISPRVHPNQYQPYKFTANSPLGHQKVGFLSTNSTRK-LC  59

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
               A++SEV ++++Y ++GA STG IP  QL+E+V+ AAK GAEVVMDAVNKPRNI YKG 
Sbjct  60    TGALLSEVSNQRQYPKVGAKSTGPIPPSQLIEVVETAAKAGAEVVMDAVNKPRNITYKGL  119

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             TDLVTDTDK SE AIL+VV++NF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  120   TDLVTDTDKMSEAAILEVVKRNFGDHLILGEEGGIIGDTSSDYLWCIDPLDGTTNFAHCY  179

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +LFRG PAA++VVEFVGGPMCW+TRT++A  G GA+ NGQK+  + TDKVEQ
Sbjct  180   PSFAVSVGVLFRGNPAAASVVEFVGGPMCWNTRTFSATAGGGAFCNGQKIHPSHTDKVEQ  239

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             SLLVTG+GY+ DD+W TN+ELFKEFT +SRGVRRLGAA+VD CHVALG+ EAYWEY L+P
Sbjct  240   SLLVTGFGYEHDDAWITNIELFKEFTDISRGVRRLGAAAVDMCHVALGVAEAYWEYCLKP  299

Query  520   WDNAAGVLI  494
             WD AAGVL+
Sbjct  300   WDMAAGVLL  308



>ref|XP_002975831.1| hypothetical protein SELMODRAFT_104473 [Selaginella moellendorffii]
 gb|EFJ22736.1| hypothetical protein SELMODRAFT_104473 [Selaginella moellendorffii]
Length=349

 Score =   403 bits (1035),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 246/298 (83%), Gaps = 3/298 (1%)
 Frame = -2

Query  1195  RIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAI  1016
             RIGA  +GS+P ++LL   +AAAK G++VV+DA++KPR I+YKG TDLVTDTDKK ELA+
Sbjct  55    RIGAARSGSLPFEELLAGAEAAAKLGSQVVLDALDKPRRIDYKGATDLVTDTDKKCELAV  114

Query  1015  LDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKP  836
             L  +++ FPDHL+LGEEGG  G+ SSDYLWC+DPLDGTTNF H Y SFAVSVA+L++G+P
Sbjct  115   LQEIQRRFPDHLILGEEGGVIGNSSSDYLWCVDPLDGTTNFAHGYPSFAVSVAVLYKGRP  174

Query  835   AASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSW  656
             AA+TVVEF GGP CW TRT+T++ GK A +      +  +++VE+SLLVTG+GYD D++W
Sbjct  175   AAATVVEFAGGPFCWVTRTFTSSSGKAAISFHL---LNFSNQVERSLLVTGFGYDHDEAW  231

Query  655   ATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGG  476
             ATN+ LFK+FT VSRGVRRLGAA+VD CHV+LGIVEAYWEYRL+PWD AAGVL+VEEAGG
Sbjct  232   ATNISLFKDFTDVSRGVRRLGAAAVDMCHVSLGIVEAYWEYRLKPWDMAAGVLMVEEAGG  291

Query  475   LVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
              V++ DG ++ VFDRSVL SNG +H KLL++I PAT+ L N+G+DFS WYKPE Y  +
Sbjct  292   KVTKMDGGEFSVFDRSVLVSNGVIHPKLLDRISPATKTLVNQGLDFSQWYKPEGYSCN  349



>ref|XP_008801574.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=329

 Score =   402 bits (1032),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 236/304 (78%), Gaps = 5/304 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERILSLRRSICAKAVM  1226
             MG  L+S++  PLR    PI   P + ++       L+P R          + +  KA++
Sbjct  1     MGRSLLSSSPIPLRLRFPPI---PKSFASVLSPKNGLRPRRMPIH--AKPPKELQIKAII  55

Query  1225  SEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVT  1046
             SE  SK  Y ++GA+STG IP+ +LL++V+ AAKTGAEVVM+AVNKP NINYKG TDLVT
Sbjct  56    SEFPSKNRYSKVGAESTGPIPAAELLQVVETAAKTGAEVVMEAVNKPHNINYKGITDLVT  115

Query  1045  DTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAV  866
             DTD+ SE  IL+VV+KNF DHL+LGEEGG  GD  SDYLWCIDPLDGTTNF H Y SF V
Sbjct  116   DTDRMSESTILEVVKKNFKDHLILGEEGGLIGDSMSDYLWCIDPLDGTTNFAHGYPSFGV  175

Query  865   SVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVT  686
             SV +LFRGKPAA++VVEFVGGPMCW+TRT++A+ G GA+ NGQK+ V+ TD+VE+SLLVT
Sbjct  176   SVGVLFRGKPAAASVVEFVGGPMCWNTRTFSASSGGGAFCNGQKIHVSPTDQVERSLLVT  235

Query  685   GYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAA  506
             G+GY+ DD+WATNM LFKEFT +SRGVRRLGAASVD  HVALGIVEAYWEYRL+PWD AA
Sbjct  236   GFGYEHDDAWATNMNLFKEFTDISRGVRRLGAASVDMSHVALGIVEAYWEYRLKPWDMAA  295

Query  505   GVLI  494
             GVL+
Sbjct  296   GVLL  299



>ref|XP_006305376.1| hypothetical protein CARUB_v10009767mg [Capsella rubella]
 gb|EOA38274.1| hypothetical protein CARUB_v10009767mg [Capsella rubella]
Length=320

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 235/310 (76%), Gaps = 7/310 (2%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSH-RPITILPCNRSNFPFLNANLQPLRYGFERILS----LRRSIC  1241
             MG  L+ +    +R S+   +  LP   S F       +  R+G  RILS        + 
Sbjct  1     MGRSLIFSGNMSMRISNLHKVPSLPLQNS-FSCRTVT-RNFRHGCSRILSNSFKSTTRLQ  58

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+SEV  +  Y RIGA +TG+I    LLE+V+ AAKTGAEVVM+AVNKPRNI YKG 
Sbjct  59    TKAVVSEVSDQTHYPRIGAKTTGTISPAHLLEVVELAAKTGAEVVMEAVNKPRNITYKGL  118

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSY  881
             TDLVTDTDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y
Sbjct  119   TDLVTDTDKASEAAILEVVKKNFSDHLILGEEGGIIGDSSSDYLWCIDPLDGTTNFAHGY  178

Query  880   ASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
              SFAVSV +L+RG PAA++VVEFVGGPMCW+TRT++A  G GA  NGQK+ V+ TD VE+
Sbjct  179   PSFAVSVGVLYRGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDSVER  238

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             +LL+TG+GY+ DD+W+TNMELFKEFT VSRGVRRLGAA+VD CHVALGI E+YWEYRL+P
Sbjct  239   ALLITGFGYEHDDAWSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKP  298

Query  520   WDNAAGVLIV  491
             WD AAGVL++
Sbjct  299   WDMAAGVLVI  308



>gb|KCW73406.1| hypothetical protein EUGRSUZ_E01881 [Eucalyptus grandis]
Length=310

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 231/311 (74%), Gaps = 12/311 (4%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCN---RSNFPFLNANLQPLRYGFERILSLR----RS  1247
             MG  LV  A +P++FS     + P     R +FP      Q    GF +  S      R+
Sbjct  1     MGRSLVFLASAPVKFSRELNWVPPLGQKLRQSFP--RTTRQVSLGGFLKFPSFSANQGRT  58

Query  1246  ICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYK  1067
             +  +AV+S   S   Y ++GA STG IP  QL E+V+ AAKTGA+VVMDAVNKPRNI YK
Sbjct  59    LSVRAVVS---SDTSYPKVGATSTGPIPGSQLAEVVETAAKTGAQVVMDAVNKPRNIFYK  115

Query  1066  GFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTH  887
             G TDLVT+TDK SE AILDVVRKNFPDHL+LGEEGG  GD SS YLWCIDPLDGTTNF H
Sbjct  116   GLTDLVTETDKMSEAAILDVVRKNFPDHLILGEEGGIIGDSSSGYLWCIDPLDGTTNFAH  175

Query  886   SYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKV  707
              Y SFAVSV +LF+G PAA+ VVEFVGGPMCW+TR ++A  G GA+ NGQK+  + TD V
Sbjct  176   GYPSFAVSVGVLFQGNPAAAAVVEFVGGPMCWNTRMFSATAGGGAFCNGQKIQSSKTDLV  235

Query  706   EQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRL  527
             EQSLLVTG+GY+ DD WATNMELFK+FT +SRGVRRLGAA+VD CHVALG+ EAYWEYRL
Sbjct  236   EQSLLVTGFGYEHDDPWATNMELFKDFTDISRGVRRLGAAAVDMCHVALGVAEAYWEYRL  295

Query  526   RPWDNAAGVLI  494
             +PWD AAGVL+
Sbjct  296   KPWDMAAGVLV  306



>gb|EMT10539.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=906

 Score =   414 bits (1065),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/268 (71%), Positives = 224/268 (84%), Gaps = 0/268 (0%)
 Frame = -2

Query  1192  IGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAIL  1013
             + A +TG +P+D+LL ++QAAAK GAEVVM+AVNKPRNI YKG  DLVTDTDK SE  IL
Sbjct  1     MAAPTTGPVPADELLGVIQAAAKAGAEVVMEAVNKPRNIQYKGVADLVTDTDKLSESVIL  60

Query  1012  DVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPA  833
             +VV KNF DHL+LGEEGG  GD  S+YLWCIDPLDGTTNF H Y SF+VS+ +LFRGKPA
Sbjct  61    EVVTKNFKDHLILGEEGGLIGDSLSEYLWCIDPLDGTTNFAHGYPSFSVSIGVLFRGKPA  120

Query  832   ASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWA  653
             A+TVVEF GGPMCW+TRT +A+ GKGAY NGQK+ V+ T+KVEQSLLVTG+GY+ DD+W 
Sbjct  121   AATVVEFCGGPMCWNTRTISASSGKGAYCNGQKIHVSPTEKVEQSLLVTGFGYEHDDAWL  180

Query  652   TNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGL  473
             TN+ LFKEFT VSRGVRRLG+A+ D  HV LGI EAYWEYRL+PWD AAGVLIVEEAGG+
Sbjct  181   TNINLFKEFTDVSRGVRRLGSAAADMSHVGLGITEAYWEYRLKPWDMAAGVLIVEEAGGV  240

Query  472   VSRTDGEKYCVFDRSVLASNGALHDKLL  389
             V+R DG ++ VFDRSVL SNG +HD+  
Sbjct  241   VTRMDGGEFTVFDRSVLVSNGTVHDQFF  268



>ref|XP_005850411.1| hypothetical protein CHLNCDRAFT_34459 [Chlorella variabilis]
 gb|EFN58309.1| hypothetical protein CHLNCDRAFT_34459 [Chlorella variabilis]
Length=333

 Score =   379 bits (972),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 176/291 (60%), Positives = 223/291 (77%), Gaps = 0/291 (0%)
 Frame = -2

Query  1180  STGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVR  1001
             ++G I + +LLE+ Q AA+ GA+VVM+AV+KPR I +KG TDLVTDTD+ SE A+L  ++
Sbjct  35    ASGRIANKELLEVAQRAAQAGAKVVMEAVDKPRTIEFKGATDLVTDTDRASEDAVLAAIQ  94

Query  1000  KNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTV  821
             + FP+H VLGEEGG +GD SS+YLWC+DPLDGTTNF H Y SFAV VA+L    P ASTV
Sbjct  95    QAFPNHAVLGEEGGVSGDTSSEYLWCVDPLDGTTNFAHGYPSFAVCVAVLRHTTPVASTV  154

Query  820   VEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNME  641
             +EF GGP  W TRTYTA+   GA+ NG+ + V+ T  + +SLLVTG+GY+ D+ WA NM+
Sbjct  155   IEFGGGPGSWVTRTYTASRNGGAFCNGKPIQVSKTHNLTKSLLVTGFGYEHDECWAANMK  214

Query  640   LFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRT  461
             LF+ FT V++GVRRLG+A+VD CHVA G+ EAYWEYRL+PWD AAGVLIVEEAGG V+  
Sbjct  215   LFQHFTDVTQGVRRLGSAAVDMCHVASGMAEAYWEYRLKPWDMAAGVLIVEEAGGSVTTM  274

Query  460   DGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
             DG  + VFDRSVL SNG LH+KLLEK   AT  L  +G+D S W+ P+ Y+
Sbjct  275   DGRAFSVFDRSVLVSNGFLHEKLLEKTEHATSHLVAEGIDLSQWFIPKGYR  325



>ref|XP_005650085.1| inositol monophosphatase, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE25541.1| inositol monophosphatase, partial [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 217/293 (74%), Gaps = 0/293 (0%)
 Frame = -2

Query  1186  ADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDV  1007
             A +TG +  + LLE+ + AAK GA VV + V+KPRNI +KG TDLVTDTDK SE A+L V
Sbjct  1     ASTTGPVAFEHLLEVAERAAKAGAAVVSERVDKPRNIEFKGATDLVTDTDKASEDAVLSV  60

Query  1006  VRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAAS  827
             +R  FPDH +LGEEGG +GD  S+YLWC+DPLDGTTNF H Y SFAVSVA+L +G P A 
Sbjct  61    LRTAFPDHALLGEEGGISGDTGSEYLWCVDPLDGTTNFAHGYPSFAVSVAVLQKGDPVAG  120

Query  826   TVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATN  647
              VVEF GGP  W T+TYTAA GKGA+ NG  +SV+    V  SLLVTG+GY+ D++WA N
Sbjct  121   VVVEFAGGPGSWVTKTYTAAKGKGAFLNGSPISVSRCKDVNLSLLVTGFGYEHDEAWAAN  180

Query  646   MELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVS  467
             +ELFKEFT  SRGVRRLGAA+VD CHVALGIV+ YWE+RL+PWD AAGVLI  EAG  ++
Sbjct  181   IELFKEFTDESRGVRRLGAAAVDLCHVALGIVDGYWEFRLKPWDMAAGVLIAREAGAKIT  240

Query  466   RTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
               DG+ + VF RSVLA+N  +H  +LEK    TE L   G+D S W+ P+ Y+
Sbjct  241   TMDGQPFTVFSRSVLAANDGIHPAILEKTQVKTEGLMKSGIDMSPWFLPDGYQ  293



>gb|AAW82030.1| inositol monophosphatase [Chlamydomonas incerta]
Length=341

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 212/289 (73%), Gaps = 0/289 (0%)
 Frame = -2

Query  1171  SIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNF  992
             ++  ++L+E+   AA+ GAEVV +A+++PRNI++KG TDLVT+TDK SE A+L V+RK++
Sbjct  50    AVALNELMEVAILAAEKGAEVVREALDRPRNISFKGATDLVTETDKASEDAVLAVLRKHY  109

Query  991   PDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEF  812
             P H +LGEEGG +GD  S YLWC+DPLDGTTNF HSY +FAVSV ++    P A  VVEF
Sbjct  110   PRHALLGEEGGVSGDTDSSYLWCVDPLDGTTNFAHSYPAFAVSVGVVRGATPVAGCVVEF  169

Query  811   VGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFK  632
              GGP  W+TRT+ A  G+    NG+ + V+    V +SLLVTG+GY+ D++WA NMELFK
Sbjct  170   TGGPHAWTTRTFAAHTGRPTTCNGKPVRVSQVSDVRRSLLVTGFGYEHDEAWAANMELFK  229

Query  631   EFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGE  452
             EFT V +GVRRLGAA+VD CH+++G+V+ YWEYRL+PWD AAG++I +EAG  ++  DG 
Sbjct  230   EFTDVCQGVRRLGAAAVDLCHLSMGVVDGYWEYRLKPWDMAAGIIIAQEAGATITTMDGR  289

Query  451   KYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKT  305
              + VF+RS+LASN  LH ++L+K  P T  L    VD S W+ P  Y T
Sbjct  290   PFSVFERSMLASNTLLHQQILDKTDPKTRGLLAANVDLSPWFVPPGYDT  338



>ref|XP_001699711.1| inositol monophosphatase [Chlamydomonas reinhardtii]
 gb|EDP07407.1| inositol monophosphatase [Chlamydomonas reinhardtii]
 gb|AEM89399.1| inositol monophosphatase [Chlamydomonas reinhardtii]
Length=340

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 210/285 (74%), Gaps = 0/285 (0%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             ++L+E+   AA+ GAEVV +A+++PR+I++KG TDLVT+TDK SE A+L V+RK++P H 
Sbjct  53    NELMEVAILAAEKGAEVVREALDRPRSISFKGATDLVTETDKASEDAVLAVLRKHYPRHA  112

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +LGEEGG +GD  S YLWC+DPLDGTTNF HSY +FAVSV ++    P A  VVEF GGP
Sbjct  113   LLGEEGGVSGDTDSSYLWCVDPLDGTTNFAHSYPAFAVSVGVVRGVTPVAGCVVEFTGGP  172

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               W+TRT+ A  G+    NG+ + V+    V +SLLVTG+GY+ D++WA NMELFKEFT 
Sbjct  173   HAWATRTFAAHTGRPTTCNGKPVRVSQVSDVRRSLLVTGFGYEHDEAWAANMELFKEFTD  232

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             V +GVRRLGAA+VD CH+++G+V+ YWEYRL+PWD AAG++I +EAG  ++  DG  + V
Sbjct  233   VCQGVRRLGAAAVDLCHLSMGVVDGYWEYRLKPWDMAAGIVIAQEAGATITTMDGRPFSV  292

Query  439   FDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKT  305
             F+RS+LASN  LH ++++K  P T  L    VD S W+ P  Y T
Sbjct  293   FERSMLASNTLLHQQIMDKTDPKTRGLLAANVDLSPWFVPPGYDT  337



>gb|KFM29121.1| Phosphatase IMPL1, chloroplastic [Auxenochlorella protothecoides]
Length=467

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 187/271 (69%), Gaps = 0/271 (0%)
 Frame = -2

Query  1120  GAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPS  941
             G +VV+   +KPR I +KG TDLVTDTD  SE A+L  + + +PDH +LGEEGG  GD +
Sbjct  189   GRKVVLANADKPRIIKHKGTTDLVTDTDSASEEAVLQAITRAYPDHGILGEEGGVMGDVT  248

Query  940   SDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVG  761
             SDYLWC+DPLDGTTNF H Y SFAVSV +L    P A  V+EF GGP  W TRTY AA  
Sbjct  249   SDYLWCVDPLDGTTNFAHGYPSFAVSVGVLRHAVPVAGVVIEFTGGPGGWITRTYEAARD  308

Query  760   KGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASV  581
              GA  +G+ +SV+    +EQSLLVTG+GYD D+ WA NM+LF+  T V++GVRR GAA+V
Sbjct  309   MGATCDGRPISVSRVKVLEQSLLVTGFGYDHDECWAANMDLFRALTDVTQGVRREGAAAV  368

Query  580   DFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALH  401
             D CH+A G+V+ YWE+RL+PWD AAG+LI EEAG   +        VFDRS+L +NG +H
Sbjct  369   DLCHLAAGLVDGYWEFRLKPWDMAAGLLIAEEAGATATTMGNGALSVFDRSLLVTNGFVH  428

Query  400   DKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
             ++LL    P    L   GVD S W+ PE +K
Sbjct  429   EQLLALTDPKVSALLEAGVDLSQWFVPEGFK  459



>ref|XP_001701734.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06709.1| predicted protein [Chlamydomonas reinhardtii]
Length=329

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 196/287 (68%), Gaps = 1/287 (0%)
 Frame = -2

Query  1168  IPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFP  989
             + ++ LL   + AA+ GAE+VM A +KPRNI+ K  TD+VT+TDK SE A++  +R  FP
Sbjct  35    VAAEDLLATAKKAAQLGAEIVMAAADKPRNISRKEGTDIVTETDKASEEAVVAAIRAAFP  94

Query  988   DHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFV  809
             +H VLGEEGG  GD SSDYLWC+DPLDGT NF H Y SF VSV +L    P A  V+EF+
Sbjct  95    NHAVLGEEGGVLGDVSSDYLWCVDPLDGTVNFAHGYQSFCVSVGVLRHATPVAGCVIEFL  154

Query  808   GGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKE  629
             GGP  W+TRT+TAA  +GA+ +GQ++ V+   ++  +++ T   Y  +D W     L KE
Sbjct  155   GGPKTWTTRTFTAARNQGAFVDGQQIFVSRVKELRDAVVTTEAVY-YEDMWPQLTVLQKE  213

Query  628   FTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEK  449
             FT   RGVR  GAA+ + CH+A+G ++AYW+Y L+PWD AAG +I+EEAGG ++  DG  
Sbjct  214   FTERCRGVRMSGAAAANMCHLAMGCIDAYWQYNLKPWDVAAGAVILEEAGGRLTTADGLA  273

Query  448   YCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYK  308
             Y VFDRS++A+N AL++K+L    P T ++  +GV  S W  P+ Y+
Sbjct  274   YSVFDRSLIATNDALYEKVLALTEPQTSRMLQEGVSLSTWCVPKGYR  320



>ref|XP_008366583.1| PREDICTED: LOW QUALITY PROTEIN: phosphatase IMPL1, chloroplastic-like 
[Malus domestica]
Length=273

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = -2

Query  907  GTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLS  728
            GTTNF H Y SFAVSV +LFRGKP A+  VEFVGGPMCW+TR ++A+ G GA+ NGQK+ 
Sbjct  11   GTTNFAHGYPSFAVSVGVLFRGKPVAADQVEFVGGPMCWNTRXFSASAGGGAFCNGQKIH  70

Query  727  VTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVE  548
            V+ TD+V +S LVTG+GY+ DD W TN+ELFKEFT +SRGVRRL AA+VD CHVALGIVE
Sbjct  71   VSQTDEVGRSCLVTGFGYEHDDVWVTNIELFKEFTDISRGVRRLDAAAVDMCHVALGIVE  130

Query  547  AYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPAT  368
            AYWEYRL+P D AAGVLIVEEAGG V+  DG K+ VFDRSVL SN  LH KLLE+I PAT
Sbjct  131  AYWEYRLKPRDMAAGVLIVEEAGGKVTCMDGGKFSVFDRSVLVSNDVLHGKLLERIAPAT  190

Query  367  EKLKNKGVDFSLWYKPEAYKTDF*QPHS  284
            EKLK+KG        P+  +  F  P S
Sbjct  191  EKLKSKGT------SPKVTQQTFDAPDS  212



>gb|ABZ07807.1| putative inositol monophosphatase family protein [uncultured 
marine microorganism HF4000_ANIW141I9]
Length=257

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 176/257 (68%), Gaps = 7/257 (3%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L++   AA+  A+V++ A+N PR   YKG TDLVT TDK+SE  I  ++ + FPDH +L 
Sbjct  7     LDVAVNAAQKAADVILTALNIPRIAYYKGKTDLVTKTDKESEQLICGIIHEKFPDHGILA  66

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G +  P ++Y W IDPLDGTTNF H+Y SFAVS+ +    +P A  V+E        
Sbjct  67    EESG-SSLPDAEYQWIIDPLDGTTNFVHNYPSFAVSIGVHQNNEPIAGCVIELP------  119

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
             +   YTA  G+GA+ +   +SV+   ++E+SLLVTG+GY   + W  NM LFK FT + +
Sbjct  120   ANHVYTALKGEGAFCDDNNISVSTIKELEKSLLVTGFGYQHGERWERNMVLFKRFTDICQ  179

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRRLGAA+VD CH+A G V+ +WE+ L PWD+AAG+LIV EAGG +S+ DG +Y ++D+
Sbjct  180   GVRRLGAAAVDLCHMASGKVDGFWEFDLHPWDSAAGILIVSEAGGKISKMDGSEYSIYDK  239

Query  430   SVLASNGALHDKLLEKI  380
              +L SNG LHD++++++
Sbjct  240   EILVSNGLLHDQMIKEM  256



>ref|WP_029748565.1| hypothetical protein [Marinimicrobia bacterium JGI 0000113-D11]
Length=261

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 175/260 (67%), Gaps = 7/260 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             +QLL++   AA    +++ + +NK + + YKG TDLVT  DK+SE  I+D +   F DH 
Sbjct  4     EQLLDLATEAATASRQIIFEHLNKTKVLTYKGKTDLVTLADKQSEKIIIDTILDKFNDHS  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G +    S YLW IDPLDGTTNF H Y S+ +S+A       + + V++     
Sbjct  64    ILAEESG-SVLKDSKYLWIIDPLDGTTNFVHGYPSYGISIACSIDNIISVAVVIDIPNND  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      YTA   KGA+ N + + ++ T ++ +SLLVTG+GY+ DD+W  NM+LFK FT 
Sbjct  123   I------YTAIKNKGAFKNSKPIKISQTKELLKSLLVTGFGYNHDDNWDFNMKLFKHFTH  176

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRRLGAASVD CH+A G+++ +WE+ L+PWD AAGVLIVEEAGG V++ DG+KY +
Sbjct  177   ITQGVRRLGAASVDLCHLASGVIDGFWEFDLKPWDTAAGVLIVEEAGGKVTKLDGQKYNI  236

Query  439   FDRSVLASNGALHDKLLEKI  380
             ++  +LASN ALH+ ++  I
Sbjct  237   YENQILASNEALHNDIISNI  256



>gb|KGN65049.1| hypothetical protein Csa_1G183590 [Cucumis sativus]
Length=227

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -2

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KA +SE+  +K+Y ++GA S G IP   L+++V+ AAKTGAEVVMDAVNKPRN+ YKG T
Sbjct  57    KAALSEISYRKQYPKVGAKSIGPIPPAHLIQVVENAAKTGAEVVMDAVNKPRNVEYKGLT  116

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT+TDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  117   DLVTETDKMSEAAILEVVKKNFKDHLILGEEGGVIGDSSSDYLWCIDPLDGTTNFAHGYP  176

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVG  761
             SFAVSV +L+RG PAA+ VVEFVGGPMCW+TR +TA  G
Sbjct  177   SFAVSVGVLYRGNPAAAAVVEFVGGPMCWNTRIFTATAG  215



>gb|KGN65051.1| hypothetical protein Csa_1G185090 [Cucumis sativus]
Length=173

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  709  VEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYR  530
            VE+SLLVTG+GY+ DD W TNM+LFKEFT VSRGVRRLGAA+VD  HVALGIVEAYWEYR
Sbjct  37   VERSLLVTGFGYEHDDPWTTNMDLFKEFTDVSRGVRRLGAAAVDMSHVALGIVEAYWEYR  96

Query  529  LRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNK  350
            L+PWD AAGVLIVEEAGG V+R DG K+ VFDRSVL SNG +HDKLLEKIGPATEKLK+K
Sbjct  97   LKPWDMAAGVLIVEEAGGAVTRMDGGKFSVFDRSVLVSNGVVHDKLLEKIGPATEKLKSK  156

Query  349  GVDFSLWYKPEAYKTDF  299
            G++FSLWYKPE Y+TD 
Sbjct  157  GIEFSLWYKPENYQTDL  173



>ref|XP_004172467.1| PREDICTED: phosphatase IMPL1, chloroplastic-like, partial [Cucumis 
sativus]
Length=195

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  1237  KAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT  1058
             KA +SE+  +K+Y ++GA S G IP   L+++V+ AAKTGAEVVMDAVNKPRN+ YKG T
Sbjct  57    KAALSEISYRKQYPKVGAKSIGPIPPAHLIQVVENAAKTGAEVVMDAVNKPRNVEYKGLT  116

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT+TDK SE AIL+VV+KNF DHL+LGEEGG  GD SSDYLWCIDPLDGTTNF H Y 
Sbjct  117   DLVTETDKMSEAAILEVVKKNFKDHLILGEEGGVIGDSSSDYLWCIDPLDGTTNFAHGYP  176

Query  877   SFAVSVAILFRGKPAASTV  821
             SFAVSV +L+RG PAA+ V
Sbjct  177   SFAVSVGVLYRGNPAAAAV  195



>ref|XP_008372106.1| PREDICTED: LOW QUALITY PROTEIN: phosphatase IMPL1, chloroplastic 
[Malus domestica]
Length=346

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 134/189 (71%), Gaps = 5/189 (3%)
 Frame = -2

Query  1375  SPLRFSHRPITILPCNRSNFPFLNANLQPLRYGFERI-LSLRR---SICAKAVMSEVESK  1208
             S   FS   I     +     FLN   Q L++GF R  LS+ +   S+C KAV+S + + 
Sbjct  60    SSQNFSDTQINFTSQSTKLLTFLNPK-QKLQHGFXRFGLSIAKPTXSLCTKAVLSGIPNH  118

Query  1207  KEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKS  1028
             + Y+++GA STG IP  QL+ + + AA TGAEVVM+AVNKPRN+ YKG TDLVTDTDKKS
Sbjct  119   ELYVKVGAKSTGPIPIGQLVGVXEKAAXTGAEVVMNAVNKPRNVTYKGVTDLVTDTDKKS  178

Query  1027  ELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILF  848
             E  IL+VVRKNF DHL+LGEEGG T D SSDYLWCIDPLD TTNF H Y SFAVSV +LF
Sbjct  179   EATILEVVRKNFEDHLILGEEGGITXDASSDYLWCIDPLDETTNFAHGYPSFAVSVGVLF  238

Query  847   RGKPAASTV  821
             +GKP A+ V
Sbjct  239   QGKPVAAAV  247


 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  592  AASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASN  413
            + SVD CHVALGIVEAYWEYRL+PWD AAGVLIVEEAGG V+  DG K+ VFDRSVL SN
Sbjct  249  SPSVDMCHVALGIVEAYWEYRLKPWDMAAGVLIVEEAGGKVTCMDGGKFSVFDRSVLVSN  308

Query  412  GALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
            G LH K+LE+I PATEKLK+K +DFSLWYKPE Y TD
Sbjct  309  GVLHGKVLERIAPATEKLKSKEIDFSLWYKPEDYTTD  345



>ref|WP_014559933.1| Myo-inositol-monophosphatase [Ignavibacterium album]
 ref|YP_005846046.1| Myo-inositol-monophosphatase [Ignavibacterium album JCM 16511]
 gb|AFH48778.1| Myo-inositol-monophosphatase [Ignavibacterium album JCM 16511]
Length=256

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 161/256 (63%), Gaps = 10/256 (4%)
 Frame = -2

Query  1147  EIVQAAAKTGAEVVMDAVNKPRNINYK--GFTDLVTDTDKKSELAILDVVRKNFPDHLVL  974
             +++Q A + G  ++ +A     ++  K     +LVT+ DKKSE  I+D VRK +P H +L
Sbjct  4     DLIQIAKEAGG-IIRNAHGTRFSVEVKSDNLKNLVTEIDKKSEKTIIDFVRKKYPSHNIL  62

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EEGG     SS+YLW IDPLDGTTNF H    F+VS+ I ++ +  A  V + +   + 
Sbjct  63    AEEGG-EHKSSSEYLWVIDPLDGTTNFAHGLPIFSVSIGIQYKDETIAGVVYDVMRDVL-  120

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
                  Y+A  G GA+ NG++++V   D + +SLLVTG+ Y+  ++     E F E   V+
Sbjct  121   -----YSAEKGSGAFENGKRINVNSNDNIAESLLVTGFPYNVAENPEKVFERFIEMLKVA  175

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             R VRRLG+A++DFC+VA G+ + +WE  L PWD  AG LIVEEAGG V+  +G    +F+
Sbjct  176   RAVRRLGSAAIDFCYVANGVFDGFWEVHLNPWDICAGKLIVEEAGGKVTDFNGNPISIFN  235

Query  433   RSVLASNGALHDKLLE  386
             +++L++NG +HDK++E
Sbjct  236   KTILSTNGKIHDKMIE  251



>ref|WP_020877033.1| inositol monophosphatase [Desulfococcus multivorans]
 gb|EPR38961.1| inositol monophosphatase [Desulfococcus multivorans DSM 2059]
Length=262

 Score =   208 bits (529),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 153/250 (61%), Gaps = 9/250 (4%)
 Frame = -2

Query  1135  AAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGF  956
             AAA +G  V+   +     I  KG  DLVT+ D  SE  I+  +R++FPDH +L EE G 
Sbjct  12    AAALSGGAVLRSYLGNLSAIEKKGAIDLVTEADIGSEKTIIQTIRQHFPDHAILAEESGT  71

Query  955   TGDPS-SDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRT  779
               DP   +Y W IDPLDGTTNF H    FAVS+A  +R + +   VV  + G +      
Sbjct  72    --DPGMPEYRWIIDPLDGTTNFAHQLPIFAVSIAFSYRDEISVGIVVNPISGEL------  123

Query  778   YTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRR  599
             +TA  G+GA  NG+ + V+D+  V +SLLVTG+ Y+  D   + +E F+     SRGVRR
Sbjct  124   FTAVRGQGALLNGRPIHVSDSLSVSESLLVTGFPYNFGDILESVVERFRSCLTASRGVRR  183

Query  598   LGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLA  419
             LGAA++D C VA G  + +WE  L+PWD AAG+LIV EAGG V+   G KY V DR +LA
Sbjct  184   LGAAALDLCFVACGRFDGFWEENLKPWDTAAGMLIVTEAGGRVTDFKGGKYGVGDREILA  243

Query  418   SNGALHDKLL  389
             +NG +H +L+
Sbjct  244   TNGCIHRELM  253



>ref|WP_008318872.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Leptolyngbya sp. PCC 6406]
Length=280

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 163/272 (60%), Gaps = 7/272 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
             Q L+I   AA TG  ++     K ++I  KG + DLVT+ DK SE A+L V++++ P+H 
Sbjct  11    QYLDIATEAALTGGAILQRYWGKLKSIEQKGRSGDLVTEADKASEAAVLAVMQRHLPEHA  70

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  + YLW IDPLDGTTN+ H Y   AVS+ +L  GKP    V +     
Sbjct  71    ILAEESGQMGNRENTYLWAIDPLDGTTNYAHQYPFSAVSIGLLVAGKPTVGVVYD-----  125

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR ++   N   F  FT 
Sbjct  126   -PFHQDLFRAATGLGATLNREPIQVSRTKRLEESLLVTGFAYDRRETLDNNYAEFCHFTH  184

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             ++RGVRR G+A++D  +VA G ++ YWE  L PWD AAG ++VEEAGG V+  D   + +
Sbjct  185   LTRGVRRGGSAALDLAYVACGRLDGYWERGLAPWDLAAGAVLVEEAGGRVTAYDEGTFDL  244

Query  439   FDRSVLASNGALHDKLLEKIGPATEKLKNKGV  344
             F   +LASNG+LH  + + +G        KG+
Sbjct  245   FSGRILASNGSLHRPMSQVLGQVKPWAGFKGI  276



>ref|WP_023073951.1| inositol monophosphatase fructose- -bisphosphatase family protein 
[Leptolyngbya sp. Heron Island J]
 gb|ESA35228.1| inositol monophosphatase fructose- -bisphosphatase family protein 
[Leptolyngbya sp. Heron Island J]
Length=277

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 161/269 (60%), Gaps = 9/269 (3%)
 Frame = -2

Query  1177  TGSIPSD--QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDV  1007
             T   P D  + LEI   AA  G  V+        +I  KG + DLVT+ D+ SE+A+L V
Sbjct  3     TTPTPEDLQRFLEIATEAALAGGAVLQRYWGNLSSIQEKGRSGDLVTEADRASEVAVLAV  62

Query  1006  VRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAAS  827
             ++++ PDH +L EE G  G   +  LW IDPLDGTTN+ H Y   AVS+ +L  GKP   
Sbjct  63    IKRHLPDHAILAEESGQLGHSDNPLLWAIDPLDGTTNYAHQYPLCAVSIGLLVAGKP---  119

Query  826   TVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATN  647
              +V  V  P+      Y AA G GA  N Q + V+   ++  SLLVTG+ YDR ++   N
Sbjct  120   -MVGVVYNPIL--QDLYRAAKGLGATHNRQSIQVSKATQLSNSLLVTGFAYDRRETIDNN  176

Query  646   MELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVS  467
                F  FT +++GVRR G+AS+D  HVA G ++ YWE  L PWD AAGV++VEEAGG VS
Sbjct  177   YAEFCHFTHLTQGVRRGGSASIDLAHVASGCLDGYWERGLSPWDLAAGVVLVEEAGGQVS  236

Query  466   RTDGEKYCVFDRSVLASNGALHDKLLEKI  380
               +G+ + ++   ++A+NGALH  ++ ++
Sbjct  237   AYNGDPFDIYSGRLVATNGALHQPIVHEL  265



>ref|WP_011342203.1| histidinol-phosphate phosphatase [Pelobacter carbinolicus]
 ref|YP_006718201.1| histidinol-phosphate phosphatase [Pelobacter carbinolicus DSM 
2380]
 gb|ABA89678.2| histidinol-phosphate phosphatase, putative [Pelobacter carbinolicus 
DSM 2380]
Length=260

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 153/241 (63%), Gaps = 7/241 (3%)
 Frame = -2

Query  1108  VMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYL  929
             +++A+++ R ++YKG  D+VTD D+ SE  ILD VR+ +P+H +L EE G      SD+ 
Sbjct  19    IVEALSELRQVDYKGRVDMVTDVDRGSEAIILDCVREAWPEHAILAEETG-ANQLRSDWR  77

Query  928   WCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAY  749
             W IDP+DGTTNF H Y  F +S+A+ +R +   + V + V   M      +TA  G+GA 
Sbjct  78    WIIDPIDGTTNFVHGYPFFCISIAVQYRRQTVVAVVYDPVHDEM------FTAVRGQGAL  131

Query  748   ANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCH  569
              NG+ + V+ T ++ ++LL TG+ Y+  D W   M+ FK F   + GVRR GAA++D C+
Sbjct  132   LNGKVIQVSQTAELSKALLATGFPYELGDRWHRAMDYFKLFYYRTHGVRRDGAAALDLCY  191

Query  568   VALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLL  389
             VA G  + +WE+ L+PWD AAG+L+VEEAGG VS   G    + D  VL SNG LH ++L
Sbjct  192   VAAGRFDGFWEFDLKPWDVAAGLLLVEEAGGRVSDLKGNPSGLDDGQVLVSNGGLHAQML  251

Query  388   E  386
             E
Sbjct  252   E  252



>gb|KEI68457.1| ImpA [Planktothrix agardhii NIVA-CYA 126/8]
Length=273

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 160/271 (59%), Gaps = 9/271 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA+ G  V+   +    ++  KG + DLVT+ DK SE AIL V+ ++ PDH +
Sbjct  9     FLDVATLAAQAGGAVLKYYLGNLTDVQEKGRSGDLVTEADKASEAAILAVLERHVPDHGI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  S YLW IDPLDGTTNF H Y  F+ S+ +L  G P    + +      
Sbjct  69    LTEESGELGDLKSPYLWAIDPLDGTTNFAHQYPFFSASIGLLINGVPQVGVIYD------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + +SV+ T+ +++SLLVTG+ YDR ++   N   F   T +
Sbjct  123   PFHDELFQAAKGLGATCNNRLISVSKTNSLDKSLLVTGFAYDRRETTDNNYAEFAHLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D  H A G ++ YWE  L PWD AAG+++VEEAGG V+  D   + + 
Sbjct  183   TQGVRRSGAASIDLAHTACGRLDGYWERGLSPWDMAAGIVLVEEAGGKVTAYDTSPFQIS  242

Query  436   DRSVLASNGALHDKLLEKI--GPATEKLKNK  350
                +LA+NG LH++L + +   PA    K+K
Sbjct  243   SGRILATNGYLHERLSQTLIETPALSSWKDK  273



>ref|XP_004139538.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Cucumis sativus]
 ref|XP_004167154.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Cucumis sativus]
Length=116

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -2

Query  646  MELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVS  467
            M+LFKEFT VSRGVRRLGAA+VD  HVALGIVEAYWEYRL+PWD AAGVLIVEEAGG V+
Sbjct  1    MDLFKEFTDVSRGVRRLGAAAVDMSHVALGIVEAYWEYRLKPWDMAAGVLIVEEAGGAVT  60

Query  466  RTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTDF  299
            R DG K+ VFDRSVL SNG +HDKLLEKIGPATEKLK+KG++FSLWYKPE Y+TD 
Sbjct  61   RMDGGKFSVFDRSVLVSNGVVHDKLLEKIGPATEKLKSKGIEFSLWYKPENYQTDL  116



>ref|WP_015204936.1| inositol-phosphate phosphatase [Crinalium epipsammum]
 ref|YP_007144347.1| inositol-phosphate phosphatase [Crinalium epipsammum PCC 9333]
 gb|AFZ14837.1| Inositol-phosphate phosphatase [Crinalium epipsammum PCC 9333]
Length=272

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 156/269 (58%), Gaps = 10/269 (4%)
 Frame = -2

Query  1174  GSIPSDQL---LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDV  1007
             G    DQL   L+I   AA  G  ++     K   +  KG   DLVT+ DK +E A+L++
Sbjct  2     GQNSPDQLQIFLDIATEAALAGGAILQKYWGKLEAVQEKGRPGDLVTEADKYAENAVLEI  61

Query  1006  VRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAAS  827
             ++++FP H +L EE G  GD SS+YLW IDPLDGTTN+ H Y  FA S+ +L  G P   
Sbjct  62    IKRHFPQHSILAEESGQLGDNSSEYLWAIDPLDGTTNYAHQYPFFATSIGLLINGVPKVG  121

Query  826   TVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATN  647
              V +       +    + AA G GA  N Q + V+ T  + +SLLVTG+ YDR ++   N
Sbjct  122   VVFD------PFHNELFRAATGLGATRNRQPIQVSQTSSLSKSLLVTGFAYDRRETADNN  175

Query  646   MELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVS  467
                F   T +++GVRR GAASVD  HVA G ++ YWE  L PWD AAG+++V+EAGG V+
Sbjct  176   YAEFCHLTHLTQGVRRSGAASVDLAHVACGRLDGYWERGLSPWDIAAGIVLVQEAGGTVT  235

Query  466   RTDGEKYCVFDRSVLASNGALHDKLLEKI  380
               D     +    +LA+N  +H+ L +++
Sbjct  236   AYDRSPLVIHSGRILATNSYIHESLSDEL  264



>ref|WP_026786233.1| MULTISPECIES: inositol monophosphatase [Planktothrix]
Length=273

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 154/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA+ G  V+   +    ++  KG + DLVT+ DK SE AIL V+ ++ PDH +
Sbjct  9     FLDVATLAAQAGGNVLKYYLGNLTDVQEKGRSGDLVTEADKASESAILAVLERHVPDHGI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  S YLW IDPLDGTTNF H Y  F+ S+ +L  G P    + +      
Sbjct  69    LTEESGELGDLKSPYLWAIDPLDGTTNFAHQYPFFSASIGLLINGVPQVGVIYD------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + +SV+ TD +++SLLVTG+ YDR ++   N   F   T +
Sbjct  123   PFHDELFQAAKGLGATCNNRLISVSKTDSLDKSLLVTGFAYDRRETTDNNYAEFAHLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D  H A G ++ YWE  L PWD AAG+++VEEAGG V+  D   + + 
Sbjct  183   TQGVRRSGAASIDLAHTACGRLDGYWERGLSPWDMAAGIVLVEEAGGKVTAYDTSPFQIS  242

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG LH+ L + +
Sbjct  243   SGRILATNGYLHESLSQAL  261



>ref|WP_017294269.1| hypothetical protein [Geminocystis herdmanii]
Length=274

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 157/263 (60%), Gaps = 7/263 (3%)
 Frame = -2

Query  1177  TGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVR  1001
             T  I   +LL++   AA+ G  ++     K  +I  KG   DL+T  D+++E  IL V+ 
Sbjct  2     TYQIEIPKLLDVALLAAQAGGNILQSYWGKQLHIREKGKAGDLITQVDQQAEEEILAVID  61

Query  1000  KNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTV  821
             ++FP+H +L EE G  G+  S+YLW IDPLDGTTN+ H Y   AVS+ +L  G P    V
Sbjct  62    RHFPEHGILAEESGILGNADSEYLWVIDPLDGTTNYAHGYPQAAVSIGLLVSGIPTVGVV  121

Query  820   VEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNME  641
                   PM      ++ A+G GA  N Q + V+  DK++ SLLVTG+ YDR +    N  
Sbjct  122   YN----PM--QNELWSGALGLGATLNHQLIQVSTIDKLKDSLLVTGFAYDRTEVEDNNYA  175

Query  640   LFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRT  461
              F   T +++GVRR G+AS+D CHVA G +E YWE  L+PWD  AGV+I++EAGG ++  
Sbjct  176   EFCYLTHLTQGVRRGGSASLDLCHVAGGRLEGYWERGLKPWDLLAGVVILQEAGGKITAY  235

Query  460   DGEKYCVFDRSVLASNGALHDKL  392
             D   + ++   +LA+NG +H +L
Sbjct  236   DESNFDLYSGRILATNGYIHSQL  258



>ref|WP_014856459.1| Inositol-1-monophosphatase (IMPase) (Inositol-1-phosphatase) 
(I-1-Pase) [Melioribacter roseus]
 ref|YP_006528040.1| Inositol-1-monophosphatase (IMPase) (Inositol-1-phosphatase) 
(I-1-Pase) [Melioribacter roseus P3M-2]
 gb|AFN75027.1| Inositol-1-monophosphatase (IMPase) (Inositol-1-phosphatase) 
(I-1-Pase) [Melioribacter roseus P3M-2]
Length=255

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 157/257 (61%), Gaps = 8/257 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYK-GFTDLVTDTDKKSELAILDVVRKNFPDHLV  977
             +L+ V  AA+   E++ +   K  +I YK    +LVT+ DKKSE AI++ + K FP H V
Sbjct  1     MLDKVIEAAQIAGEIIKEGYRKNISIEYKTNLANLVTEIDKKSEEAIINFISKEFPGHSV  60

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G   +  S+Y W IDPLDGTTNF H    F+VS+A+    +     V + +    
Sbjct  61    LAEESGIK-ERDSEYKWIIDPLDGTTNFAHGLPIFSVSIAVQRSDEVICGVVYDVM----  115

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
                   Y+A  G GA+ NG+KL V+  D + +SLLVTG+ Y+ D++    +E F  F   
Sbjct  116   --REAIYSAEKGGGAFCNGRKLKVSLNDDLRKSLLVTGFPYNIDENPGHAIERFVIFLKN  173

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             SR VRRLG+A++D C+VA GI + +WE  L PWD AAG LIVEEAGG+V+  + E   + 
Sbjct  174   SRAVRRLGSAAIDLCYVAEGIFDGFWEVSLNPWDMAAGKLIVEEAGGVVTNFNNEPLDLA  233

Query  436   DRSVLASNGALHDKLLE  386
              + +LA+NG +HDK+L+
Sbjct  234   GKQILATNGKIHDKMLK  250



>ref|WP_015199905.1| inositol-phosphate phosphatase [Calothrix parietina]
 ref|YP_007139256.1| inositol-phosphate phosphatase [Calothrix sp. PCC 6303]
 gb|AFZ03284.1| Inositol-phosphate phosphatase [Calothrix sp. PCC 6303]
Length=274

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 157/271 (58%), Gaps = 11/271 (4%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I  AAA  G E++   + K  N I  K    DLVT  DK +E  ILD  +++ P+H 
Sbjct  7     FLDIATAAALAGGEILQSYLGKVENAIAQKDRPGDLVTIADKAAEAVILDHFQRHLPEHA  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+ +S YLW IDPLDGTTNF H Y  FAVS+ +L  G P    +       
Sbjct  67    ILAEESGALGNQTSKYLWAIDPLDGTTNFAHQYPVFAVSIGLLIDGVPQVGVIYN-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
              C     + AA G GA  N Q + V+ T +++QSLL+TG+ YDR ++   N   F   T 
Sbjct  122   PC-QNELFQAATGLGAKRNQQSIQVSRTSQLDQSLLITGFAYDRRETTDNNYGEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D  +VA G ++ YWE  L PWD AAG++I  EAGG V+  DG  + +
Sbjct  181   ITQGVRRSGSAALDLAYVACGRIDGYWERGLSPWDMAAGIVIAREAGGRVTAYDGSDFQM  240

Query  439   FDRSVLASNGALHDKL---LEKIGPATEKLK  356
                 +LA+NG +HD L   L K+ P T ++ 
Sbjct  241   TSGRILATNGYIHDSLSQELIKVTPLTVRIN  271



>ref|WP_023174101.1| inositol monophosphatase [Gloeobacter kilaueensis]
 ref|YP_008712606.1| inositol monophosphatase [Gloeobacter kilaueensis JS1]
 gb|AGY58899.1| inositol monophosphatase [Gloeobacter kilaueensis JS1]
Length=267

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 160/261 (61%), Gaps = 6/261 (2%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             ++ L+I  AAA+    V++D  +    I+ K   +LVTD D+ +E  IL  +++++PDH 
Sbjct  2     ERFLDIACAAARAAGSVLVDYRDSLATIDEKTPGNLVTDADRAAEAVILATLKRHYPDHG  61

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G   S +LW +DPLDGTTNF H Y  FAVSV +L  G P    + + V   
Sbjct  62    ILAEESGLAGMEHSPFLWAVDPLDGTTNFAHRYPVFAVSVGLLIDGTPVVGAIFDPV---  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
                +   + AA G GA+ NG+ L+V+    +++SLL TG+ YDR ++   N   F +FT 
Sbjct  119   ---ADELFAAARGVGAFCNGRPLTVSTIATLDRSLLATGFAYDRRETNDNNYAEFCQFTH  175

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +S+GVRR GAA++D  +VA G  + +WE  L PWD AAGV++V+EAGG VS  DG  + +
Sbjct  176   LSQGVRRGGAAALDLAYVAAGRFDGFWERGLSPWDMAAGVVLVQEAGGTVSAYDGSPFDL  235

Query  439   FDRSVLASNGALHDKLLEKIG  377
                 +LASNG LH  + E++G
Sbjct  236   RSGRILASNGHLHRAMSEQLG  256



>ref|WP_023068568.1| inositol monophosphatase family protein [Lyngbya aestuarii]
 gb|ERT05167.1| inositol monophosphatase family protein [Lyngbya aestuarii BL 
J]
Length=278

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 164/272 (60%), Gaps = 11/272 (4%)
 Frame = -2

Query  1183  DSTGSIPSDQL---LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAI  1016
             ++T + P DQL   L+I   AA+ G  V+   +   ++I  KG + DLVT+ DK SE A+
Sbjct  2     NTTKTTP-DQLQTFLDIATLAAEAGGAVLQSCLGNLKDIQEKGRSGDLVTEADKASEAAV  60

Query  1015  LDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKP  836
             LD+++++ PDH +L EE G  G+  S +LW IDPLDGTTNF H Y  F+ S+A+L  G P
Sbjct  61    LDILKRHAPDHAILTEESGELGNRDSSFLWAIDPLDGTTNFAHQYPFFSTSIALLIDGVP  120

Query  835   AASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSW  656
             +   V++       W    + AA G GA  N Q + V+ TD +  SLLVTG+ YDR ++ 
Sbjct  121   SVGAVLD------PWRGELFRAAKGLGATRNYQPIQVSKTDHLANSLLVTGFAYDRRETS  174

Query  655   ATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGG  476
               N   F   T +++GVRR G+A++D  +VA G ++ YWE  L PWD AAG++++EEAGG
Sbjct  175   DNNYAEFCYLTHLTQGVRRGGSAALDLSYVASGRLDGYWERGLSPWDMAAGIVVLEEAGG  234

Query  475   LVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
              V+  D     +    +LA+NG LH  L + +
Sbjct  235   KVTAYDSSPLDLKSGRILATNGHLHRSLSQAL  266



>ref|WP_015218348.1| inositol-phosphate phosphatase [Cyanobacterium aponinum]
 ref|YP_007160661.1| inositol-phosphate phosphatase [Cyanobacterium aponinum PCC 10605]
 gb|AFZ52617.1| Inositol-phosphate phosphatase [Cyanobacterium aponinum PCC 10605]
Length=277

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 166/271 (61%), Gaps = 7/271 (3%)
 Frame = -2

Query  1186  ADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILD  1010
             ++S+  +   +LL+I   AA+ G  ++     K  +I  KG + DL+T+ D+KSE  +L 
Sbjct  2     SESSNLLKKQKLLDIAILAAQEGGAILKQYWGKQLDIREKGRSGDLITEVDQKSEEKVLS  61

Query  1009  VVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAA  830
             V+++++PDH +L EE G  G   S+YLW IDPLDGTTN+ H Y   AVS+ +L  GKP  
Sbjct  62    VIKRHYPDHGILAEESGTIGIQESEYLWVIDPLDGTTNYAHGYPQAAVSIGLLASGKP--  119

Query  829   STVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWAT  650
               +V  V  P+      ++AA G GA  N   + V+ T+ +  SLLVTG+ YDR ++   
Sbjct  120   --LVGVVYNPI--REELWSAADGLGATLNRVPIRVSRTNNLTNSLLVTGFAYDRRETEDN  175

Query  649   NMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLV  470
             N   F   T +++GVRR G+AS+D C VA G ++ YWE  L+PWD  AGV+IV+EAGG V
Sbjct  176   NYAEFCYLTHLTQGVRRGGSASLDLCDVATGRLDGYWERGLKPWDLLAGVVIVKEAGGFV  235

Query  469   SRTDGEKYCVFDRSVLASNGALHDKLLEKIG  377
             +  DG ++ +    +LA+NG +H +L   +G
Sbjct  236   TAYDGSEFDLDSGRILATNGYIHSQLSNALG  266



>ref|WP_015147712.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Oscillatoria acuminata]
 ref|YP_007084984.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Oscillatoria acuminata PCC 6304]
 gb|AFY81064.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Oscillatoria acuminata PCC 6304]
Length=275

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 153/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA     +V         I  KG + DLVT  DK SE AIL+V+R++ P+H +
Sbjct  11    FLDIATEAALDAGAIVQSYWGNLNAIEEKGRSGDLVTAADKASEKAILEVLRRHVPEHGI  70

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD +S YLW IDPLDGTTNF H Y  F VS+ +L  G P    V +      
Sbjct  71    LAEESGKLGDSTSQYLWAIDPLDGTTNFAHQYPPFGVSIGLLINGIPQVGVVFD------  124

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N Q + V++T ++  SLLVTG+ YDR ++   N   F   T +
Sbjct  125   PFHNELFRAAKGLGATRNRQPIRVSETVELRNSLLVTGFAYDRRETPDNNYAEFCHLTHL  184

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D C+V+ G ++ YWE  L PWD AAGV+I+ EAGG ++  DG  + + 
Sbjct  185   TQGVRRSGSASIDLCYVSCGRLDGYWERGLSPWDLAAGVVILSEAGGKITAYDGSPWKIE  244

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG LH+ L +++
Sbjct  245   SGRILATNGKLHESLSQEL  263



>ref|WP_006621515.1| MULTISPECIES: inositol monophosphatase [Arthrospira]
 gb|EDZ92199.1| Inositol-phosphate phosphatase [Arthrospira maxima CS-328]
 gb|EKD10386.1| inositol-phosphate phosphatase [Arthrospira platensis C1]
Length=270

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 153/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1165  PSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFP  989
             P    L++   AA  G  V+       ++I  KG + DLVT+ DK SE AIL+V++++ P
Sbjct  5     PLQTFLDVATLAATAGGTVLKYYWGNLQDIQEKGRSGDLVTEADKASEAAILEVLKRHVP  64

Query  988   DHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFV  809
              H +L EE G  GD SS YLW IDPLDGTTN+ H Y +FA S+A+L  G P    V    
Sbjct  65    GHGILAEESGSLGDTSSRYLWAIDPLDGTTNYAHQYPAFATSIALLIDGVPQVGAVYN--  122

Query  808   GGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKE  629
                  +    +  A G GA  NG  + V+ T+ ++QSLLVTG+ YDR ++   N   F  
Sbjct  123   ----PFHDELFQGATGHGATCNGTPIKVSQTNSLDQSLLVTGFAYDRRETPDNNYAEFCY  178

Query  628   FTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEK  449
              T +++GVRR G+ASVD  +VA G ++ YWE  L PWD AAGV++V+EAGG V+  D   
Sbjct  179   LTHLTQGVRRGGSASVDLAYVACGRLDGYWERGLSPWDLAAGVVLVQEAGGKVTAYDESP  238

Query  448   YCVFDRSVLASNGALHDKL  392
             + +    +LA+NG LH  L
Sbjct  239   FEIQSGRILATNGFLHSSL  257



>ref|WP_027248740.1| inositol monophosphatase [Planktothrix agardhii]
Length=273

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 154/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA+ G  V+   +    ++  KG + DLVT+ DK SE AIL V+ ++ PDH +
Sbjct  9     FLDVATLAAQAGGAVLKYYLGNLTDVQEKGRSGDLVTEADKASEAAILAVLERHVPDHGI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  S YLW IDPLDGTTNF H Y  F+ S+ +L  G P    + +      
Sbjct  69    LTEESGELGDLKSPYLWAIDPLDGTTNFAHQYPFFSASIGLLINGVPQVGVIYD------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + +SV+ T+ +++SLLVTG+ YDR ++   N   F   T +
Sbjct  123   PFHDELFQAAKGLGATCNNRLISVSKTNSLDKSLLVTGFAYDRRETTDNNYAEFAHLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D  H A G ++ YWE  L PWD AAG+++VEEAGG V+  D   + + 
Sbjct  183   TQGVRRSGAASIDLAHTACGRLDGYWERGLSPWDMAAGIVLVEEAGGKVTAYDTSPFQIS  242

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG LH+ L + +
Sbjct  243   SGRILATNGYLHESLSQAL  261



>ref|WP_009783914.1| inositol monophosphatase [Lyngbya sp. PCC 8106]
 gb|EAW37456.1| inositol monophophatase family protein [Lyngbya sp. PCC 8106]
Length=276

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 164/272 (60%), Gaps = 11/272 (4%)
 Frame = -2

Query  1183  DSTGSIPSDQL---LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAI  1016
             ++T + P DQL   L+I   AA+ G  V+   +   ++I  KG + DLVT+ DK SE A+
Sbjct  2     NTTKTTP-DQLQTFLDIATLAAEAGGAVLQSCLGNLKDIQEKGRSGDLVTEADKASEAAV  60

Query  1015  LDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKP  836
             LD+++++ PDH +L EE G  G+  S +LW IDPLDGTTNF H Y  F+ S+A+L  G P
Sbjct  61    LDILKRHAPDHAILTEESGELGNRDSSFLWAIDPLDGTTNFAHQYPFFSTSIALLIDGVP  120

Query  835   AASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSW  656
             +   V++       W    + AA G GA  N Q + V++T+ +  SLLVTG+ YDR ++ 
Sbjct  121   SVGAVLD------PWRGELFRAAKGLGATRNRQPIYVSETNNLANSLLVTGFAYDRRETS  174

Query  655   ATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGG  476
               N   F   T +++GVRR G+A++D  +VA G ++ YWE  L PWD AAG++I+EEAGG
Sbjct  175   DNNYAEFCHLTHLTQGVRRGGSAALDLSYVACGRIDGYWERGLSPWDIAAGIVILEEAGG  234

Query  475   LVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
              V+  D     +    +LA+N  LH  L + +
Sbjct  235   KVTTYDSSPLDLKSGRILATNSHLHGSLSQAL  266



>ref|XP_008371877.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Malus domestica]
Length=170

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 127/170 (75%), Gaps = 6/170 (4%)
 Frame = -2

Query  1405  MGERLVSTAMSPLRFSHRPITILPCNRSNFP-FLNANLQPLRYGFERI-LSLRR---SIC  1241
             MG  LV +   PLR S  P +ILP NR ++  FLN   Q L++GF+R  LS+ +   S+C
Sbjct  1     MGRSLVFSTNVPLRISQIPRSILPPNRPSYSLFLNPK-QKLQHGFQRFGLSIAKPTSSLC  59

Query  1240  AKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGF  1061
              KAV+S + + + Y+++GA STG IP  QL+ +V+ AAKTGAEVVM+AVNKPRNI YKG 
Sbjct  60    TKAVLSGIPNHELYVKVGAKSTGPIPIGQLVGVVEKAAKTGAEVVMNAVNKPRNITYKGV  119

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPL  911
              DLVTDTDKKSE  IL+VVRKNF DHL+LGEEGG TGD SSDY+WCIDPL
Sbjct  120   ADLVTDTDKKSEATILEVVRKNFEDHLILGEEGGITGDASSDYMWCIDPL  169



>ref|WP_008057189.1| inositol monophosphatase [Arthrospira sp. PCC 8005]
 emb|CCE20618.1| inositol monophosphatase [Arthrospira sp. PCC 8005]
 emb|CDM93143.1| inositol monophosphatase [Arthrospira sp. PCC 8005]
Length=270

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 153/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1165  PSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFP  989
             P    L++   AA  G  V+       ++I  KG + DLVT+ DK SE AIL+V++++ P
Sbjct  5     PLQTFLDVATLAATAGGTVLKYYWGNLQDIQEKGRSGDLVTEADKASEAAILEVLKRHVP  64

Query  988   DHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFV  809
              H +L EE G  GD SS YLW IDPLDGTTN+ H Y +FA S+A+L  G P    V    
Sbjct  65    GHGILTEESGSLGDTSSRYLWAIDPLDGTTNYAHQYPAFATSIALLIDGVPQVGAVYN--  122

Query  808   GGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKE  629
                  +    +  A G GA  NG  + V+ T+ ++QSLLVTG+ YDR ++   N   F  
Sbjct  123   ----PFHDELFQGATGHGATCNGTPIKVSQTNSLDQSLLVTGFAYDRRETPDNNYAEFCY  178

Query  628   FTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEK  449
              T +++GVRR G+ASVD  +VA G ++ YWE  L PWD AAGV++V+EAGG V+  D   
Sbjct  179   LTHLTQGVRRGGSASVDLAYVACGRLDGYWERGLSPWDLAAGVVLVQEAGGKVTAYDESP  238

Query  448   YCVFDRSVLASNGALHDKL  392
             + +    +LA+NG LH  L
Sbjct  239   FEIKSGRILATNGFLHSSL  257



>ref|WP_006518715.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Leptolyngbya sp. PCC 7375]
 gb|EKU97538.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Leptolyngbya sp. PCC 7375]
Length=277

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 159/270 (59%), Gaps = 9/270 (3%)
 Frame = -2

Query  1180  STGSIPSD--QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILD  1010
             ST   P D  + L++   AA  G  V+        +I  KG + DLVT+ D+ SE+ +L+
Sbjct  2     STTPAPEDLRRFLDVATEAAMAGGAVLQKYWGNLSSIQEKGRSGDLVTEADRASEVDVLN  61

Query  1009  VVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAA  830
             V++++FPDH +L EE G  G   + +LW IDPLDGTTN+ H Y   AVS+ +L  G P  
Sbjct  62    VIKRHFPDHAILAEESGQLGQRDNRFLWAIDPLDGTTNYAHQYPLCAVSIGLLVAGVPTV  121

Query  829   STVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWAT  650
               V   +   +      Y AA G GA  N Q + V+ T ++  SLLVTG+ YDR ++   
Sbjct  122   GVVYNPILNDL------YRAAKGLGATHNRQPMQVSATAQLSDSLLVTGFAYDRRETSDN  175

Query  649   NMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLV  470
             N   F   T +++GVRR G+AS+D  HVA G ++ YWE  L PWD AAG ++VEEAGG +
Sbjct  176   NYAEFCHLTHLTQGVRRGGSASIDLAHVACGCLDGYWERGLSPWDLAAGAVLVEEAGGQL  235

Query  469   SRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             S  DG  + ++   ++A+NG LH  +++++
Sbjct  236   SAYDGSSFDIYSGRLVATNGPLHQPIVQEL  265



>ref|WP_006618759.1| inositol monophosphatase [Arthrospira platensis]
 ref|YP_005068937.1| inositol monophosphatase family protein [Arthrospira platensis 
NIES-39]
 dbj|BAI90399.1| inositol monophosphatase family protein [Arthrospira platensis 
NIES-39]
 gb|KDR56378.1| inositol monophosphatase [Arthrospira platensis str. Paraca]
Length=270

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 154/255 (60%), Gaps = 7/255 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA  G  V+       ++I  KG + DLVT+ DK SE AIL+V++++ P H +
Sbjct  9     FLDVATLAATAGGTVLKYYWGNLQDIQEKGRSGDLVTEADKASEAAILEVLKRHVPGHGI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD SS YLW IDPLDGTTN+ H Y +FA S+A+L  G P    V        
Sbjct  69    LTEESGSLGDTSSRYLWAIDPLDGTTNYAHQYPAFATSIALLIDGVPQVGAVYN------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    +  A+G GA  NG+ + V+  + +++SLLVTG+ YDR ++   N   F   T +
Sbjct  123   PFHDELFQGAIGHGATCNGKPIKVSQANSLDKSLLVTGFAYDRRETPDNNYAEFCYLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+ASVD  +VA G ++ YWE  L PWD AAGV++V+EAGG V+  D   + + 
Sbjct  183   TQGVRRGGSASVDLAYVACGRLDGYWERGLSPWDLAAGVVLVQEAGGKVTAYDQSPFDIK  242

Query  436   DRSVLASNGALHDKL  392
                +LA+NG+LH  L
Sbjct  243   SGRILATNGSLHSSL  257



>ref|WP_024124707.1| myo-inositol-1-phosphate phosphatase SuhB [Thermosynechococcus 
sp. NK55a]
 ref|YP_008899818.1| myo-inositol-1-phosphate phosphatase SuhB [Thermosynechococcus 
sp. NK55a]
 gb|AHB88305.1| myo-inositol-1-phosphate phosphatase SuhB [Thermosynechococcus 
sp. NK55a]
Length=283

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 164/281 (58%), Gaps = 15/281 (5%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLVL  974
             LEI   AA  G  V+     K   I  KG + DLVT  D++SE A+LDV+R++ PDH VL
Sbjct  17    LEIATEAALAGGAVLQHYWGKLSEIEEKGRSGDLVTVADRQSEAAVLDVIRRHCPDHAVL  76

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EE G +G  ++ +LW IDPLDGTTN+ H Y   AVSVA+L  G+P    V +       
Sbjct  77    AEESGLSGLKNNPFLWAIDPLDGTTNYAHQYPFSAVSVALLVEGEPHIGVVYD------P  130

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
             +    + AA G GA  + Q + V+ T ++  SLLVTG+ YDR ++   N   F   T ++
Sbjct  131   FHRELFRAATGLGATRDRQPIHVSSTAELSHSLLVTGFAYDRRETADNNYAEFCYLTHLT  190

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             +GVRR GAA++D  ++A G ++ YWE  L PWD AAGV++V EAGG+V+  D   + +  
Sbjct  191   QGVRRGGAAAIDLAYIACGRLDGYWERGLSPWDLAAGVVLVREAGGIVTAYDQSPFQLTS  250

Query  433   RSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAY  311
               +LA+NG LH  L E +      L+ K + FS  + PE +
Sbjct  251   GRILATNGHLHAALSEAL------LRVKPLGFS--FLPEGH  283



>ref|WP_033378094.1| MULTISPECIES: histidinol phosphate phosphatase, partial [Marinimicrobia]
Length=246

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 151/251 (60%), Gaps = 7/251 (3%)
 Frame = -2

Query  1132  AAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFT  953
             AA+   + ++       +   K   ++VT  D+ SE  I+D + K+FPDH +L EEG   
Sbjct  3     AAQRAGQYILQHTESSPDYTLKSRANMVTQIDQTSEKIIVDTILKDFPDHQILAEEG-LN  61

Query  952   GDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYT  773
                 S++ W IDPLDGTTNF H +  +AVS+ + F G+     ++  V  P       + 
Sbjct  62    QAGESEFKWIIDPLDGTTNFVHGFPFYAVSIGLEFEGQ----IILGVVNFPTF--QELFY  115

Query  772   AAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLG  593
             A  G+GA+ N +++ V+  DK+EQ+LL TG+ YD    +  N +LFK F   ++G+RR G
Sbjct  116   ARAGQGAFLNQRQIRVSHIDKLEQALLATGFPYDLSGKFNLNFDLFKLFYQKTQGIRRPG  175

Query  592   AASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASN  413
             AA++D C+VA G ++ +WEY L PWD AAG +IV+EAGG +   DG  + ++DR +LA+N
Sbjct  176   AAAIDLCYVACGRLDGFWEYELNPWDVAAGSIIVQEAGGKLRNIDGSPFSIYDRQILATN  235

Query  412   GALHDKLLEKI  380
             G +  ++L+ +
Sbjct  236   GLIEAEMLQHL  246



>ref|WP_033374645.1| inositol monophosphatase [Spirulina subsalsa]
Length=284

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 152/260 (58%), Gaps = 7/260 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              LL I   AA +   ++ D     + I  KG   DLVT+ DKKSE  IL ++ +  PDH 
Sbjct  10    HLLTIASEAALSAGVILQDHWGNIQIIEEKGRAGDLVTEVDKKSEATILAILNEQVPDHG  69

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+ +S YLW IDPLDGTTN+ HSY   +VSV +LF G P    + +     
Sbjct  70    ILAEESGILGNANSPYLWAIDPLDGTTNYAHSYPLSSVSVGLLFNGVPILGAIYD-----  124

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +S   Y AA G GA  N + + V+ T  + +SLLVTG+ YDR ++   N   F   T 
Sbjct  125   -PYSQLLYRAAKGLGATCNHRPIKVSSTPNLNRSLLVTGFAYDRRETTDQNYAEFCYLTH  183

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  H+A G ++ YWE  L+PWD AAGV++VEEAGG V+  D     +
Sbjct  184   ITQGVRRGGSASLDLAHLASGRLDGYWERGLKPWDLAAGVVLVEEAGGTVTAYDQSPLDI  243

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG LH  L + +
Sbjct  244   NSGRILATNGHLHQALSQAL  263



>ref|WP_021834376.1| Inositol-1-monophosphatase [Crocosphaera watsonii]
 emb|CCQ59736.1| Inositol-1-monophosphatase [Crocosphaera watsonii WH 0401]
Length=276

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 161/267 (60%), Gaps = 7/267 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA T   ++ D V+K   I  KG   DLVT+ DKK+E  +L++++K   +H +
Sbjct  12    FLDVATEAAMTAGVILEDLVDKLEKIEEKGRPGDLVTEADKKAEATVLNILKKRVSNHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  SDYLW IDPLDGTTN+ H Y + AVSV +L++ KP    +V  V  P 
Sbjct  72    LAEESGKIGDNDSDYLWVIDPLDGTTNYAHGYPASAVSVGLLWQEKP----IVGAVYNP-  126

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              ++   +  A G GA  N + + V+ TD++  SLLVTG+ YDR +S  TN   F   T +
Sbjct  127   -FNRELFRGAKGLGATLNYRPIKVSQTDQLSNSLLVTGFAYDRRESKDTNYPEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D  +VA G ++ YWE  L PWD AAG++I+EEAGG V+  D     + 
Sbjct  186   TQGVRRGGSASLDIANVACGRLDGYWERGLSPWDIAAGIIILEEAGGKVTAYDESPLKLE  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLK  356
                +LA+NG +H  L + +  A   LK
Sbjct  246   SGRLLATNGKIHHSLSQALAEALSWLK  272



>ref|WP_008276397.1| inositol monophosphatase [Cyanothece sp. CCY0110]
 gb|EAZ90464.1| inositol monophophatase family protein [Cyanothece sp. CCY0110]
Length=276

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 159/267 (60%), Gaps = 7/267 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   A  T   ++ D VNK   I  KG   DLVT+ DKK+E+ +L++++   P+H +
Sbjct  12    FLDIATEAVMTAGVILEDLVNKLEKIEEKGRPGDLVTEADKKAEITVLNILKDRVPNHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G   S YLW IDPLDGTTN+ H Y + AVSV +L++GKP    VV  V  P 
Sbjct  72    LAEESGKIGKSDSYYLWAIDPLDGTTNYAHGYPASAVSVGLLWQGKP----VVGAVYNP-  126

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +S   +  A G GA  N + + V+ T+K+  SLLVTG+ YDR ++  TN   F   T +
Sbjct  127   -FSKELFRGAKGLGATLNYRPIKVSQTNKLSNSLLVTGFAYDRRETKDTNYPEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D   VA G ++ YWE  L PWD AAG++I+EEAGG V+  D     + 
Sbjct  186   TQGVRRGGSASLDIVSVACGRLDGYWERGLSPWDIAAGIIILEEAGGKVTAYDESPLKLE  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLK  356
                +LA+NG +H  L + +  A   LK
Sbjct  246   SGRLLATNGLIHHSLSQALTEALPWLK  272



>ref|WP_011141322.1| inositol monophosphatase [Gloeobacter violaceus]
 ref|NP_924268.1| inositol monophosphatase [Gloeobacter violaceus PCC 7421]
 dbj|BAC89263.1| inositol monophophatase family [Gloeobacter violaceus PCC 7421]
Length=267

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 160/261 (61%), Gaps = 6/261 (2%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             ++ L+I   AA+    V++  + K  + + K   +LVTD D+ +E  IL  +++++PDH 
Sbjct  2     ERFLDIACVAARAAGAVLLGYLGKLADFDEKTPGNLVTDADRAAEAVILATLKRHYPDHG  61

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G   S +LW +DPLDGTTNF H Y  F VS+ +L  G P    V + V G 
Sbjct  62    ILAEESGLAGIEESPFLWAVDPLDGTTNFAHRYPVFCVSIGLLIDGTPVVGAVFDPVSGE  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      ++AA G GA+ N + ++V+ T+K+ +SLL TG+ YDR ++   N   F +FT 
Sbjct  122   L------FSAARGLGAFCNHRPIAVSTTEKLGRSLLATGFAYDRRETPDNNYAEFCQFTH  175

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D  +VA G  + +WE  L PWD  AG+++V EAGG VS  DG    +
Sbjct  176   LTQGVRRGGSAALDLAYVAAGRFDGFWERGLSPWDMVAGIVLVREAGGTVSAYDGSPLDL  235

Query  439   FDRSVLASNGALHDKLLEKIG  377
                 VLA+NGA+H  ++E++G
Sbjct  236   RSGRVLATNGAVHAAMVEQLG  256



>ref|WP_016873198.1| inositol monophosphatase [Chlorogloeopsis fritschii]
Length=274

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 140/226 (62%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  +L+ +R++FPDH +L EE G  G+  +++LW IDPLDGTTNF H Y 
Sbjct  45    DLVTVADKASEEVVLEALRRHFPDHAILAEESGKIGNQENEFLWAIDPLDGTTNFAHQYP  104

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              F VS+ +L  G P    + +       +    + AA G GA  N   + V++T K+ QS
Sbjct  105   CFTVSIGLLIDGVPQVGVIYD------PFHNELFRAAQGLGATRNRHPIRVSETSKLSQS  158

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F  FT +++GVRR G+AS+D  HVA G V+ YWE  + PW
Sbjct  159   LLVTGFAYDRRETSDNNYAEFCHFTHLTQGVRRTGSASLDLAHVACGRVDGYWERGISPW  218

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAG++I+ EAGG V+  DG    +    +LA+NG +HD ++ ++
Sbjct  219   DIAAGIIILREAGGKVTAYDGTPIKLESGRILATNGYIHDIMIREL  264



>ref|WP_007310101.1| inositol monophosphatase [Crocosphaera watsonii]
 gb|EHJ13593.1| Inositol-1-monophosphatase [Crocosphaera watsonii WH 0003]
 emb|CCQ49430.1| Inositol-1-monophosphatase [Crocosphaera watsonii WH 8502]
 emb|CCQ54576.1| Inositol-1-monophosphatase [Crocosphaera watsonii WH 0005]
 emb|CCQ65778.1| Inositol-1-monophosphatase [Crocosphaera watsonii WH 0402]
Length=276

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 161/267 (60%), Gaps = 7/267 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA T   ++ D V+K   I  KG   DLVT+ DKK+E  +L++++K   +H +
Sbjct  12    FLDVATEAAMTAGVILEDLVDKLEKIEEKGRPGDLVTEADKKAEATVLNILKKRVSNHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  SDYLW IDPLDGTTN+ H Y + AVSV +L++ KP    +V  V  P 
Sbjct  72    LAEESGKIGDNDSDYLWVIDPLDGTTNYAHGYPASAVSVGLLWQEKP----IVGAVYNP-  126

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              ++   +  A G GA  N + + V+ TD++  SLLVTG+ YDR ++  TN   F   T +
Sbjct  127   -FNRELFRGAKGLGATLNYRPIKVSQTDQLSNSLLVTGFAYDRRETKDTNYPEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D  +VA G ++ YWE  L PWD AAG++I+EEAGG V+  D     + 
Sbjct  186   TQGVRRGGSASLDIANVACGRLDGYWERGLSPWDIAAGIIILEEAGGKVTAYDESPLKLE  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLK  356
                +LA+NG +H  L + +  A   LK
Sbjct  246   SGRLLATNGKIHHSLSQALAEALSWLK  272



>ref|WP_007304705.1| inositol monophosphatase [Crocosphaera watsonii]
 gb|EAM51557.1| Inositol-1(or 4)-monophosphatase [Crocosphaera watsonii WH 8501]
Length=276

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 161/267 (60%), Gaps = 7/267 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   AA T   ++ D V+K   I  KG   DLVT+ DKK+E  +L++++K   +H +
Sbjct  12    FLDVATEAAMTAGVILEDLVDKLEKIEEKGRPGDLVTEADKKAEATVLNILKKRVSNHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  SDYLW IDPLDGTTN+ H Y + AVSV +L++ KP    +V  V  P 
Sbjct  72    LAEESGKIGDNDSDYLWVIDPLDGTTNYAHGYPASAVSVGLLWQEKP----IVGAVYNP-  126

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              ++   +  A G GA  N + + V+ TD++  SLLVTG+ YDR ++  TN   F   T +
Sbjct  127   -FNRELFRGAKGLGATLNYRPIKVSQTDQLSNSLLVTGFAYDRRETKDTNYPEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D  +VA G ++ YWE  L PWD AAG++I+EEAGG V+  D     + 
Sbjct  186   TQGVRRGGSASLDIANVACGRLDGYWERGLSPWDIAAGIIILEEAGGKVTAYDESPLKLE  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLK  356
                +LA+NG +H  L + +  A   LK
Sbjct  246   SGRLLATNGKIHHSLSQALAEALSWLK  272



>dbj|BAP18025.1| inositol monophophatase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=280

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 154/268 (57%), Gaps = 7/268 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
             LLE+   A  T   ++ D   K   I  KG   DLVT+ DK +E AIL+++R+  P H +
Sbjct  12    LLEVATEAVMTAGVILQDLWGKLEKIEEKGRPGDLVTEADKTAEAAILNILRRRVPQHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G   SDYLW IDPLDGTTN+ H Y  +AVSV +L  G P    + +      
Sbjct  72    LAEESGLLGVAESDYLWVIDPLDGTTNYAHGYPIYAVSVGLLIEGIPQVGAIYD------  125

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + + V+ T ++  SLLVTG+ YDR ++  TN   F   T +
Sbjct  126   PFKKELFRAAKGLGATLNYRSIQVSKTTELSNSLLVTGFPYDRQETQDTNYTEFCYLTHI  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+A++D  +VA G ++ YWE  L PWD +AG++I+EEAGG +S  D     + 
Sbjct  186   TQGVRRTGSAALDLANVACGRLDGYWERGLSPWDISAGIIILEEAGGKISAYDESTLILK  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLKN  353
                +LA+NG +H  L + +  A   L+N
Sbjct  246   SGRLLATNGHIHHVLSQALDGALPWLQN  273



>ref|WP_017659711.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=285

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 153/261 (59%), Gaps = 11/261 (4%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA  G  V+     K   +  KG + DLVT  DK +E  +L+V+R++ P+H +
Sbjct  12    FLDIATEAALAGGAVLKSYWGKLDGVEEKGRSGDLVTAADKAAEARVLEVLRRHVPEHGI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G  +S +LW IDPLDGTTN+ H Y  FAVSV +L  GKPA   V        
Sbjct  72    LAEESGNLGRQASPFLWAIDPLDGTTNYAHQYPVFAVSVGLLIEGKPAVGVVYNPA----  127

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
               +   + AA G GA  N   + V+ TD + +SLLVTG+ YDR ++   N   F   T +
Sbjct  128   --TDELFRAAKGLGATRNRVSMRVSTTDSLARSLLVTGFAYDRRETDDNNYAEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+ASVD  HVA G ++ YWE  L PWD AAG+++VEEAGG V+  DG    V 
Sbjct  186   TQGVRRSGSASVDLAHVACGCLDGYWERGLSPWDIAAGIVLVEEAGGRVTAYDGSPLEVT  245

Query  436   DRSVLASNGALH----DKLLE  386
                +LA+NG +H    D+LLE
Sbjct  246   SGRLLATNGKIHRETSDRLLE  266



>ref|WP_017746306.1| inositol monophosphatase [Scytonema hofmanni]
Length=271

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 143/226 (63%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE+ ILD+VR++FP+H +L EE G  G+  +++LW IDPLDGTTNF H Y 
Sbjct  41    DLVTAADKASEVVILDIVRRHFPEHSILAEESGKLGNQDNEFLWAIDPLDGTTNFAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L RG P    + +       +    + AA G GA  N + + V++T ++ +S
Sbjct  101   FFAVSIGLLIRGIPQVGVIYD------PFHDELFRAAQGLGATRNRRPIQVSNTSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  + PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASLDLAHVACGRIDGYWERGIAPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAGV+++ EAGG V+  DG    +    +LA+N  +H+ L +++
Sbjct  215   DIAAGVILLREAGGKVTAYDGSPLDIVSGRILATNSYIHESLSQEL  260



>ref|WP_008231301.1| Inositol-1-monophosphatase [Richelia intracellularis]
 emb|CCH66153.1| Inositol-1-monophosphatase [Richelia intracellularis HM01]
Length=272

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 142/226 (63%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK+SE  ILD + ++FP+H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  41    DLVTVADKESEAVILDCLHRHFPEHAILAEESGSLGNYQNEYLWLIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FA+S+ +L  G P    + + + G +      + AA+G GA  N Q + V+ T+K+ +S
Sbjct  101   CFAISIGLLINGVPRLGVIYDPLHGEL------FQAAMGLGATLNRQPICVSQTNKLGKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LL TG+ YDR ++   N   F   T +++GVRR GAAS+D  HVA G V+ YWE  L PW
Sbjct  155   LLATGFAYDRRETLNNNYAEFCHLTHLTQGVRRSGAASIDLAHVACGRVDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAGV++V+EAGG V+  D     ++   ++A+N  +H  L +++
Sbjct  215   DIAAGVILVQEAGGKVTAYDEGPLKLYSGKIMATNSIIHQSLSQEL  260



>ref|WP_017317072.1| inositol monophosphatase [Mastigocladopsis repens]
Length=270

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 143/226 (63%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK +E+ ILDV+R++FPDH +L EE G  G+  ++YLW IDPLDGTTNF H Y 
Sbjct  41    DLVTAADKAAEVVILDVLRRHFPDHSILAEESGKLGNQDNEYLWAIDPLDGTTNFAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA G GA  N + + V+DT ++ +S
Sbjct  101   FFAVSIGLLIHGVPQVGVIYD------PFHDELFRAAQGLGATRNRRPIKVSDTSELGKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  + PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASLDLAHVACGRLDGYWERGIAPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAGV+++ EAGG V+  DG    +    +LA+NG +H+ L +++
Sbjct  215   DIAAGVILLREAGGKVTAYDGSPLNIPSGRILATNGYIHNILSQEL  260



>ref|WP_015161231.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Chamaesiphon minutus]
 ref|YP_007098647.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Chamaesiphon minutus PCC 6605]
 gb|AFY95120.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Chamaesiphon minutus PCC 6605]
Length=282

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 158/258 (61%), Gaps = 7/258 (3%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLVL  974
             LE+ +AAA    EV+     K  +I  K    DLVT+ D+++E  IL+++R+NFP+H +L
Sbjct  15    LEVAKAAALAAGEVLQACWGKLESIVEKDRPGDLVTEADRQAEAVILEILRQNFPEHSIL  74

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EE G  GD +++YLW IDPLDGTTN+ H Y   A S+ +L  G P    + +       
Sbjct  75    AEESGQFGDLNAEYLWAIDPLDGTTNYAHQYPFSAASIGLLINGVPTVGAIYD------P  128

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
             +    +  A+G GA  N + + V++ DK+ +SLLVTG+ YDR ++   N + F   T ++
Sbjct  129   FHRELFAGAIGIGATCNDRSICVSNVDKLAKSLLVTGFAYDRRETPDNNYQEFCYLTHIT  188

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             +GVRR GAAS+D  +VA G ++ YWE  L PWD AAGV IVE AGG ++  D   + +  
Sbjct  189   QGVRRAGAASIDLAYVACGRLDGYWERGLSPWDLAAGVAIVEAAGGTITAYDRSPFDIRS  248

Query  433   RSVLASNGALHDKLLEKI  380
               +LA+NG LHD+L +++
Sbjct  249   GRILATNGKLHDELSQEL  266



>ref|WP_015145708.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Pleurocapsa minor]
 ref|YP_007082967.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Pleurocapsa sp. PCC 7327]
 gb|AFY79410.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Pleurocapsa sp. PCC 7327]
Length=288

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 157/273 (58%), Gaps = 10/273 (4%)
 Frame = -2

Query  1168  IPSDQL---LEIVQAAAKTGAEVVMDAVNKPRNINYKGF-TDLVTDTDKKSELAILDVVR  1001
             + S+QL   L+I   A  +   +++D   K   I  KG   DLVT+ DKK+E AIL V+R
Sbjct  4     LSSNQLQIFLDIATEAVMSAGAILLDCWGKIETIEEKGRPDDLVTEADKKAEDAILAVLR  63

Query  1000  KNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTV  821
             ++ PDH +L EE G  G+  +DYLW IDPLDGTTN+ H Y    VSV +L  G P    V
Sbjct  64    RHVPDHQILAEESGRLGNEENDYLWAIDPLDGTTNYAHGYPVAVVSVGLLVEGIPQVGAV  123

Query  820   VEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNME  641
                      +    + AA G GA  N   + V+ T+++ +SLLVTG+ YDR ++   N  
Sbjct  124   YN------PFRNELFRAARGLGATLNRHPIGVSGTEELSKSLLVTGFAYDRRETADNNYA  177

Query  640   LFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRT  461
              F   T +++GVRR G+A+ D   VA G ++ YWE  +RPWD AAG++I+EEAGG+ S  
Sbjct  178   EFCYLTHLTQGVRRSGSAAHDLTDVACGRLDGYWERGIRPWDIAAGLVILEEAGGVASAY  237

Query  460   DGEKYCVFDRSVLASNGALHDKLLEKIGPATEK  362
             DG    +    VLA+NG +H  L + +  A  +
Sbjct  238   DGSPLVIESGRVLATNGKIHASLSQSLQEAATR  270



>ref|XP_010460930.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Camelina sativa]
 ref|XP_010460931.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Camelina sativa]
Length=116

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  646  MELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVS  467
            MELFKEFTGVSRGVRRLGAA+VD CHVALGI ++YWEYRL+PWD AAGVLIVEEAGG V+
Sbjct  1    MELFKEFTGVSRGVRRLGAAAVDMCHVALGIADSYWEYRLKPWDMAAGVLIVEEAGGAVT  60

Query  466  RTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPEAYKTD  302
            R DG K+ VFDRSVL SN  LH KLLE+I PATE LK+KG+DFSLW+KPE Y T+
Sbjct  61   RMDGGKFSVFDRSVLVSNDILHSKLLERIAPATENLKSKGIDFSLWFKPEDYHTE  115



>ref|WP_015120363.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Rivularia sp. PCC 7116]
 ref|YP_007057348.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Rivularia sp. PCC 7116]
 gb|AFY56801.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Rivularia sp. PCC 7116]
Length=272

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/278 (40%), Positives = 164/278 (59%), Gaps = 10/278 (4%)
 Frame = -2

Query  1168  IPSDQL-LEIVQAAAKTGAEVVMDAVNKPRN-INYKGFTDLVTDTDKKSELAILDVVRKN  995
             +P  Q+ L+I   AA  G  V+   + K  +  + K   DLVT  DK SE  +L+ +R++
Sbjct  1     MPDLQIFLDIATEAALAGGAVLQSYLGKVEDKTSEKRPGDLVTAADKASEAVVLETLRRH  60

Query  994   FPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVE  815
              P+H +L EE G  G+ + +YLW IDPLDGTTNF H Y  F+VSV +L  G P    + +
Sbjct  61    VPEHAILAEESGKLGNQNQEYLWAIDPLDGTTNFAHEYPFFSVSVGLLINGVPQVGVIYD  120

Query  814   FVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELF  635
                    +    Y AA G GA  N + +SV+ T ++ +SLLVTG+ YDR ++   N   F
Sbjct  121   ------PFRNELYRAAQGLGASCNRRPISVSKTSELNKSLLVTGFAYDRRETDDNNYTEF  174

Query  634   KEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDG  455
                T +++GVRR G+A++D  H A G ++ YWE  L PWD  AGV+I+ EAGG V+  DG
Sbjct  175   CHLTHLTQGVRRGGSAALDLAHTACGRLDGYWERGLSPWDITAGVIILREAGGKVTAYDG  234

Query  454   EKYCVFDRSVLASNGALHDKLLEKIGPATE--KLKNKG  347
               + +    +LA+NG +H+ L +++G A +  K++ KG
Sbjct  235   SDFKMDSGRLLATNGYIHENLSQELGRAHQVWKVEKKG  272



>ref|WP_015131078.1| inositol-phosphate phosphatase [Calothrix sp. PCC 7507]
 ref|YP_007068117.1| inositol-phosphate phosphatase [Calothrix sp. PCC 7507]
 gb|AFY35283.1| Inositol-phosphate phosphatase [Calothrix sp. PCC 7507]
Length=269

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 139/222 (63%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE+ +L+++R++FP H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  40    DLVTAADKASEVVVLEILRRHFPQHSILAEESGKLGNQENEYLWAIDPLDGTTNYAHQYP  99

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA G GA  N +++ V++T  + +S
Sbjct  100   FFAVSIGLLINGVPKVGVIYD------PFHNELFRAAAGLGATRNRRRIQVSETSDLNKS  153

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  +VA G V+ YWE  L PW
Sbjct  154   LLVTGFAYDRRETSDNNYAEFSHLTHLTQGVRRSGSASLDLAYVACGRVDGYWERGLSPW  213

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D  AG+++V+EAGG V+  DG    +    +LA+NG +HD L
Sbjct  214   DITAGIILVQEAGGKVTAYDGTPVKIESGRILATNGYIHDNL  255



>ref|WP_015171146.1| inositol monophosphatase [Geitlerinema sp. PCC 7407]
 ref|YP_007108631.1| inositol monophosphatase [Geitlerinema sp. PCC 7407]
 gb|AFY65579.1| inositol monophosphatase [Geitlerinema sp. PCC 7407]
Length=273

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 154/265 (58%), Gaps = 10/265 (4%)
 Frame = -2

Query  1159  DQL---LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNF  992
             DQL   L+I   AA     V+     K   I  KG   DLVT  DK SE  IL++  ++ 
Sbjct  7     DQLQNFLDIATEAALQAGTVLRSYWGKLDKIEEKGRPGDLVTAADKASEAKILEIFGRHL  66

Query  991   PDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEF  812
             PDH +L EE G  GD + ++LW IDPLDGTTN+ H Y  +AVS+ +L RG P    + + 
Sbjct  67    PDHAILAEESGQLGDRNGEFLWAIDPLDGTTNYAHQYPFYAVSLGLLVRGVPVVGVIYD-  125

Query  811   VGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFK  632
                   +    + AA G GA  N Q + V+ T  +  SLLVTG+ YDR ++   N   F 
Sbjct  126   -----PFHDELFRAAQGLGATRNQQPIQVSQTRDLSSSLLVTGFAYDRRETPDNNYAEFC  180

Query  631   EFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGE  452
              FT +++GVRR G+AS+D  +V+ G ++ YWE  L PWD +AG+++V+EAGG V+  DG 
Sbjct  181   HFTHLTQGVRRGGSASIDLAYVSCGRLDGYWERGLSPWDISAGIVVVQEAGGRVTAYDGR  240

Query  451   KYCVFDRSVLASNGALHDKLLEKIG  377
                ++   +LASNG LH+ +  ++G
Sbjct  241   PIDLWSGRILASNGHLHEAMQRELG  265



>ref|WP_011057494.1| inositol monophosphatase [Thermosynechococcus elongatus]
 ref|NP_682447.1| extragenic suppressor protein SuhB-like protein [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC09209.1| tlr1657 [Thermosynechococcus elongatus BP-1]
Length=283

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/282 (41%), Positives = 163/282 (58%), Gaps = 15/282 (5%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
              + LEI   AA  G  V+     K   I  KG + DLVT  D++SE A+LDV+ ++ PDH
Sbjct  14    QRYLEIATEAALAGGAVLQHYWGKLSEIEEKGRSGDLVTVADRQSEAAVLDVIGRHCPDH  73

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              VL EE G +G  ++ +LW IDPLDGTTN+ H Y   AVSVA+L  G+P    V +    
Sbjct  74    AVLAEESGLSGLANNPFLWAIDPLDGTTNYAHQYPFSAVSVALLVEGEPHIGVVYD----  129

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  + Q + V+ T ++  SLLVTG+ YDR ++   N   F   T
Sbjct  130   --PFHRELFRAATGLGATRDRQPIRVSSTAELSHSLLVTGFAYDRRETEDNNYAEFCYLT  187

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR GAA++D  ++A G ++ YWE  L PWD AAGV++V EAGG+V+  D   + 
Sbjct  188   HLTQGVRRGGAAAIDLAYIACGRLDGYWERGLSPWDLAAGVVLVREAGGIVTAYDQSPFQ  247

Query  442   VFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLWYKPE  317
             +    +LA+NG LH  L E +      L+ K + FS  + PE
Sbjct  248   LTSGRILATNGHLHAALSEAL------LRVKPLGFS--FLPE  281



>ref|WP_015174953.1| Inositol-phosphate phosphatase [Oscillatoria nigro-viridis]
 ref|YP_007114043.1| Inositol-phosphate phosphatase [Oscillatoria nigro-viridis PCC 
7112]
 gb|AFZ05627.1| Inositol-phosphate phosphatase [Oscillatoria nigro-viridis PCC 
7112]
Length=271

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 146/256 (57%), Gaps = 7/256 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
               LEI   AA     V+     K   I  KG + DLVT+ DK SE  IL+++ ++ PDH 
Sbjct  8     NFLEIATEAALAAGSVLKSFCGKLEKIQEKGRSGDLVTEADKASEAVILEILGRHVPDHG  67

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  GD SS YLW IDPLDGTTN+ H Y  +AVS+ +L  G P    + +     
Sbjct  68    ILAEESGKLGDASSKYLWAIDPLDGTTNYAHQYPFWAVSIGLLIDGIPQIGVIYD-----  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + A  G GA  N   + V+   ++  SLLVTG+ YDR ++   N   F   T 
Sbjct  123   -PFHNELFRAGKGLGATCNRSPIEVSQISELRTSLLVTGFAYDRRETADNNYAEFCHLTH  181

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  H+A+G  + YWE  L PWD AAGVLIV EAGG ++  DG  + +
Sbjct  182   LTQGVRRSGSASLDLAHLAMGRSDGYWERGLSPWDVAAGVLIVSEAGGQITAYDGSAFEM  241

Query  439   FDRSVLASNGALHDKL  392
                 +LA+NG +H +L
Sbjct  242   NSGRILATNGKIHAEL  257



>ref|WP_038086003.1| inositol monophosphatase [Tolypothrix bouteillei]
 gb|KIE08092.1| inositol monophosphatase [Tolypothrix bouteillei VB521301]
Length=273

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 142/226 (63%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE+ ILD+VR++FP+H +L EE G  GD  +++LW IDPLDGTTNF H Y 
Sbjct  43    DLVTAADKASEVVILDIVRRHFPEHSILAEESGKLGDQDNEFLWAIDPLDGTTNFAHQYP  102

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA G GA  N + + V++T ++ +S
Sbjct  103   FFAVSIGLLIHGVPQVGVIYD------PFHDELFRAAQGLGATRNRRPIQVSNTSELSKS  156

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  + PW
Sbjct  157   LLVTGFAYDRRETSDNNYAEFCYLTHLTQGVRRSGSASLDLAHVACGRIDGYWERGISPW  216

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAGV+++ EAGG V+  DG    +    +LA+N  +H+ L +++
Sbjct  217   DIAAGVILLREAGGKVTAYDGSPLDLVSGRILATNSYIHESLSQEL  262



>ref|WP_008232548.1| Inositol-1-monophosphatase [Richelia intracellularis]
 emb|CCH66747.1| Inositol-1-monophosphatase [Richelia intracellularis HH01]
Length=257

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 141/226 (62%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK+SE  ILD + ++FP+H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  26    DLVTVADKESEAVILDCLHRHFPEHAILAEESGNLGNYQNEYLWAIDPLDGTTNYAHQYP  85

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FA+S+ +L  G P    + + + G +      + AA+G GA  N   + V+ T+K+ +S
Sbjct  86    CFAISIGLLINGVPRLGVIYDPLRGEL------FQAAMGLGATLNRHPICVSQTNKLGKS  139

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LL TG+ YDR ++   N   F   T +++GVRR GAAS+D  HVA G V+ YWE  L PW
Sbjct  140   LLATGFAYDRRETLNNNYAEFCHLTHLTQGVRRSGAASIDLAHVACGRVDGYWERGLSPW  199

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAGV++V+EAGG V+  D     ++   ++A+N  +H  L +++
Sbjct  200   DIAAGVILVQEAGGKVTAYDEGPLKLYSGKIMATNSIIHKSLSQEL  245



>ref|WP_019492350.1| inositol monophosphatase [Calothrix sp. PCC 7103]
Length=269

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/263 (41%), Positives = 151/263 (57%), Gaps = 8/263 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA +G  V+   + K  + +  KG   DLVT  DK +E  IL+  +++ P+H 
Sbjct  7     FLDIATEAALSGGAVLQSFLGKIEDSVVEKGRPGDLVTAADKAAENVILEHFQRHLPEHG  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+    YLW IDPLDGTTNF H Y  FAVS+ +L  G P    + +     
Sbjct  67    ILSEESGELGNQKDKYLWAIDPLDGTTNFAHQYPMFAVSIGLLVDGVPEVGVIYD-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               W    + A  G GA  N   + V++T ++ +SLLVTG+ YDR ++   N   F  FT 
Sbjct  122   -PWHNELFRAGTGLGATRNRHPIRVSNTSELSKSLLVTGFAYDRRETTDNNYAEFCHFTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR GAAS+D  +VA G V+ YWE  L PWD  AGV I+ EAGG V+  DG ++ V
Sbjct  181   LTQGVRRSGAASIDLAYVACGRVDGYWERGLSPWDMVAGVAILREAGGKVTAYDGSEFKV  240

Query  439   FDRSVLASNGALHDKLLEKIGPA  371
                 +LA+NG +HD + + +  A
Sbjct  241   LSGRILATNGRIHDAMSDSLKKA  263



>gb|KIH76427.1| histidinol phosphate phosphatase [Geoalkalibacter ferrihydriticus 
DSM 17813]
Length=261

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 154/254 (61%), Gaps = 7/254 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVL  974
             + EI   AA+ G ++++       +I+ KG  DLVTD D+++E AI+ V+R  FP H +L
Sbjct  1     MKEIALRAAREGGKILLQKFGTALHIDRKGAGDLVTDADREAEEAIVGVIRHTFPRHAIL  60

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EE  + G+   DY W IDPLDGTTN+ H++  F+VS+A+    + A   V+  V  P  
Sbjct  61    AEEADY-GEKEGDYRWIIDPLDGTTNYAHAFPWFSVSIAL----EVAGEVVLGVVYNPA-  114

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
                  + A VG+GAY N  ++ V+ TD +++SL+ TG+ YDR    A N + F  F   +
Sbjct  115   -HQDLFYAEVGQGAYLNDVQIRVSATDALDESLVATGFPYDRKQCQANNYDHFINFQQAA  173

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             +  RR+G+A++D  + A G  + +WE +L+PWD AAG L+VEEAGG VS   GE   +F 
Sbjct  174   QACRRVGSAALDLAYTAAGRFDGFWEMKLKPWDVAAGKLLVEEAGGRVSDFSGEPCDIFG  233

Query  433   RSVLASNGALHDKL  392
               +LASNG +H+ +
Sbjct  234   CEILASNGLIHEPM  247



>ref|WP_028954158.1| inositol monophosphatase [Synechocystis sp. PCC 7509]
Length=269

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 153/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              LEI   AA    EV++D +        KG   DLVT  DK SE  +L++++++FP+H +
Sbjct  10    FLEIATEAALAAGEVLLDYLGNIGTATQKGRPGDLVTVADKASEAVVLEILQRHFPNHSI  69

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G   S YLW IDPLDGTTN+ H Y  FAVS+ +L  G P    + +      
Sbjct  70    LAEESGKLGLAESQYLWAIDPLDGTTNYAHQYPFFAVSIGLLVDGIPEVGVIFD------  123

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              ++   + AA G GA  N + + V+ T+K+ +SLLV+G+ YDR ++   N   F   T +
Sbjct  124   PFAQELFRAARGLGATKNRRPIQVSTTNKLSESLLVSGFAYDRHETADNNYAEFCHLTHL  183

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+A++D  HVA G ++ YWE  + PWD +AGV++++EAGG V+  D     + 
Sbjct  184   TQGVRRSGSAALDLAHVACGRLDGYWERGIAPWDISAGVILLQEAGGKVTAYDQSPLSIE  243

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG +H  L +++
Sbjct  244   SGRILATNGLIHHNLSQEL  262



>ref|WP_039753200.1| inositol monophosphatase [Hassallia byssoidea]
 gb|KIF29518.1| inositol monophosphatase [Hassallia byssoidea VB512170]
Length=267

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 145/231 (63%), Gaps = 9/231 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE+ ILD++R++FP+H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  38    DLVTAADKASEVVILDILRRHFPEHSILAEESGKLGNQDNEYLWAIDPLDGTTNYAHQYP  97

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    Y AA G GA  N + + V++T ++ +S
Sbjct  98    FFAVSIGLLINGVPQVGVIYD------PFHDELYRAATGLGATRNRRPIKVSETAELSKS  151

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLV+G+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  L PW
Sbjct  152   LLVSGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASLDLAHVACGRLDGYWERGLSPW  211

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIGP  374
             D  AG+++++EAGG V+  D     +    +LA+NG +HD+L   L+++ P
Sbjct  212   DITAGIILLQEAGGKVTAYDRTPLKIESGRILATNGHIHDQLSQELQQVPP  262



>ref|WP_026099087.1| inositol monophosphatase [Oscillatoria sp. PCC 10802]
Length=282

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 152/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA     V    + K  +I  KG   DLVT  DK SE AIL V+R++ P H +
Sbjct  12    FLDIATEAACAAGAVQQAYLGKLEDIQEKGRPGDLVTAADKASEEAILAVLRRHVPAHAI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD +S+YLW IDPLDGTTN+ H Y  F+ SV +L  G P    + +      
Sbjct  72    LAEESGALGDTNSEYLWAIDPLDGTTNYAHQYPFFSASVGLLIDGVPQVGAIFD------  125

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + + V+ T ++ +SLLVTG+ YDR ++   N   F   T +
Sbjct  126   PFHNELFRAARGLGATRNRRPIQVSQTAELGKSLLVTGFAYDRRETADNNYAEFCHLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D  HVA G ++ YWE  L PWD AAGV++VEEAGG V+  D     + 
Sbjct  186   TQGVRRSGSASLDLAHVACGRLDGYWERGLSPWDIAAGVVLVEEAGGRVTAYDCSPLQIG  245

Query  436   DRSVLASNGALHDKLLEKI  380
                VLA+NG LHD+L +++
Sbjct  246   SGRVLATNGHLHDRLSKEL  264



>ref|WP_009544530.1| MULTISPECIES: inositol monophosphatase [Cyanothece]
 ref|YP_001804200.1| inositol monophophatase [Cyanothece sp. ATCC 51142]
 gb|ACB52134.1| inositol monophophatase [Cyanothece sp. ATCC 51142]
Length=276

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 159/267 (60%), Gaps = 7/267 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   A  T   ++ D V++   I  KG   DLVT+ DKK+E  +L++++   P H +
Sbjct  12    FLDVATEAVMTAGTILEDLVDQLEKIEEKGRPGDLVTEADKKAEETVLNILKCRVPTHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G+  SDYLW IDPLDGTTN+ H Y + AVS+ +L++GKP    VV  V  P 
Sbjct  72    LAEESGTIGNNESDYLWAIDPLDGTTNYAHGYPASAVSIGLLWQGKP----VVGAVYNP-  126

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +S   +  A G GA  N + + V+ T+++  SLLVTG+ YDR ++  TN   F   T +
Sbjct  127   -FSRELFRGAKGLGATLNYRPIKVSQTNELSNSLLVTGFAYDRRETKDTNYPEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D   VA G ++ YWE  L PWD AAG++I+EEAGG V+  D     + 
Sbjct  186   TQGVRRGGSASLDMVSVACGRLDGYWERGLSPWDIAAGIIILEEAGGKVTAYDESPLKLE  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLK  356
                +LA+NG +H  L + +  A   LK
Sbjct  246   SGRLLATNGLIHHSLSQALTEALPWLK  272



>ref|WP_027403655.1| inositol monophosphatase [Aphanizomenon flos-aquae]
Length=267

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 154/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     V+ D + K  N I  KG   DLVT  DK SE  IL+V+R++FP H 
Sbjct  4     FLDIATEAALAAGVVLQDYLGKLENVITEKGRPGDLVTAADKASEQVILEVLRRHFPQHS  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  +++LW IDPLDGTTN+ H Y  FAVS+ +L  G P    + +     
Sbjct  64    ILAEESGKLGNQDNEFLWAIDPLDGTTNYAHQYPCFAVSIGLLIHGVPKVGVIYD-----  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLLV+G+ YDR ++   N   F   T 
Sbjct  119   -PFRDELFRAAAGLGATRNRRPIQVSQTAELGKSLLVSGFAYDRRETADNNYAEFCHLTH  177

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR GAA++D  +VA G V+ YWE  + PWD  AG+++V+EAGG V+  DG    +
Sbjct  178   LTQGVRRDGAAALDLAYVACGRVDGYWERGIAPWDVVAGIILVQEAGGNVTAYDGTPINI  237

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG +H KL +++
Sbjct  238   QSGRILATNGHIHKKLSQEL  257



>ref|WP_037215872.1| inositol monophosphatase [Richelia intracellularis]
 emb|CDN09673.1| Inositol-1-monophosphatase [Richelia intracellularis]
Length=270

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 154/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L++   AA     V+ D + K  + I  KG   DLVT  DK SE  +LD + ++FP+H 
Sbjct  7     FLDVATEAALAAGAVLQDYLGKVEDAITEKGRPGDLVTVADKASETVVLDYLHRHFPEHA  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  ++YLW IDPLDGTTNF H Y  FAVS+ +L  G P    + +     
Sbjct  67    ILAEESGKLGNQQNEYLWAIDPLDGTTNFAHQYPCFAVSIGLLINGVPQLGVIYD-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLLVTG+ YDR ++   N   F   T 
Sbjct  122   -PFHKELFRAAAGLGATLNRRSIQVSKTTELSKSLLVTGFAYDRRETTDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  HVA G V+ YWE  L PWD +AGV++V+EAGG V+  DG    +
Sbjct  181   LTQGVRRSGSASIDLAHVACGRVDGYWERGLSPWDISAGVILVQEAGGKVTAYDGSPLEL  240

Query  439   FDRSVLASNGALHDKLLEKI  380
             +   +LA+NG ++  L +++
Sbjct  241   YSGRILATNGLIYSSLSQEL  260



>ref|WP_013190313.1| inositol monophosphatase [Trichormus azollae]
 ref|YP_003720418.1| inositol monophosphatase ['Nostoc azollae' 0708]
 gb|ADI63295.1| inositol monophosphatase ['Nostoc azollae' 0708]
Length=269

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 158/260 (61%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     ++ D + K  + I  KG   DL+T  DK SE  IL++++++FP H 
Sbjct  7     FLDIATEAALATGVILQDYLGKVEDAITEKGRPGDLLTAADKASEKVILEILQRHFPQHS  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  GD +++YLW IDPLDGTTN+ H Y  FAVS++++ +G P    + +     
Sbjct  67    ILAEESGKLGDQTNEYLWAIDPLDGTTNYAHQYPCFAVSISLVIQGVPQVGVIYD-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLL TG+ YDR ++   N   F   T 
Sbjct  122   -PFHNELFRAAAGLGATRNRRTIKVSKTAELNKSLLTTGFAYDRRETTDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  +VA G ++ YWE  + PWD AAG+++V+EAGGLV+  DG    +
Sbjct  181   LTQGVRRGGSASLDLAYVACGRIDGYWERGIAPWDVAAGIVLVQEAGGLVTAYDGTAINI  240

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+N  +H++L +K+
Sbjct  241   ESGRILATNAYIHNELSQKL  260



>ref|WP_039200561.1| inositol monophosphatase [Aphanizomenon flos-aquae]
 gb|KHG42423.1| inositol monophosphatase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=267

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 154/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     V+ D + K  N I  KG   DLVT  DK SE  IL+V+R++FP H 
Sbjct  4     FLDIATEAALAAGVVLQDYLGKLENVITEKGRPGDLVTAADKASEQVILEVLRRHFPQHS  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  +++LW IDPLDGTTN+ H Y  FAVS+ +L  G P    + +     
Sbjct  64    ILAEESGKLGNQDNEFLWAIDPLDGTTNYAHQYPCFAVSIGLLIHGVPKVGVIYD-----  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLLV+G+ YDR ++   N   F   T 
Sbjct  119   -PFRDELFRAAAGLGATRNRRPIQVSQTAELGKSLLVSGFAYDRRETADNNYAEFCHLTH  177

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR GAA++D  +VA G V+ YWE  + PWD  AG+++V+EAGG V+  DG    +
Sbjct  178   LTQGVRRDGAAALDLAYVACGRVDGYWERGIAPWDVVAGIILVQEAGGNVTAYDGTPINI  237

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG +H KL +++
Sbjct  238   DSGRILATNGHIHKKLSQEL  257



>ref|WP_035149247.1| inositol monophosphatase [Calothrix sp. 336/3]
 gb|KFB81715.1| inositol monophosphatase [Calothrix sp. 336/3]
Length=271

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 146/236 (62%), Gaps = 7/236 (3%)
 Frame = -2

Query  1081  NINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDG  905
             +I  KG + DLVT  DK SE  IL+ + ++FP H +L EE G  G+  +++LW IDPLDG
Sbjct  32    DITEKGRSGDLVTIADKASEAVILEYLDRHFPHHAILSEESGKLGNQDNEFLWAIDPLDG  91

Query  904   TTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSV  725
             TTNF H Y  FAVS+ +L  G+P    + +    P       + AA G GA  N + + V
Sbjct  92    TTNFAHQYPFFAVSIGLLINGEPQVGVIYD----PS--HQELFRAAEGLGASCNRRPIHV  145

Query  724   TDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEA  545
             + T ++ +SLLVTG+ YDR ++   N   F  FT +++GVRR GAA++D  HVA G ++ 
Sbjct  146   SRTSELSKSLLVTGFAYDRRETPDNNYAEFCHFTHLTQGVRRSGAAAIDLAHVACGRIDG  205

Query  544   YWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIG  377
             YWE  + PWD  AGV+I++EAGG V+  DG+   +    +LA+NG LH  L E++G
Sbjct  206   YWERGISPWDIVAGVIILKEAGGTVTAYDGKPLEIASGRILATNGYLHKSLSEELG  261



>ref|WP_028082831.1| inositol monophosphatase [Dolichospermum circinale]
Length=267

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 153/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L++   AA +   V+ D + K  N I  KG   DLVT  DK SE  IL+V+R++FP H 
Sbjct  4     FLDMATEAALSAGVVLQDYLGKLENTITEKGRPGDLVTAADKASEQVILEVLRRHFPQHS  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+   D+LW IDPLDGTTN+ H Y  FAVS+ +L +G P    + +     
Sbjct  64    ILAEESGKLGNQDHDFLWAIDPLDGTTNYAHQYPCFAVSIGLLIQGVPKVGVIYD-----  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + A  G GA  N + + V+ T ++ +SLL +G+ YDR ++   N   F   T 
Sbjct  119   -PFRDELFRAGAGLGATRNRRPIHVSKTAELNKSLLSSGFAYDRRETADNNYPEFCHLTH  177

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR GAA++D  +VA G ++ YWE  + PWD  AG+++V+EAGG V+  DG    +
Sbjct  178   LTQGVRRGGAAALDLAYVACGRLDGYWERGIAPWDVVAGIILVQEAGGKVTAYDGTPIKI  237

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG LHD L +K+
Sbjct  238   ESGRILATNGHLHDSLSQKL  257



>ref|WP_036616256.1| inositol monophosphatase, partial [Oscillatoriales cyanobacterium 
JSC-12]
Length=269

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 151/264 (57%), Gaps = 10/264 (4%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA     V+ D  +    +  KG   DLVT+ DK +E  IL+V+ +  PDH +
Sbjct  11    FLDIATEAAYLAGAVLQDYADNLEQVQEKGRPGDLVTEADKAAEATILNVLHRYLPDHAI  70

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD SS +LW IDPLDGTTN+ H Y   AVS+ ++  G P    + +      
Sbjct  71    LAEESGQIGDRSSSFLWAIDPLDGTTNYAHRYPISAVSIGLMIEGIPQVGVIYD------  124

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N Q + V+ T ++++SLLVTG+ YDR  +   N   F   T +
Sbjct  125   PFRQELFQAASGMGAICNQQPIQVSSTSELQKSLLVTGFAYDRHQTVDNNYAEFCYLTHL  184

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+A++D  +VA G ++ YWE  L PWD  AGV+I++EAGG+V+  D   + + 
Sbjct  185   TQGVRRSGSAAMDLAYVACGRLDGYWERGLSPWDVTAGVVILQEAGGVVTAYDSSPFQLK  244

Query  436   DRSVLASNGALHDKL---LEKIGP  374
                +LA+NG +H  L   L+ + P
Sbjct  245   TGRILATNGQIHASLSRALQNVPP  268



>ref|WP_015226006.1| inositol monophosphatase [Halothece sp. PCC 7418]
 ref|YP_007168345.1| inositol monophosphatase [Halothece sp. PCC 7418]
 gb|AFZ44131.1| inositol monophosphatase [Halothece sp. PCC 7418]
Length=267

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 153/265 (58%), Gaps = 10/265 (4%)
 Frame = -2

Query  1162  SDQL---LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKN  995
             +DQL   LEI   AA     V+ D       +  KG + DLVT+ D+ SE  IL++++++
Sbjct  4     TDQLKTYLEIATEAALAAGAVLQDYWGNLSQVEEKGRSGDLVTNADRASETVILEIIQRH  63

Query  994   FPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVE  815
             FP+H +L EE G  G   ++YLW IDPLDGTTN+ H Y  +AVS+ +L  G P    V  
Sbjct  64    FPNHSILAEESGSFGKQQAEYLWAIDPLDGTTNYAHQYPIYAVSIGLLIAGVPQVGVVYN  123

Query  814   FVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELF  635
                  +      + AA G GA  N Q + V+ TD++  SLLVTG+ YDR ++   N   F
Sbjct  124   PARKEL------FRAATGWGASCNRQPIQVSKTDELAHSLLVTGFAYDRRETSDNNYAEF  177

Query  634   KEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDG  455
                T +++GVRR G+A++D   VA G V+ YWE  L PWD AAG++IV EAGG +S  DG
Sbjct  178   CHLTHLTQGVRRSGSAALDLADVASGRVDGYWERGLSPWDLAAGMVIVAEAGGKISSYDG  237

Query  454   EKYCVFDRSVLASNGALHDKLLEKI  380
                 + +  +LASN  +H  L E +
Sbjct  238   SPVSLSEGRILASNPKIHSVLSEAL  262



>ref|WP_015230984.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Dactylococcopsis salina]
 ref|YP_007173367.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Dactylococcopsis salina PCC 8305]
 gb|AFZ52010.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Dactylococcopsis salina PCC 8305]
Length=277

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/254 (41%), Positives = 151/254 (59%), Gaps = 7/254 (3%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLVL  974
             LEI   AA +   V+         +  KG + DLVT+ D+ SE  IL++++++FPDH +L
Sbjct  11    LEIATEAALSAGAVLRSYWGNLSAVEEKGRSGDLVTNADRASEAVILEIIQRHFPDHSIL  70

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EE G +G+    YLW IDPLDGTTN+ H Y  +AVS+A+L  G P    + +     + 
Sbjct  71    AEESGQSGNAEGKYLWAIDPLDGTTNYAHQYPVYAVSIALLIDGTPEVGVIYDPDRDEL-  129

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
                  + AA G GA  N + + V+ T  ++QSLLVTG+ YDR  +   N   F   T ++
Sbjct  130   -----FRAARGCGATCNRRSIQVSSTPNLDQSLLVTGFAYDRRTTRDNNYAEFCYLTHLT  184

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             +GVRR G+A++D   VA G V+ YWE  L PWD AAG+++VEEAGG +S  DG K  +  
Sbjct  185   QGVRRGGSAALDLAAVASGRVDGYWERGLSPWDMAAGMILVEEAGGKISAYDGNKVNLAT  244

Query  433   RSVLASNGALHDKL  392
               ++A+N  LH++L
Sbjct  245   GRIIATNSVLHNQL  258



>ref|WP_026734702.1| inositol monophosphatase [Fischerella sp. PCC 9605]
Length=270

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 154/265 (58%), Gaps = 11/265 (4%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     V+   + K  + I  KG   DLVT  DK SE  +L ++ ++FPDH 
Sbjct  7     FLDIATEAALAAGGVLQAYLGKVEDAITEKGRPGDLVTVADKASEEVVLQILERHFPDHA  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  +++LW IDPLDGTTNF H Y  FAVS+ +L  G P    + +     
Sbjct  67    ILAEESGKLGNQENEFLWAIDPLDGTTNFAHQYPFFAVSIGLLINGVPQVGVIYD-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA   GA  N + + V++T ++ +SLLVTG+ YDR ++   N   F   T 
Sbjct  122   -PFHDELFRAAQDLGATRNRRPMQVSETSELSKSLLVTGFAYDRRETSDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR GAASVD  HVA G ++ YWE  L PWD AAG++I+ EAGG V+  DG    +
Sbjct  181   LTQGVRRSGAASVDLAHVACGRLDGYWERGLSPWDIAAGIIILREAGGKVTAYDGTPINL  240

Query  439   FDRSVLASNGALHDKL---LEKIGP  374
                 +LA+NG +HD L   L+++ P
Sbjct  241   ESGRILATNGYIHDSLSCELQQVPP  265



>ref|WP_006635698.1| inositol monophosphatase [Microcoleus vaginatus]
 gb|EGK83906.1| Inositol-phosphate phosphatase [Microcoleus vaginatus FGP-2]
Length=312

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 146/256 (57%), Gaps = 7/256 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
               LEI   AA     V+     K   I  KG + DLVT+ DK SE  IL+++ ++ PDH 
Sbjct  49    NFLEIATEAALAAGSVLKSFCGKLEKIQEKGRSGDLVTEADKASEAVILEILGRHVPDHA  108

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  GD SS YLW IDPLDGTTN+ H Y  +AVS+ +L  G P    + +     
Sbjct  109   ILAEESGKLGDASSKYLWAIDPLDGTTNYAHQYPFWAVSIGLLIDGIPQIGVIYD-----  163

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + A  G GA  N   + V+   ++  SLLVTG+ YDR ++   N   F   T 
Sbjct  164   -PFHNELFRAGKGLGATCNRSPIEVSQISELRTSLLVTGFAYDRRETADNNYAEFCHLTH  222

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  H+A+G  + YWE  L PWD AAGV+IV EAGG ++  DG  + +
Sbjct  223   LTQGVRRSGSASLDLAHLAMGRSDGYWERGLAPWDVAAGVVIVSEAGGQITAYDGSAFEM  282

Query  439   FDRSVLASNGALHDKL  392
                 +LA+NG +H +L
Sbjct  283   NSGRILATNGRIHAEL  298



>ref|WP_008178066.1| inositol monophosphatase [Moorea producens]
 gb|EGJ35590.1| fructose-1,6-bisphosphatase family enzyme [Moorea producens 3L]
Length=274

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 134/223 (60%), Gaps = 8/223 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK++E  +LD+++ + PDH +L EE G  GD  S YLW IDPLDGTTN+ H Y 
Sbjct  45    DLVTAADKEAEAVVLDILKNDVPDHSILAEESGQLGDNESKYLWAIDPLDGTTNYAHQYP  104

Query  877   SFAVSVAILFRGKPAASTVVE-FVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQ  701
               A SV +L  GKP    V   F    +C       AAVG GA  NGQ + V+    + +
Sbjct  105   IAATSVGLLIDGKPQVGAVYNPFRDELLC-------AAVGLGATCNGQPIQVSQVSDLGK  157

Query  700   SLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRP  521
             SLLVTG+ YDR  +   N   F   T +++GVRR G+AS+D C VA G ++ YWE  L P
Sbjct  158   SLLVTGFAYDRRQTSDNNYAEFCYLTHLTQGVRRSGSASIDLCDVASGRLDGYWERGLSP  217

Query  520   WDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             WD AAG++I+EEAGG V+  DG    +    +LA+N  +HD L
Sbjct  218   WDVAAGIVILEEAGGKVTAYDGSPIDINSGRILATNAKIHDSL  260



>ref|WP_015212626.1| Inositol-phosphate phosphatase [Anabaena cylindrica]
 ref|YP_007154881.1| Inositol-phosphate phosphatase [Anabaena cylindrica PCC 7122]
 gb|AFZ55971.1| Inositol-phosphate phosphatase [Anabaena cylindrica PCC 7122]
Length=276

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 156/264 (59%), Gaps = 8/264 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     ++ D + K  + I  KG   DLVT  DK SE  IL+++R++FP H 
Sbjct  14    FLDIATEAALAAGVILQDFLGKVEDAITEKGRPGDLVTAADKASEKVILEILRRHFPQHS  73

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  ++YLW IDPLDGTTN+ H Y  FAVS+ +   G P    + +     
Sbjct  74    ILAEESGKLGNQDNEYLWAIDPLDGTTNYAHQYPCFAVSIGLFINGVPQIGVIYD-----  128

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLL TG+ YDR ++   N   F   T 
Sbjct  129   -PFRDELFRAAAGLGATRNRRPIKVSQTAELNKSLLTTGFAYDRRETADNNYAEFCHLTH  187

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D  +VA G V+AYWE  + PWD AAGV++++EAGG V+  DG  + +
Sbjct  188   LTQGVRRGGSAALDLAYVACGRVDAYWERGIAPWDVAAGVILLQEAGGKVTAYDGTTFKI  247

Query  439   FDRSVLASNGALHDKLLEKIGPAT  368
                 +LA+NG +H+ L +++   T
Sbjct  248   ESGRILATNGYIHNSLSQELMQVT  271



>emb|CDR34580.1| Inositol-1-monophosphatase [Criblamydia sequanensis CRIB-18]
Length=273

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 158/265 (60%), Gaps = 7/265 (3%)
 Frame = -2

Query  1171  SIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKN  995
             +I  ++ L I + A+  G +++++   K  N+  K    DLVT+ D  SE AI  +++K+
Sbjct  2     NINLEKALAIAEKASMEGGKILLNHFGKLENVREKSIQGDLVTEADNASEYAITTIIKKH  61

Query  994   FPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVE  815
             FP H ++GEEGG      +DYLW IDPLDGTTN+TH    FA+S+ +L++ +P    VV 
Sbjct  62    FPSHPIIGEEGGLIPSKDTDYLWAIDPLDGTTNYTHQMPVFAISIGLLYKMEP----VVG  117

Query  814   FVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELF  635
              V  P+  +   + A   KGAY N ++L VT T+ + +SLL TG+ YDR D+   N   F
Sbjct  118   LVYNPI--TNELFKAIKEKGAYLNDRQLFVTKTETLSKSLLATGFAYDRRDTKDNNYLEF  175

Query  634   KEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDG  455
                T ++ GVRR G+A++D   VA G  + +WE  L+ WD AAG L+V+EA G +S  + 
Sbjct  176   CYLTSITHGVRRGGSAALDLAFVAAGRYDGFWERGLKIWDIAAGALLVKEAFGSLSSYEN  235

Query  454   EKYCVFDRSVLASNGALHDKLLEKI  380
                 +    +LA+NG LH++L E +
Sbjct  236   GPIDLETGRILATNGLLHNELSETL  260



>gb|EKQ69058.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Oscillatoriales cyanobacterium JSC-12]
Length=282

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 151/264 (57%), Gaps = 10/264 (4%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA     V+ D  +    +  KG   DLVT+ DK +E  IL+V+ +  PDH +
Sbjct  11    FLDIATEAAYLAGAVLQDYADNLEQVQEKGRPGDLVTEADKAAEATILNVLHRYLPDHAI  70

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD SS +LW IDPLDGTTN+ H Y   AVS+ ++  G P    + +      
Sbjct  71    LAEESGQIGDRSSSFLWAIDPLDGTTNYAHRYPISAVSIGLMIEGIPQVGVIYD------  124

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N Q + V+ T ++++SLLVTG+ YDR  +   N   F   T +
Sbjct  125   PFRQELFQAASGMGAICNQQPIQVSSTSELQKSLLVTGFAYDRHQTVDNNYAEFCYLTHL  184

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+A++D  +VA G ++ YWE  L PWD  AGV+I++EAGG+V+  D   + + 
Sbjct  185   TQGVRRSGSAAMDLAYVACGRLDGYWERGLSPWDVTAGVVILQEAGGVVTAYDSSPFQLK  244

Query  436   DRSVLASNGALHDKL---LEKIGP  374
                +LA+NG +H  L   L+ + P
Sbjct  245   TGRILATNGQIHASLSRALQNVPP  268



>ref|WP_036483658.1| inositol monophosphatase [Myxosarcina sp. GI1]
Length=274

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/259 (41%), Positives = 152/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA  G  V+     K  +I  KG + DLVT+ DK+SE  IL V+ ++ P+H +
Sbjct  12    FLDIATEAALAGGTVLKSLRGKLEDIQEKGRSGDLVTEADKQSEAEILKVLHRHLPEHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G+  S+YLW IDPLDGTTN+ HS    + SV +L  G P+   +   + G +
Sbjct  72    LAEESGALGNSDSEYLWAIDPLDGTTNYAHSLPIASTSVGLLIDGVPSVGVIYNPLSGEL  131

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
                   + AA G  A  + + + V+ T ++  SLLVTG+ YDR ++   N   F   T +
Sbjct  132   ------FRAAKGLPATCDRRPIKVSQTSELANSLLVTGFAYDRRETSDNNYAEFCHLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRRLG+A++D   +A G  + YWE  L PWD AAGV+IVE AGG ++  DG  + + 
Sbjct  186   TQGVRRLGSAALDLAWLACGRYDGYWERGLSPWDIAAGVVIVEAAGGTITAYDGSPFELN  245

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NGALHD L + +
Sbjct  246   SGRILATNGALHDNLSQAL  264



>ref|WP_010997068.1| inositol monophosphatase [Nostoc sp. PCC 7120]
 ref|NP_486957.1| inositol monophosphatase [Nostoc sp. PCC 7120]
 dbj|BAB74616.1| inositol monophophatase family [Nostoc sp. PCC 7120]
Length=270

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 137/222 (62%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  +L+++R++FP H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  41    DLVTAADKASEAVVLEIIRRHFPQHSILAEESGKLGNQDNEYLWAIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             +F VS+ +L  G P    + +       +    +  A G GA  N + + V+DT ++ +S
Sbjct  101   AFCVSIGLLINGVPQVGVIYD------PFHDELFRGAAGLGATRNRRPIKVSDTSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D  HVA G V+ YWE  + PW
Sbjct  155   LLVTGFAYDRRETPDNNYAEFCHLTHLTQGVRRSGSAALDLAHVACGRVDGYWERGISPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D  AGV+++EEAGG V+  D     +    +LA+NG++HD L
Sbjct  215   DVVAGVILLEEAGGKVTAYDSTPLKIATGRILATNGSIHDNL  256



>ref|WP_006454598.1| inositol monophosphatase [Synechococcus sp. PCC 7335]
 gb|EDX84852.1| Inositol monophosphatase family [Synechococcus sp. PCC 7335]
Length=274

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 151/260 (58%), Gaps = 7/260 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
             + L+I   AA  G  V+        NI  KG   DLVT+ DK +E  +L V+R++ PDH 
Sbjct  10    RFLDIATEAASAGGAVLQYYWGNLSNIQQKGRPGDLVTEADKAAEKEVLAVLRRHVPDHA  69

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+ + + LW +DPLDGTTN+TH Y     SV +L  G+PA   ++  V   
Sbjct  70    ILAEESGSMGEQTDELLWAVDPLDGTTNYTHQYPFCGCSVGLLINGQPAVGAILNPV---  126

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
                  + + AA G GA  N + + V+ T+ + +SLLVTG+ YDR ++   N   F   T 
Sbjct  127   ---DNQLFRAAKGLGATCNREPIRVSKTETLAESLLVTGFAYDRRETIDNNYAEFCHLTH  183

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  +VA G ++ YWE  L PWD AAGV++VEEAGG V+  D   + +
Sbjct  184   LTQGVRRGGSASIDLAYVACGRLDGYWERGLSPWDVAAGVILVEEAGGTVTAYDKSPFDI  243

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+N  +H  L + +
Sbjct  244   KSGRILATNSQIHTALSDTL  263



>ref|WP_019500429.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=276

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 155/267 (58%), Gaps = 9/267 (3%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L+I   AA  G  ++     K ++I  K   DLVT  DK+SE A++ +++++FP H +L 
Sbjct  13    LDIATEAACAGGAILKSYWGKLKDIQEKQPGDLVTIADKESEAAVMKIIQRHFPSHNILA  72

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G  G   S++LW IDPLDGTTNF H Y   AVSV ++  G PA   + +       +
Sbjct  73    EESGAFGTAESEFLWAIDPLDGTTNFAHQYPFSAVSVGLMLNGIPAVGVIYD------PF  126

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 + AA G GA  + Q + V++T ++ +SLLVTG+ YDR  +   N   F  FT +++
Sbjct  127   HDELFRAATGLGATCDHQPIRVSNTTELSRSLLVTGFAYDRTRTHDNNYAEFCHFTHLTQ  186

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRR G+A++D  +VA G V+ +WE  L  WD AAG++IV EAGG V+  DG    +   
Sbjct  187   GVRRSGSAALDLAYVACGRVDGFWERGLSIWDMAAGIVIVREAGGKVTAYDGSDLDLKSG  246

Query  430   SVLASNGALHDKL---LEKIGPATEKL  359
              +L++NG +HD     L K+ P T + 
Sbjct  247   RLLSTNGHIHDSAIAELAKVKPLTAQF  273



>ref|WP_015206213.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Cylindrospermum stagnale]
 ref|YP_007145636.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Cylindrospermum stagnale PCC 7417]
 gb|AFZ22956.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Cylindrospermum stagnale PCC 7417]
Length=270

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 153/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     V+ D   K  + I  KG   DLVT  DK SE  IL+V+R++ P+H 
Sbjct  7     FLDIATEAALAAGVVLQDYFGKLEDAITEKGRPGDLVTVADKASEKVILEVLRRHVPEHS  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  ++YLW IDPLDGTTN+ H Y  FAVS+ +L  G P    + +     
Sbjct  67    ILAEESGKLGNQDNEYLWAIDPLDGTTNYAHQYPCFAVSIGLLINGVPQVGVIYD-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLL TG+ YDR ++   N   F   T 
Sbjct  122   -PFHDELFRAAAGLGATRNRRPIRVSKTSELSKSLLTTGFAYDRRETSDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  +VA G V+AYWE  L PWD AAGV++++EAGG VS  +   + +
Sbjct  181   LTQGVRRGGSASLDLAYVACGRVDAYWERGLAPWDIAAGVILLQEAGGKVSAYERTPFKI  240

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG LHD L + +
Sbjct  241   ESGRILATNGHLHDSLSQAL  260



>ref|WP_015079254.1| inositol monophosphatase [Anabaena sp. 90]
 ref|YP_006995904.1| inositol monophosphatase [Anabaena sp. 90]
 gb|AFW94091.1| inositol monophosphatase [Anabaena sp. 90]
Length=267

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 155/260 (60%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     V+ D + K  + I  KG   DLVT  DK SE  IL+V+R++FP H 
Sbjct  4     FLDIATEAALAAGVVLQDYLGKLEDAITEKGRPGDLVTAADKASEQVILEVLRRHFPQHS  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  +++LW IDPLDGTTN+ H Y  FAVS+ ++ +G P    + +     
Sbjct  64    ILAEESGKLGNQDNEFLWAIDPLDGTTNYAHQYPCFAVSIGLMIQGVPKVGVIYD-----  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+ T ++ +SLLV+G+ YDR ++   N   F   T 
Sbjct  119   -PFRDELFRAAAGLGATRNRRPIQVSQTAELGKSLLVSGFAYDRRETPDNNYAEFCHLTH  177

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR GAA++D  +VA G V+ YWE  + PWD  AG+++V+EAGG V+  DG    +
Sbjct  178   LTQGVRRDGAAALDLAYVACGRVDGYWERGIAPWDVVAGIILVQEAGGNVTAYDGTPIKI  237

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG LHD L +++
Sbjct  238   ESGRILATNGYLHDSLSQEL  257



>ref|WP_022608882.1| fructose-1,6-bisphosphatase [Rubidibacter lacunae]
 gb|ERN40329.1| fructose-1,6-bisphosphatase [Rubidibacter lacunae KORDI 51-2]
Length=278

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 154/263 (59%), Gaps = 6/263 (2%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L+I   AA T   ++ +   K  +I  K   DLVTD DK SE AIL+V++++ PDH +L 
Sbjct  14    LDIATEAASTAGAILREHFGKLASIEDKRPGDLVTDADKASEAAILEVLQRHLPDHAILA  73

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G  G+  S+Y W IDPLDGTTN+ H     +VS+A+L    P     V  V  P  +
Sbjct  74    EESGRLGNLDSNYCWAIDPLDGTTNYAHQLPIASVSIALLVDDVP----CVGVVYNP--F  127

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 + AA G GA  N Q +SVT T  +++SLLVTG+ YDR ++   N   F   T ++R
Sbjct  128   RNELFRAATGLGATRNRQPMSVTTTASLDRSLLVTGFAYDRRETSDNNYAEFCYLTHLTR  187

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRRLG+A++D   VA G ++ YWE  L  WD AAGV++V EAGG V+  DG    +   
Sbjct  188   GVRRLGSAALDLADVACGRLDGYWERGLSLWDIAAGVVLVREAGGCVTAYDGSPVDLASG  247

Query  430   SVLASNGALHDKLLEKIGPATEK  362
              ++A+NG LH +L   +  A ++
Sbjct  248   RLMATNGVLHVELGNALARAPQE  270



>ref|WP_011317835.1| inositol monophosphatase [Anabaena variabilis]
 ref|YP_321502.1| inositol monophosphatase [Anabaena variabilis ATCC 29413]
 gb|ABA20607.1| Inositol monophosphatase [Anabaena variabilis ATCC 29413]
Length=270

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 138/222 (62%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  +L+++R++FP H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  41    DLVTAADKASEAVVLEIIRRHFPQHSILAEESGKLGNQDNEYLWAIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             +F VS+ +L  G P    + +       +    +  A G GA  + + + V+DT ++ +S
Sbjct  101   AFCVSIGLLINGVPQVGVIYD------PFHDELFRGAAGLGATRDRRPIKVSDTSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D  HVA G V+ YWE  + PW
Sbjct  155   LLVTGFAYDRRETPDNNYAEFCHLTHLTQGVRRSGSAALDLAHVACGRVDGYWERGISPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D  AGV++++EAGG V+  DG    +    +LA+NG++HD L
Sbjct  215   DIVAGVILLQEAGGKVTAYDGTPLKIATGRILATNGSIHDNL  256



>ref|WP_029101839.1| hypothetical protein [Candidatus Latescibacter anaerobius]
Length=257

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 155/251 (62%), Gaps = 8/251 (3%)
 Frame = -2

Query  1132  AAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFT  953
             AA+T   ++     + + I+YKG  DLVT+ D +SE AILD++++  PDH ++ EE    
Sbjct  8     AARTAGAILKKHFGEQKEISYKGRIDLVTNADFESEKAILDIIKERHPDHDIITEESNPE  67

Query  952   GDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYT  773
                S+ Y W IDPLDGT N+ H +   AVS+A+   G    +  +  V  P+      + 
Sbjct  68    MSGSA-YRWVIDPLDGTVNYAHDFPFMAVSIALEING----TIEIGVVNNPIM--NEFFH  120

Query  772   AAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLG  593
             A  G+GA+ N   +SV++T  +E+S L TG+ YD  +S + N+  F  F   ++ VRR+G
Sbjct  121   ACRGEGAFYNDIPISVSETGILEKSFLATGFPYDIKES-SLNLAHFSHFIRHAQAVRRVG  179

Query  592   AASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASN  413
             +A++D C+ A+G  + YWE  + PWD AAG+LIV EAGG+VS+ DG    ++D  ++ASN
Sbjct  180   SAALDMCYCAMGRFDGYWELTILPWDIAAGILIVTEAGGIVSKLDGGPLSIYDNEIVASN  239

Query  412   GALHDKLLEKI  380
             G +H++L+E+I
Sbjct  240   GRIHEQLVEEI  250



>ref|WP_017286126.1| hypothetical protein [Leptolyngbya boryana]
Length=267

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 153/264 (58%), Gaps = 10/264 (4%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA +   ++       + I  KG   DLVT+ DK +E A+L V++++ PDH +
Sbjct  9     FLDIATEAALSAGAILQQYWGNLQEIREKGRPGDLVTEADKAAEDAVLAVLKRHVPDHPI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  S++LW IDPLDGTTN+ H Y   AVSV +L  G P    V   +    
Sbjct  69    LAEESGQMGDRQSEFLWAIDPLDGTTNYAHQYPFVAVSVGLLIEGVPQVGVVYNPI----  124

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
                   + AA G GA  N + + V+ T ++++SLLVTG+ YDR  +  TN   F   T +
Sbjct  125   --HQELFRAAKGLGATQNRKPIQVSQTQELDRSLLVTGFAYDRRQTSDTNYAEFCHLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAA++D  +VA G ++ YWE  L  WD AAGV++VEEAGGLV+  D     + 
Sbjct  183   TQGVRRDGAAALDLAYVACGRLDGYWERGLSMWDMAAGVVLVEEAGGLVTAYDQSPVQLE  242

Query  436   DRSVLASNGALHDKL---LEKIGP  374
                +LA+NG +H +L   L ++ P
Sbjct  243   TGRILATNGKIHQQLSHELSQVKP  266



>ref|WP_035999471.1| inositol monophosphatase [Leptolyngbya sp. JSC-1]
Length=278

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/261 (41%), Positives = 151/261 (58%), Gaps = 8/261 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
              + L+I   AA  G  V+     K   +      DL+T+ D+ +E AIL V+R++FP+H 
Sbjct  9     QRFLDIATEAALAGGGVLQAYAGKVEAVEKGRPGDLLTEADQAAEAAILAVIRRHFPEHG  68

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTV-VEFVGG  803
             VL EE G  G  +S+++W IDPLDGTTN+ H Y  +A SV +L  G P    V V F+  
Sbjct  69    VLAEESGRMGATASEFVWAIDPLDGTTNYAHQYPFYATSVGLLVHGVPCVGVVFVPFL--  126

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                     + AA G GA  N Q + V+ T  + QSLLVTG+ YDR ++   N   F   T
Sbjct  127   -----QELFRAAHGLGATRNRQPIRVSQTAALAQSLLVTGFAYDRRETPDNNYAEFCHLT  181

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR GAA+VD  +VA G ++ YWE  L  WD AAGV+IVEEAGG V+  D  ++ 
Sbjct  182   HLTQGVRRGGAAAVDLAYVACGRLDGYWERGLSAWDMAAGVVIVEEAGGRVTAYDQGEFE  241

Query  442   VFDRSVLASNGALHDKLLEKI  380
             +    +LA+NG +H  L  ++
Sbjct  242   IGSGRILATNGLIHSALSREL  262



>ref|WP_028672900.1| hypothetical protein [Marinimicrobia bacterium SCGC AAA298-D23]
Length=254

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 157/262 (60%), Gaps = 9/262 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKG-FTDLVTDTDKKSELAILDVVRKNFPDHLV  977
             +L+I    +   AE++  +  K ++   KG  ++LVT TD + +  I   ++++FP+H V
Sbjct  1     MLDIALEISDQAAELIRLSSQKIKSFKSKGEVSNLVTQTDIEVDKLIAGKIKESFPEHNV  60

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             + EE G + + SS+Y W IDP+DGT NF H+Y SFAVS+ +  R KP    V +    P 
Sbjct  61    VSEELG-SKNLSSEYTWYIDPIDGTNNFVHNYPSFAVSIGVYLRSKPIVGVVYDI---P-  115

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
               +   + A    G+++N  K+SV++ D+  + L VTG+    ++    N+++ K     
Sbjct  116   --NNEKFFALKDGGSFSNDSKISVSNKDRFSEGLYVTGFIPYDENYIEKNLQVIKNINLN  173

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             S GVRRLGAAS+D CHVA GIVE +WEY L+PWD AAG +IV EAGG VS  +G +Y  F
Sbjct  174   SHGVRRLGAASLDMCHVAKGIVEGFWEYNLQPWDTAAGNIIVTEAGGTVSNENGSQYN-F  232

Query  436   DRSVLASNGALHDKLLEKIGPA  371
             D+ ++ SN  +H   L+ I  +
Sbjct  233   DKCIVVSNNKVHKDFLKIINES  254



>ref|WP_006277150.1| inositol monophosphatase [Cylindrospermopsis raciborskii]
 gb|EFA69963.1| Inositol monophosphatase [Cylindrospermopsis raciborskii CS-505]
Length=267

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 154/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     ++ D + K  + I  KG   DLVT  D+ +E AIL V+ ++FP+H 
Sbjct  9     FLDIATEAALAAGVILQDYLGKVEDAITEKGRPGDLVTAADQTAEKAILAVINRHFPEHS  68

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+ +S YLW IDPLDGTTN+TH Y  F  S+ +L  G+P    + + + G 
Sbjct  69    ILAEESGKVGNQTSQYLWVIDPLDGTTNYTHQYPCFCTSIGLLVEGEPKVGVIYDPLRGE  128

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      + AA G GA  N + + V+ T ++ +SLL TG+ YDR ++  TN   F  FT 
Sbjct  129   L------FQAAAGLGATRNRRPIRVSSTTQLSKSLLTTGFAYDRRETSDTNYPEFCHFTH  182

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D  +++ G V+ YWE  L PWD  AG+++V EAGG V+  +G    +
Sbjct  183   LTQGVRRGGSAALDLAYISCGRVDGYWERGLAPWDMVAGIILVREAGGKVTAYNGSDLQI  242

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+N  LH  + E++
Sbjct  243   DSGRILATNSYLHQVISEEL  262



>ref|WP_012407906.1| inositol monophosphatase [Nostoc punctiforme]
 ref|YP_001864828.1| inositol monophosphatase [Nostoc punctiforme PCC 73102]
 gb|ACC79885.1| inositol monophosphatase [Nostoc punctiforme PCC 73102]
Length=270

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 139/222 (63%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL+++ ++FP H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  41    DLVTAADKASEELILEILHRHFPQHSILAEESGKLGNQENEYLWAIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    ++AA G GA  N + ++V+ T ++ +S
Sbjct  101   FFAVSIGLLINGVPEVGVIYD------PFHNELFSAATGLGATRNRRPINVSATSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  +VA G V+ YWE  L PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFSHLTHLTQGVRRSGSASLDLAYVACGRVDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D AAG+++++EAGG V+  +G    +    +LA+NG +HD L
Sbjct  215   DIAAGIILLQEAGGKVTAYNGTPVKIESGRILATNGYIHDSL  256



>ref|WP_027714936.1| histidinol phosphate phosphatase [Desulfuromonas sp. TF]
Length=257

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 152/254 (60%), Gaps = 7/254 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVL  974
             + +I  +AA+ G  V+M    +   +++KG  DLVT+ D+ +E AI+ ++   FP H +L
Sbjct  1     MRDIAVSAAREGGRVLMQKFGRTLKVHHKGEVDLVTEADRAAEDAIVSMIHHTFPRHDIL  60

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EEG ++    SDYLW IDPLDGTTN+ H +  FAVS+A+   G+     ++  V  P  
Sbjct  61    AEEGEYSSH-GSDYLWIIDPLDGTTNYAHGFPWFAVSIALAVAGE----IILGVVYNP--  113

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
             +    + A  GKGA+ N  +L V+ T +++ +LL TG+ YDR  S A N + F  F   +
Sbjct  114   FHREFFIAEKGKGAFLNDVELRVSTTARLDHALLATGFPYDRKTSPANNYDHFVNFQQAA  173

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             R  RR G+AS+D  + A G ++ +WE +L+PWD AAGVL+V+EAGG V+        +  
Sbjct  174   RACRRTGSASLDLAYTAAGRLDGFWEMKLKPWDMAAGVLMVQEAGGRVTDFVQAPLQLHG  233

Query  433   RSVLASNGALHDKL  392
             +  LASNG +HD +
Sbjct  234   QECLASNGIIHDDM  247



>ref|WP_015192679.1| Inositol-phosphate phosphatase [Stanieria cyanosphaera]
 ref|YP_007131973.1| Inositol-phosphate phosphatase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ35007.1| Inositol-phosphate phosphatase [Stanieria cyanosphaera PCC 7437]
Length=276

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 154/269 (57%), Gaps = 8/269 (3%)
 Frame = -2

Query  1180  STGSIPSDQL-LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDV  1007
             S  SI   Q+ L+I   A  T   V+ +  NK   I  KG   DLVT+ DK++E AI+ V
Sbjct  2     SQNSIQQLQIFLDIATEAVMTAGVVLQNNWNKLEEIEEKGKPGDLVTEADKQAEKAIIQV  61

Query  1006  VRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAAS  827
             + ++ P+H +L EE G  G   S+YLW IDPLDGTTN+ H Y   AVSV ++  G P   
Sbjct  62    LNRHVPEHSILAEESGKLGAIESEYLWAIDPLDGTTNYAHGYPVSAVSVGLMIDGVPQVG  121

Query  826   TVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATN  647
              V         +    + AA G GA  N + + V+ T ++ +SLLVTG+ YDR ++   N
Sbjct  122   AVYN------PFRNELFRAAKGLGASCNRRPIQVSQTQELSKSLLVTGFAYDRRETTDNN  175

Query  646   MELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVS  467
                F   T +++GVRR G+AS+D   VA G ++ YWE  L PWD  AG++IVEEAGG V+
Sbjct  176   YAEFCYLTHLTQGVRRSGSASLDLTDVACGRLDGYWERGLSPWDITAGIVIVEEAGGKVT  235

Query  466   RTDGEKYCVFDRSVLASNGALHDKLLEKI  380
               DG +  +    +LA+NG +H  L + +
Sbjct  236   AYDGSEIQLNSGRILATNGHIHQSLSQAL  264



>ref|WP_012593906.1| MULTISPECIES: inositol monophosphatase [Cyanothece]
 ref|YP_002370785.1| inositol-phosphate phosphatase [Cyanothece sp. PCC 8801]
 ref|YP_003136338.1| inositol monophosphatase [Cyanothece sp. PCC 8802]
 gb|ACK64629.1| Inositol-phosphate phosphatase [Cyanothece sp. PCC 8801]
 gb|ACU99502.1| inositol monophosphatase [Cyanothece sp. PCC 8802]
Length=277

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/268 (40%), Positives = 150/268 (56%), Gaps = 7/268 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   A  T   ++ +   +   I  KG   DLVT+ DKK+E A+L ++R+  P H +
Sbjct  12    FLDIATEAVMTAGVILQNLWGQLEKIQEKGRPGDLVTEADKKAETAVLTILRRRVPHHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G   S++LW IDPLDGTTN+ H Y   +VSV +L  G P    +        
Sbjct  72    LAEESGLFGLAESNFLWAIDPLDGTTNYAHGYPICSVSVGLLIEGVPQVGAIYN------  125

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    +  A G GA  N + + V+ T ++ +SLLVTG+ YDR ++  TN   F   T +
Sbjct  126   PFRQELFRGARGLGATLNYRPIRVSQTTELSKSLLVTGFAYDRRETKDTNYPEFCYLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D   VA G ++ YWE  L PWD AAG++I+EEAGG +S  D     + 
Sbjct  186   TQGVRRAGAASLDLADVACGRLDGYWERGLSPWDMAAGIVILEEAGGKISAYDESPLILE  245

Query  436   DRSVLASNGALHDKLLEKIGPATEKLKN  353
                +LA+NG +H  L E +  A   LKN
Sbjct  246   SGRLLATNGQIHSSLSEALKDAVPWLKN  273



>ref|WP_011418156.1| histidinol-phosphate phosphatase [Syntrophus aciditrophicus]
 ref|YP_462304.1| myo-inositol-1(or 4)-monophosphatase [Syntrophus aciditrophicus 
SB]
 gb|ABC78136.1| myo-inositol-1(or 4)-monophosphatase [Syntrophus aciditrophicus 
SB]
Length=276

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 147/256 (57%), Gaps = 7/256 (3%)
 Frame = -2

Query  1147  EIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGE  968
             E   + AK   +++   +N P  INYKG  +LVT+ D+ SE  IL+ ++K FPDH  L E
Sbjct  24    EFAVSTAKEAGQLLKSRLNTPHTINYKGVINLVTEADRMSETLILERLQKRFPDHSFLTE  83

Query  967   EGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWS  788
             E    GD   +  W IDPLDGTTN+ H Y  F VS+A+  R +     V   V  PM   
Sbjct  84    ESP-AGDKDPECRWIIDPLDGTTNYAHGYPVFCVSIALERRKR----IVTGVVYNPMM--  136

Query  787   TRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRG  608
                + A  G+GA+ NGQ++SV+    + +SLL TG+ YD  +S   N+  F      ++ 
Sbjct  137   DELFFAEEGQGAWLNGQRISVSHISDLSRSLLATGFPYDIRESEFNNLNYFNSLAKQAQA  196

Query  607   VRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRS  428
             VRR G+A++D  +VA G  + +WE +L PWD AA  L++ EAGG+VS   G ++      
Sbjct  197   VRRAGSAALDMAYVAAGRFDGFWELKLMPWDTAAASLLIMEAGGIVSDLSGLEFSPGSPH  256

Query  427   VLASNGALHDKLLEKI  380
             VLASNG +H +L++ +
Sbjct  257   VLASNGKIHRQLIDAL  272



>ref|WP_026100308.1| inositol monophosphatase [Microchaete sp. PCC 7126]
Length=270

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 135/222 (61%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL+++ ++FP H +L EE G  G+  ++YLW IDPLDGTTN+ H Y 
Sbjct  41    DLVTAADKASEAVILEILHRHFPQHSILAEESGKIGNQENEYLWAIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVS+ +L  G P    + +            + AA   GA  N + + V+D  ++ +S
Sbjct  101   SFAVSIGLLIHGVPEVGVIYD------PSREELFRAATNLGATRNRRPIKVSDVSELNKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D  +VA G V+ YWE  L PW
Sbjct  155   LLVTGFAYDRRETPDNNYAEFSHLTHLTQGVRRSGSAAMDLAYVACGRVDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D  AG+++++EAGG VS  DG    +    +LA+NG +HD L
Sbjct  215   DITAGIILLQEAGGKVSAYDGTPVKIESGRLLATNGYIHDNL  256



>ref|WP_029949366.1| hypothetical protein [Cloacimonetes bacterium JGI OTU-2]
Length=257

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 149/254 (59%), Gaps = 6/254 (2%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L+I   A     +++ +  +K + I+YKG  +LVT+ D+++E  +++ +R  +P H +L 
Sbjct  5     LDIALEACTKAGDIIRENFHKKKLIDYKGRINLVTNVDREAEKVVVETIRNYYPKHNILT  64

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE     +P  +Y W IDPLDGTTN+ H +    VS+A+    +    ++V  V  P+  
Sbjct  65    EETEHAQNPGQEYCWVIDPLDGTTNYVHGFPFVCVSIAL----QKNNESIVGVVYNPIL-  119

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 + A  G+    N +++ V+D     ++LL TG+ YD  +    N++   +     R
Sbjct  120   -HELFFAEKGRCCVRNDEEVHVSDNSDFPKALLATGFPYDMLNDERNNIKNLSKVIKKCR  178

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             G+RR GAA++D C+VA GI + YWE  L PWD AAG+ I+EEAGG VS+ DG ++ +FD+
Sbjct  179   GIRRPGAAAIDICYVACGIFDGYWELELYPWDTAAGIAILEEAGGKVSKFDGSEFSIFDK  238

Query  430   SVLASNGALHDKLL  389
              + ASNG +H++ L
Sbjct  239   EIAASNGHIHEEFL  252



>ref|WP_009628658.1| Inositol-phosphate phosphatase [Pseudanabaena biceps]
 gb|ELS31257.1| Inositol-phosphate phosphatase [Pseudanabaena biceps PCC 7429]
Length=282

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 160/272 (59%), Gaps = 10/272 (4%)
 Frame = -2

Query  1183  DSTGSIPSDQL---LEIVQAAAKTGAEVVMDAV-NKPRNINYKGFTDLVTDTDKKSELAI  1016
             +S  S+  +QL   L+I   AA  G  ++     N   NI  K   DLVT  DK+SE  +
Sbjct  3     NSLASVSQEQLQTFLDIATEAACAGGAILKSYWGNLQENIEEKRPGDLVTIADKESEAMV  62

Query  1015  LDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKP  836
             L +++++FPDH +L EE G  G+  S YLW IDPLDGTTN+ H Y   +VS+A+L  G P
Sbjct  63    LSILQRHFPDHGILAEESGVLGNTESIYLWAIDPLDGTTNYAHQYPFSSVSIALLVDGIP  122

Query  835   AASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSW  656
             +   + +       +    + AA G GA  N   + V+ T ++ +SLLVTG+ YDR    
Sbjct  123   SVGAIYD------PFRDEIFRAATGLGATRNRLPIHVSKTVELSRSLLVTGFAYDRTLVE  176

Query  655   ATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGG  476
               N   F  FT +++GVRR G+A++D  +VA G ++ YWE  L  WD AAGV+IV EAGG
Sbjct  177   DNNYAEFCHFTHLTQGVRRGGSAAMDLAYVACGRLDGYWERGLSLWDLAAGVVIVREAGG  236

Query  475   LVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             +V+  DG ++      +LA+NG LH++++ ++
Sbjct  237   IVTAYDGSEHLPKSGRLLATNGHLHEQMIAEL  268



>ref|WP_019504277.1| inositol monophosphatase [Pleurocapsa sp. PCC 7319]
Length=275

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 148/259 (57%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L++   +      V+ +   K  NI  KG   DLVT+ DK +E  +L V+ ++ PDH +
Sbjct  12    FLDVATESVLAAGAVLKERWGKLNNIQEKGRPGDLVTEADKLAEAEVLKVLNRHLPDHQI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G+  S+YLW IDPLDGTTN+ H +   A SV +L  G P    V        
Sbjct  72    LAEESGALGNSKSEYLWAIDPLDGTTNYAHGFPVAATSVGLLIDGIPTVGAVYN------  125

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +S   + AA G GA  N + + V+ T ++ +SLL+TG+ YDR ++   N   F   T +
Sbjct  126   PFSNELFRAAKGLGATCNRRPIQVSRTAELSKSLLITGFAYDRRETTDNNYAEFCHLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRRLG AS+D   VA G ++ YWE  L+PWD  AG++I+EEAGG V+  DG    + 
Sbjct  186   TQGVRRLGCASMDLAGVACGRLDGYWERGLQPWDITAGIVILEEAGGKVTAYDGSPLDIN  245

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG +HD L + +
Sbjct  246   SGRILATNGLIHDSLSQAL  264



>ref|WP_012629273.1| inositol monophosphatase [Cyanothece sp. PCC 7425]
 ref|YP_002484580.1| inositol-phosphate phosphatase [Cyanothece sp. PCC 7425]
 gb|ACL46219.1| Inositol-phosphate phosphatase [Cyanothece sp. PCC 7425]
Length=279

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/259 (41%), Positives = 153/259 (59%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
             LL+I   AA  G  ++     K  +I  KG T DL+T+ D+ +E A+L V++++ PDH +
Sbjct  9     LLDIATEAALAGGAILQTYWGKLESIQEKGRTGDLLTEADQLAEAAVLKVIQRHCPDHQI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD SS YLW IDPLDGTTN+ H Y   + SV +L  G P    + +      
Sbjct  69    LAEESGQLGDLSSPYLWAIDPLDGTTNYAHQYPFSSTSVGLLHYGVPQVGAIFD------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N Q + V+ T  + +SLLVTG+ YDR ++   N   F + T +
Sbjct  123   PFHNDLFRAAKGLGATRNRQPIRVSATPTLAKSLLVTGFAYDRRETIDNNYAEFCQLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G AS++  +VA G ++ +WE  L PWD AAGV+IVEEAGG V+  D   + + 
Sbjct  183   TQGVRRGGCASIELAYVACGRLDGFWERGLCPWDMAAGVVIVEEAGGRVTAYDQSAFDLN  242

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG +H +L + +
Sbjct  243   SGRILATNGLIHAELSQAL  261



>ref|WP_029637532.1| inositol monophosphatase [[Scytonema hofmanni] UTEX B 1581]
Length=270

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 143/231 (62%), Gaps = 9/231 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK +E+ ILD++R++FP+H +L EE G  G+  +++LW IDPLDGTTN+ H Y 
Sbjct  41    DLVTAADKAAEVVILDILRRHFPEHSILAEESGKLGNQDNEFLWAIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +    P       +  A G GA  N + + V++T ++ +S
Sbjct  101   FFAVSIGLLINGVPQIGVIYD----PS--HNELFRGATGLGATRNRRPIQVSETAELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D  HVA G ++ YWE  L PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSAALDLAHVACGRLDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIGP  374
             D  AG+++++EAGG V+  D     +    +LA+NG +HD L   LE++ P
Sbjct  215   DITAGIILLQEAGGKVTAYDRTPLKIESGRILATNGHIHDSLSQELEQVPP  265



>ref|WP_007356489.1| MULTISPECIES: inositol monophosphatase [Kamptonema]
 emb|CBN57287.1| inositol-1(or 4)-monophosphatase [ [[Oscillatoria] sp. PCC 6506]
Length=280

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/259 (41%), Positives = 149/259 (58%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
             LL+I   AA     V+     K   I  KG   DLVT+ DK +E+AILDV+R++ P H +
Sbjct  9     LLDIATEAALAAGAVLQAYWGKLEEIQEKGRPGDLVTEADKAAEVAILDVLRRHVPTHGI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD +S YLW IDPLDGTTN+ H Y   A S+ +L    P    + +      
Sbjct  69    LTEESGSLGDRTSKYLWAIDPLDGTTNYAHQYPFSAASIGLLIDDVPQVGAIFD------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + + V+   ++ +SLLVTG+ YDR ++   N   F   T +
Sbjct  123   PFHNELFRAATGLGATRNRRPIQVSKISELSKSLLVTGFAYDRHETADNNYAEFCHLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+AS+D  HVA G ++ YWE  L PWD AAG++I+ EAGG V+  DG    + 
Sbjct  183   TQGVRRSGSASLDLAHVACGRLDGYWERGLSPWDMAAGIVILLEAGGQVTAYDGSPLQIK  242

Query  436   DRSVLASNGALHDKLLEKI  380
                +L SNG +HD++ + +
Sbjct  243   SGRILGSNGRIHDQIRDAL  261



>ref|WP_027845578.1| inositol monophosphatase [Mastigocoleus testarum]
Length=270

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 150/260 (58%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L++    A     V++D V K  + I  KG   DLVT  DK SE  ILD ++++FP+H 
Sbjct  7     FLDVATEMALAAGAVLLDYVGKLEDSITEKGRPGDLVTIADKASEALILDSLQRHFPEHA  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+ ++ YLW +DPLDGTTN+ H Y  FAVS+ +L  G+PA   + +    P
Sbjct  67    ILSEESGALGNSNNKYLWAVDPLDGTTNYAHQYPMFAVSIGLLIDGEPAVGVIYD----P  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
                    + A  G GA  N Q + V+   ++ +SLLVTG+ YDR ++   N   F   T 
Sbjct  123   S--RNELFRAGKGLGATLNRQPIKVSQISELSKSLLVTGFAYDRRETSDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  HVA G ++ YWE  L PWD  AG++I  EAG  V+  DG    +
Sbjct  181   LTQGVRRGGSASLDLAHVACGRLDGYWERGLSPWDIVAGIVIAREAGAKVTAYDGSPIIL  240

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG +H+ L + +
Sbjct  241   ESGRILATNGYIHNSLSQAL  260



>ref|WP_006196791.1| inositol monophosphatase [Nodularia spumigena]
 gb|EAW45026.1| Inositol monophosphatase [Nodularia spumigena CCY9414]
 gb|AHJ30600.1| Inositol-1-monophosphatase [Nodularia spumigena CCY9414]
Length=270

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 138/222 (62%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE+ IL+++R++FP+H +L EE G  G+  + YLW IDPLDGTTN+ H Y+
Sbjct  41    DLVTAADKASEVVILEILRRHFPEHSILAEESGKLGNQDNQYLWAIDPLDGTTNYAHQYS  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             +FAVS+ +L  G P    + +       +    + AA G GA  N   + V++  ++ +S
Sbjct  101   AFAVSIGLLVNGVPQVGVIYD------PFHDELFRAATGLGATRNRHSIKVSEISELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D  +VA G V+ YWE  + PW
Sbjct  155   LLVTGFAYDRRETPDNNYAEFCHLTHLTQGVRRSGSAALDLAYVACGRVDGYWERGISPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D  AG++++ EAGG V+  DG  + +    +LA+NG +H  L
Sbjct  215   DVVAGIVLLREAGGKVTAYDGTAFKIESGRILATNGNIHHNL  256



>gb|EKE02731.1| hypothetical protein ACD_20C00337G0002 [uncultured bacterium]
Length=265

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 149/236 (63%), Gaps = 10/236 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT+ DK SE  I+ ++  +FPDH +LGEE G     SS+Y+W IDPLDGTTN++H++ 
Sbjct  40    DLVTNIDKMSEERIISIIHGHFPDHEILGEESGTHEGKSSEYVWIIDPLDGTTNYSHNFP  99

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L++G+     V+  V  P  +   T+ AA   G++ N   + V+  D +++S
Sbjct  100   HFAVSIGLLYKGE----IVLGVVYDP--FKNETFWAAKETGSFLNADPIKVSQADTIKKS  153

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LL TG+ Y+R ++   N++ F +    ++ +RR GAAS+D C+VA G ++ +WE  L PW
Sbjct  154   LLATGFPYERAEAMEENLKYFCKLIYEAQAIRRPGAASLDLCYVACGRLDGFWELNLSPW  213

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNK  350
             D  AG  I++EAGG V+    +K+ ++ ++++ASN  +H    E+I    E ++N+
Sbjct  214   DTTAGACIIKEAGGKVTNFGTDKFDIYTKNIIASNSLIH----EQIAKVIESIRNR  265



>ref|WP_015124576.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Synechococcus sp. PCC 6312]
 ref|YP_007061576.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Synechococcus sp. PCC 6312]
 gb|AFY61033.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Synechococcus sp. PCC 6312]
Length=289

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/289 (39%), Positives = 161/289 (56%), Gaps = 20/289 (7%)
 Frame = -2

Query  1162  SDQLLE----IVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRK  998
             SDQ L     +   AA  G +++     +   +  KG + DLVT  DK+SE A+L +++K
Sbjct  2     SDQFLADCLAVATEAALAGGKILQAHWGQLEMVEEKGRSGDLVTIADKESEAAVLGILQK  61

Query  997   NFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVV  818
             NFP H +L EE G  G  +S YLW IDPLDGTTN+ H Y   AVS+ +L  G+P    + 
Sbjct  62    NFPSHQILAEESGRIGTNTSPYLWAIDPLDGTTNYAHQYPFSAVSIGLLVEGEPQVGVIF  121

Query  817   EFVGGPMCWSTRTYTAAVGKGAY--------ANGQKLSVTDTDKVEQSLLVTGYGYDRDD  662
             +       +    + AA G GA         A  + L V+ T ++  SLLVTG+ YDR +
Sbjct  122   D------PFHQELFAAAKGLGATVSTPPLTAAATKHLHVSHTSQLRDSLLVTGFAYDRRE  175

Query  661   SWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEA  482
             +   N   F   T +++GVRR GAA++D  +VA G ++ YWE  L PWD AAGV+IV EA
Sbjct  176   TSDNNYAEFCYLTHLTQGVRRAGAAAIDLAYVACGRLDGYWERGLSPWDLAAGVVIVREA  235

Query  481   GGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFS  335
             GG+V+  D     +    +LA+NG +H +L + +  A   +K +  DFS
Sbjct  236   GGVVTAYDQSALVLETGRILATNGRIHSQLSQAL-TAVAPIKAQFPDFS  283



>ref|WP_020252747.1| MULTISPECIES: hypothetical protein [unclassified Cloacimonetes]
Length=257

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/254 (35%), Positives = 150/254 (59%), Gaps = 6/254 (2%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L+I   A     +++ +  +K + I+YKG  +LVT+ D+++E  +++ ++  +P H +L 
Sbjct  5     LDIALEACTKAGDIIRENFHKKKLIDYKGRINLVTNVDREAEKVVVETIQNYYPKHNILT  64

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE     +P  +Y W IDPLDGTTN+ H +    VS+A+    +    ++V  V  P+  
Sbjct  65    EETEHEQNPGQEYCWVIDPLDGTTNYVHGFPFVCVSIAL----QKNNESIVGVVYNPIL-  119

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 + A  G+    N +++ V+D     ++LL TG+ YD  +    N++   +     R
Sbjct  120   -HELFFAEKGRCCVRNDEEIHVSDNSDFPKALLATGFPYDMLNDERNNIKNLSKVIKKCR  178

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             G+RR GAA++D C+VA G+ + YWE  L PWD AAG++I+EEAGG VS+ DG ++ +FD+
Sbjct  179   GIRRPGAAAIDICYVAYGVFDGYWELELYPWDTAAGIVILEEAGGKVSKFDGSEFSIFDK  238

Query  430   SVLASNGALHDKLL  389
              + ASNG +H++ L
Sbjct  239   EIAASNGHIHEEFL  252



>ref|WP_011733974.1| histidinol-phosphate phosphatase [Pelobacter propionicus]
 ref|YP_899717.1| inositol monophosphatase [Pelobacter propionicus DSM 2379]
 gb|ABK97659.1| inositol monophosphatase [Pelobacter propionicus DSM 2379]
Length=266

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 150/260 (58%), Gaps = 10/260 (4%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L++   AA+            P +I  KG  DLVT+ D++SE  I+  +   FPDH +L 
Sbjct  8     LQVAIEAARLAGSYQRHRFTSPLSIELKGDKDLVTEVDRESERLIVQQLLNRFPDHSILA  67

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EEG       S + W IDPLDGTTNF H +  F VS+A+   G+  A  ++  +   +  
Sbjct  68    EEGS-CPHSESPHCWIIDPLDGTTNFAHGFPWFCVSIALEADGELVAGVILNPIHDEL--  124

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 +TA  G GA+ NG++L V++   ++ +LL TG+ YD       N + F  F   +R
Sbjct  125   ----FTATRGGGAFLNGRRLRVSERSPLKDTLLGTGFPYDCASDPVNNFDNFMAFQRAAR  180

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             G+RR GAA++D   VA G ++ +WE +L+PWD AAGVL+V EAGG+VS  DG +Y +F  
Sbjct  181   GIRRAGAAALDLASVAAGRLDGFWELKLKPWDVAAGVLLVREAGGMVSGFDGSEYSIFHN  240

Query  430   SVLASNGALHDK---LLEKI  380
              +LASNG +H +   +LE++
Sbjct  241   RILASNGLIHGEMATMLERV  260



>ref|WP_017311811.1| inositol monophosphatase [Fischerella sp. PCC 9339]
Length=265

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 148/260 (57%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I    A     V+   + K  + I  KG   DLVT  DK SE  IL  + ++FPDH 
Sbjct  7     FLDIATETALAAGAVLQSYLGKVEDAITEKGRPGDLVTVADKASEEVILQALDRHFPDHA  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  +++LW IDPLDGTTNF H Y  FAVS+ +L  G P    + +     
Sbjct  67    ILTEESGKLGNQDNEFLWAIDPLDGTTNFAHQYPFFAVSIGLLINGVPQVGVIYD-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA   GA  N + + V+DT ++ +SLLVTG+ YDR ++   N   F   T 
Sbjct  122   -PFHDELFRAAQDMGATRNRRPIKVSDTSELSKSLLVTGFAYDRRETSDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D  HVA G ++ YWE  L PWD AAG++IV EAGG V+  D     +
Sbjct  181   LTQGVRRSGSASLDLAHVACGRLDGYWERGLSPWDIAAGIIIVREAGGEVTAYDRTPVKI  240

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG LH  L +++
Sbjct  241   ESGRILATNGHLHQSLSQEL  260



>ref|WP_029412620.1| hypothetical protein [Acidobacteria bacterium JGI 0001001-H03]
Length=269

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 147/257 (57%), Gaps = 6/257 (2%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             D+LL++   AA    +++ ++  KP++I YKG  DLVT  D++SE  I+  ++ +FPDH 
Sbjct  6     DELLDVAWQAASAAGQLIRESWQKPKSIEYKGAIDLVTSVDRESERVIVATIQSHFPDHS  65

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE         +  W +DPLDGTTNF H Y  F +S+A   RG      V + V   
Sbjct  66    ILAEEETIVRGADEECRWIVDPLDGTTNFAHGYPQFCISIAFENRGIVLMGLVYDPV---  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
                    + A    GA  N   +  +  D+V+++LL TG+ YDR D     +  FK F  
Sbjct  123   ---RQECFKAMRAGGATLNDAPIHTSSVDRVDKALLGTGFPYDRRDFADVYLGYFKGFMT  179

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
              S+GVRR G+A++D C+VA G  + +WE +L+PWD AAG LIV EAGG++S   G  + +
Sbjct  180   RSQGVRRGGSAALDLCYVASGRFDGFWEMKLKPWDVAAGALIVIEAGGVLSDFSGNAFSI  239

Query  439   FDRSVLASNGALHDKLL  389
             + +  LASN  +H +++
Sbjct  240   YGQETLASNRLIHREMV  256



>ref|WP_015136731.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Nostoc sp. PCC 7524]
 ref|YP_007073867.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Nostoc sp. PCC 7524]
 gb|AFY46270.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Nostoc sp. PCC 7524]
Length=270

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 135/222 (61%), Gaps = 6/222 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL+++ ++FP+H +L EE G  G+    YLW IDPLDGTTN+ H Y 
Sbjct  41    DLVTAADKASEAVILEILHRHFPEHSILAEESGKIGNQDHQYLWAIDPLDGTTNYAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             +F VS+ +L  G+P    + +     +      + AA G GA  N + + V++T ++ +S
Sbjct  101   AFCVSIGLLINGEPQVGVIYDPAHNEL------FRAAAGLGATRNRRPIRVSETSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D   VA G V+ YWE  + PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSAALDLASVACGRVDGYWERGISPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             D  AGV+++ EAGG V+  DG    +    +LA+NG LHD L
Sbjct  215   DVVAGVILLHEAGGKVTAYDGTPLKIASGRILATNGYLHDNL  256



>ref|WP_026100862.1| inositol monophosphatase [Synechococcus sp. PCC 7336]
Length=282

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 151/254 (59%), Gaps = 10/254 (4%)
 Frame = -2

Query  1084  RNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGD-PSSDYLWCIDPLD  908
             ++I  K   DLVT+ D+ +EL +L++V+++FP   +L EE G  G+  ++ +LW IDPLD
Sbjct  33    QDIREKRPGDLVTEADRAAELTVLEIVQRHFPADSILAEESGQQGNGAATGFLWAIDPLD  92

Query  907   GTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLS  728
             GTTN+ H Y + AVS+ +L  G+P    V +       +    + AA G GA  N   + 
Sbjct  93    GTTNYAHGYPAAAVSIGLLQAGEPVLGVVYD------VFRNELFRAATGMGATCNYLPIC  146

Query  727   VTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVE  548
             V+ TD++E SLLVTG+ YDR ++   N   F  FT +++GVRR G+ASVD   VA+G ++
Sbjct  147   VSSTDRLENSLLVTGFAYDRRETADNNYAEFCHFTHLTQGVRRGGSASVDLAAVAMGRLD  206

Query  547   AYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIG  377
              YWE  L  WD AAG+++V EAGG V+  DG    +    +LASNG+LH  +   L ++ 
Sbjct  207   GYWERGLSVWDIAAGIVLVREAGGSVTAYDGSPLLIESGRLLASNGSLHAAMQLELSRVQ  266

Query  376   PATEKLKNKGVDFS  335
             P  + L      F+
Sbjct  267   PLQQALPTHPTQFT  280



>ref|WP_015188644.1| Inositol-phosphate phosphatase [Gloeocapsa sp. PCC 7428]
 ref|YP_007127932.1| Inositol-phosphate phosphatase [Gloeocapsa sp. PCC 7428]
 gb|AFZ30772.1| Inositol-phosphate phosphatase [Gloeocapsa sp. PCC 7428]
Length=288

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 140/226 (62%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  ILDV++++ P H +L EE G  G+ +SDYLW IDPLDGTTNF H Y 
Sbjct  43    DLVTQADKASEAVILDVLQRHVPQHGILAEESGNVGNSTSDYLWAIDPLDGTTNFAHQYP  102

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
             SFAVS+ +L  G P    + +       +    + AA G GA  + + +SV+ T ++ +S
Sbjct  103   SFAVSIGLLVAGIPQVGVIFD------PFHQELFRAARGLGATRDRRPISVSQTQELSKS  156

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+A++D  +VA G ++ YWE  L PW
Sbjct  157   LLVTGFAYDRRETPDNNYAEFCHLTHLTQGVRRSGSAALDLAYVACGRLDGYWERGLSPW  216

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D  AG++++EEA G V+  D   + +    +LA+NG LH  L +++
Sbjct  217   DITAGIVLLEEAKGKVTAYDQSPFDMASGRILATNGYLHAALSDEL  262



>ref|WP_026720730.1| inositol monophosphatase [Fischerella sp. PCC 9431]
Length=271

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 137/226 (61%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL  + ++FPDH +L EE G  G+  +++LW IDPLDGTTNF H Y 
Sbjct  41    DLVTVADKASEEVILQALSRHFPDHAILTEESGKLGNQDNEFLWAIDPLDGTTNFAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA   GA  N + + V+DT ++ +S
Sbjct  101   FFAVSIGLLINGVPQVGVIYD------PFHDELFRAAQDMGATRNRRPIKVSDTAELGKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLV+G+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  L PW
Sbjct  155   LLVSGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASLDLAHVACGRLDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAG++IV EAGG V+  D     +    +LA+NG LHD L +++
Sbjct  215   DIAAGIIIVREAGGKVTAYDRTPVKIESGRILATNGHLHDSLSQEL  260



>ref|WP_038038587.1| histidinol phosphate phosphatase [Thermomicrobiales bacterium 
KI4]
Length=273

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 139/240 (58%), Gaps = 8/240 (3%)
 Frame = -2

Query  1078  INYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDP-SSDYLWCIDPLDGT  902
             I YKG  +LVTD D  SE  IL  +R+ FP+H +L EE   + +   + Y W +DPLDGT
Sbjct  35    IRYKGEINLVTDVDLASERLILHRIREEFPEHAILSEEQPTSAEVLRAPYTWVVDPLDGT  94

Query  901   TNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVT  722
             TNF H Y  FAVS+A L  G+P    V +    PM      + A  G GAY NGQ+L V+
Sbjct  95    TNFAHGYPMFAVSIAWLCEGEPYIGVVYQ----PML--DELFVAERGHGAYLNGQRLYVS  148

Query  721   DTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAY  542
                 + +SLL TG+ YD +       + F  F  V+R +RR G A++D C+VA G  + +
Sbjct  149   TEHVLRRSLLATGFPYDAERRRQAVRD-FVHFIDVARAIRRDGTAAIDLCYVAAGRFDGF  207

Query  541   WEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEK  362
             WE  L PWD AAGVL+V EAGG+V+   GE Y + D   +ASNG +H ++L  +  A  +
Sbjct  208   WERELSPWDTAAGVLLVREAGGMVTNEAGEPYRLGDLVCVASNGQIHQEMLAVLAAAQHQ  267



>ref|WP_015115459.1| inositol-phosphate phosphatase [Nostoc sp. PCC 7107]
 ref|YP_007052418.1| inositol-phosphate phosphatase [Nostoc sp. PCC 7107]
 gb|AFY45268.1| Inositol-phosphate phosphatase [Nostoc sp. PCC 7107]
Length=270

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 153/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     V+   + K  + +  KG   DLVT  DK SE  +L+++ ++FP H 
Sbjct  7     FLDIATEAALAAGVVLQGYLGKLEDAVTEKGRPGDLVTAADKASEAVVLEILHRHFPLHS  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  +++LW IDPLDGTTN+ H Y  FAVS+ +L  G P    + +    P
Sbjct  67    ILAEESGKIGNQDNEFLWAIDPLDGTTNYAHQYPFFAVSIGLLINGAPQVGVIYD----P  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      + AA G GA  N + + V++T ++ +SLLVTG+ YDR ++   N   F   T 
Sbjct  123   L--HHELFRAAAGLGATRNRRPIQVSETSELGKSLLVTGFAYDRRETSDNNYAEFCHLTH  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+AS+D   VA G V+ YWE  L PWD AAG+++++EAGG V+  DG    +
Sbjct  181   LTQGVRRSGSASIDLASVACGRVDGYWERGLSPWDIAAGIILLQEAGGKVTAYDGSPLQI  240

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+NG +HD L  ++
Sbjct  241   NSGRLLATNGYIHDILSHEL  260



>ref|WP_039728768.1| inositol monophosphatase [Lyngbya confervoides]
 gb|KIF16333.1| inositol monophosphatase [Aphanocapsa montana BDHKU210001]
 gb|KIF41258.1| inositol monophosphatase [Lyngbya confervoides BDU141951]
Length=282

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 152/264 (58%), Gaps = 11/264 (4%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLVL  974
             LE+   AA     V+     K  +I  KG   DLVT+ DK +E  +LDV+ ++ PDH +L
Sbjct  13    LEVATEAALAAGAVLQTYWGKLEHIEQKGRPGDLVTEADKAAEAVVLDVLTRHLPDHPIL  72

Query  973   GEEGG-FTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
              EE G       S  LW IDPLDGTTN+TH Y   AVS+ +L  G PA   + +      
Sbjct  73    AEESGSLRAASDSPLLWAIDPLDGTTNYTHQYPFSAVSIGLLIDGHPAVGAIFD------  126

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G+GA  N + + V+ TDK+  SLLVTG+ YDR +    N   F   T +
Sbjct  127   PFREDLFRAAKGQGATLNRRSIRVSTTDKLANSLLVTGFAYDRHERVDNNYAEFCHLTHL  186

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D  +VA G ++ YWE  L PWD AAGV++VEEAGG V+  D   + + 
Sbjct  187   TQGVRRGGAASLDLAYVACGRLDGYWERGLSPWDMAAGVVLVEEAGGHVTAYDETDFDIQ  246

Query  436   DRSVLASNGALH---DKLLEKIGP  374
                +LA+NG +H    ++LE++ P
Sbjct  247   SGRILATNGRIHTILSQVLEQVQP  270



>ref|WP_012875162.1| inositol monophosphatase [Thermobaculum terrenum]
 ref|YP_003322949.1| inositol-phosphate phosphatase [Thermobaculum terrenum ATCC BAA-798]
 gb|ACZ42127.1| Inositol-phosphate phosphatase [Thermobaculum terrenum ATCC BAA-798]
Length=256

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 157/254 (62%), Gaps = 8/254 (3%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             LE+   AA    +V+     K   ++YKG  DLVT  D +SE  I++ + K FP+H +  
Sbjct  5     LEVAIEAAYKAGKVLRSMFEKGVQVHYKGRVDLVTTADFESEKTIIETIHKAFPNHGIYA  64

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G   + +    W IDPLDGTTNF H++  FAVS+A+    +     ++  V  P+  
Sbjct  65    EESGIK-EGTQPLRWIIDPLDGTTNFAHNFPLFAVSIAL----EHEEEMILGVVYNPI--  117

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
             S   +TAA G+G+  N + + V+DT+ +  SL+VTG+ YDR +  ++ +EL+  FT  ++
Sbjct  118   SDEMFTAARGEGSRKNDKPIQVSDTEDLIHSLVVTGFPYDRSEV-SSIIELWTYFTLHAQ  176

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRRLG+AS+D C+VA G ++AY+E  + PWD AAG +IV+EAGG V+   G K+  +  
Sbjct  177   GVRRLGSASLDLCYVATGQMDAYYERYVFPWDIAAGAIIVQEAGGKVTDFYGGKFTSYKN  236

Query  430   SVLASNGALHDKLL  389
              ++ASNG LH+ ++
Sbjct  237   EIVASNGKLHEAMI  250



>ref|WP_011431458.1| inositol monophosphatase [Synechococcus sp. JA-3-3Ab]
 ref|YP_476050.1| inositol monophosphatase family protein [Synechococcus sp. JA-3-3Ab]
 gb|ABD00787.1| inositol monophosphatase family protein [Synechococcus sp. JA-3-3Ab]
Length=283

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 146/257 (57%), Gaps = 6/257 (2%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L++   AA     ++   V     I  K   DLVT  D+ SE  IL ++R++FP+ ++L 
Sbjct  4     LDVATEAALEAGALLRSYVGGTLAIEEKRPGDLVTAADRASEELILKILRRHFPEDVILT  63

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G  G P   Y W IDPLDGTTNF H Y   AVS+ +L   +P    + +   G +  
Sbjct  64    EESGQQGSPQGTYAWMIDPLDGTTNFAHGYPFAAVSIGLLEGREPVLGVIYDIFRGDL--  121

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 + A  G GA  N Q + V+ T ++  SLLVTG+ YDR ++   N   F  FT +++
Sbjct  122   ----FRAVQGMGATRNRQPIRVSSTTELSHSLLVTGFAYDRRETPDNNYAEFCHFTHLTQ  177

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRR G+A++D  +VA G ++ YWE  L PWD AAG+++V EAGG V+  DG    V+  
Sbjct  178   GVRRGGSAALDLAYVATGQLDGYWERGLSPWDIAAGIVLVREAGGKVTAYDGSPVDVYSG  237

Query  430   SVLASNGALHDKLLEKI  380
              +LASNG LH  L E++
Sbjct  238   RLLASNGWLHAALQEEL  254



>ref|WP_009456177.1| MULTISPECIES: inositol monophosphatase [Fischerella]
 gb|EHC16159.1| Inositol-phosphate phosphatase [Fischerella sp. JSC-11]
Length=270

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 138/231 (60%), Gaps = 9/231 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL V+ ++F DH +L EE G  GD  +++LW IDPLDGTTNF H Y 
Sbjct  41    DLVTVADKASEAVILQVLGRHFSDHAILTEESGKLGDQKNEFLWVIDPLDGTTNFAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA   GA  N   + V+DT ++ +S
Sbjct  101   FFAVSIGLLINGVPQVGVIYD------PFHDELFRAAQDLGATRNRIPIRVSDTSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+ASVD  HVA G ++ YWE  L PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASVDLAHVACGRLDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIGP  374
             D AAG++IV EAGG V+  D     +    +LA+NG LH+ L   L+++ P
Sbjct  215   DIAAGIIIVREAGGKVTAYDCTPIKIESGRILATNGHLHEILSQELQQVPP  265



>emb|CBX30354.1| Inositol-1-monophosphatase [uncultured Desulfobacterium sp.]
Length=260

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 148/251 (59%), Gaps = 9/251 (4%)
 Frame = -2

Query  1135  AAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGF  956
             AAA  G EV+ +  +K   I  KG  DLVT++D +SE  I++ ++K FP H +L EE G 
Sbjct  12    AAAYKGGEVLKENFDKIPKIKKKGSIDLVTESDTESEKLIIETIKKVFPSHTILAEESGL  71

Query  955   -TGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRT  779
               GD  ++ LW IDPLDGTTNF H    FAVS+A    G   A  V+  V G +      
Sbjct  72    ENGD--AECLWIIDPLDGTTNFAHHLPIFAVSIAFALNGDIVAGIVLNPVTGEL------  123

Query  778   YTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRR  599
             +TA  G+GA  NG  + V+ T K+  SLLVTG  Y+  +        F      S+GVRR
Sbjct  124   FTATKGEGANLNGIPIHVSKTQKLTDSLLVTGIPYNFKEIIDDIQTRFFNCLKASQGVRR  183

Query  598   LGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLA  419
             LG+A++D C+ A G  E ++E  L+PWD AAG++I +EAGG V+   G  + ++   +LA
Sbjct  184   LGSAALDLCYTAAGRFEGFFEQDLKPWDTAAGLIIAKEAGGSVTDFSGNSFDIYKPEILA  243

Query  418   SNGALHDKLLE  386
             +NG +HD++++
Sbjct  244   TNGKIHDEMIK  254



>ref|WP_011522862.1| inositol monophosphatase [Candidatus Koribacter versatilis]
 ref|YP_591135.1| inositol-1(or 4)-monophosphatase [Candidatus Koribacter versatilis 
Ellin345]
 gb|ABF41061.1| Inositol-1(or 4)-monophosphatase [Candidatus Koribacter versatilis 
Ellin345]
Length=282

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/265 (40%), Positives = 153/265 (58%), Gaps = 14/265 (5%)
 Frame = -2

Query  1174  GSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKN  995
             G  P  Q +  ++A A+    +++   ++   I YKG  DLVT  D+ SE  I+D VR  
Sbjct  3     GPTPEFQFVSKIEAIAREAGALLLGYFHQRVKIEYKGDVDLVTVADRASEKLIVDRVRAT  62

Query  994   FPDHLVLGEEGGFTGDPS-SDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVV  818
             +P + ++GEEG  T D S SDY W IDPLDGTTNF H Y  F VS+ +  RG        
Sbjct  63    WPGYDIVGEEG--TRDESGSDYRWYIDPLDGTTNFAHGYPVFCVSMGLEHRG--------  112

Query  817   EFVGGPMCWSTRT--YTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNM  644
             E + G +   TR   + A  GKGAY NG  + V+ T ++ +SLL TG+   +      N+
Sbjct  113   EMLAGVLYDPTRDELFAAEKGKGAYLNGAPIHVSATKRLCESLLATGFPSHKRHK-NPNI  171

Query  643   ELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSR  464
               + E T  S GVRR G+A++D  +VA G  + +WE+ L PWD +AG L+V EAGG V+R
Sbjct  172   HFYHEITLHSHGVRRAGSAALDLANVACGRYDGFWEFNLNPWDTSAGTLLVTEAGGRVTR  231

Query  463   TDGEKYCVFDRSVLASNGALHDKLL  389
              DG  + +  +  LASNG +HD+++
Sbjct  232   YDGSTWRMDSKETLASNGLIHDEMM  256



>ref|XP_008342752.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Malus domestica]
Length=162

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  820  VEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNME  641
            VEFVGGPMCW+TR ++A+ G GA+ NGQK+ V+ TD+V +SLLVTG+GY+ DD W TN+E
Sbjct  31   VEFVGGPMCWNTRIFSASAGGGAFCNGQKIHVSQTDEVGRSLLVTGFGYEHDDVWITNIE  90

Query  640  LFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLI  494
            LFKEFT VSRGVRRLGAASVD CHVALGIVEAYWEYRL+PWD AAGVL 
Sbjct  91   LFKEFTDVSRGVRRLGAASVDMCHVALGIVEAYWEYRLKPWDMAAGVLF  139



>dbj|GAM08117.1| inositol-1-monophosphatase [Geobacter sp. OR-1]
Length=262

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 157/260 (60%), Gaps = 7/260 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             ++ L + + AA+   ++ +  +     +++KG  DLVT+ D++SE  I+ ++R  FP   
Sbjct  2     NEYLMVAEQAARAAGKLQLKRLGGDFKVSHKGAIDLVTEVDRESESLIVKMLRAAFPGSD  61

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE  + G    +  W +DPLDGTTNF H    F VS+ +   G+ + + +       
Sbjct  62    ILAEENDY-GARRGNAAWIVDPLDGTTNFAHRLPWFCVSIGLEIDGEISVAALYHPCMDE  120

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             M      +TA  G+GA+ NG +L+V+   +++ S+L +G+ YDR      N+EL+  FT 
Sbjct  121   M------FTAIRGEGAFLNGNRLAVSAITELKSSILASGFPYDRTWDNENNLELYARFTM  174

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
              ++GVRR GAA++D  +VA G ++ +WE +L+PWD AAG L+V+EAGG V+   G+ Y V
Sbjct  175   ATQGVRRFGAAALDLAYVAAGRLDGFWECKLKPWDVAAGKLLVQEAGGRVTNYSGDAYSV  234

Query  439   FDRSVLASNGALHDKLLEKI  380
             +D  ++ASN  +HD++LE I
Sbjct  235   YDHRIVASNRLVHDEMLEII  254



>ref|WP_015837967.1| histidinol-phosphate phosphatase [Geobacter sp. M21]
 ref|YP_003022500.1| inositol monophosphatase [Geobacter sp. M21]
 gb|ACT18742.1| inositol monophosphatase [Geobacter sp. M21]
Length=266

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 138/231 (60%), Gaps = 9/231 (4%)
 Frame = -2

Query  1078  INYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFT-GDPSSDYLWCIDPLDGT  902
             ++YKG  DLVT+ D+  E  I++ V   FP H  L EE  +  GDP     W +DPLDGT
Sbjct  35    LSYKGEVDLVTEVDRACEELIVNRVSGVFPGHSFLAEENQYPDGDPG--LRWIVDPLDGT  92

Query  901   TNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVT  722
             TN+ H +  F VS+A    G+  A  +        C     Y+AA G+GA+ NG+++SV+
Sbjct  93    TNYAHGFPWFCVSIAFEKEGEVVAGVIYH------CMMDELYSAAKGEGAFLNGRRISVS  146

Query  721   DTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAY  542
                 + QSL+ TG+ YD       N E F E    +RGVRR GAA++D   VA G ++ Y
Sbjct  147   RRAPLRQSLIATGFPYDVARDNENNFENFIELQLAARGVRRAGAAALDLACVAAGRLDGY  206

Query  541   WEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLL  389
             WE +L+PWD AAG L+V+EAGG V+   G  Y V+D  +LASNGA+H+++L
Sbjct  207   WECKLKPWDVAAGTLLVQEAGGTVTNHSGAPYSVYDHRILASNGAIHEEML  257



>ref|WP_016869344.1| inositol monophosphatase [Fischerella muscicola]
Length=270

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 139/231 (60%), Gaps = 9/231 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL V+ ++FP H +L EE G  G+  +++LW IDPLDGTTNF H Y 
Sbjct  41    DLVTVADKASEEVILQVLGRHFPSHAILTEESGKLGNQENEFLWAIDPLDGTTNFAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA   GA  N + + V+DT ++ +S
Sbjct  101   FFAVSIGLLINGVPQVGVIYD------PFHDELFRAAQDFGATRNRRFIKVSDTSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  L PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASLDLAHVACGRLDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIGP  374
             D AAG++IV EAGG V+  D     +    +LA+NG LH+ L   L+++ P
Sbjct  215   DIAAGIIIVREAGGKVTAYDRTPIKIESGRILATNGHLHEILSQELQQVPP  265



>ref|WP_013321174.1| inositol monophosphatase [Cyanothece sp. PCC 7822]
 ref|YP_003886342.1| inositol monophosphatase [Cyanothece sp. PCC 7822]
 gb|ADN13067.1| inositol monophosphatase [Cyanothece sp. PCC 7822]
Length=270

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 149/267 (56%), Gaps = 7/267 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
             + L+I    A  G  ++     K   I  KG   DLVTD DK SE  IL V++++FP+H 
Sbjct  8     RFLDIATECALAGGVILEQQWGKLNTIEEKGRPGDLVTDVDKTSETEILKVLKRHFPEHG  67

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  + YLW IDPLDGTTN+ H Y    VSV +L    P    V       
Sbjct  68    ILAEESGHLGEADNPYLWAIDPLDGTTNYAHGYPVACVSVGLLIENVPQVGVVYN-----  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA GKGA  N + + V+ T ++  SLLVTG+ YDR ++   N   F   T 
Sbjct  123   -PFRKELFRAAKGKGATLNRRPIQVSTTQQLSSSLLVTGFAYDRRETPDNNYREFCYLTH  181

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D   VA G V+ YWE  ++ WD  AG++I+EEAGG V+  D     +
Sbjct  182   LTQGVRRSGSAALDLTDVACGRVDGYWERGIKAWDMTAGIVILEEAGGQVTAYDESPLVI  241

Query  439   FDRSVLASNGALHDKLLEKIGPATEKL  359
                 +LA+NG +H++L + +  A+  L
Sbjct  242   ESGRILATNGQIHNRLSKALHEASSWL  268



>ref|WP_004268128.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI36292.1| Inositol-1-monophosphatase [Microcystis aeruginosa PCC 9701]
Length=276

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 151/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP+H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIEKIEEKGRSGDLVTEIDRRAETEILKIISRHFPEH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      S+YLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLPGRDSEYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAAKGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDMAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_016862025.1| inositol monophosphatase [Fischerella muscicola]
Length=271

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 144/238 (61%), Gaps = 10/238 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK SE  IL  + ++FPDH +L EE G  G+  +++LW IDPLDGTTNF H Y 
Sbjct  41    DLVTVADKASEEVILQALGRHFPDHAILTEESGKLGNQDNEFLWAIDPLDGTTNFAHQYP  100

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + +       +    + AA   GA  N + + V+DT ++ +S
Sbjct  101   FFAVSIGLLINGVPQVGVIYD------PFHDELFRAAQDMGATRNRRLIKVSDTSELSKS  154

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D  HVA G ++ YWE  L PW
Sbjct  155   LLVTGFAYDRRETSDNNYAEFCHLTHLTQGVRRSGSASLDLAHVACGRLDGYWERGLSPW  214

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPATEKLKNKGV  344
             D AAG++IV EAGG V+  D     +    +LA+N  LH+ L +++    ++++++G+
Sbjct  215   DIAAGIIIVREAGGEVTAYDRTPVKIESGRILATNRHLHNVLSQEL----QQVQHQGI  268



>ref|WP_015182249.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Microcoleus sp. PCC 7113]
 ref|YP_007121504.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Microcoleus sp. PCC 7113]
 gb|AFZ18098.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Microcoleus sp. PCC 7113]
Length=274

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/255 (42%), Positives = 145/255 (57%), Gaps = 7/255 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA     ++ D   K   +  KG   DLVT  DK +E+AIL V++++ P H +
Sbjct  12    FLDIATEAAMAAGAILKDYWGKLDEVEEKGRPGDLVTAADKDAEVAILKVLKRHVPHHSI  71

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  GD  ++YLW IDPLDGTTN+ H Y   AVSV +L  G P    +        
Sbjct  72    LAEESGQIGDNQNEYLWAIDPLDGTTNYAHQYPVAAVSVGLLVSGIPMVGAIYN------  125

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + + V++T  + +SLLVTG+ YDR ++   N   F   T +
Sbjct  126   PFRDELFRAARGLGATRNRRPIQVSETSDLSKSLLVTGFAYDRRETSDNNYAEFCHLTHL  185

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D   VA G ++ YWE  L PWD AAGV++VEEAGG V+  DG    + 
Sbjct  186   TQGVRRSGAASLDLADVACGRLDGYWERGLSPWDIAAGVVLVEEAGGKVTAYDGNPLKID  245

Query  436   DRSVLASNGALHDKL  392
                +LA+N  LH  L
Sbjct  246   SGRILATNAHLHKHL  260



>ref|WP_012529943.1| histidinol-phosphate phosphatase [Geobacter bemidjiensis]
 ref|YP_002138324.1| inositol-1-monophosphatase [Geobacter bemidjiensis Bem]
 gb|ACH38528.1| histidinol-phosphate phosphatase, putative [Geobacter bemidjiensis 
Bem]
Length=266

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/261 (39%), Positives = 148/261 (57%), Gaps = 9/261 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLV  977
             ++L+    AA+    +  + +     ++YKG  DLVT+ D+  E  I++ +   FP H  
Sbjct  9     KVLDTATTAAREAGALQKERLWSEHTLSYKGEVDLVTEVDRACEELIVNRISGVFPGHSF  68

Query  976   LGEEGGF-TGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             L EE  +  GDP     W +DPLDGTTN+ H +  F VS+A    G+  A  V       
Sbjct  69    LAEENQYPEGDPG--LRWIVDPLDGTTNYAHGFPWFCVSIAFEKEGEILAGVVYH-----  121

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
              C     ++AA G+GA+ NG+++ V+    + QSL+ TG+ YD       N E F E   
Sbjct  122   -CMMDELFSAAKGEGAFLNGRRILVSQRAPLRQSLIATGFPYDIARDNENNFENFIELQL  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
              +RGVRR GAA++D   VA G ++ YWE +L+PWD AAG L+V+EAGG V+   G  Y V
Sbjct  181   AARGVRRAGAAALDLACVAAGRLDGYWECKLKPWDVAAGTLLVQEAGGKVTNHAGAPYSV  240

Query  439   FDRSVLASNGALHDKLLEKIG  377
             +D  +LASNGA+H ++L  +G
Sbjct  241   YDHRILASNGAIHKEMLSILG  261



>ref|WP_009342688.1| inositol monophosphatase [Raphidiopsis brookii]
 gb|EFA73292.1| Inositol monophosphatase [Raphidiopsis brookii D9]
Length=271

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 152/260 (58%), Gaps = 8/260 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDHL  980
              L+I   AA     ++ D + K  + I+ KG   DLVT  D+ +E AIL V+ ++FP H 
Sbjct  13    FLDIATEAALAAGVILQDYLGKVEDAISEKGRPGDLVTAADQTAEQAILAVINRHFPQHS  72

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+ +S+YLW IDPLDGTTN+ H Y  FAVS+ +L  G+P      +    P
Sbjct  73    ILAEESGKVGNQASEYLWTIDPLDGTTNYAHQYPCFAVSIGLLIEGEPKVGVTYD----P  128

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      + AA G GA  N   + V+ T ++ +SLL TG+ YDR ++  TN   F   T 
Sbjct  129   L--RNELFRAAAGLGATRNRHPIRVSQTVELSKSLLSTGFAYDRTETNDTNYPEFCHLTH  186

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D  +V+ G V+ YWE  L PWD  AG+++V EAGG V+  +G    +
Sbjct  187   LTQGVRRGGSAALDLAYVSCGRVDGYWERGLAPWDIVAGIILVREAGGKVTAYNGGDLQI  246

Query  439   FDRSVLASNGALHDKLLEKI  380
                 +LA+N  LH  + E++
Sbjct  247   DSGRILATNSDLHQVISEEL  266



>ref|WP_006927781.1| inositol monophosphatase [Caldithrix abyssi]
 gb|EHO40750.1| inositol monophosphatase [Caldithrix abyssi DSM 13497]
Length=265

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 155/268 (58%), Gaps = 9/268 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNK--PRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             ++E+ + AA    E++++   K   + I  K   D ++  D++SE  IL  +RK +P H 
Sbjct  1     MIEVAKQAASAAGEILLEHFRKIPQQAIRRKQRNDFLSFVDEQSEQTILKTIRKAYPQHA  60

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
              L EE G +     DYLW IDPLDGTTNF      FA+S+A+LF+G+P A  + + +   
Sbjct  61    FLAEEVGGSAH-EDDYLWIIDPLDGTTNFLQGIPIFAISIALLFKGRPVAGVIYDPLHRE  119

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             M W+ +      GKGA+ N   +SV+  +K+++S + TG+ +         + +FK+   
Sbjct  120   MFWAEK------GKGAFLNDAPISVSKKNKLDESFIATGFPFKAKHFLNDYLAVFKDIFT  173

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
                G RR+GAA++D  +VA G  + +WE  L PWD AAG +I+EEAGG V+   G +  +
Sbjct  174   DCIGKRRMGAAAIDLAYVAAGRFDGFWELGLSPWDQAAGWIIIEEAGGKVTDFWGSEDFL  233

Query  439   FDRSVLASNGALHDKLLEKIGPATEKLK  356
             + R  LA+NG +H+++++KI    ++ K
Sbjct  234   YARYTLATNGLIHEQMIDKINKHFKEFK  261



>ref|WP_015168036.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Synechococcus sp. PCC 7502]
 ref|YP_007105513.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Synechococcus sp. PCC 7502]
 gb|AFY73378.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Synechococcus sp. PCC 7502]
Length=282

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 143/237 (60%), Gaps = 6/237 (3%)
 Frame = -2

Query  1090  KPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPL  911
             K  + N K   DLVT  DK++E  +L V++++FPDH +L EE G  G   S +LW IDPL
Sbjct  38    KESDRNEKRPGDLVTIADKEAEAQVLAVIKRHFPDHSILAEESGAGGKTESKFLWAIDPL  97

Query  910   DGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKL  731
             DGTTNF+HSY   AVSV +L  G P+   + +       +    +  A+G GA  + + +
Sbjct  98    DGTTNFSHSYPFSAVSVGLLIDGIPSVGAIYD------PFHDELFCGAIGLGATCDRKPI  151

Query  730   SVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIV  551
              V+  ++++ SLLVTG+ YDR  +   N   F  FT ++ GVRR GAASVD  +VA G V
Sbjct  152   QVSTENELKHSLLVTGFAYDRTQTPDNNYAEFCHFTHITHGVRRGGAASVDLAYVACGRV  211

Query  550   EAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             + YWE  L  WD AAGV+IV EAGG V+  DG +  +    +LA+N  +H +++ ++
Sbjct  212   DGYWERGLSIWDIAAGVVIVREAGGTVTAYDGGELDLKSGRILATNTHIHSEMITEL  268



>ref|WP_035496786.1| histidinol phosphate phosphatase [Geobacter bremensis]
Length=252

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 146/255 (57%), Gaps = 11/255 (4%)
 Frame = -2

Query  1135  AAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGF  956
             AAA+    +  + +     ++YKG  DLVT+ D+  E  I++ +   FP H  L EE  +
Sbjct  2     AAAREAGSLQKERLWSEHTLSYKGEVDLVTEVDRACEELIVNRISGVFPGHSFLAEENQY  61

Query  955   TGDPSSDY--LWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTR  782
                P  D    W +DPLDGTTN+ H +  F VS+A    G+  A  +        C    
Sbjct  62    ---PEGDLGLRWIVDPLDGTTNYAHGFPWFCVSIAFEKGGEILAGVIYH------CMMDE  112

Query  781   TYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVR  602
              ++AA G+GA+ NG+++SV+    + QSL+ TG+ YD       N E F E    +RGVR
Sbjct  113   LFSAAKGEGAFLNGRRISVSQRAPLRQSLIATGFPYDVTRDNENNFENFIELQLAARGVR  172

Query  601   RLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVL  422
             R GAA++D   VA G ++ YWE +L+PWD AAG L+V+EAGG V+   G  Y V+D  +L
Sbjct  173   RAGAAALDLACVAAGRLDGYWECKLKPWDVAAGTLLVQEAGGKVTNHAGAPYSVYDHRIL  232

Query  421   ASNGALHDKLLEKIG  377
             ASNGA+H+++L  +G
Sbjct  233   ASNGAIHEEMLSILG  247



>ref|WP_016515851.1| Inositol-1-monophosphatase [Microcystis aeruginosa]
 gb|EPF21484.1| Inositol-1-monophosphatase [Microcystis aeruginosa SPC777]
 gb|EPF21555.1| Inositol-1-monophosphatase [Microcystis aeruginosa SPC777]
Length=273

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      SDYLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLPGTDSDYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTSDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAANDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_011433751.1| inositol monophosphatase [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478379.1| inositol monophosphatase family protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03116.1| inositol monophosphatase family protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=270

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 147/257 (57%), Gaps = 6/257 (2%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             +++   AA     ++   V     I  K   DLVT  D+ SE  IL ++R++FP+ ++L 
Sbjct  1     MDVATEAALEAGALLRSYVGGTLAIEEKRPGDLVTAADRASEDLILKILRRHFPEDVILT  60

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G  G P   Y W IDPLDGTTNF H Y   AVS+ +L   +P    V +   G +  
Sbjct  61    EESGQQGSPEGAYAWMIDPLDGTTNFAHGYPFAAVSIGLLQGREPVLGVVCDVFRGDL--  118

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 + A  G GA  N Q + V+ T ++ +SLLVTG+ YDR ++   N   F  FT +++
Sbjct  119   ----FRAVQGMGATRNRQPIRVSTTAELSRSLLVTGFAYDRRETPDNNYAEFCHFTHLTQ  174

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRR G+A++D  +VA G ++ YWE  L PWD AAG+++V EAGG V+  DG    V+  
Sbjct  175   GVRRGGSAALDLAYVATGQLDGYWERGLSPWDIAAGIVLVREAGGKVTAYDGSPVDVYSG  234

Query  430   SVLASNGALHDKLLEKI  380
              +LASNG LH  L E++
Sbjct  235   RLLASNGWLHAALQEEL  251



>ref|WP_006511974.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Xenococcus sp. PCC 7305]
 gb|ELS01013.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Xenococcus sp. PCC 7305]
Length=271

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 144/259 (56%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA     V+ D     +NI  KG + DLVT+ DK +E  +L V+ ++ P H +
Sbjct  7     FLDIASEAALEAGTVLQDKFRNLKNIQEKGRSGDLVTEADKAAEAIVLKVLNRHVPGHQI  66

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G   + YLW IDPLDGTTN+ H Y   AVS+ ++  G P    V        
Sbjct  67    LAEESGTLGGNDAKYLWAIDPLDGTTNYAHGYPVSAVSIGLMIDGIPQVGVVYN------  120

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    + AA G GA  N + + V+ T +++ ++LVTG+ YDR ++   N   F   T +
Sbjct  121   PFRNELFRAAKGFGATLNHRPIQVSQTAQLKNTILVTGFAYDRRETTDNNYAEFCYLTHL  180

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAAS+D   VA G ++ YWE  L PWD  AG++IVEEAGGLV+  D     + 
Sbjct  181   TQGVRRSGAASIDLTDVACGRLDGYWERGLSPWDITAGIVIVEEAGGLVTAYDNSPVDIS  240

Query  436   DRSVLASNGALHDKLLEKI  380
                +L +N  +HD L + +
Sbjct  241   SGRLLVTNSKIHDSLSQAL  259



>ref|WP_017323604.1| inositol monophosphatase [cyanobacterium PCC 7702]
Length=276

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 140/234 (60%), Gaps = 9/234 (4%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             D+VT  D+ SE  I+  ++ +FPDH +L EE G  G+  +++LW IDPLDGTTNF H Y 
Sbjct  47    DIVTVADRASEQLIIKTLQLHFPDHAILSEELGQLGNQENEFLWAIDPLDGTTNFAHQYP  106

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
              FAVS+ +L  G P    + + V          + AA   GA  N + + V+ T ++ QS
Sbjct  107   CFAVSIGLLINGVPRVGVIYDPV------RNELFRAAQNLGATLNRRSIKVSQTSQLGQS  160

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T  ++GVRR GAAS+D  +VA G V+ YWE  + PW
Sbjct  161   LLVTGFAYDRRETSDNNYAEFCYLTHFTQGVRRSGAASLDLAYVACGRVDGYWERGISPW  220

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIGPATE  365
             D AAG++I++EAGG V+  DG    +    +LA+NG +H  L   L+++ P ++
Sbjct  221   DVAAGIIILQEAGGKVTAYDGTPIKIESGKILATNGHIHASLSHQLQQVPPLSD  274



>ref|WP_014101520.1| histidinol-phosphate phosphatase [Candidatus Chloracidobacterium 
thermophilum]
 ref|YP_004864299.1| fructose-1,6-bisphosphatase [Candidatus Chloracidobacterium thermophilum 
B]
 gb|AEP13782.1| Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol 
monophosphatase family [Candidatus Chloracidobacterium 
thermophilum B]
Length=260

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 155/264 (59%), Gaps = 7/264 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVL  974
             LL   +A A+    ++ +    P ++ +KG  DLVT+ D  +E  I   ++  FPDH +L
Sbjct  4     LLPFAEAVAREAGALLRERFGAPLDVRHKGRIDLVTEVDVLAEQCIRRRIQARFPDHAIL  63

Query  973   GEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMC  794
              EE G T + +S + W +DPLDGTTN+ H Y  F+V++A+ ++ +     +V  V  P+ 
Sbjct  64    AEESGLT-ETASAFRWIVDPLDGTTNYAHGYPFFSVAIAVEWQRE----IIVGVVYDPL-  117

Query  793   WSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVS  614
                  ++AA G+GA  NG+ L V+D   +EQ+LLVTG+ Y+   S   N++ F  F  V+
Sbjct  118   -RDELFSAAKGQGAQCNGRPLHVSDVTSLEQALLVTGFPYNVKASPQKNLDHFSAFLDVA  176

Query  613   RGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFD  434
             + +RR G+A++D  +VA G  + +WE  L PWD AAG L+V EAGG V+   G+ +  + 
Sbjct  177   QAIRRDGSAALDLAYVAAGRFDGFWELNLAPWDMAAGSLLVTEAGGQVTAFSGQAFSPYV  236

Query  433   RSVLASNGALHDKLLEKIGPATEK  362
               ++ASNG LH  + + +  +T +
Sbjct  237   PEIVASNGHLHAAMCQVLMKSTPQ  260



>ref|WP_024970828.1| inositol monophosphatase [Microcystis aeruginosa]
Length=273

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 149/264 (56%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
               L EE G      SDYLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GFLAEESGKLPGTDSDYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAAQGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTSDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAANDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_013246772.1| histidinol-phosphate phosphatase [Candidatus Nitrospira defluvii]
 ref|YP_003795872.1| inositol-phosphate phosphatase [Candidatus Nitrospira defluvii]
 emb|CBK39945.1| Inositol-phosphate phosphatase [Candidatus Nitrospira defluvii]
Length=273

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 147/244 (60%), Gaps = 6/244 (2%)
 Frame = -2

Query  1111  VVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDY  932
             V+++       I+YK   +LVTD D+ +E +I+  +    P H +L EE G  G   S Y
Sbjct  29    VLLEHARSGFRIDYKAAINLVTDADRGAEESIVRTILSAHPSHRILAEERGEDGAADSPY  88

Query  931   LWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGA  752
              W IDPLDGTTNF H +  ++VS+ +   G+     V++ V          +TA +G+GA
Sbjct  89    RWIIDPLDGTTNFAHGFPFYSVSIGLECDGECIVGVVLDPV------RRELFTAVLGQGA  142

Query  751   YANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFC  572
             Y NG++L V+    +E SLLVTG+ Y+  ++   N++ F   +  ++GVRR G+A++D  
Sbjct  143   YLNGERLRVSIIQTLEHSLLVTGFAYNIRETTNNNLDHFSRISLRAQGVRRTGSAALDLS  202

Query  571   HVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL  392
             +VA G  + YWE +L PWD AAG++I+ EAGG+VS     ++ ++ + ++A+NG +HD+L
Sbjct  203   YVAAGRFDGYWEVKLSPWDMAAGIVILREAGGVVSGFSRSRFSLYGQELVATNGHIHDQL  262

Query  391   LEKI  380
             L  I
Sbjct  263   LRAI  266



>ref|WP_005009368.1| Inositol-phosphate phosphatase [Nitrospina gracilis]
 emb|CCQ91053.1| Inositol-phosphate phosphatase [Nitrospina gracilis 3/211]
Length=265

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 137/230 (60%), Gaps = 7/230 (3%)
 Frame = -2

Query  1078  INYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTT  899
             I YKG  + VT+ D   E  I+D ++K FPDH VL EE G T    +D+LW IDPLDGT 
Sbjct  29    IRYKGDINPVTEVDLLCEKEIIDRIQKAFPDHAVLAEESGETVG-HADHLWVIDPLDGTI  87

Query  898   NFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTD  719
             N+ H Y  + VS+A     +    TVV  V  P       + A  GKGA  NG+ ++V+ 
Sbjct  88    NYAHGYPCYCVSIAY----RHENETVVGVVYNPSL--DELFVAEKGKGATMNGKPIAVSP  141

Query  718   TDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYW  539
                +++SLLVTG+ YD   +   N++ F  F    + VRR G+A++D C+ A+G  E +W
Sbjct  142   LANLKESLLVTGFAYDIHTATHNNLDHFINFISACQAVRRAGSAALDLCYTAMGRFEGFW  201

Query  538   EYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLL  389
             E +L  WD AAGVLI++EAGG V+R DG  +   DR +L SNG +HD ++
Sbjct  202   ELKLNTWDYAAGVLILQEAGGRVTRFDGTPFQYGDREILTSNGLIHDAMI  251



>ref|WP_002736852.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI09053.1| Inositol-1-monophosphatase [Microcystis aeruginosa PCC 7941]
 gb|ELP54309.1| inositol monophosphatase family protein [Microcystis aeruginosa 
TAIHU98]
Length=273

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      SDYLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLPGTDSDYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G G+  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAAQGLGSTLNRRPIHVSRTGELEKSLLVTGFAYDRCQTSDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAANDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_039714995.1| inositol monophosphatase [Scytonema millei]
 gb|KIF17433.1| inositol monophosphatase [Scytonema millei VB511283]
Length=276

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 150/259 (58%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA +   V++  + K   +  KG   DLVT  DK SE+ +L+V++++FPDH +
Sbjct  10    FLDIATEAALSAGAVLLGYLGKLEEVREKGRGGDLVTAADKASEVVVLEVLQRHFPDHAI  69

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G  G+  S++ W IDPLDGTTNF H Y  FA+S+ +L  G P    + +      
Sbjct  70    LAEESGKLGNADSEFCWAIDPLDGTTNFAHQYPCFAISIGLLVAGVPQVGVIFD------  123

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    +  A G  A  N + +SV+ T ++ + LLVTG+ YDR ++   N   F   T +
Sbjct  124   PYRDELFRGAKGTIATCNRKPISVSTTAELSKCLLVTGFAYDRRETADNNYAEFCHLTHL  183

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR GAA++D  +VA G V+ YWE  +  WD AAG+ I++ AGG VS  DG    + 
Sbjct  184   TQGVRRSGAAALDLAYVASGRVDGYWERGISLWDIAAGIAILKAAGGQVSAYDGSPIDLA  243

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG +H  L +++
Sbjct  244   TGRILATNGLIHPSLSQEL  262



>ref|WP_026099518.1| inositol monophosphatase [Prochlorothrix hollandica]
Length=277

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 151/269 (56%), Gaps = 12/269 (4%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMD--AVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFP  989
              + L+I   AA  G  V+           I  KG   DLVT  D+ SE A+L V++++ P
Sbjct  7     QRFLDIATEAALAGGAVLQAHWGTLDRHTIEEKGRPGDLVTVADRASEAAVLAVIQRHLP  66

Query  988   DHLVLGEEGGFTGDPSS---DYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVV  818
              H +L EE GF    ++   DYLW IDPLDGTTN+ H Y  + VS+A++ +G P    + 
Sbjct  67    HHSILAEESGFQATTTATAIDYLWAIDPLDGTTNYAHQYPFYGVSIALVIQGVPQVGVIY  126

Query  817   EFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMEL  638
                   + +    + AA G GA  N Q++ V+ T  +EQSLLVTG+ YDR ++   N   
Sbjct  127   ------VPFFQELFRAAQGLGATLNRQRIQVSSTATLEQSLLVTGFAYDRRETTDNNYRE  180

Query  637   FKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTD  458
             F   T +++GVRR G+ASVD  +VA G ++ YWE  L PWD AAGV++V EAGG V+  D
Sbjct  181   FCHLTHLTQGVRRGGSASVDLAYVACGRLDGYWERGLSPWDLAAGVVLVREAGGQVTAYD  240

Query  457   GEKYCVFDRSVLASNGALHDKLLEKIGPA  371
                + +    +LA+NG L  +L   +  A
Sbjct  241   QSPFDLPSGRILATNGHLQGELSAALAQA  269



>ref|WP_012814273.1| histidinol-phosphate phosphatase [Candidatus Methylomirabilis 
oxyfera]
 ref|YP_003204983.1| inositol-1-monophosphatase (Inositol-1-phosphatase) (I-1-Pase) 
[Candidatus Methylomirabilis oxyfera]
 emb|CBE67138.1| Inositol-1-monophosphatase (IMPase) (Inositol-1-phosphatase) 
(I-1-Pase) [Candidatus Methylomirabilis oxyfera]
Length=260

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 149/257 (58%), Gaps = 7/257 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             D +  +   AAK    ++   + + R I YKG  +LVT  D++SE AI D++R+  P H 
Sbjct  4     DMIRMVALRAAKEAGAILRQGLEQSRTIEYKGVKNLVTTVDRRSEAAIADLIRRKLPHHS  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             V+ EEG    D  S Y W IDPLDGTTN+ H Y  F+VS+ +   G+     +   V  P
Sbjct  64    VVCEEGTRL-DGDSGYRWLIDPLDGTTNYAHGYPCFSVSIGVEKDGE----LIFGLVYDP  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
                    +TA  G GA+ NG++L V+    +  +LL TG+  D   +   N++ F  F  
Sbjct  119   NL--EELFTAERGAGAFLNGKRLQVSTIHILSDALLATGFPNDVAGTKNNNLDYFVRFMK  176

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
              ++G+RR G+A++D C+VA G  +A+WE +L PWD AAGVL+V EAGG ++   G  + +
Sbjct  177   HAQGIRRPGSAALDLCYVAAGRFDAFWELKLYPWDMAAGVLMVTEAGGRITDLRGGPHHL  236

Query  439   FDRSVLASNGALHDKLL  389
              +  ++ASNG LH+++L
Sbjct  237   SNPQIVASNGLLHEEML  253



>ref|WP_002794377.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI25906.1| Inositol-1-monophosphatase [Microcystis aeruginosa PCC 9808]
Length=273

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      +DYLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLPGTDNDYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAANDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_012597922.1| inositol monophosphatase [Cyanothece sp. PCC 7424]
 ref|YP_002375843.1| inositol-phosphate phosphatase [Cyanothece sp. PCC 7424]
 gb|ACK68975.1| Inositol-phosphate phosphatase [Cyanothece sp. PCC 7424]
Length=272

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 154/277 (56%), Gaps = 15/277 (5%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTD-LVTDTDKKSELAILDVVRKNFPDHL  980
             Q L+I   AA  G  ++ +   K   +  KG +D LVTD DK SE  IL V+ ++ P+H 
Sbjct  8     QFLDIATEAAMAGGVILQEHWGKINTVEEKGQSDDLVTDVDKLSEKEILKVLGRHLPEHG  67

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G  G+  + YLW IDP+DGTTN+ H Y    VSV +L  G P    V       
Sbjct  68    ILAEESGQIGEVDNPYLWAIDPVDGTTNYAHGYPVSCVSVGLLIEGVPQVGVVYN-----  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               +    + AA G GA  N + + V+  DK+ +SLLV+G+ YDR  +   N   F   T 
Sbjct  123   -PFRNELFRAARGLGATLNRRPIRVSSVDKLSKSLLVSGFAYDRRQTPDNNYREFCYLTH  181

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D   VA G ++ YWE  ++PWD  AG++I+EEAGG VS  D     +
Sbjct  182   LTQGVRRSGSAALDLTDVACGRLDGYWERGIKPWDITAGIVILEEAGGKVSAYDESPLEI  241

Query  439   FDRSVLASNGALHDKLLEKIGPATEKLKNKGVDFSLW  329
                 +LA+NG +H  L       ++ LKN  ++++ W
Sbjct  242   ESGRILATNGLIHSSL-------SQSLKN-AINWTPW  270



>ref|WP_002745870.1| inositol monophosphatase family protein [Microcystis aeruginosa]
 emb|CAO88386.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS46747.1| inositol monophosphatase family protein [Microcystis aeruginosa 
DIANCHI905]
Length=273

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      +DYLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLPGTDNDYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAANDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>gb|AIE72720.1| Inositol-1-monophosphatase [Synechocystis sp. PCC 6714]
Length=287

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/265 (39%), Positives = 149/265 (56%), Gaps = 9/265 (3%)
 Frame = -2

Query  1165  PSD--QLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKN  995
             PSD    LEI   AA      ++    K + +  KG   DLVT+ D+++E  IL+++++ 
Sbjct  11    PSDLQTWLEIATEAALAAGAEILSLWGKVQQVQEKGRAGDLVTEADRQAEAIILEIIKRR  70

Query  994   FPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVE  815
              PDH +L EE G  G   + + W IDPLDGTTNF HSY    VS+ +L +G P    V  
Sbjct  71    CPDHAILAEESGQLGQVDNPFCWAIDPLDGTTNFAHSYPVSCVSIGLLIQGIPTVGVVYN  130

Query  814   FVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELF  635
                    +    + AA G GA  N Q + V+ T  + +SLLVTG+ YDR  +   N   F
Sbjct  131   ------PFRQELFRAATGLGATLNRQPIRVSTTTVLAKSLLVTGFAYDRVKTLDNNYPEF  184

Query  634   KEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDG  455
                T +++GVRR G+A++D   VA G ++ YWE  + PWD AAG++IV+EAGG VS  DG
Sbjct  185   CHLTHLTQGVRRSGSAAIDLIDVACGRLDGYWERGINPWDMAAGIVIVQEAGGTVSAYDG  244

Query  454   EKYCVFDRSVLASNGALHDKLLEKI  380
                 +    +LA+NG +H +L + +
Sbjct  245   SPLELSTGRILATNGKIHRELSQAL  269



>ref|WP_011243838.1| inositol monophosphatase [Synechococcus elongatus]
 ref|YP_172238.1| myo-inositol-1(or 4)-monophosphatase [Synechococcus elongatus 
PCC 6301]
 ref|YP_401599.1| myo-inositol-1(or 4)-monophosphatase [Synechococcus elongatus 
PCC 7942]
 dbj|BAD79718.1| myo-inositol-1(or 4)-monophosphatase [Synechococcus elongatus 
PCC 6301]
 gb|ABB58612.1| myo-inositol-1(or 4)-monophosphatase [Synechococcus elongatus 
PCC 7942]
 gb|AJD56935.1| inositol monophosphatase [Synechococcus sp. UTEX 2973]
Length=273

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 142/226 (63%), Gaps = 6/226 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DL+T+ D+ +E A+L V+ ++ PDH VL EE G++GD   ++ W +DPLDGTTN+ H Y 
Sbjct  45    DLLTEADRAAEAAVLSVLERHCPDHAVLAEESGWSGDRQQEFSWAVDPLDGTTNYAHGYP  104

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
                 S+A+L++ +P    +V     P  +    + AA G GA  N Q + V+ T+K+ +S
Sbjct  105   FCGTSIALLYQNQP----IVGVFYAP--YLKELFRAAQGLGATLNRQPIRVSKTEKLAKS  158

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR +    N   F   T V++GVRR G+A++D  +VA G ++ YWE  L PW
Sbjct  159   LLVTGFAYDRCEVEDNNYAEFCRLTHVTQGVRRGGSAALDLSYVACGRLDGYWERGLSPW  218

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKI  380
             D AAGV++V+EAGGLV+  D   + +    +LA+NG +H +L E +
Sbjct  219   DLAAGVVLVQEAGGLVTAYDRSPFDISSGRILATNGQIHAELSETL  264



>ref|WP_006528747.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Gloeocapsa sp. PCC 73106]
 gb|ELR98419.1| inositol monophosphatase/fructose-1,6-bisphosphatase family protein 
[Gloeocapsa sp. PCC 73106]
Length=272

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 149/259 (58%), Gaps = 7/259 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNKPRNINYKG-FTDLVTDTDKKSELAILDVVRKNFPDHLV  977
              L+I   AA +   ++ ++  K   +  KG   DLVT+ D ++E+AIL++++++FPDH +
Sbjct  9     FLDIATEAALSAGGIIEESWGKLHKVIQKGRIGDLVTEVDTQAEVAILEIIQRHFPDHSI  68

Query  976   LGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPM  797
             L EE G     +  YLW IDPLDGTTN+ H Y   AVS+ +L  G P    V        
Sbjct  69    LAEESGQIDKNNRKYLWAIDPLDGTTNYAHGYPVAAVSIGLLIEGIPKVGVVYN------  122

Query  796   CWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGV  617
              +    +  A   GA  N + + V+ T  + +SLLV+G+ YDR ++   N   F   T +
Sbjct  123   PFRRELFRGATDLGATCNRRPIQVSSTATLAESLLVSGFAYDRRETSDNNYAEFCYLTHL  182

Query  616   SRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVF  437
             ++GVRR G+A++D   VA G V+ YWE  +RPWD AAG++IVEEAGG VS  D +   + 
Sbjct  183   TQGVRRSGSAALDLTDVACGRVDGYWERGIRPWDIAAGIVIVEEAGGKVSAYDQKPLSLE  242

Query  436   DRSVLASNGALHDKLLEKI  380
                +LA+NG +H  L + +
Sbjct  243   SGRILATNGHVHPFLSQAL  261



>ref|WP_012641591.1| histidinol-phosphate phosphatase [Thermomicrobium roseum]
 ref|YP_002521433.1| inositol-1-monophosphatase [Thermomicrobium roseum DSM 5159]
 gb|ACM05295.1| inositol-1-monophosphatase [Thermomicrobium roseum DSM 5159]
Length=265

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/256 (38%), Positives = 147/256 (57%), Gaps = 7/256 (3%)
 Frame = -2

Query  1147  EIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGE  968
             ++  AAA +   ++ + + + R I YKG  +LVT+ D  SE  I++ ++  FP+H    E
Sbjct  9     QVAVAAALSAGRLLRERLGRVREIRYKGAVNLVTEVDIASERLIVETIQAAFPEHAFFTE  68

Query  967   EGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWS  788
             EG  +    +  LW IDPLDGTTN+ H Y  F VS+A L  G+P  + V + V   +   
Sbjct  69    EGTGSASLDAPALWVIDPLDGTTNYAHGYPMFCVSIAFLCEGEPEFAVVYQPVLDEL---  125

Query  787   TRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRG  608
                + A  G GA+ NG++L V+    +  +LL TG+ YDR+      +  F  FT  +R 
Sbjct  126   ---FIAERGVGAFLNGERLRVSQHADLHSALLATGFPYDRERR-REALAAFARFTLTARA  181

Query  607   VRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRS  428
             VRR G+A+++  +VA G  + +WE  L PWD AAG L+V EAGG V+  DG+ Y +   +
Sbjct  182   VRRDGSAALNLAYVAAGRFDGFWEQELSPWDTAAGTLLVTEAGGRVTDYDGQPYRLTQGT  241

Query  427   VLASNGALHDKLLEKI  380
              +ASNG +HD +L+ I
Sbjct  242   CVASNGLIHDAMLDLI  257



>ref|WP_011958020.1| histidinol-phosphate phosphatase [Roseiflexus sp. RS-1]
 ref|YP_001277627.1| inositol monophosphatase [Roseiflexus sp. RS-1]
 gb|ABQ91677.1| inositol monophosphatase [Roseiflexus sp. RS-1]
Length=262

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 155/255 (61%), Gaps = 8/255 (3%)
 Frame = -2

Query  1141  VQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEG  962
             ++ A + GA ++M  + + R++  K   ++VT+ D++SE  I+  +R  FPDH +L EEG
Sbjct  15    IETARRAGA-LLMAGLERRRSLELKSAYEVVTEVDRESEALIVSAIRHAFPDHAILAEEG  73

Query  961   GFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTR  782
             G   + +S +LW IDPLDGT N+ H +  FAVS+A++  G+     V +    P+     
Sbjct  74    GGI-ERTSPFLWLIDPLDGTNNYAHGFPFFAVSIALMEDGELRLGVVFD----PL--RDE  126

Query  781   TYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVR  602
              ++A  G GA+ N Q+L V+DT  +  SL+ TG+ YD   +   N   F      ++GVR
Sbjct  127   LFSAERGAGAWRNDQRLRVSDTPALAASLVSTGFPYDFATTTDNNTRQFTRIQARTQGVR  186

Query  601   RLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVL  422
             R G+A++D  +VA G ++A+WE RL+PWD AAG L+V EAGG +S   G+ +  ++  ++
Sbjct  187   RAGSAALDLAYVASGRLDAHWELRLKPWDTAAGALLVLEAGGRLSDWRGQPWNPWNDRLV  246

Query  421   ASNGALHDKLLEKIG  377
             ASNG +HD+L+  + 
Sbjct  247   ASNGRIHDELIAALA  261



>ref|WP_013179221.1| myo-inositol-1-monophosphatase [Truepera radiovictrix]
 ref|YP_003706405.1| inositol monophosphatase [Truepera radiovictrix DSM 17093]
 gb|ADI15862.1| inositol monophosphatase [Truepera radiovictrix DSM 17093]
Length=267

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 143/232 (62%), Gaps = 12/232 (5%)
 Frame = -2

Query  1060  TDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSD--YLWCIDPLDGTTNFTH  887
              DLVT  DK+SE  I +V+  ++PDH+VLGEE    G P  D  Y W +DPLDGT N+ H
Sbjct  39    ADLVTRVDKESEALIREVLLSSYPDHVVLGEE---EGQPGGDAPYRWIVDPLDGTLNYAH  95

Query  886   SYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKV  707
             ++  + VS+A+   G      V++   G +  +TR      G GAY NG  + V+    V
Sbjct  96    AFPFYCVSIALEVEGTVQVGVVLDSARGELFSATR------GGGAYLNGAPIEVSRQRTV  149

Query  706   EQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRL  527
              Q++L TG+ Y  +D+ A N+E+F       R VRRLGAA++D  +VA G ++ +W+ +L
Sbjct  150   AQAMLGTGFAY-AEDAIAQNVEVFARMLSRCRAVRRLGAAALDLAYVAAGRLDGFWQLQL  208

Query  526   RPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLLEKIGPA  371
             +PWD AAG+L+VEEAGG VS   GE Y + D +++A+N  LHD+L+  +G A
Sbjct  209   KPWDVAAGLLLVEEAGGRVSNGSGEPYRMGDGALVAANAHLHDELVTALGLA  260



>ref|WP_028324287.1| hypothetical protein [Desulfatirhabdium butyrativorans]
Length=265

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 141/258 (55%), Gaps = 6/258 (2%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             D +L     AA  G +++        ++  KG  DLV++ D  SE AI++ +R   PDH 
Sbjct  7     DTILRTAVRAAYRGGKILRRHFGNLHHVRKKGAIDLVSEADTSSEAAIIETIRSRHPDHA  66

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G + +  + + W IDPLDGTTNF H    FAVS+ + +RG+     V+    G 
Sbjct  67    ILAEESGASREEHATFQWIIDPLDGTTNFVHQIPVFAVSIGVSYRGELVVGVVLNPASGE  126

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      ++A  G+GA+ NG+ + V+ T  ++ SLL TG+ Y         +  F     
Sbjct  127   L------FSAVYGEGAWRNGEPIHVSSTASIQDSLLATGFPYQARRMIDVVVPRFSRCLQ  180

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
              ++G+RRLGAA++D C++A G  + +WE  L+PWD AAG +I  EAG  ++      Y +
Sbjct  181   AAQGIRRLGAAAIDLCYLACGRFDGFWEQNLKPWDTAAGTVIAREAGARITDFSNHPYTL  240

Query  439   FDRSVLASNGALHDKLLE  386
                 +L +NG +H+ LL+
Sbjct  241   ASDQILVTNGRIHEDLLQ  258



>ref|WP_010475015.1| inositol monophosphatase [Acaryochloris sp. CCMEE 5410]
Length=277

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 149/262 (57%), Gaps = 9/262 (3%)
 Frame = -2

Query  1150  LEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLG  971
             L+I   AA  G  V+     K  NI  K   DLVT+ D+ +E A+L V+ ++FP H +L 
Sbjct  10    LDIATEAALAGGGVLQQFWGKLENIQEKRPGDLVTEADQAAEKAVLAVIGRHFPGHQILA  69

Query  970   EEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCW  791
             EE G  G+  S+YLW IDPLDGTTN+ H Y   A S+A++ RG P    + +       +
Sbjct  70    EESGQQGNQDSEYLWAIDPLDGTTNYAHQYPFSATSIALIIRGVPTVGVIYD------PF  123

Query  790   STRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSR  611
                 +  A G GA  N Q + V+ T  +  SLLVTG+ YDR ++   N   F   T +S+
Sbjct  124   HRELFRGATGLGATRNRQPIHVSSTSSLASSLLVTGFAYDRRETKDNNYAEFCHLTHLSQ  183

Query  610   GVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDR  431
             GVRR G+AS+D  ++A G ++ YWE  L PWD AAG+++V+EAGG V+  D     +   
Sbjct  184   GVRRGGSASIDLAYIACGRLDGYWERGLSPWDIAAGIVLVQEAGGTVTAYDQSPQQLASG  243

Query  430   SVLASNGALHDKL---LEKIGP  374
              +LA+NG +H  L   L KI P
Sbjct  244   RLLATNGHIHAALSHELLKIQP  265



>ref|WP_012173433.1| inositol-phosphate phosphatase [Desulfococcus oleovorans]
 ref|YP_001527891.1| inositol-phosphate phosphatase [Desulfococcus oleovorans Hxd3]
 gb|ABW65814.1| Inositol-phosphate phosphatase [Desulfococcus oleovorans Hxd3]
Length=260

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 142/251 (57%), Gaps = 7/251 (3%)
 Frame = -2

Query  1132  AAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFT  953
             AA  GA  +        +++ KG  DLVT+ D+ SE AI+D +   FPDH VL EE G T
Sbjct  15    AAFKGARALRAFFRGRFSVDKKGVRDLVTEADRASEKAIVDEIHYRFPDHAVLAEESGAT  74

Query  952   GDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYT  773
             G   S+Y W +DPLDGTTNF H    F VS+A    G+  A  V+    G +      +T
Sbjct  75    G-TRSEYRWIVDPLDGTTNFAHGLGLFCVSIAFAENGEVTAGVVLNPETGEL------FT  127

Query  772   AAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLG  593
             A V  GA  NG  ++V+ T  +  SLL TG+ YD D      M         SRG+RRLG
Sbjct  128   ATVDHGAELNGAPIAVSGTSTLSDSLLATGFPYDVDKRLDPVMARLSRCMAASRGIRRLG  187

Query  592   AASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASN  413
             +A++D C+VA G  + +WE  L PWD AAG+LI   AG  V+   G+ +    +++LA+N
Sbjct  188   SAALDLCYVACGRFDGFWEEGLYPWDTAAGMLIARRAGATVTDFSGKAFVPEQKTILATN  247

Query  412   GALHDKLLEKI  380
             G +H+++L+++
Sbjct  248   GLIHNEILKEM  258



>ref|WP_025323069.1| hypothetical protein [Deferrisoma camini]
Length=267

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 154/260 (59%), Gaps = 8/260 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             D LLEI   AA+    ++ D       + +KG  DLVT+ D + E AI  V+ +  P   
Sbjct  4     DDLLEIAVEAARAAGRILRDRFETGFGVRHKGAVDLVTEVDLECEEAIRQVLGRLAPGTP  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             VLGEE G TG   +   W +DPLDGTTN+ H + +  VS+A    G+  A  V + + G 
Sbjct  64    VLGEEEGLTGTGDAGR-WIVDPLDGTTNYAHGFPACCVSIAWEEGGRVRAGVVYDPLRGE  122

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
               W    +TA  G+GA  NG+ + V++T ++ ++LL TG+ YDR ++   N   F   T 
Sbjct  123   --W----FTARQGRGAQRNGEPIRVSETARLSEALLATGFPYDRGEN-PRNYREFCHLTQ  175

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
             +++GVRR G+A++D  + A G ++ +WE  L+PWD AAG L+VEEAGG+V+  DG  +  
Sbjct  176   ITQGVRRTGSAALDLAYTACGRLDGFWEPGLKPWDLAAGCLLVEEAGGVVTGYDGGPFTP  235

Query  439   FDRSVLASNGALHDKLLEKI  380
             +DR V+A+N  LH +LLE +
Sbjct  236   YDRDVVAANPKLHPELLEAL  255



>ref|WP_015222591.1| inositol monophosphatase [Cyanobacterium stanieri]
 ref|YP_007164922.1| inositol monophosphatase [Cyanobacterium stanieri PCC 7202]
 gb|AFZ47273.1| inositol monophosphatase [Cyanobacterium stanieri PCC 7202]
Length=278

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  1057  DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYA  878
             DLVT  DK+SE  ++ V++++ PDH +  EE G +G  +  Y W IDPLDGTTN+ H Y 
Sbjct  43    DLVTQVDKESEAEVIKVIQRHCPDHAIFAEESGKSGTQNHKYQWVIDPLDGTTNYAHGYP  102

Query  877   SFAVSVAILFRGKPAASTVVEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQS  698
               AVS+ +   G P+   V      PM      + A  G GA  NGQ + V+ T +++ S
Sbjct  103   QAAVSIGLNIDGIPSVGVVYN----PM--KEELWCAGKGLGATLNGQTIRVSHTQELKDS  156

Query  697   LLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPW  518
             LLVTG+ YDR ++   N   F   T +++GVRR G+AS+D C +A G ++ YWE  L PW
Sbjct  157   LLVTGFAYDRRETNDNNYAEFCYLTHLTQGVRRAGSASLDLCELAGGRLDGYWERGLSPW  216

Query  517   DNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKLL  389
             D  AGV+IV EAGG ++  DG  + +    +LA+NG +H+ L+
Sbjct  217   DLLAGVVIVTEAGGYITAYDGSPFDINTGRILATNGKIHEALM  259



>ref|WP_008197778.1| inositol monophosphatase [Microcystis sp. T1-4]
 emb|CCI30951.1| Inositol-1-monophosphatase [Microcystis sp. T1-4]
Length=273

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     ++ D   K   I  KG + DLVT+ D+++E  IL ++ ++FP+H
Sbjct  9     EKYLDIASEAALVAGTIIEDNWGKIEKIEEKGRSGDLVTEIDRRAETEILKIIGRHFPEH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      S+YLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLQRTDSEYLWAIDPLDGTTNYAHGYPVAVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGATLNRRAIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG ++  D   + 
Sbjct  183   HLTQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKITAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_002768969.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI03174.1| Inositol-1-monophosphatase [Microcystis aeruginosa PCC 9443]
Length=273

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      S+YLW IDPLDGTTN+ H Y    VS+ +L  GK A   +      
Sbjct  69    GILAEESGKLPGTDSEYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGKAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G G+  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGSTLNRRPIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAG++I+EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDLAAGIVIIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   METGRILATNGHIHTSLSQALQKA  266



>ref|WP_038507684.1| histidinol phosphate phosphatase [Leptospirillum ferriphilum]
 gb|AIA31296.1| histidinol phosphate phosphatase [Leptospirillum ferriphilum 
YSK]
Length=261

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 152/254 (60%), Gaps = 8/254 (3%)
 Frame = -2

Query  1144  IVQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEE  965
             + + AA +   ++++  ++   I+YKG  DLVT+ D  SE  I+ ++R  FP+H +LGEE
Sbjct  7     VAREAALSAGNILLEGYSREIKISYKGTIDLVTEIDWASEKEIVRLIRSRFPEHSILGEE  66

Query  964   GGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWST  785
             GG    P ++  W IDPLDGTTN+TH +  F +S+     G+     V +    P+    
Sbjct  67    GGVLAGPGTER-WIIDPLDGTTNYTHHFPFFCISIGFESEGEVLYGLVFD----PL--RQ  119

Query  784   RTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDR-DDSWATNMELFKEFTGVSRG  608
             + + A   +GA  N +++SV+ + ++ QSLLVTG+   + +D    N+  F + +   +G
Sbjct  120   QIFEAVKEEGAMLNERRISVSRSPRLSQSLLVTGFSSSKPEDPERDNLPFFNQLSRKVQG  179

Query  607   VRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRS  428
             +RR G+A++D C+VA+G V+ +WE  L PWD AAG LIV EAGG  S     ++ +    
Sbjct  180   IRRTGSAALDLCYVAMGAVDGFWEIGLAPWDTAAGSLIVREAGGRTSDRKNARHELTSPM  239

Query  427   VLASNGALHDKLLE  386
             ++ASNG +HD++++
Sbjct  240   IVASNGIIHDEIID  253



>ref|WP_002795757.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI21750.1| Inositol-1-monophosphatase [Microcystis aeruginosa PCC 9809]
Length=273

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP+H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPEH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      S+YLW IDPLDGTTN+ H Y    VS+ +L  G  A   +      
Sbjct  69    GILAEESGKLQGRDSEYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGIAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGQIHTPLSQALQKA  266



>ref|WP_012266817.1| inositol monophosphatase [Microcystis aeruginosa]
 ref|YP_001659136.1| myo-inositol-1(or 4)-monophosphatase [Microcystis aeruginosa 
NIES-843]
 dbj|BAG03944.1| probable myo-inositol-1(or 4)-monophosphatase [Microcystis aeruginosa 
NIES-843]
Length=266

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP+H
Sbjct  2     EKYLDIASEAALAAGTIILDNWGKIETIEEKGRSGDLVTEIDRRAETEILKIIGRHFPEH  61

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      S+YLW IDPLDGTTN+ H Y    VS+ +L  G  A   +      
Sbjct  62    GILAEESGKLPGTDSEYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGIAAVGVIYN----  117

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  118   --PFRKELFRAARGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTPDNNYAEFCYLT  175

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAG++++EEAGG +S  D   + 
Sbjct  176   HLTQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDLAAGIILIEEAGGKISAYDESPFL  235

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  236   IETGRILATNGQIHTPLSQALQKA  259



>ref|WP_002781271.1| Inositol-1-monophosphatase [Microcystis aeruginosa]
 emb|CCI15623.1| Inositol-1-monophosphatase [Microcystis aeruginosa PCC 9806]
Length=273

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 149/264 (56%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP H
Sbjct  9     EKYLDIASEAALAAGTIILDNWGKIEKIEEKGRSGDLVTEIDRRAETEILKIISRHFPKH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      S+YLW IDPLDGTTN+ H Y    VS+ +L  G  A   +      
Sbjct  69    GILAEESGKLPGTDSEYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGIAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGATLNRRPIHVSRTSELEKSLLVTGFAYDRCQTSDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+A+ D   VA G ++ YWE  + PWD AAGV+++EEAGG +S  D   + 
Sbjct  183   HLTQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDLAAGVILIEEAGGKISAYDESPFL  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   IETGRILATNGHIHTPLSQALQKA  266



>ref|WP_011125089.1| MULTISPECIES: inositol monophosphatase [Prochlorococcus]
 ref|NP_875329.1| inositol monophosphatase family [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAP99981.1| inositol monophosphatase family [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG13779.1| Inositol-1-monophosphatasee [Prochlorococcus marinus str. LG]
 gb|KGG18914.1| Inositol-1-monophosphatasee [Prochlorococcus marinus str. SS2]
 gb|KGG23548.1| Inositol-1-monophosphatasee [Prochlorococcus marinus str. SS35]
 gb|KGG32216.1| Inositol-1-monophosphatasee [Prochlorococcus marinus str. SS51]
 gb|KGG35092.1| Inositol-1-monophosphatasee [Prochlorococcus sp. SS52]
Length=287

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 164/302 (54%), Gaps = 26/302 (9%)
 Frame = -2

Query  1249  SICAKAVMSEVESKKEYLRIGADSTGSIPSDQLLEIVQAAAKTGAEVVMDAVNKPRNINY  1070
             +IC +AV     S+K+  +             L ++ ++AA  G EV+M+   K   IN 
Sbjct  4     NICDQAVSDSGISQKDLTK-------------LTDLAKSAALQGGEVLMNYYRKINTINN  50

Query  1069  KGFT-DLVTDTDKKSELAILDVVRKNFPDHLVLGEEGGFTGDPSSDYLWCIDPLDGTTNF  893
             KG   DLVT+ D ++E  I+ ++    P+  +  EEGG +G P+  Y+WCIDPLDGTTN+
Sbjct  51    KGLEGDLVTNADIEAENLIVSLLNNKTPEFGIFAEEGGVSG-PTDSYVWCIDPLDGTTNY  109

Query  892   THSYASFAVSVAILFRGKPAASTV-VEFVGGPMCWSTRTYTAAVGKGAYANGQKLSVTDT  716
              H Y  FA S+ + +  KP    + + F+          Y A  G+G++ N QK+ V+ +
Sbjct  110   AHGYPFFACSIGLTWNNKPMLGAISIPFI-------KELYWATPGQGSFCNDQKIEVSTS  162

Query  715   DKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRGVRRLGAASVDFCHVALGIVEAYWE  536
               + +SLLVTG+ YDR  +   N   F   T  +RGVRR GAA+VD   VA G ++ YWE
Sbjct  163   KVLNESLLVTGFAYDRHSTEDNNYAEFCWLTHRTRGVRRGGAAAVDMAFVASGRIDGYWE  222

Query  535   YRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRSVLASNGALHDKL---LEKIGPATE  365
               L  WD AAG+ +VE AGGL+S     ++ +    +LASN  +  +L   L+K+ P   
Sbjct  223   RGLSKWDIAAGIPLVELAGGLISDYKSNEFDLDRGRILASNPYIQKELLSELKKVSPLET  282

Query  364   KL  359
             K 
Sbjct  283   KF  284



>ref|WP_016952094.1| inositol monophosphatase [Anabaena sp. PCC 7108]
Length=269

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/265 (37%), Positives = 151/265 (57%), Gaps = 8/265 (3%)
 Frame = -2

Query  1156  QLLEIVQAAAKTGAEVVMDAVNKPRN-INYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
               L+I   AA     ++ D + K  +    KG   DLVT  DK SE  IL+++ ++FP H
Sbjct  6     NFLDIATEAALNAGIILQDYLGKVADATTEKGRPGDLVTAADKASEKVILEILHRHFPQH  65

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G  G+  ++YLW IDPLDGTTN+ H Y  FAVS+ +   G      + +    
Sbjct  66    SILAEESGKLGNQENEYLWAIDPLDGTTNYAHQYPCFAVSIGLFINGISQVGVIYD----  121

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G GA  N + + V+ T+++ +SLL TG+ YDR ++   N   F   T
Sbjct  122   --PFHNELFRAAAGLGATRNRRPIKVSQTNELSKSLLTTGFAYDRRETSDNNYAEFCHLT  179

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +++GVRR G+AS+D  +VA G V+ YWE  + PWD AAG+++++EAGG V+  D   + 
Sbjct  180   HLTQGVRRGGSASLDLAYVACGRVDGYWERGIAPWDIAAGIILLQEAGGKVTAYDNTPFQ  239

Query  442   VFDRSVLASNGALHDKLLEKIGPAT  368
             +    +LA+N  +H+ L +++   T
Sbjct  240   IDSGRILATNCCIHNNLSQELMKVT  264



>dbj|GAL94478.1| inositol-1-monophosphatase [Microcystis aeruginosa NIES-44]
Length=276

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 150/264 (57%), Gaps = 7/264 (3%)
 Frame = -2

Query  1159  DQLLEIVQAAAKTGAEVVMDAVNKPRNINYKGFT-DLVTDTDKKSELAILDVVRKNFPDH  983
             ++ L+I   AA     +++D   K   I  KG + DLVT+ D+++E  IL ++ ++FP+H
Sbjct  9     EKYLDIASEAALAAGTIILDNWCKIEIIEEKGRSGDLVTEIDRRAEREILKIISRHFPEH  68

Query  982   LVLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGG  803
              +L EE G      SDYLW IDPLDGTTN+ H Y    VS+ +L  G  A   +      
Sbjct  69    GILAEESGKMPGTDSDYLWAIDPLDGTTNYAHGYPVSVVSIGLLIAGIAAVGVIYN----  124

Query  802   PMCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFT  623
                +    + AA G G+  N + + V+ T ++E+SLLVTG+ YDR  +   N   F   T
Sbjct  125   --PFRKELFRAARGLGSTLNRRPIHVSRTSELEKSLLVTGFAYDRCQTQDNNYAEFCYLT  182

Query  622   GVSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYC  443
              +S+GVRR G+A+ D   VA G ++ YWE  + PWD AAG++++EEAGG +S  D   + 
Sbjct  183   HLSQGVRRSGSAAKDLTDVACGRLDGYWERGINPWDMAAGIILIEEAGGKISAYDESPFR  242

Query  442   VFDRSVLASNGALHDKLLEKIGPA  371
             +    +LA+NG +H  L + +  A
Sbjct  243   METGRILATNGQIHTPLSQALQKA  266



>ref|WP_032138353.1| inositol monophosphatase [Coxiella burnetii]
Length=265

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 153/269 (57%), Gaps = 9/269 (3%)
 Frame = -2

Query  1153  LLEIVQAAAKTGAEVVMDAVNK--PRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHL  980
             +L I   AA+  A  ++  V++    +IN K   D VT  D+ SE  I++ + K +PDH 
Sbjct  4     MLNIAIQAARNAARTIVRFVDRLDTLDINEKTRNDFVTQVDRLSEDEIINTIHKAYPDHT  63

Query  979   VLGEEGGFTGDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGP  800
             +L EE G      +DY W IDPLDGT NF H +  FA+S+A+ +RG    +  +  V  P
Sbjct  64    ILAEETGLQ-KYKNDYTWIIDPLDGTANFIHGFPQFAISIALKYRG----TLEIGLVYDP  118

Query  799   MCWSTRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTG  620
             +      +TA  G GA  N +K+ V+   K+  +L+ TG+ +   + +   +++F+    
Sbjct  119   L--RQELFTATRGSGAQLNNRKIRVSSCQKLSHALIGTGFPFKAKELFPAYLKIFEAVFP  176

Query  619   VSRGVRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCV  440
              + GVRR GAA++D  +VA G ++ +WE  LRPWD AAG+L++ EAGG+VS   GEK  +
Sbjct  177   QTSGVRRAGAAALDLAYVAAGRLDGFWEMSLRPWDMAAGILLITEAGGIVSDFQGEKNYM  236

Query  439   FDRSVLASNGALHDKLLEKIGPATEKLKN  353
              + +V+A N  +H  LLE +      ++N
Sbjct  237   ENGNVIAGNPRIHKALLEIVSKKHSPVRN  265



>ref|WP_008481279.1| histidinol-phosphate phosphatase [Nitrolancea hollandica]
 emb|CCF85932.1| Inositol-1-monophosphatase [Nitrolancea hollandica Lb]
Length=262

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 152/254 (60%), Gaps = 10/254 (4%)
 Frame = -2

Query  1141  VQAAAKTGAEVVMDAVNKPRNINYKGFTDLVTDTDKKSELAILDVVRKNFPDHLVLGEEG  962
             + AA + G  ++ D + + R++ YKG  DLVT+ D+ SE  I++ +R++FPD+ +L EE 
Sbjct  10    ISAACEAGG-ILRDMIGRIRHVRYKGVVDLVTEADELSERHIMNRLRESFPDYQILAEES  68

Query  961   GFT--GDPSSDYLWCIDPLDGTTNFTHSYASFAVSVAILFRGKPAASTVVEFVGGPMCWS  788
             G T   +  S   W +DPLDGT N+ H Y  FAVS+A+   G      V+E     +   
Sbjct  69    GKTTPSEGESTSRWIVDPLDGTVNYAHGYPIFAVSIALEVSG------VIELGVVYVPPL  122

Query  787   TRTYTAAVGKGAYANGQKLSVTDTDKVEQSLLVTGYGYDRDDSWATNMELFKEFTGVSRG  608
                + A  G GA  NG+ + V+ TD + QS++ TG+ YD ++    N+  +  F   ++ 
Sbjct  123   DELFVAERGAGATLNGEPIHVSTTDSLIQSMVTTGFPYDLEER-GQNIVHWGNFIHATQA  181

Query  607   VRRLGAASVDFCHVALGIVEAYWEYRLRPWDNAAGVLIVEEAGGLVSRTDGEKYCVFDRS  428
             VRR G+A++D C+VA G  + +WE  L PWD AAG L+V EAGGL++   G+ + V+ R 
Sbjct  182   VRRDGSAAMDLCYVAAGRFDGFWERWLNPWDVAAGGLMVTEAGGLLTDFQGQPFSVYRRE  241

Query  427   VLASNGALHDKLLE  386
              LASNG +HD+++E
Sbjct  242   CLASNGLIHDQMIE  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3804414986880