BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78406_g1_i1 len=2089 path=[1:0-2088]

Length=2089
                                                                      Score     E

ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               757   0.0      
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               753   0.0      
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               726   0.0      
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               696   0.0      
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               694   0.0      
emb|CDP12889.1|  unnamed protein product                                692   0.0      
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               690   0.0      
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               688   0.0      
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    686   0.0      
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               683   0.0      
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               683   0.0      
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               682   0.0      
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               681   0.0      
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               681   0.0      
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               681   0.0      
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               673   0.0      
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                669   0.0      
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               665   0.0      
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               659   0.0      
gb|EPS72790.1|  hypothetical protein M569_01963                         655   0.0      
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    654   0.0      Vitis vinifera
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    649   0.0      
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    647   0.0      Vitis vinifera
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                640   0.0      
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             639   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               639   0.0      
gb|EPS57870.1|  hypothetical protein M569_16947                         637   0.0      
emb|CDP12888.1|  unnamed protein product                                636   0.0      
emb|CAN80536.1|  hypothetical protein VITISV_035975                     635   0.0      Vitis vinifera
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                624   0.0      
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         623   0.0      
ref|XP_007048137.1|  Cytochrome P450                                    623   0.0      
gb|KDP35257.1|  hypothetical protein JCGZ_09416                         617   0.0      
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               617   0.0      
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               611   0.0      
ref|XP_006374652.1|  cytochrome P450 family protein                     609   0.0      
emb|CDP12890.1|  unnamed protein product                                606   0.0      
ref|XP_002529227.1|  cytochrome P450, putative                          607   0.0      Ricinus communis
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               607   0.0      
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               604   0.0      
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               604   0.0      
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             592   0.0      
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    589   0.0      
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       587   0.0      
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               585   0.0      
gb|EPS67771.1|  hypothetical protein M569_06997                         577   0.0      
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               571   0.0      
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               570   0.0      
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               566   0.0      
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     565   0.0      
gb|AJD25224.1|  cytochrome P450 CYP96A84                                564   0.0      
gb|KGN48435.1|  hypothetical protein Csa_6G487560                       561   0.0      
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               561   0.0      
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like               560   0.0      
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               557   0.0      
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    555   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               554   0.0      
ref|XP_002866853.1|  CYP96A10                                           555   0.0      
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    553   0.0      
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     551   0.0      
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    551   0.0      
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               551   0.0      
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    549   0.0      
emb|CDY53179.1|  BnaA06g40580D                                          549   0.0      
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               548   0.0      
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               548   0.0      
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         547   0.0      
emb|CDY46088.1|  BnaA09g42120D                                          546   0.0      
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    545   0.0      
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               544   0.0      
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               544   0.0      
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    544   0.0      
emb|CDY53181.1|  BnaA06g40600D                                          543   0.0      
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    541   0.0      
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             541   0.0      
emb|CDX72695.1|  BnaC07g47170D                                          541   0.0      
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like               538   0.0      
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             537   0.0      
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               537   0.0      
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    536   1e-180   
emb|CAB44684.1|  cytochrome P450-like protein                           535   2e-180   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    536   3e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    536   3e-180   
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               536   3e-180   
gb|KGN48434.1|  hypothetical protein Csa_6G487550                       535   4e-180   
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like               535   4e-180   
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             535   5e-180   
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    534   9e-180   
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               531   4e-179   
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               531   5e-179   
ref|XP_002878665.1|  CYP96A1                                            532   6e-179   
ref|XP_004151191.1|  PREDICTED: cytochrome P450 86B1-like               531   9e-179   
emb|CDX76867.1|  BnaC08g34530D                                          530   6e-178   
emb|CDY27160.1|  BnaA08g07980D                                          529   9e-178   
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               528   2e-177   
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             528   3e-177   
emb|CDY12435.1|  BnaC08g09240D                                          526   1e-176   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               526   1e-176   
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             524   9e-176   
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       522   7e-175   
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               522   8e-175   
ref|XP_004157875.1|  PREDICTED: cytochrome P450 86B1-like               520   1e-174   
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    521   2e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like               517   1e-173   
ref|XP_004142036.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    518   1e-173   
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               518   2e-173   
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               516   1e-172   
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    516   2e-172   
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         515   2e-172   
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         513   8e-172   
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    511   6e-171   
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               509   1e-169   
ref|XP_002866852.1|  CYP96A9                                            508   1e-169   
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               509   1e-169   
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               508   2e-169   
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               508   2e-169   
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               509   2e-169   
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               507   5e-169   
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               506   8e-169   
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             504   3e-168   
gb|KFK30508.1|  hypothetical protein AALP_AA7G271100                    502   4e-168   
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               503   2e-167   
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               502   4e-167   
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               502   5e-167   
gb|KHN27468.1|  Cytochrome P450 86B1                                    498   2e-166   
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               499   3e-166   
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               499   3e-166   
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                499   3e-166   
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like               498   4e-166   
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               499   5e-166   
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               498   8e-166   
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               498   8e-166   
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               498   1e-165   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               497   1e-165   
ref|XP_008440137.1|  PREDICTED: cytochrome P450 86B1-like               494   2e-165   
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               498   2e-165   
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         496   4e-165   
gb|KHN27469.1|  Cytochrome P450 86B1                                    494   6e-165   
ref|XP_002521474.1|  cytochrome P450, putative                          495   2e-164   Ricinus communis
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    495   2e-164   
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               495   2e-164   
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               495   2e-164   
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               494   3e-164   
gb|KEH24773.1|  cytochrome P450 family protein                          494   4e-164   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     499   4e-164   Vitis vinifera
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             493   9e-164   
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               494   1e-163   
gb|EYU24054.1|  hypothetical protein MIMGU_mgv1a025585mg                488   1e-163   
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             493   2e-163   
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               493   2e-163   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             492   2e-163   
ref|XP_002521476.1|  cytochrome P450, putative                          492   2e-163   Ricinus communis
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               492   2e-163   
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                492   3e-163   
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             492   3e-163   Populus trichocarpa [western balsam poplar]
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             492   4e-163   
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             491   5e-163   
ref|XP_002878579.1|  CYP96A5                                            490   1e-162   
gb|KHN19680.1|  Cytochrome P450 86B1                                    492   2e-162   
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             490   2e-162   
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               488   1e-161   
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             488   1e-161   
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               488   2e-161   
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               486   2e-161   
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               487   3e-161   
emb|CDY42628.1|  BnaC01g00400D                                          488   3e-161   
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               486   5e-161   
gb|KDP35252.1|  hypothetical protein JCGZ_09411                         485   9e-161   
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    485   1e-160   
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               485   1e-160   
gb|KEH24772.1|  cytochrome P450 family protein                          485   2e-160   
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               484   2e-160   
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    484   3e-160   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             484   3e-160   
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    484   3e-160   
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    483   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               483   4e-160   
ref|XP_010431920.1|  PREDICTED: cytochrome P450 86B1-like               480   5e-160   
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               483   5e-160   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               483   6e-160   
dbj|BAF46296.1|  cytochrome P450                                        484   7e-160   Ipomoea nil [qian niu]
gb|KEH24777.1|  cytochrome P450 family protein                          483   8e-160   
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    483   1e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             482   2e-159   
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               481   5e-159   
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               481   6e-159   
dbj|BAJ86572.1|  predicted protein                                      480   1e-158   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               480   1e-158   
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               480   1e-158   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             480   1e-158   
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               480   1e-158   
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          480   1e-158   Sorghum bicolor [broomcorn]
ref|XP_002869292.1|  CYP96A2                                            479   2e-158   
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg             479   2e-158   
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               480   2e-158   
emb|CDX76962.1|  BnaC08g35480D                                          479   3e-158   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               479   3e-158   
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             479   3e-158   
gb|KGN48429.1|  hypothetical protein Csa_6G487010                       477   3e-158   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    478   5e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    478   6e-158   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   478   6e-158   
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               478   9e-158   
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             477   9e-158   
dbj|BAD94304.1|  cytochrome p450 - like protein                         478   1e-157   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    475   1e-157   
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    477   1e-157   
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    477   1e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               478   1e-157   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         475   2e-157   
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               477   3e-157   
ref|XP_009402197.1|  PREDICTED: cytochrome P450 86B1-like               476   5e-157   
emb|CDM81753.1|  unnamed protein product                                476   6e-157   
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               475   6e-157   
emb|CDY44658.1|  BnaA08g06820D                                          475   7e-157   
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    475   8e-157   
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    474   1e-156   
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             475   2e-156   
gb|KDP35251.1|  hypothetical protein JCGZ_09410                         474   2e-156   
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    474   2e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    474   3e-156   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg             474   5e-156   
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               473   6e-156   
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               473   8e-156   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             473   1e-155   
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               472   1e-155   
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               472   2e-155   
dbj|BAC42841.1|  putative cytochrome P450                               472   2e-155   Arabidopsis thaliana [mouse-ear cress]
emb|CDP18605.1|  unnamed protein product                                469   2e-155   
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    471   4e-155   
ref|XP_006427985.1|  hypothetical protein CICLE_v10025385mg             471   5e-155   
emb|CDY53177.1|  BnaA06g40560D                                          471   6e-155   
gb|KEH22136.1|  cytochrome P450 family protein                          470   7e-155   
ref|XP_002865907.1|  CYP96A4                                            470   8e-155   
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    469   1e-154   
emb|CDY53178.1|  BnaA06g40570D                                          468   1e-154   
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             467   2e-154   
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               469   2e-154   
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    469   3e-154   
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               469   3e-154   
gb|KCW62188.1|  hypothetical protein EUGRSUZ_H04845                     465   4e-154   
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               468   5e-154   
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               468   5e-154   
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    469   5e-154   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    466   6e-154   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72693.1|  BnaC07g47150D                                          466   8e-154   
ref|NP_001048917.1|  Os03g0140100                                       467   1e-153   Oryza sativa Japonica Group [Japonica rice]
emb|CDP04331.1|  unnamed protein product                                466   1e-153   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               467   2e-153   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    466   2e-153   
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    467   2e-153   Arabidopsis thaliana [mouse-ear cress]
emb|CDM81752.1|  unnamed protein product                                466   3e-153   
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               466   3e-153   
gb|EAY88476.1|  hypothetical protein OsI_09947                          466   3e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               466   4e-153   
gb|AJD25225.1|  cytochrome P450 CYP96A85                                465   5e-153   
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                466   6e-153   
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    465   6e-153   
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             465   6e-153   
ref|XP_004492144.1|  PREDICTED: cytochrome P450 86B1-like               465   8e-153   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               466   8e-153   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               465   1e-152   
ref|XP_006464845.1|  PREDICTED: cytochrome P450 86B1-like               463   2e-152   
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             464   2e-152   
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               464   2e-152   
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             463   2e-152   
emb|CDY39928.1|  BnaA09g15100D                                          463   4e-152   
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             463   4e-152   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like               463   6e-152   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    463   7e-152
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           462   7e-152   Arabidopsis thaliana [mouse-ear cress]
gb|KEH22137.1|  cytochrome P450 family protein                          462   9e-152   
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             462   1e-151   
ref|XP_003629932.1|  Cytochrome P450                                    461   1e-151   
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               461   2e-151   
ref|XP_002894061.1|  CYP96A8                                            462   2e-151   
gb|EPS60696.1|  hypothetical protein M569_14105                         460   2e-151   
gb|EMT29854.1|  Cytochrome P450 86A2                                    461   3e-151   
emb|CDX79038.1|  BnaA01g11050D                                          460   3e-151   
ref|XP_002894062.1|  CYP96A8                                            461   5e-151   
ref|XP_002868909.1|  CYP96A12                                           460   6e-151   
gb|KEH24775.1|  cytochrome P450 family protein                          460   7e-151   
gb|AHF22086.1|  CYP96A68                                                458   1e-150   
emb|CDY39927.1|  BnaA09g15090D                                          459   1e-150   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               459   1e-150   
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like               459   3e-150   
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             458   4e-150   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             474   5e-150   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630          458   7e-150   
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               457   8e-150   
gb|ACR38435.1|  unknown                                                 457   9e-150   
ref|XP_003604436.1|  Cytochrome P450                                    456   1e-149   
gb|KHN45347.1|  Cytochrome P450 86B1                                    454   3e-149   
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             455   3e-149   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               456   3e-149   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             455   4e-149   
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             455   4e-149   
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like               456   5e-149   
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               455   6e-149   
ref|XP_010527154.1|  PREDICTED: cytochrome P450 86B1-like               453   6e-149   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    454   6e-149   
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                452   1e-148   
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               455   1e-148   
gb|AEI59774.1|  cytochrome P450                                         454   1e-148   
ref|XP_007019556.1|  Cytochrome P450                                    454   2e-148   
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               453   2e-148   
emb|CDY68678.1|  BnaCnng60030D                                          453   2e-148   
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               453   3e-148   
ref|XP_009109463.1|  PREDICTED: cytochrome P450 86B1-like               454   3e-148   
emb|CDY58383.1|  BnaC09g51620D                                          452   6e-148   
emb|CDY39926.1|  BnaA09g15080D                                          452   6e-148   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               453   7e-148   
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like               452   7e-148   
gb|KEH24774.1|  cytochrome P450 family protein                          451   8e-148   
ref|XP_010418988.1|  PREDICTED: cytochrome P450 86B1-like               452   8e-148   
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like               452   9e-148   
emb|CDY39035.1|  BnaA02g17240D                                          451   1e-147   
ref|NP_001042228.1|  Os01g0183600                                       451   2e-147   
ref|XP_008650864.1|  PREDICTED: cytochrome P450 86B1-like               451   2e-147   
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like               449   2e-147   
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                449   2e-147   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               451   2e-147   
gb|AIE57505.1|  MAH1                                                    451   3e-147   
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               450   3e-147   
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    449   5e-147   
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               450   5e-147   
gb|EAY88475.1|  hypothetical protein OsI_09946                          450   5e-147   
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like               449   6e-147   
gb|EAY72807.1|  hypothetical protein OsI_00673                          449   1e-146   
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             449   1e-146   
emb|CDY39931.1|  BnaA09g15130D                                          448   1e-146   
gb|ABF93892.1|  Cytochrome P450 family protein                          449   1e-146   
ref|XP_007019638.1|  Cytochrome P450                                    449   2e-146   
emb|CDX72690.1|  BnaC07g47120D                                          448   3e-146   
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                448   3e-146   
emb|CDY39934.1|  BnaA09g15160D                                          446   4e-146   
gb|EYU43136.1|  hypothetical protein MIMGU_mgv1a007195mg                444   5e-146   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               448   5e-146   
ref|XP_008441105.1|  PREDICTED: cytochrome P450 86B1-like               444   5e-146   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               447   7e-146   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             447   7e-146   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               447   9e-146   
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               446   1e-145   
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               446   1e-145   
gb|KEH40811.1|  cytochrome P450 family protein                          446   2e-145   
gb|KEH40835.1|  cytochrome P450 family protein                          446   2e-145   
ref|XP_002312417.2|  cytochrome P450 family protein                     444   3e-145   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like               446   4e-145   
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               445   5e-145   
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...    444   6e-145   
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             444   1e-144   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    444   2e-144   
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640          444   2e-144   
gb|EPS60789.1|  hypothetical protein M569_14012                         442   2e-144   
ref|XP_010473758.1|  PREDICTED: cytochrome P450 86B1-like               439   6e-144   
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like               441   7e-144   
gb|KEH40823.1|  cytochrome P450 family protein                          441   1e-143   
gb|KEH40821.1|  cytochrome P450 family protein                          441   2e-143   
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3    441   2e-143   
ref|XP_003558844.1|  PREDICTED: cytochrome P450 86B1-like               441   2e-143   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               441   3e-143   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               440   5e-143   
gb|EAY88477.1|  hypothetical protein OsI_09948                          441   5e-143   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg             440   5e-143   
gb|ABF93894.1|  Cytochrome P450 family protein, expressed               440   5e-143   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    439   1e-142   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             439   3e-142   
gb|KDO45858.1|  hypothetical protein CISIN_1g047974mg                   437   3e-142   
emb|CDX90337.1|  BnaA08g16470D                                          438   4e-142   
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               436   4e-142   
gb|KHN27470.1|  Cytochrome P450 86B1                                    434   5e-142   
gb|KHN19678.1|  Cytochrome P450 86B1                                    434   7e-142   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               437   8e-142   
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               436   9e-142   
ref|NP_001141467.1|  uncharacterized protein LOC100273577               437   1e-141   
ref|XP_006404465.1|  hypothetical protein EUTSA_v10010970mg             436   1e-141   
dbj|BAJ89570.1|  predicted protein                                      435   3e-141   
gb|EMT10522.1|  Cytochrome P450 86A1                                    435   6e-141   
gb|KEH40830.1|  cytochrome P450 family protein                          434   1e-140   
gb|EMT05588.1|  Cytochrome P450 86A2                                    432   3e-140   
gb|KEH41380.1|  cytochrome P450 family protein                          431   1e-139   
ref|XP_006649381.1|  PREDICTED: cytochrome P450 86B1-like               432   1e-139   
gb|EMS45869.1|  Cytochrome P450 86B1                                    430   2e-139   
ref|XP_007041219.1|  Cytochrome P450, putative                          430   3e-139   
ref|XP_009109462.1|  PREDICTED: cytochrome P450 86B1-like               431   3e-139   
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                430   4e-139   
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein      431   5e-139   
gb|EEC74485.1|  hypothetical protein OsI_09945                          429   6e-139   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            431   7e-139   
ref|XP_007019555.1|  Cytochrome P450                                    429   1e-138   
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like               429   1e-138   
dbj|BAJ85246.1|  predicted protein                                      429   1e-138   
gb|KEH40819.1|  cytochrome P450 family protein                          427   2e-138   
ref|XP_006285226.1|  hypothetical protein CARUB_v10006585mg             428   2e-138   
ref|XP_011100143.1|  PREDICTED: cytochrome P450 86B1-like               428   2e-138   
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             429   3e-138   
ref|XP_002468540.1|  hypothetical protein SORBIDRAFT_01g047610          427   3e-138   
gb|ABF93896.1|  Cytochrome P450 family protein, expressed               428   3e-138   
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          427   4e-138   
ref|XP_007042368.1|  Cytochrome P450-like protein                       427   4e-138   
ref|XP_010681240.1|  PREDICTED: cytochrome P450 86A7-like               424   5e-138   
ref|XP_003562115.1|  PREDICTED: cytochrome P450 86B1-like               427   5e-138   
ref|XP_011100144.1|  PREDICTED: cytochrome P450 86B1-like               426   8e-138   
ref|XP_002865881.1|  hypothetical protein ARALYDRAFT_331566             425   2e-137   
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like               426   2e-137   
emb|CDY29175.1|  BnaC09g15720D                                          424   3e-137   
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                    432   4e-137   
gb|ABF93891.1|  Cytochrome P450 family protein                          425   7e-137   
ref|XP_002523775.1|  cytochrome P450, putative                          425   7e-137   
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             423   8e-137   
gb|EMT22279.1|  Cytochrome P450 86A1                                    424   8e-137   
gb|EPS65366.1|  hypothetical protein M569_09411                         423   1e-136   
gb|KHM99046.1|  Cytochrome P450 86B1                                    419   6e-136   
gb|EMS50674.1|  Cytochrome P450 86B1                                    423   7e-136   
ref|XP_009389165.1|  PREDICTED: cytochrome P450 86B1-like               422   8e-136   
gb|KEH40822.1|  cytochrome P450 family protein                          421   1e-135   
gb|KEH40839.1|  cytochrome P450 family protein                          420   1e-135   
ref|XP_007042364.1|  Cytochrome P450-like protein                       420   3e-135   
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                419   7e-135   
gb|KEH40828.1|  cytochrome P450 family protein                          418   1e-134   
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             417   2e-134   
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like               419   2e-134   
ref|XP_006412935.1|  hypothetical protein EUTSA_v10027133mg             416   3e-134   
ref|XP_008797199.1|  PREDICTED: cytochrome P450 86B1-like               418   3e-134   
emb|CDM86413.1|  unnamed protein product                                415   6e-134   
ref|XP_008389072.1|  PREDICTED: cytochrome P450 86B1-like               418   1e-133   
emb|CAN75428.1|  hypothetical protein VITISV_003302                     417   1e-133   
dbj|BAA99522.1|  putative cytochrome P450                               415   2e-133   
ref|XP_002277006.1|  PREDICTED: cytochrome P450 86B1                    416   2e-133   
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             413   5e-133   
gb|KEH40818.1|  cytochrome P450 family protein                          414   7e-133   
ref|XP_010905515.1|  PREDICTED: cytochrome P450 86B1-like               415   7e-133   
ref|XP_003538960.2|  PREDICTED: cytochrome P450 86B1-like               415   1e-132   
gb|EMS49628.1|  Cytochrome P450 86B1                                    413   2e-132   
ref|XP_008796515.1|  PREDICTED: cytochrome P450 86B1-like               414   2e-132   
ref|XP_002870817.1|  hypothetical protein ARALYDRAFT_916433             413   2e-132   
emb|CDX90338.1|  BnaA08g16460D                                          412   3e-132   
gb|KEH40842.1|  cytochrome P450 family protein                          411   7e-132   
ref|XP_009407697.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    412   1e-131   
ref|XP_004297737.1|  PREDICTED: cytochrome P450 86B1-like               412   2e-131   
ref|XP_009407623.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    412   4e-131   
ref|XP_010270986.1|  PREDICTED: cytochrome P450 86B1-like               409   4e-131   
gb|KHN19669.1|  Cytochrome P450 86B1                                    407   4e-131   
gb|EMT01671.1|  Cytochrome P450 86A2                                    413   5e-131   
emb|CDY66735.1|  BnaC03g60620D                                          409   6e-131   
emb|CDY53182.1|  BnaA06g40610D                                          407   8e-131   
ref|XP_008340443.1|  PREDICTED: cytochrome P450 86B1                    411   8e-131   
emb|CBH32604.1|  cytochrome P450, putative, expressed                   407   1e-130   
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               406   2e-130   
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g             405   2e-130   
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                   409   2e-130   
ref|XP_004231497.1|  PREDICTED: cytochrome P450 86B1                    408   3e-130   
ref|XP_010688690.1|  PREDICTED: cytochrome P450 86B1                    409   4e-130   
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like               408   5e-130   
gb|KEH40805.1|  cytochrome P450 family protein                          406   5e-130   
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               406   6e-130   
ref|XP_003607255.1|  Cytochrome P450                                    407   1e-129   
ref|XP_007031595.1|  Cytochrome P450, putative                          404   1e-129   
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg             407   2e-129   
ref|XP_007131626.1|  hypothetical protein PHAVU_011G029000g             406   3e-129   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like               405   4e-129   
ref|XP_010067001.1|  PREDICTED: cytochrome P450 86B1-like               405   5e-129   
emb|CAE54308.1|  cytochrome P450-like protein                           403   7e-129   
ref|XP_006354968.1|  PREDICTED: cytochrome P450 86B1-like               404   7e-129   
ref|XP_006394587.1|  hypothetical protein EUTSA_v10003923mg             405   7e-129   
ref|XP_011022041.1|  PREDICTED: cytochrome P450 86B1                    405   9e-129   
gb|EYU23733.1|  hypothetical protein MIMGU_mgv1a018790mg                402   1e-128   
ref|XP_007042363.1|  Cytochrome P450-like protein                       402   1e-128   
ref|XP_010274128.1|  PREDICTED: cytochrome P450 86B1-like               403   2e-128   
emb|CDP11007.1|  unnamed protein product                                404   2e-128   
ref|XP_009351729.1|  PREDICTED: cytochrome P450 86B1-like               406   2e-128   
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like               404   2e-128   
ref|XP_006643843.1|  PREDICTED: cytochrome P450 86B1-like               402   2e-128   
ref|XP_004135954.1|  PREDICTED: cytochrome P450 86B1-like               403   3e-128   
ref|XP_004158225.1|  PREDICTED: cytochrome P450 86B1-like               403   3e-128   
gb|KHN32292.1|  Cytochrome P450 86B1                                    400   6e-128   
ref|XP_009794122.1|  PREDICTED: cytochrome P450 86B1-like               402   7e-128   
ref|XP_002888364.1|  CYP96A3                                            399   7e-128   
ref|XP_010245486.1|  PREDICTED: cytochrome P450 86B1                    402   7e-128   
ref|XP_006651022.1|  PREDICTED: cytochrome P450 86B1-like               400   1e-127   
ref|XP_002310074.1|  hypothetical protein POPTR_0007s07700g             401   1e-127   
emb|CAB93726.1|  cytochrome P450-like protein                           401   2e-127   
gb|KEH40921.1|  cytochrome P450 family protein                          401   2e-127   
gb|EPS58816.1|  hypothetical protein M569_15996                         399   2e-127   
ref|XP_011006771.1|  PREDICTED: cytochrome P450 86B1-like               401   3e-127   
ref|XP_007043287.1|  Cytochrome P450, family 86, subfamily B, pol...    401   3e-127   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               399   3e-127   
ref|XP_002306380.1|  hypothetical protein POPTR_0005s09500g             400   3e-127   
gb|KDP33058.1|  hypothetical protein JCGZ_13644                         400   5e-127   
emb|CBI33551.3|  unnamed protein product                                395   5e-127   
ref|XP_006290052.1|  hypothetical protein CARUB_v10003687mg             400   6e-127   
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               398   8e-127   
dbj|BAK07250.1|  predicted protein                                      398   9e-127   
ref|XP_010522165.1|  PREDICTED: cytochrome P450 86B1-like               400   9e-127   
ref|XP_008221383.1|  PREDICTED: cytochrome P450 86B1-like               400   1e-126   
ref|XP_008461361.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    399   2e-126   
ref|XP_010556203.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    397   2e-126   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like               397   3e-126   
gb|EMT14219.1|  Cytochrome P450 86A2                                    397   3e-126   
ref|XP_008796514.1|  PREDICTED: cytochrome P450 86B1-like               397   6e-126   



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/516 (72%), Positives = 418/516 (81%), Gaps = 14/516 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MASI YFEIFVA FC  ++  L D    P   P  GM P L  HV +IH+RC  V S  G
Sbjct  7     MASIGYFEIFVAIFCFFVFCALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSRTG  66

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GT+LLKGPWF N+DIL TVDPANVHYIMS  FENFPKG+EFKKIFDVLGDGIFNSDLDLW
Sbjct  67    GTYLLKGPWFANMDILGTVDPANVHYIMSAKFENFPKGEEFKKIFDVLGDGIFNSDLDLW  126

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K QRK+ R LI HQRFH  LV+TSW+K+E GLI VLEF A E   +VDLQDVFQRFTFDT
Sbjct  127   KTQRKITRTLITHQRFHNCLVKTSWDKIENGLISVLEFVARE-SKIVDLQDVFQRFTFDT  185

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC LVTGYDPGCLS++FPD PFSKAMD+AEEVLFIRHLLPES+WKLQ+WLG G EKKLS+
Sbjct  186   TCQLVTGYDPGCLSLEFPDNPFSKAMDEAEEVLFIRHLLPESVWKLQKWLGFGHEKKLSK  245

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A ++LDQVIGKYI+MKR EL    K +      ++E GFDLLTSYI ++      GL FD
Sbjct  246   AWQVLDQVIGKYISMKRDELSNGTKLKE-----DNEEGFDLLTSYILDD------GLNFD  294

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             DK LRDTILNLMIAGRDTTSS LTWFIWLVSTHPEVEK IR+EL+ A+ S  + +K+RLF
Sbjct  295   DKSLRDTILNLMIAGRDTTSSGLTWFIWLVSTHPEVEKKIREELM-AIISVTESQKWRLF  353

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             +A ELKN +YLHAALCESLRLYPPVPFQHK+P +  ILPSGH V P+ R+MFSLYAMGRM
Sbjct  354   RANELKNAIYLHAALCESLRLYPPVPFQHKTPREPGILPSGHHVHPNMRVMFSLYAMGRM  413

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + IWGKDA EFKPERWI+ +RG VKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII
Sbjct  414   ESIWGKDASEFKPERWIS-DRGTVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  472

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             HNY V  +K H   PNVSIILYM+HG K R+++RWT
Sbjct  473   HNYQVEVIKGHKVYPNVSIILYMQHGFKARIKKRWT  508



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/516 (72%), Positives = 420/516 (81%), Gaps = 14/516 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             +ASI YFEIFVA FC  ++  L D    P   P  GM P L  HV +IH+RC  V S  G
Sbjct  7     VASIGYFEIFVAIFCFFVFCALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSTTG  66

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTFLLKGPWF N+DIL TVDPANVHYIMS NFENFPKG+EFKKIFDVLGDGIFNSDLDLW
Sbjct  67    GTFLLKGPWFANIDILGTVDPANVHYIMSANFENFPKGEEFKKIFDVLGDGIFNSDLDLW  126

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K+QRK+ R LI HQRFH  L +TSW+K+E GLIPVLEF A E   +VDLQDVFQRFTFDT
Sbjct  127   KSQRKITRTLITHQRFHNCLEKTSWDKIENGLIPVLEFVARE-SKIVDLQDVFQRFTFDT  185

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC LVTG+DPGCLS++FP+VPFSKAMD+AEEVLFIRHLLPES+WKLQ+WLGIG EKKLS+
Sbjct  186   TCQLVTGFDPGCLSLEFPNVPFSKAMDEAEEVLFIRHLLPESVWKLQKWLGIGHEKKLSK  245

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A ++LDQVIGKYI+MKR EL    K +      ++E GFDLLTSYI ++      GL FD
Sbjct  246   AWQVLDQVIGKYISMKRDELSNGTKLKE-----DNEEGFDLLTSYILDD------GLNFD  294

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             DK LRDTILNLMIAGRDTTSS LTWFIWLVSTHPEVEK IR+EL+ A+ S    +K+RLF
Sbjct  295   DKSLRDTILNLMIAGRDTTSSGLTWFIWLVSTHPEVEKKIREELM-AIISVAKSQKWRLF  353

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             +A ELKN +YLHAALCESLRLYPPVPFQHK+P +  ILPSGH V P+ R+MFSLYAMGR+
Sbjct  354   RANELKNAIYLHAALCESLRLYPPVPFQHKTPREPCILPSGHHVHPNMRVMFSLYAMGRI  413

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + IWGKDA EFKPERWI+ +RG VKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII
Sbjct  414   ESIWGKDAAEFKPERWIS-DRGIVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  472

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             HNY V  +K H   PNVSIILYM+HG K  +++RWT
Sbjct  473   HNYQVEVIKGHKVYPNVSIILYMQHGFKASIKKRWT  508



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/516 (68%), Positives = 414/516 (80%), Gaps = 11/516 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MAS  Y EI  A  C  +     +    P   PL GMLPS+F HV +IHDRC  +    G
Sbjct  3     MASFGYPEILFALLCCFLVWCFSNINGMPWNWPLVGMLPSVFWHVNQIHDRCVNIFEQVG  62

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTFLLKGPWF N+DI+ T DPANVH+IMS NF NFPKG EFKKIFDVLGDGIFNSD DLW
Sbjct  63    GTFLLKGPWFANMDIIATADPANVHFIMSANFANFPKGAEFKKIFDVLGDGIFNSDADLW  122

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             ++QRK ARALI H+RF ++L++TSW KVEKGLIPVLE  + E+G V+DLQD+FQR TFDT
Sbjct  123   RSQRKQARALITHERFRKFLIKTSWEKVEKGLIPVLEHVS-EQGMVIDLQDLFQRLTFDT  181

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC LVTG+DPGCLS +FPDVPFSKAMD+AEE + +RH LPESLW+L + LGIGPEKKLSR
Sbjct  182   TCILVTGFDPGCLSTEFPDVPFSKAMDEAEEAILMRHCLPESLWRLGKLLGIGPEKKLSR  241

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A  +LD VIGKY++MKR+E+       N  N+ +DE G DLLTSYIN   G+ + GL+ +
Sbjct  242   AWTVLDDVIGKYVSMKREEM----SKSNKCNEDDDE-GLDLLTSYIN---GDESTGLECN  293

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             DKFLRDTILN MIAGRDTTSSALTWF+WLVSTHPEVE+ IRDE L +V   +D  K+R+F
Sbjct  294   DKFLRDTILNFMIAGRDTTSSALTWFLWLVSTHPEVERKIRDE-LNSVVPAKDSNKWRMF  352

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             + +EL+NLVYLH ALCE+LRLYPPVPFQHK+P+Q  +LPSGH V P  +++FSLYAMGRM
Sbjct  353   QVDELRNLVYLHGALCEALRLYPPVPFQHKAPIQPVMLPSGHYVHPKMKILFSLYAMGRM  412

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
              +IWGKD+KEFKPERWI  +RG +K+EPSYKFLAFNAGPRTCLGKEVAFTQ+KAVAAAII
Sbjct  413   DYIWGKDSKEFKPERWIT-DRGTIKYEPSYKFLAFNAGPRTCLGKEVAFTQLKAVAAAII  471

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             HNY V  VK H  +PNVS+ILYMKHGLKVR+ +RWT
Sbjct  472   HNYQVEVVKGHIVTPNVSVILYMKHGLKVRISKRWT  507



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/516 (65%), Positives = 399/516 (77%), Gaps = 13/516 (3%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             A+  + Y EIF+   C  ++   RD  + P+  P+FGMLP    H+++IH+RC   +   
Sbjct  2     ALIELGYIEIFLTMLCFFLFYFFRDS-KYPINWPIFGMLPGALYHIQQIHERCTMTMRAS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTFL KGPWF N+D+L TVDPANVHYIMS NF NFPKG +FK++FDVLG+GIFN+DLD+
Sbjct  61    GGTFLFKGPWFANMDMLSTVDPANVHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDM  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK  RALI HQ+F+++LV+TS +KVEKGLIPVL++   ++G +VDLQD+FQRFTFD
Sbjct  121   WKIQRKTTRALITHQQFYKFLVKTSRDKVEKGLIPVLDYIC-DKGSIVDLQDLFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LVTGYDPGC+S+DFPDVPFSKAMDDAEE +  RH LPE +WKLQ+WL IG EKKL 
Sbjct  180   TTCILVTGYDPGCVSIDFPDVPFSKAMDDAEEAILFRHALPEIIWKLQRWLRIGEEKKLI  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             RA E LD  I KYI+ KR EL      +  D     E GFDLLT Y+     E  +G+K 
Sbjct  240   RARETLDYTISKYISKKRDEL------KEGDKLKESEEGFDLLTFYLKE---EENLGVKC  290

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DD +LRDTILNLMIAGRDTTSSALTWFIWLVST+P+VEK IRDE +  +   ++  K+RL
Sbjct  291   DDNYLRDTILNLMIAGRDTTSSALTWFIWLVSTNPQVEKKIRDE-INFIIPKQEVGKWRL  349

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F  +EL  LVYLH ALC+SLRLYPPVPFQHK PL+ DILPS HKV P  ++MFSLYAMGR
Sbjct  350   FNVQELNKLVYLHGALCDSLRLYPPVPFQHKEPLEKDILPSVHKVHPKLKIMFSLYAMGR  409

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ IWGKD  EFKPERWI+ +RG +KHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI
Sbjct  410   MESIWGKDCLEFKPERWIS-DRGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  468

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             IHNY V  VK H   PN SIILYM+HG KVR+ RRW
Sbjct  469   IHNYQVELVKGHPIEPNASIILYMRHGFKVRISRRW  504



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/516 (65%), Positives = 401/516 (78%), Gaps = 13/516 (3%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             A+  + Y EIF+A  C  ++   RD  + P+  P+FGMLP    H+++IH+RC   +   
Sbjct  2     ALIGLGYIEIFLAMLCFFLFYYYRDS-KYPINWPIFGMLPGALYHIQQIHERCTMTMRAS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTFL KGPWF N+D+L TVDPANVHYIMS NF NFPKG +FK++FDVLG+GIFN+DLD+
Sbjct  61    GGTFLFKGPWFANMDMLSTVDPANVHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDM  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK  RALI H +F+++LV+TS  KVEKGLIPVL++   ++G +VDLQD+FQRFTFD
Sbjct  121   WKIQRKTTRALITHLQFYKFLVKTSREKVEKGLIPVLDYIC-DKGSIVDLQDLFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LVTGYDPGC+S+DFPDVPFSKAMDDAEE +  RH LPE +WKLQ+WL IG EKKL 
Sbjct  180   TTCILVTGYDPGCVSIDFPDVPFSKAMDDAEEAILFRHALPEIIWKLQRWLRIGEEKKLI  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             RA E LD  + KYI+ KR++L      +  +N    E G DLLT Y+     E  +G+K 
Sbjct  240   RARETLDYTLSKYISKKREKL------KEGENVKESEEGIDLLTFYLKE---EENLGVKC  290

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDK+LRDTILNLMIAGRDTTSSALTWFIWLVST+P+V+K IRDE + ++   ++  K+RL
Sbjct  291   DDKYLRDTILNLMIAGRDTTSSALTWFIWLVSTNPQVKKKIRDE-INSIIPKQEIGKWRL  349

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F  +EL  LVYLH ALC+SLRLYPPVPFQHK PL+ DILPSGHKV P  ++MFSLYAMGR
Sbjct  350   FNVQELNKLVYLHGALCDSLRLYPPVPFQHKEPLENDILPSGHKVHPKLKIMFSLYAMGR  409

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ IWGKD  EFKPERWI+ + G +KHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI
Sbjct  410   MESIWGKDCLEFKPERWIS-DGGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  468

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             IHNY V  VK H   PN SIILYM+HG KVR+ RRW
Sbjct  469   IHNYQVELVKGHPIEPNASIILYMRHGFKVRISRRW  504



>emb|CDP12889.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/517 (66%), Positives = 397/517 (77%), Gaps = 29/517 (6%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             A+ S+ YFEIF+A  C      LR   R   K+P+ G  P L +++ +IHD+CA VL   
Sbjct  2     ALFSLGYFEIFLAIICFFYLRNLRSFKRLAWKLPILGTFPYLIMNIHRIHDKCAEVLEKT  61

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
              GT+ LKGP F N+DIL TVDPANVHYIMS NF NFPKG EFKKIF+VLGDGIFNSDLDL
Sbjct  62    RGTYHLKGPSFANMDILGTVDPANVHYIMSSNFVNFPKGPEFKKIFEVLGDGIFNSDLDL  121

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRKLARAL+ HQ FH++L                      +G +VDLQDVFQR TFD
Sbjct  122   WKCQRKLARALLNHQSFHKFL----------------------QGLMVDLQDVFQRLTFD  159

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC  VTGYDPGCLS+DFP VPFSKAMD+ EE +F+RH+LPE + KL++WLGIG EKKLS
Sbjct  160   TTCKFVTGYDPGCLSIDFPGVPFSKAMDEVEEAIFMRHILPEIVLKLERWLGIGQEKKLS  219

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             ++ +ILD+VI KYI++K++EL      +      NDE GFDLLTSYIN  D E T GLK 
Sbjct  220   KSWKILDEVICKYISVKQEEL------KKGTKSTNDEEGFDLLTSYINLGDNEITTGLKR  273

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKFLRDTI+N MIAGRDTTSSALTWFIWLVSTHP V   IR+EL + +   E+ + FRL
Sbjct  274   DDKFLRDTIINFMIAGRDTTSSALTWFIWLVSTHPTVLNKIREELKSVIQVNEEAENFRL  333

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             FK +ELKNLVY+HAALCES+RLYPPVPFQHK PLQ D LPSGH+V P  +++FSLYAMGR
Sbjct  334   FKVDELKNLVYIHAALCESMRLYPPVPFQHKFPLQPDTLPSGHRVHPKIKVIFSLYAMGR  393

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+FIWGKD+ EFKPERWI+ ERG +KHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAA+
Sbjct  394   MKFIWGKDSWEFKPERWIS-ERGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAM  452

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             IHNY+V  V+ H   PN+S+ILYMKHGLKVRV +RW 
Sbjct  453   IHNYNVEMVEGHPVVPNLSVILYMKHGLKVRVSKRWA  489



>ref|XP_009790818.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=512

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/516 (66%), Positives = 403/516 (78%), Gaps = 10/516 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             +ASI YFEIFVA FC  + + LR G       P  GM PSL LH+ +IH+R   +LS+  
Sbjct  7     LASIGYFEIFVAIFCFFV-LALRGGNSYRWNWPFLGMFPSLILHIHRIHERSVEILSITK  65

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTFL+KG WFTN+DIL TVDP NVHYIMS NF NFPKG+E KKIFDVLGDGIF+SD+D+W
Sbjct  66    GTFLIKGLWFTNMDILGTVDPPNVHYIMSANFTNFPKGQELKKIFDVLGDGIFSSDMDMW  125

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             KNQRKLARALII++RFH+   + S NKV+ GLIP+LEF A E   +VDLQDVF+RFTFDT
Sbjct  126   KNQRKLARALIINERFHKCSAKISMNKVKNGLIPILEFIAKE-DRIVDLQDVFKRFTFDT  184

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC L+TG++  CLS++FP+VPF KAMDDA+ V+ IR+LLPES+WKLQ+WLG+GPE KL +
Sbjct  185   TCKLLTGFESCCLSLEFPEVPFLKAMDDAKYVVTIRYLLPESVWKLQKWLGVGPEMKLRK  244

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A  +LD VIG+YI MKR+EL    + + P  D  +E GFDLLT YI  NDGETT GLKFD
Sbjct  245   ASNVLDHVIGEYILMKREEL---SRGEKPKKD--NEEGFDLLTPYI-INDGETTSGLKFD  298

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
              KFLRDT LN M  G DT S  LTWFIWLVSTHPEVEKNIR+E L A+   E+ +K+RLF
Sbjct  299   TKFLRDTFLNFMFTGHDTISPGLTWFIWLVSTHPEVEKNIREE-LKAIIPIEEAEKWRLF  357

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
              A+ELKN VYL AALCESLRLYPPV FQHK+PL+ DILPSGH V P+ R+M  L AMGRM
Sbjct  358   TADELKNAVYLLAALCESLRLYPPVAFQHKTPLEPDILPSGHHVHPNMRVMIPLCAMGRM  417

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + IWGKDA EFKP RWI+ +RG +KHEPSYKF +FNAGPRTCLGKEVAFTQMK V A II
Sbjct  418   ESIWGKDASEFKPHRWIS-DRGTIKHEPSYKFFSFNAGPRTCLGKEVAFTQMKLVVATII  476

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             +NY +  VK H   PN+S++LYMKHG  VRV+R+W 
Sbjct  477   YNYQIEMVKGHVVYPNLSVMLYMKHGFNVRVKRKWA  512



>ref|XP_009783405.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=520

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/522 (65%), Positives = 407/522 (78%), Gaps = 8/522 (2%)
 Frame = -2

Query  1848  IITCAMASIDYFEIFVA-FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAA  1672
             + +  +ASI Y EIFVA FF L+ W +  +G   P   P  GM P L LH++KIH+  A 
Sbjct  6     VFSSLLASIGYLEIFVAIFFFLIFWALGNNGL--PRNYPFLGMFPGLLLHIQKIHESSAK  63

Query  1671  VLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFN  1492
             +L   GGTFLLKG WFTN D L T+DPANVHYIMS NF NFPKG EFKKIFD LGDGIFN
Sbjct  64    LLPRAGGTFLLKGLWFTNTDTLCTLDPANVHYIMSTNFSNFPKGPEFKKIFDFLGDGIFN  123

Query  1491  SDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQ  1312
             SD DLW+NQRK AR LII+QR+H+ LV+T  NKV+ GLIP+LEF A E   + DLQDVF+
Sbjct  124   SDFDLWENQRKYARELIINQRYHKCLVKTIENKVKDGLIPILEFMAKE-DRIFDLQDVFK  182

Query  1311  RFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGP  1132
             RFTFDT C +VTG+DPGCLS++FPD+PF K  +D + V+ IRHLLPE +WKLQ+ LG+GP
Sbjct  183   RFTFDTICKIVTGFDPGCLSLEFPDIPFLKVTEDIDHVIVIRHLLPEIIWKLQKKLGVGP  242

Query  1131  EKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETT  952
             EKKLS+A E++DQVIGKYI+MK  EL    K +  D +     G+DLLT  I  NDGET 
Sbjct  243   EKKLSKAVEVVDQVIGKYISMKHDELNKGTKIKE-DEEEEGGGGYDLLTLCI-VNDGETK  300

Query  951   MGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDP  772
              GLKFD+KFLRDTILN + AGRD  +S LTWFIWLV THPEVEKNIR+EL T +   E+ 
Sbjct  301   TGLKFDNKFLRDTILNFLTAGRDGVNSCLTWFIWLVFTHPEVEKNIREELRTIIPV-EEA  359

Query  771   KKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSL  592
             +K+RLF  EELKN+VYLHA LCE+LRLYPPVPFQ K+P + DILPSGH V P  R+MF+L
Sbjct  360   EKWRLFTVEELKNVVYLHATLCEALRLYPPVPFQFKTPQEPDILPSGHHVHPKMRVMFNL  419

Query  591   YAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKA  412
             YAMGRM+FIWGKDA EFKPERWI+ ERG +KHEPSYKFL+FNAGPRTCLGK  +FTQ+KA
Sbjct  420   YAMGRMEFIWGKDASEFKPERWIS-ERGTIKHEPSYKFLSFNAGPRTCLGKGTSFTQLKA  478

Query  411   VAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             VAAA+IHNY ++ VK HD SPN S+IL+MK+G KVRV++RW 
Sbjct  479   VAAAVIHNYKIKMVKGHDVSPNCSVILHMKYGFKVRVKKRWA  520



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/489 (67%), Positives = 391/489 (80%), Gaps = 13/489 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P+  P+FGMLP L  ++++IH+RC   +   GGTFL KG WF N+D L TVDPANVHYIM
Sbjct  30    PINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVDPANVHYIM  89

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF NFPKG +FK++FDVLG+GIFN+DLD+WK QRK+ R+LI H  F+++LV+TS +KV
Sbjct  90    SANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKFLVKTSCDKV  149

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             EKGLIPV++     +G VVDLQD+FQRFTFDTTC LVTGYDPGC+S+DFPDVPFSKAMDD
Sbjct  150   EKGLIPVIDHVCN-KGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFPDVPFSKAMDD  208

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             AEE +  RH LPE +WKLQ+WL IG EKK+  A E+LD  I KYI+MKR++L      + 
Sbjct  209   AEEAILFRHALPEIVWKLQRWLRIGEEKKMINAQEVLDYTIDKYISMKREDL------KE  262

Query  1029  PDNDIND-ENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFI  853
              D+D+ + E GFDLLT Y+ +   E  +G+K DDKFLRD ILNLMIAGRDTTSSALTWFI
Sbjct  263   VDHDLKESEEGFDLLTFYLKD---EKELGVKCDDKFLRDNILNLMIAGRDTTSSALTWFI  319

Query  852   WLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPF  673
             WLVST+P+VEK IRDE +  V   E+ +KFRLF  +EL  LVYLH ALC+SLRLYPPVPF
Sbjct  320   WLVSTNPQVEKKIRDE-INFVIPNEEGEKFRLFNVQELNKLVYLHGALCDSLRLYPPVPF  378

Query  672   QHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHE  493
             QHK PL+ DILPSGHKV P  ++MFSLYAMGRM+ IWGKD  EFKPERWI+ ERG +KHE
Sbjct  379   QHKEPLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWIS-ERGTIKHE  437

Query  492   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGL  313
             PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY V  VK H   PN SIILYM+HG 
Sbjct  438   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHIVEPNASIILYMRHGF  497

Query  312   KVRVQRRWT  286
             KV++ +RWT
Sbjct  498   KVKINKRWT  506



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/515 (65%), Positives = 399/515 (77%), Gaps = 11/515 (2%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             A+  + Y EIF+A  C  ++  L+D    P   P+FGMLP    ++++IH+R    +   
Sbjct  2     AIIGLGYIEIFLAILCFFLFHGLKDTKGYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRS  61

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTFL KGP F  LD+L TVDPANVHYIMS NF NFPKG +F++IFDVLGDGIFN+DLDL
Sbjct  62    GGTFLFKGPIFAKLDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADLDL  121

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK ARALI HQ+F+++LV+TS  KVEKGLIPVL      +G +VDLQD+FQRFTFD
Sbjct  122   WKIQRKTARALITHQQFYKFLVKTSREKVEKGLIPVLNHVC-HKGVIVDLQDLFQRFTFD  180

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LVTGYDPGC+S+DFPDVPFSKAMDDAEEV+ +RH++PE++W+LQ+WLGIG EKKL 
Sbjct  181   TTCILVTGYDPGCVSIDFPDVPFSKAMDDAEEVILVRHVMPEAIWRLQKWLGIGEEKKLI  240

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             +A EI+D VIG YI+ KR +L+       P+  + DE GFDLLT Y+        MG+  
Sbjct  241   KAWEIMDNVIGNYISKKRDKLL----KMEPELKLEDE-GFDLLTFYLKEGQ---YMGVNC  292

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKFLRDTILNLMIAGRDTTSSALTWFIWLV+ +P+VEK +R+E + +V   E+   +RL
Sbjct  293   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVTQNPQVEKKLREE-INSVIPKEEVGNWRL  351

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F   EL  LVYLH ALC+SLRLYPPVPFQHK PLQ D+LPSGHKV P  +++FSLYAMGR
Sbjct  352   FNVHELNKLVYLHGALCDSLRLYPPVPFQHKEPLQEDMLPSGHKVHPKLKILFSLYAMGR  411

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ IWGKD  EFKPERWI+ ERG +KHEPSYKFLAFNAGPRTCLGKEVAF QMKAVAA I
Sbjct  412   MESIWGKDCLEFKPERWIS-ERGTIKHEPSYKFLAFNAGPRTCLGKEVAFNQMKAVAATI  470

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             IHNY V+ V+ H   PN SIILYM+HG KVR+ RR
Sbjct  471   IHNYQVQVVEGHPIKPNTSIILYMRHGFKVRISRR  505



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/520 (65%), Positives = 401/520 (77%), Gaps = 12/520 (2%)
 Frame = -2

Query  1845  ITCAMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             I   +A+I YFEIFVA FC  +      G       P  GM PSL  H+ +IH+R   VL
Sbjct  3     IISLLATIGYFEIFVAIFCFFVLAFQGRG-SFIWNWPFLGMFPSLVFHIHRIHERSVEVL  61

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
             S   GTFLLKG WFTN+DIL TVDPANV YIMS NF NFPKG+E +KIFDVLGDGIF+SD
Sbjct  62    SRTRGTFLLKGLWFTNMDILGTVDPANVQYIMSANFTNFPKGRELRKIFDVLGDGIFSSD  121

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
             +DLWKNQRKLARALI HQRFH+ L + S +KV+ GLIP+LE  A E   +VDLQDVF+RF
Sbjct  122   MDLWKNQRKLARALITHQRFHKCLTKISLDKVKNGLIPILELIAKE-DRIVDLQDVFKRF  180

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTTC L+TG++  CLS++FP+VPF KAMDDA+ V+ IR+LLPES+WKLQ+WLG+GPE 
Sbjct  181   TFDTTCKLLTGFESCCLSLEFPEVPFLKAMDDAKYVVSIRYLLPESIWKLQKWLGVGPEM  240

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             +L +A ++LD+VIG+YI MKR+EL    K +       +E GFDLLT YI  NDGE T G
Sbjct  241   QLRKASDVLDRVIGEYILMKREELSRVEKCK------ENEEGFDLLTPYI-INDGERTSG  293

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
             LKF DKFLRDT LN M AG DT SS LTWFIWLVSTHPEVEKNIR+E L A+   E+ +K
Sbjct  294   LKF-DKFLRDTFLNFMFAGHDTVSSGLTWFIWLVSTHPEVEKNIREE-LRAIIPPEEAEK  351

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +RLF A+ELKN++YLHAALCESLRLYPPV FQHK+PL+ DILPSGH V P+ R+M  LYA
Sbjct  352   WRLFTADELKNVIYLHAALCESLRLYPPVAFQHKTPLEPDILPSGHHVHPNMRVMIPLYA  411

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWGKDA EFKP RWI+ +RG + +EPSYKF +FNAGPRTCLGKE AFTQMK V 
Sbjct  412   MGRMESIWGKDASEFKPHRWIS-DRGTINYEPSYKFFSFNAGPRTCLGKEAAFTQMKVVV  470

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             A IIHNY +  VK H   PNVS++LYMKHG KVRV+R+W 
Sbjct  471   ATIIHNYQIEMVKGHVVYPNVSVMLYMKHGFKVRVKRKWA  510



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/488 (67%), Positives = 387/488 (79%), Gaps = 12/488 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P+  P+FGMLP L  ++++IH+RC   +   GGTFL KG WF N+D L TVDPANVHYIM
Sbjct  30    PINFPIFGMLPGLLYNIQQIHERCTMSMRASGGTFLFKGLWFANMDTLTTVDPANVHYIM  89

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF NFPKG +FK++FDVLG+GIFN+DLD+WK QRK+ RALI H  F+++LV+TS +KV
Sbjct  90    SANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRALITHHEFYKFLVKTSRDKV  149

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             EKGLIPV++     +G VVDLQD+FQRFTFDTTC LVTGYDPGC+S+DFPDVPFSKAMDD
Sbjct  150   EKGLIPVIDHVCN-KGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFPDVPFSKAMDD  208

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
              EE +  RH LPE +WKLQ+WL IG EKK+  A E+LD  I KYI+ KR++L      + 
Sbjct  209   VEEAILFRHALPEIVWKLQRWLRIGEEKKMINAQEVLDYTIDKYISKKREDL------KE  262

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              D+    E GFDLLT Y+ +   E ++G+K DDKFLRD ILNLMIAGRDTTSSALTWFIW
Sbjct  263   GDDLKESEEGFDLLTFYLKD---EKSLGVKCDDKFLRDNILNLMIAGRDTTSSALTWFIW  319

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             LVST+P+VEK IRDE +  V   E+ +KF+LF  +EL  LVYLH ALC+SLRLYPPVPFQ
Sbjct  320   LVSTNPQVEKKIRDE-INFVIPNEEVEKFKLFNVQELNKLVYLHGALCDSLRLYPPVPFQ  378

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK PL+ DILPSGHKV P  ++MFSLYAMGRM+ IWGKD  EFKPERWI+ ERG +KHEP
Sbjct  379   HKEPLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWIS-ERGTIKHEP  437

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY V  VK H   PN SIILYM+HG K
Sbjct  438   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHIVEPNASIILYMRHGFK  497

Query  309   VRVQRRWT  286
             VR+ +RWT
Sbjct  498   VRINKRWT  505



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/512 (65%), Positives = 397/512 (78%), Gaps = 14/512 (3%)
 Frame = -2

Query  1815  FEIFVA---FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSL-HGGT  1648
             FE+F+A   FF L  W   R+        PL GMLP+L LHV +IHD C  +L     GT
Sbjct  9     FEVFLAVSWFFALWAW---RNRRMIGWNWPLMGMLPTLLLHVDRIHDTCTEILRRSRRGT  65

Query  1647  FLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKN  1468
             F  +GPWF N++IL T +PA+VHYIMS NF+NFPKG  F+++FDVLG+GIFN+D D WK+
Sbjct  66    FRFQGPWFANMEILGTANPADVHYIMSSNFQNFPKGPVFREMFDVLGEGIFNADSDSWKH  125

Query  1467  QRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTC  1288
             QR+ ARALI HQRFHR L + S+ KVEKGL+ VLE    E+  V+DLQD+FQR TFDTTC
Sbjct  126   QRRAARALIGHQRFHRCLSKISFEKVEKGLVSVLEMVCREKQ-VIDLQDLFQRLTFDTTC  184

Query  1287  TLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRAC  1108
              LVTGYDPGCLSVD PDVPFSKAMDDAEE +F+RH+LP+ +WKLQ+WLG+G E+KLS+A 
Sbjct  185   ALVTGYDPGCLSVDLPDVPFSKAMDDAEEAIFMRHVLPDRVWKLQRWLGVGSERKLSKAW  244

Query  1107  EILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDK  928
              +LD VIGKYI MKR+EL      +    D  +E+G DLLTSYIN  D   +  LK DDK
Sbjct  245   GVLDSVIGKYIAMKREEL-----RRGKLMDHEEEDGADLLTSYINGGDDAPSQYLKCDDK  299

Query  927   FLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKA  748
             FLRDTILNLMIAGRDTTSSALTWF+WLVSTHPEVEK IRDEL +  +  E+  K+R+FK 
Sbjct  300   FLRDTILNLMIAGRDTTSSALTWFMWLVSTHPEVEKKIRDELSSICDPSEESHKWRIFKI  359

Query  747   EELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQF  568
             +E+  LVY+H A+CE+LRLYPPVPFQHK P++ DILPSGH V P  ++MF LYAMGRM+ 
Sbjct  360   DEINKLVYMHGAMCEALRLYPPVPFQHKEPMKPDILPSGHYVHPKMKVMFFLYAMGRMES  419

Query  567   IWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  388
             IWGKD  EFKPERWI+ ERG +KHEPSYKFLAFNAGPRTCLG+EVAFTQMK VAA +IHN
Sbjct  420   IWGKDCLEFKPERWIS-ERGTIKHEPSYKFLAFNAGPRTCLGREVAFTQMKMVAATVIHN  478

Query  387   YHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             Y VR V+ H  +PN S+ILYM+HGLKVRV +R
Sbjct  479   YQVRVVEGHRVAPNCSVILYMRHGLKVRVAKR  510



>ref|XP_004237152.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=516

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/515 (65%), Positives = 390/515 (76%), Gaps = 5/515 (1%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
              +ASI Y EIFVA F     +          K P FG  PSLF H+  IH     + S  
Sbjct  7     VLASIGYIEIFVAIFLFFFVLAFGGKGDFGWKWPFFGEFPSLFYHINTIHQSLTILFSRI  66

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             G T  +KGP F N+DIL TVDP NVHYIMS NF+NF KG  FKKIFDVLGDGIFN+D DL
Sbjct  67    GATAFVKGPCFANMDILGTVDPKNVHYIMSANFQNFQKGPGFKKIFDVLGDGIFNADFDL  126

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK+QRK+A+ LI H  FH++LV+TS + V+ GL+PVLEF A E G V DLQDVFQRFTFD
Sbjct  127   WKDQRKIAKTLITHHTFHKFLVKTSCDMVKNGLVPVLEFMAKE-GIVFDLQDVFQRFTFD  185

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LVTG+DPG LSVD  ++ F KAM+D  EV+ IR+LLP  +WKLQ+WLGIGPEKKL 
Sbjct  186   TTCILVTGFDPGSLSVDLNNIAFMKAMNDMGEVMVIRNLLPRCVWKLQKWLGIGPEKKLR  245

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
              A E++D+VIGKYITMKR EL    K  N + +   E G DLL SYI N+DGET  GL F
Sbjct  246   DAREVIDRVIGKYITMKRDELRAKGKKLNKNEE---EEGVDLLASYIANDDGETKTGLMF  302

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKFLRDTILN MIAGRDTTSS LTWFIWLV THPE+EK IR+EL + ++ GE+ +K RL
Sbjct  303   DDKFLRDTILNFMIAGRDTTSSGLTWFIWLVVTHPEIEKKIREELKSIISLGEEGEKPRL  362

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             FK  E KN +YLHAALCESLRLYPPVPFQ K+P + D+LPSGH+V P  R+M  LYAMGR
Sbjct  363   FKGGEFKNAIYLHAALCESLRLYPPVPFQLKTPQEPDVLPSGHRVHPKMRVMVILYAMGR  422

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ +WGKDA EFKPERWI+ ERG VKHEPSYKF +FNAGPR CLGKEVAFTQMKAVAA+I
Sbjct  423   MESVWGKDALEFKPERWIS-ERGTVKHEPSYKFFSFNAGPRVCLGKEVAFTQMKAVAASI  481

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             IHNYHV  VK H+  PNVSIILYMK+G KVR++ R
Sbjct  482   IHNYHVEMVKGHEVCPNVSIILYMKNGFKVRIRNR  516



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/516 (64%), Positives = 401/516 (78%), Gaps = 11/516 (2%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             A+  + Y EIF+A  C  ++  L+D    P   P+FGMLP    ++++IH+R    +   
Sbjct  2     AIIGLGYIEIFLAILCFFLFHGLKDTKGYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRS  61

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTFL KGP F  +D+L TVDPANVHYIMS NF NFPKG +F++IFDVLGDGIFN+D+DL
Sbjct  62    GGTFLFKGPLFAKMDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADMDL  121

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK ARALI HQ+F+++LV+TS  KVEKGLIPVL+     +G +VDLQD+FQRFTFD
Sbjct  122   WKIQRKTARALITHQQFYKFLVKTSREKVEKGLIPVLDHVC-HKGVIVDLQDLFQRFTFD  180

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LVTGYDPGC+S+DFPDVPFSKAMDDAEE + +RH++PE++W+LQ+WLGIG EKKL 
Sbjct  181   TTCILVTGYDPGCVSIDFPDVPFSKAMDDAEEAILVRHVMPEAIWRLQKWLGIGEEKKLI  240

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             +A E +D VIG YI+ KR +L+ T      +  + DE GFDLLT Y+        MG+  
Sbjct  241   KAWETMDNVIGNYISKKRDKLLKT----ESELKLEDE-GFDLLTFYLKEGQ---NMGVNC  292

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKFLRDTILNLMIAGRDTTSSALTWFIWLV+ +P+VEK +R+E + +V   E+  K+R+
Sbjct  293   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVTQNPQVEKKLREE-INSVIPKEEVGKWRI  351

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F   EL  LVYLH ALC+SLRLYPPVPFQHK PL+ DILPSGHKV P  +++FSLYAMGR
Sbjct  352   FNVHELNKLVYLHGALCDSLRLYPPVPFQHKEPLKEDILPSGHKVHPKLKILFSLYAMGR  411

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ IWGKD  EFKPERWI+ ERG +KHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA I
Sbjct  412   MESIWGKDCLEFKPERWIS-ERGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAATI  470

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             IHNY V+ V+ H   PN SIILYM++G KVR+ RRW
Sbjct  471   IHNYQVQVVEGHPIKPNTSIILYMRYGFKVRISRRW  506



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/519 (62%), Positives = 398/519 (77%), Gaps = 12/519 (2%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             ++  + Y EIFVA  C  ++  L      P   P+ GMLPS+  H++ IHDR   ++S+ 
Sbjct  2     SIVGLGYIEIFVAILCFFLFHSLNHPKGYPKSWPIVGMLPSMLFHLKHIHDRLTVIMSVT  61

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTF+ KGP F  +DIL TVDP+NVHYIMS NF NFPKGK+FK++FDVLGDGIFN+D+DL
Sbjct  62    GGTFVPKGPLFAEMDILATVDPSNVHYIMSQNFMNFPKGKKFKELFDVLGDGIFNADMDL  121

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK  R+L+ HQ+F+++L++TS +KVEKGL+ VL+     +G +VDLQD+FQRFTFD
Sbjct  122   WKIQRKTTRSLVTHQQFYKFLIKTSRDKVEKGLVNVLDHVCN-KGVIVDLQDLFQRFTFD  180

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LVTGYDPGC+S+DFP VPFSKA+DDAEE +  RH++PE +WKLQ+WLGIG EKKLS
Sbjct  181   TTCILVTGYDPGCVSIDFPHVPFSKALDDAEEAILFRHVIPEPIWKLQRWLGIGEEKKLS  240

Query  1116  RACEILDQVIGKYITMKRQEL--ILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +A E +D VIG YI+ KR EL  I T+ ++  +ND     GFDLLT Y+    G   +G+
Sbjct  241   KAWETMDDVIGNYISKKRDELTKIETHDDEVEEND----EGFDLLTFYLKEGQG---LGV  293

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRDTILNLMIAGRDTTSSALTWFIWLV+ +P+VEK +R+E + ++   E+  KF
Sbjct  294   NCDDKFLRDTILNLMIAGRDTTSSALTWFIWLVTKNPQVEKKLREE-INSIIPKEEVGKF  352

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
             R+F   EL  LVYLH ALC+SLRLYPPVPFQHK PL+ D LPSGHKV P T ++FSLYAM
Sbjct  353   RVFNVHELNKLVYLHGALCDSLRLYPPVPFQHKEPLKEDTLPSGHKVHPKTMILFSLYAM  412

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
              R + IWGKD  EFKPERWI+ E G +KHEPSYKF+AFNAGPRTCLGKEVAFTQMKAVAA
Sbjct  413   ARTESIWGKDCLEFKPERWIS-ETGTIKHEPSYKFMAFNAGPRTCLGKEVAFTQMKAVAA  471

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              IIHNY V  V+     PN SIILYM++G KVR+ RRWT
Sbjct  472   TIIHNYKVEVVEGQTIEPNTSIILYMRYGFKVRISRRWT  510



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/510 (66%), Positives = 396/510 (78%), Gaps = 16/510 (3%)
 Frame = -2

Query  1812  EIFVAF-FCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLK  1636
             EI + F F L +W   R+    P   P+ GMLPSLF H+ ++H RC  +L L GGTF LK
Sbjct  11    EILLPFIFFLFVWC-FRNINGLPWNWPVVGMLPSLFCHLHRVHHRCVDILKLAGGTFHLK  69

Query  1635  GPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKL  1456
             GP F N DI+IT DPAN+H+IMS NF NFPKG  FK+IFDVLGDGIFN+D D W  QRK 
Sbjct  70    GPSFANSDIIITADPANIHFIMSSNFANFPKGPHFKEIFDVLGDGIFNADSDSWARQRKQ  129

Query  1455  ARALIIHQRFHRYLVRTSWNKVEKGLIPVLE-FAAGERGGVVDLQDVFQRFTFDTTCTLV  1279
             ARALI H  F R+L+RT+  KV   LIPVLE      RG VVDLQD+FQRFTFDTTC LV
Sbjct  130   ARALITHDSFRRFLIRTTSEKVRHSLIPVLEQVCNNSRGIVVDLQDLFQRFTFDTTCVLV  189

Query  1278  TGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEIL  1099
             TGYDPGCLSV  PDVPFS+A+D+AEE +F+RH LPESLWKLQ++LG G EK+LSRA  +L
Sbjct  190   TGYDPGCLSVGLPDVPFSRALDEAEEAIFMRHCLPESLWKLQRFLGFGHEKQLSRARVVL  249

Query  1098  DQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLR  919
             D VI KYI+ KR+E I+  K+  P +++  EN  DLL+SYIN ++ +       +D  LR
Sbjct  250   DSVIEKYISAKREE-IMAGKSGGP-HELGQENDLDLLSSYINESEND-------NDSSLR  300

Query  918   DTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK-KFRLFKAEE  742
             DTILN MIAGRDTTSSALTWF+WLVSTHPEVEK IRDEL + +   ED + K RLF+A+E
Sbjct  301   DTILNFMIAGRDTTSSALTWFVWLVSTHPEVEKKIRDELNSVI--PEDSRTKLRLFEADE  358

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
             ++NLVYLHAALCESLRLYPPVPFQHK+P +  +LPSGH   P+ +L+FSLYAMGRM++IW
Sbjct  359   VRNLVYLHAALCESLRLYPPVPFQHKAPARPVVLPSGHYAGPEMKLLFSLYAMGRMEYIW  418

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             GKD+ EFKPERWI  ERG VKHEPSYKFLAFNAGPRTCLGKEVAFTQ+K VAAAIIHNY 
Sbjct  419   GKDSGEFKPERWIT-ERGTVKHEPSYKFLAFNAGPRTCLGKEVAFTQLKCVAAAIIHNYQ  477

Query  381   VRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +  V+ H+ SPNVSIILYMK+GLKVRV +R
Sbjct  478   IEVVEGHNVSPNVSIILYMKYGLKVRVTKR  507



>ref|XP_009795090.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=513

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/517 (62%), Positives = 395/517 (76%), Gaps = 11/517 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVA-FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             + S+ Y EIF+A FF LV W I       P   P  GM P+L L++ +IH++   VLS  
Sbjct  7     LTSVGYLEIFIAIFFFLVFWAIGNTKNDLPRNYPFLGMFPTLLLNIHRIHEKITEVLSKT  66

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTFLLKGPWFTN+D+L TVDP NVHYIMS N  NFPKG EFKKIFD  GDGIFNSD DL
Sbjct  67    GGTFLLKGPWFTNMDMLGTVDPVNVHYIMSTNSSNFPKGPEFKKIFDAFGDGIFNSDFDL  126

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK Q K A+ L+I+Q++H+ L++T  +KV+ GLIP+L+F A E   + DLQD+F+R TFD
Sbjct  127   WKKQSKYAKELVINQKYHKCLIKTINDKVKDGLIPILDFMAKE-DKIFDLQDIFKRLTFD  185

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             T C +VTG+DPGCLS++FP VPF KAM+D + V+ IRHLLPES+WKLQ+WLG+GPEKKLS
Sbjct  186   TICKVVTGFDPGCLSLEFPCVPFVKAMEDIDYVIVIRHLLPESIWKLQKWLGVGPEKKLS  245

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             +A E++DQ+I K+I MKR+EL       N       E GFDLLT  I  NDGE T GLKF
Sbjct  246   KAVEVVDQIIEKFILMKREEL------SNGAKSKQQEVGFDLLTLCI-VNDGERTTGLKF  298

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             D+KFLRDTI + + AGRD  +S LTWFIWLV  HPEVE+NIR+E L A+   E+ +K++ 
Sbjct  299   DNKFLRDTIFSFLFAGRDGVNSCLTWFIWLVFAHPEVERNIREE-LKAIIPVEETEKWKF  357

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F AE+LKN++YLHAALCE++RLYPPVPFQHK P + DILPSGH V P  R+MF+LYAMGR
Sbjct  358   FTAEDLKNMIYLHAALCETMRLYPPVPFQHKRPQKHDILPSGHHVHPKMRVMFNLYAMGR  417

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+FIWGK+A EFKPERWI+ E G +KHE SYKFL F AGPR C+G E +FTQ+K +AAAI
Sbjct  418   MEFIWGKEASEFKPERWIS-ECGTIKHEASYKFLTFGAGPRKCIGIETSFTQLKVMAAAI  476

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             IHNY ++ VK+HD SPN SIIL+MKHG KVRV++RW 
Sbjct  477   IHNYEIKMVKDHDVSPNCSIILHMKHGFKVRVKKRWA  513



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/522 (62%), Positives = 398/522 (76%), Gaps = 17/522 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVA---FFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             M  I Y E+F++   F  L +W+     YR      P+ GMLP+L LHV +IHD C  ++
Sbjct  1     MVGIVYIELFLSVMWFMALWVWL----NYRALAWNWPVIGMLPTLLLHVSRIHDNCTEIM  56

Query  1665  S-LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
                  GTF  +GPW  ++D++ T DP NVHYIMS NF+NFPKG +F++IFDVLGDGIFN+
Sbjct  57    GKSRRGTFHFRGPWLADMDMMGTADPENVHYIMSANFQNFPKGPKFREIFDVLGDGIFNA  116

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D + W++QR++ARALI H  F R+L + S  KVEKGLIPVLE    E   VVDLQD+FQR
Sbjct  117   DSESWRDQRRVARALISHHGFLRFLAKISREKVEKGLIPVLETVCLE-NRVVDLQDLFQR  175

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
              TFDTTCT VTGYDPGCLSVD PDVPFSKA+DDAEE +F+RH++PE +WKLQ+W G+G E
Sbjct  176   LTFDTTCTFVTGYDPGCLSVDLPDVPFSKALDDAEEAIFMRHVVPEKIWKLQRWFGVGSE  235

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYIN-NNDGETT  952
             +KLS+A E+LD VIG+YI +KR E+    +++    D  +E+G DLLTSY+   +DG  T
Sbjct  236   RKLSKAREVLDSVIGRYIALKRGEM----RSRGISIDCENEDGVDLLTSYMTVGDDGTQT  291

Query  951   MGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDP  772
               LK DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTH EVEK IRDEL + + +GE  
Sbjct  292   HDLKCDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHAEVEKRIRDELKSFLPAGER-  350

Query  771   KKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSL  592
             +K+R+F  EE K LVY+H A+CE+LRLYPPVPFQHK P++ DILPSGH V P  ++MFSL
Sbjct  351   EKWRVFGVEETKKLVYMHGAICEALRLYPPVPFQHKEPVEPDILPSGHFVEPTMKVMFSL  410

Query  591   YAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKA  412
             YAMGRM+ +WG+D  EFKPERWI+ +RG++KHEPSYKFLAFNAGPRTCLGK+VAF Q+KA
Sbjct  411   YAMGRMESVWGEDCLEFKPERWIS-DRGSIKHEPSYKFLAFNAGPRTCLGKDVAFAQVKA  469

Query  411   VAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             VAA +IHNY V     H   PN SIILYM++GLKVRV  RW+
Sbjct  470   VAATLIHNYQVHVADGHRVLPNCSIILYMRNGLKVRVANRWS  511



>gb|EPS72790.1| hypothetical protein M569_01963, partial [Genlisea aurea]
Length=491

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/485 (67%), Positives = 374/485 (77%), Gaps = 22/485 (5%)
 Frame = -2

Query  1740  VPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGN  1561
             +P  GM P L+  + +IHD C  VL L GGTFLLKGPWF NLDIL TVDP NVH+IMS N
Sbjct  26    MPFVGMFPILYQKLNRIHDACVEVLELFGGTFLLKGPWFVNLDILATVDPENVHFIMSQN  85

Query  1560  FENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKG  1381
             F NFPKG EFKKIFDVLGDGIFNSD + W+ QRK ARALI H+RF R+LV T+  K+EKG
Sbjct  86    FNNFPKGTEFKKIFDVLGDGIFNSDGEAWRVQRKQARALIAHERFRRFLVETNAGKLEKG  145

Query  1380  LIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEE  1201
             LIP+LE AAG  GG +DLQDVFQRFTFDTTC L+TGYDPGCLSVD PDVPFS AMD AEE
Sbjct  146   LIPILERAAGN-GGALDLQDVFQRFTFDTTCMLITGYDPGCLSVDLPDVPFSAAMDTAEE  204

Query  1200  VLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDN  1021
              +FIRH+LPE+LWK+ ++L IG E++L RA  +LD+VIG YI MK+ EL          +
Sbjct  205   AIFIRHILPETLWKIGRFLRIGYEQRLKRAHGVLDRVIGDYIAMKKSEL----------S  254

Query  1020  DINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVS  841
             D   +N  DLLTSYI+ +D          DKFLRDT+LNLMIAGRDTTSSALTWFIWLVS
Sbjct  255   DPTRKNSDDLLTSYISESD--------VTDKFLRDTVLNLMIAGRDTTSSALTWFIWLVS  306

Query  840   THPEVEKNIRDELLTAVN--SGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQH  667
             +HP+VE  I  EL +  N  +G      RLFK EEL NLVYLH ALCESLRLYPPVPFQH
Sbjct  307   SHPDVESKILTELASLPNPPAGSPAAACRLFKPEELHNLVYLHCALCESLRLYPPVPFQH  366

Query  666   KSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPS  487
             KSP    +LPSGH V P  +++FSLYAM RM +IWG+D KEF+PERWIN  RG V +EPS
Sbjct  367   KSPAAPAVLPSGHYVHPKMKVLFSLYAMARMAYIWGEDCKEFRPERWIN-GRGKVNYEPS  425

Query  486   YKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKV  307
             YKF+AFNAGPRTC+GKEVAFTQ+KAVAAA+I+NY V  V+ HD SPNVS+ILYMKHG KV
Sbjct  426   YKFMAFNAGPRTCIGKEVAFTQLKAVAAAVIYNYRVELVEGHDVSPNVSVILYMKHGFKV  485

Query  306   RVQRR  292
             RV +R
Sbjct  486   RVTKR  490



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/529 (60%), Positives = 391/529 (74%), Gaps = 9/529 (2%)
 Frame = -2

Query  1875  LEKTSRTTSIITCAMASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVR  1696
             +E T+ ++      MA + Y EI +A    +I     +    P   PL GM PS+FLH+ 
Sbjct  2     VELTNPSSKQSAALMALLGYPEILLAVIFFIILGRFWNINDLPWNWPLLGMFPSVFLHLH  61

Query  1695  KIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFD  1516
             +IHDR   +L   G TFL+KGPWF N+D+L+T DPANVHYIMS +F NFPKG EF KIFD
Sbjct  62    RIHDRVTDILEKSGCTFLVKGPWFCNMDLLVTTDPANVHYIMSSHFSNFPKGSEFSKIFD  121

Query  1515  VLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGV  1336
              LGDGIFNSD + W+ QRKL + +I + R +R+L + + NKVEKGL+P+L++ + +    
Sbjct  122   FLGDGIFNSDAESWRKQRKLGQLMINNVRLYRFLGKITQNKVEKGLLPILDYLSEQEDRA  181

Query  1335  VDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKL  1156
             +DLQDVFQR TFDTTC LVTG+D  CLS++ P+VPF+ A++DAEE +  RH+LPE+LW+L
Sbjct  182   MDLQDVFQRLTFDTTCMLVTGFDSKCLSIELPEVPFATALEDAEEAILHRHVLPETLWRL  241

Query  1155  QQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYI  976
             Q+WLGIG EKK  +A E LD  I +YI+ KR EL     ++   N   +E+G DLLTSY+
Sbjct  242   QRWLGIGKEKKHQKAWETLDHTIAEYISKKRDEL-----SKGIINLQEEEDGVDLLTSYM  296

Query  975   NNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLT  796
             + +    TMGLK D KFLRDTILN MIAGRDTTSSALTWF WLVS +P VE  IR+EL +
Sbjct  297   SED---ITMGLKCDHKFLRDTILNFMIAGRDTTSSALTWFFWLVSKNPLVESKIREELES  353

Query  795   AVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSP  616
             A+   ED K    FK E L  LVYLHAALCE+LRLYPPVPFQHK+PLQ D+LPSGH+V P
Sbjct  354   AIPEKEDKKGRHTFKTEALNKLVYLHAALCETLRLYPPVPFQHKAPLQPDMLPSGHRVDP  413

Query  615   DTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKE  436
               +++FSLYAMGRM  IWG D  EFKPERWI+ ERG +KHEPSYKF AFNAGPRTCLGKE
Sbjct  414   KMKILFSLYAMGRMTSIWGTDCLEFKPERWIS-ERGRIKHEPSYKFFAFNAGPRTCLGKE  472

Query  435   VAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             VAFTQMKAVAA IIHNYHV+ V+ H  +PNVSIILYMKHGL VRV +RW
Sbjct  473   VAFTQMKAVAATIIHNYHVQVVEGHHVAPNVSIILYMKHGLMVRVSKRW  521



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/515 (62%), Positives = 395/515 (77%), Gaps = 13/515 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MASI Y EI +A  C ++   L +    P   PL GMLP +F ++++I DRC  VL    
Sbjct  1     MASIGYPEILLAVICFLLLHRLSNSNMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSS  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTFLLKGPWF N+D+LIT DPANVHYIMS NF NFPKG EF KIFDVLG+GIFNSD DLW
Sbjct  61    GTFLLKGPWFANMDMLITSDPANVHYIMSTNFSNFPKGPEFLKIFDVLGEGIFNSDSDLW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             + QRKLA+ LI  ++F ++LV+T+ NKV++GLIPVLE  + ++G +VDLQD+FQRFTFDT
Sbjct  121   RKQRKLAQVLINDRQFQQFLVKTTENKVDEGLIPVLEHVS-KQGLLVDLQDLFQRFTFDT  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC L+TG+D  CLS++FP V F+KAMDD EE +F RH++PESLWKLQ+WLGIG EKKLS+
Sbjct  180   TCKLITGFDTKCLSIEFPRVLFAKAMDDVEEAIFFRHVVPESLWKLQRWLGIGEEKKLSK  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
               E +D VI +YI+MK +EL     ++       DE G DLLTSY+N +   +TM LK  
Sbjct  240   GWETIDNVIAEYISMKHEEL-----SKGIAKLQEDEEGTDLLTSYMNED---STMELK-S  290

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             +KFLRDTI+N ++AGRDTTS+ALTWF WLVS +P VE  IR+EL   +   E  +K+ +F
Sbjct  291   NKFLRDTIVNFLLAGRDTTSAALTWFFWLVSKNPLVEAKIREELKETI--PEKDQKWHIF  348

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             + EEL  LVYLH ALCE+LRLYPPVPFQHK+P Q D+LPSGH+V P  +++FSLYAMGRM
Sbjct  349   RTEELNKLVYLHGALCETLRLYPPVPFQHKAPHQADVLPSGHRVHPKMKILFSLYAMGRM  408

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
               IWGKD  EFKPERWI  E+G +K+EPSYKF AFNAGPRTCLGK VAFTQMKAVAAAII
Sbjct  409   TTIWGKDCFEFKPERWIT-EQGGIKYEPSYKFFAFNAGPRTCLGKGVAFTQMKAVAAAII  467

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             HNY+V+ V+ H  +PNVSIIL+MKH L VRV +RW
Sbjct  468   HNYNVQLVQGHPVAPNVSIILHMKHELMVRVTKRW  502



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/517 (61%), Positives = 385/517 (74%), Gaps = 14/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVA--FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSL  1660
             MA + Y EI VA  FF  +     + G   P   P+ GM   L  HV +IHD  A +L  
Sbjct  1     MALVSYPEILVAVIFFLFIGGFCSKKGV--PWNWPIVGMFAGLLFHVHRIHDEAAEILEK  58

Query  1659  HGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLD  1480
              G TFL KGPWF N+D+L T DPANVHYIMS NF NFPKG EF+K+F+VLGDGIFN+D +
Sbjct  59    TGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFPKGTEFRKMFEVLGDGIFNADGE  118

Query  1479  LWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTF  1300
              W+NQRKL +++I + RFHR+L + ++NKVEKGL+P+L+  + E+G VVDLQDVFQR TF
Sbjct  119   SWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLLDHLS-EQGRVVDLQDVFQRLTF  177

Query  1299  DTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKL  1120
             DTTC LVTG+D  CLS++FP+VPF+ A++D EE +F RH LPE+LW+L +WLGIG EKKL
Sbjct  178   DTTCMLVTGFDTKCLSIEFPEVPFATALEDVEEAVFYRHALPETLWRLLRWLGIGKEKKL  237

Query  1119  SRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLK  940
              +  + LD  I +YI+MKR+EL     ++       DE+G DLLTSY+  ++    +GLK
Sbjct  238   RKGWKTLDHTIAEYISMKREEL-----SKGITKLREDEDGADLLTSYMTEDNA---IGLK  289

Query  939   FDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFR  760
              D KFLRDTILN MIAGRDTTSSALTWF WLVS +P VE  IR+E+ TA+   ED K   
Sbjct  290   CDGKFLRDTILNFMIAGRDTTSSALTWFFWLVSKNPLVESKIREEIETAIPEKEDRKGRH  349

Query  759   LFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMG  580
             +FK E L  LVYLHAA+CE+LRLYPPVPFQHK+P+Q D+LPSGHKV P  ++ F +YAMG
Sbjct  350   IFKTEGLNKLVYLHAAMCEALRLYPPVPFQHKAPIQPDVLPSGHKVDPKMKIFFPVYAMG  409

Query  579   RMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAA  400
             RM  IWGKD  EFKPERWI+ E G +KHEPSYKF +FNAGPRTC+GKEVAFTQMKAVAA 
Sbjct  410   RMTAIWGKDCLEFKPERWIS-ELGKIKHEPSYKFFSFNAGPRTCIGKEVAFTQMKAVAAT  468

Query  399   IIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             IIHNYHV  VK H  +PNVSIILYMK G KVRV +RW
Sbjct  469   IIHNYHVEMVKGHHVAPNVSIILYMKRGFKVRVSKRW  505



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/486 (66%), Positives = 375/486 (77%), Gaps = 17/486 (3%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVL-SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGN  1561
             PL GMLP L L+V +IH+ C  VL     GTF  +GP F N+D+L TVDP N+HYIM+ N
Sbjct  35    PLIGMLPGLLLNVGRIHEICTEVLRKSRRGTFHFQGPCFANMDMLWTVDPENIHYIMTSN  94

Query  1560  FENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKG  1381
             F NFPKG EF++IFDVLGDGIFNSD D WK+QR ++RALI H+ FHR+L   S  KVEKG
Sbjct  95    FRNFPKGPEFREIFDVLGDGIFNSDDDSWKDQRNVSRALITHRSFHRFLAVISREKVEKG  154

Query  1380  LIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPD-VPFSKAMDDAE  1204
             LIPVLE AA E   V+DLQD+FQRFTFD+ C LVTGY+PGCLS+D  D VPFSKAMDD E
Sbjct  155   LIPVLEKAALE-NRVLDLQDLFQRFTFDSICQLVTGYNPGCLSLDLADDVPFSKAMDDVE  213

Query  1203  EVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPD  1024
             E +F+RH+LPE +WKLQ+WLG+G E++LS+A EILD  I KYI MKR E+      +N D
Sbjct  214   ESIFVRHVLPEKIWKLQRWLGVGGERRLSKASEILDSFIIKYIAMKRNEI----SRKNGD  269

Query  1023  NDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLV  844
              +I +ENG DLLT+Y+N       +G + DDKFLRDTILNLMIAGRDTTSSALTWF+WLV
Sbjct  270   WNIENENGEDLLTAYMN-------LGDRDDDKFLRDTILNLMIAGRDTTSSALTWFVWLV  322

Query  843   STHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHK  664
             STHP+VE  IRDE+ T + SGE   +   F  +E K LVYLH ALCE+LRLYPPVPFQHK
Sbjct  323   STHPQVENKIRDEIKTIIPSGE---RRGFFSVDETKKLVYLHGALCEALRLYPPVPFQHK  379

Query  663   SPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSY  484
              P++ D LPSGH V P  +++FSLYAMGRM+ IWGKD  EFKPERWI+    +V+HEPSY
Sbjct  380   EPVEPDTLPSGHFVHPKMKVLFSLYAMGRMESIWGKDCSEFKPERWISEGGRSVRHEPSY  439

Query  483   KFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVR  304
             KFLAFNAGPRTCLGKEVAFTQMKAVAAA+IHNY VR V  H   PN SIILYM+ GLKVR
Sbjct  440   KFLAFNAGPRTCLGKEVAFTQMKAVAAALIHNYRVRVVDGHRVVPNCSIILYMRDGLKVR  499

Query  303   VQRRWT  286
             V  RW+
Sbjct  500   VASRWS  505



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/516 (61%), Positives = 383/516 (74%), Gaps = 13/516 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MAS+   EIF A   L I     +  +R P   PL GMLP    ++ + ++R A V+ L 
Sbjct  1     MASLGLLEIFFAIVALAISCCFGNKKKRLPRNWPLVGMLPDSIRNLHRPYERIAEVIQLS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GG+F+ K  WF + ++L TVDPAN+HYIMS NF NFPKG  F +IFD+LGDGIFN+D  L
Sbjct  61    GGSFIYKSLWFFSPNVLNTVDPANIHYIMSSNFSNFPKGSMFSRIFDILGDGIFNADSHL  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WKNQRKLA  LI HQ+F R+LV++SWNKVEKGLIPVLE  A ++G VVDLQDVFQRFTFD
Sbjct  121   WKNQRKLAHVLINHQQFQRFLVKSSWNKVEKGLIPVLEHVA-KQGSVVDLQDVFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
              T  LVTGYDPGCLS++FP V FSKAMDDAEE +F RHL PE   KLQ+WLG G E+KL 
Sbjct  180   ITSILVTGYDPGCLSIEFPQVEFSKAMDDAEEAIFYRHLWPEIFLKLQRWLGFGQEQKLK  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
              A + LD ++ +YI+ KR++L            I DE+G DLLTSY+++ +    MGLK 
Sbjct  240   EAWQTLDHMVAEYISRKREKL------SKKTTTIEDEDGVDLLTSYMSHPE---IMGLKT  290

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKFLRDTI+N  +AGRDTTSSALTWF WLVS +P+VE  IR E L A    E+ + +RL
Sbjct  291   DDKFLRDTIVNFFLAGRDTTSSALTWFFWLVSQNPQVESKIRQE-LKATMPAEERENWRL  349

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F  +EL NLVYLH ALCE+LRLYPPVPFQHK PL++D+LPSGH+V P+  ++FS+Y MGR
Sbjct  350   FSTQELSNLVYLHGALCETLRLYPPVPFQHKEPLKSDVLPSGHRVGPNMMVLFSVYVMGR  409

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M  IWG D  EFKPERWI+ + G +KHEPSYKFLAFNAGPRTCLG+ VAFTQMKAVAAAI
Sbjct  410   MTSIWGPDCLEFKPERWIS-DSGKIKHEPSYKFLAFNAGPRTCLGRGVAFTQMKAVAAAI  468

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             IHNY V  V+ H  +P+ SIIL+MKHGLKV + R+W
Sbjct  469   IHNYQVHVVEGHPVAPSSSIILHMKHGLKVSLSRKW  504



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/519 (61%), Positives = 389/519 (75%), Gaps = 13/519 (3%)
 Frame = -2

Query  1842  TCAMASIDYFEIFVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             T +MAS+   EIF+A   L I+    +  +R P   PL GMLP    ++ + ++R A V+
Sbjct  6     TLSMASLGLLEIFLAIVALAIFRCFGNKKKRLPTNWPLVGMLPDSIQNLHRPYERIAEVI  65

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              L GG+F+ K  WF +  +L TVDPAN+HYIMS NF NFPKG  F +IFD+LGDGIFN+D
Sbjct  66    QLSGGSFIYKSLWFLSPHVLNTVDPANIHYIMSSNFSNFPKGSMFSRIFDILGDGIFNAD  125

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
               LWKNQRKLA  LI HQ+F R+LV +SW+KVEKGLIPVLE  A ++G VVDLQDVFQRF
Sbjct  126   SHLWKNQRKLAHMLINHQQFQRFLVNSSWSKVEKGLIPVLEQVA-KQGSVVDLQDVFQRF  184

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFD T  LVTGYDPGCLS++FP V FSKAMDDAEE +F RHL PE   KLQ+WLG G E+
Sbjct  185   TFDITSILVTGYDPGCLSIEFPQVEFSKAMDDAEEAIFYRHLWPEIFLKLQRWLGFGHEQ  244

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL  A + LD ++ +YI+ KR++L         +  I DE+G DLLTSY+++ +    MG
Sbjct  245   KLKEAWQTLDHMVAEYISRKREKL------NKKNTMIEDEDGVDLLTSYMSHPE---IMG  295

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
             LK DDKFLRDTI+N  +AGRDTTSSALTWF WLVS +P+VE  IR+EL + +   E+ + 
Sbjct  296   LKTDDKFLRDTIVNFFLAGRDTTSSALTWFFWLVSQNPQVESKIREELKSTM-PAEEREN  354

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +RLF  +EL NLVYLH ALCE+LRLYPPVPFQHK PL++D+LPSGH+V P+T ++FS+Y 
Sbjct  355   WRLFSTQELSNLVYLHGALCETLRLYPPVPFQHKEPLKSDVLPSGHRVGPNTMVLFSVYV  414

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM  IWG D  EFKPERWI+ + G +KHEPSYKFLAFNAGPRTCLG+ VAFTQMKAVA
Sbjct  415   MGRMASIWGPDCIEFKPERWIS-DSGKIKHEPSYKFLAFNAGPRTCLGRGVAFTQMKAVA  473

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             AAIIHNY V  V+ H  +P+ SIIL+MKHGLKV + ++W
Sbjct  474   AAIIHNYQVHVVEGHPVAPSSSIILHMKHGLKVSLSKKW  512



>gb|EPS57870.1| hypothetical protein M569_16947 [Genlisea aurea]
Length=505

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/486 (62%), Positives = 376/486 (77%), Gaps = 14/486 (3%)
 Frame = -2

Query  1740  VPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGN  1561
             +P  G  P LF  +R+IHD C  VL    GT+LL GPWF NLDIL+T DPANVH++MS N
Sbjct  28    MPFVGTFPVLFYKMRRIHDACVEVLETFHGTYLLNGPWFANLDILVTADPANVHFVMSEN  87

Query  1560  FENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKG  1381
             F NFPKG EF+KIFDVLGDGIFNSD ++W+ QRK ARALI H RF ++LV T+  K+ +G
Sbjct  88    FANFPKGDEFRKIFDVLGDGIFNSDGEMWRRQRKQARALIAHDRFRKFLVETNRRKMAEG  147

Query  1380  LIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEE  1201
             LIPV+E AA + G V+DLQD+FQRFTFDTTC  +TG+DPGCL++D P+VPFS AMDDAEE
Sbjct  148   LIPVIERAAAD-GTVLDLQDIFQRFTFDTTCIFITGFDPGCLTLDLPEVPFSSAMDDAEE  206

Query  1200  VLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDN  1021
              +F+RH+LPE +WK++++LGIG E+KL RA   LD  +  YI MKR E+      + P  
Sbjct  207   AIFMRHVLPEFVWKIERFLGIGHEEKLRRARATLDAAVQGYIDMKRDEISRKVSGETP--  264

Query  1020  DINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVS  841
                     DLLT+YI+  +GE+    + DDKFLRD+ILNLMIAGRDTTSSALTWF WLVS
Sbjct  265   ------AVDLLTAYID--EGESITNER-DDKFLRDSILNLMIAGRDTTSSALTWFTWLVS  315

Query  840   THPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKS  661
             THPEV + IR EL +   + +    +R F AEEL +LVYLHA+LCESLRLYPPVPFQHKS
Sbjct  316   THPEVRRKIRGELNSLPPAEQTDDGWRYFTAEELSSLVYLHASLCESLRLYPPVPFQHKS  375

Query  660   PLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWI--NWERGAVKHEPS  487
             P +  +LPSGH   P T+++FS+YAMGRM ++WGKD+KE+KPERWI  + ERG +K+EPS
Sbjct  376   PAKAVVLPSGHTAHPKTKVLFSVYAMGRMDYVWGKDSKEYKPERWIINSGERGTIKYEPS  435

Query  486   YKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKV  307
             YKF+AFNAGPRTCLG+EVAFTQ+K++AAAI++NY V  V+ HD +PNVS+ILYMKHG KV
Sbjct  436   YKFMAFNAGPRTCLGREVAFTQLKSLAAAIVYNYDVATVEGHDVTPNVSVILYMKHGFKV  495

Query  306   RVQRRW  289
             ++ +RW
Sbjct  496   KLSKRW  501



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/479 (65%), Positives = 378/479 (79%), Gaps = 8/479 (2%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP+L L+   +HD C  V  L GGTFL KGPWF N+D L+TVDPAN+H+IMSGNF NFP
Sbjct  1     MLPNLILYANWLHDNCTNVARLAGGTFLFKGPWFFNMDTLLTVDPANIHHIMSGNFPNFP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG +FK++FDVLGDGIFN+D+DLWK+QRK  R LI H RFH++LV+TS +KVEKGLIPVL
Sbjct  61    KGPKFKEMFDVLGDGIFNADMDLWKSQRKTTRFLINHHRFHQFLVKTSRDKVEKGLIPVL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +    + G V+DLQD+FQRFTFDTTC LVTGYDPGC+S++FPDVPF++A+D AEE +  R
Sbjct  121   DHLC-KTGQVLDLQDLFQRFTFDTTCKLVTGYDPGCVSINFPDVPFARALDRAEEAIAAR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             ++ PES WKLQ+ L IG EKK S A + LD+VIG+YI+ KR+EL     ++   +  +D+
Sbjct  180   NIQPESTWKLQRLLNIGEEKKYSEAWKTLDRVIGEYISKKREELSSKSSSK---SRTDDQ  236

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +G DLLTSYI   + +T      DD FLRDTILNLMIAGRDTTSSALTWF WL+S +P V
Sbjct  237   DGIDLLTSYI--TEAKTMELPSDDDTFLRDTILNLMIAGRDTTSSALTWFFWLLSQNPIV  294

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
             E  IR+E L ++    D +K++LFK ++L  LVYLH ALCESLRLYPPVPFQHK PL+ D
Sbjct  295   ETKIREE-LRSITPPVDTEKYQLFKVQDLNKLVYLHGALCESLRLYPPVPFQHKEPLEPD  353

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             ILP+GH+V P  ++MFSLYAMGRM  IWGKD  E KPERWI+ +RG +KHEPSYKFLAFN
Sbjct  354   ILPTGHQVYPKMKIMFSLYAMGRMASIWGKDCMEMKPERWIS-DRGTIKHEPSYKFLAFN  412

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             AGPRTCLGKEVAFTQ+KAVAA IIHNYHVR VK     PN+S+ILY+K GLKV+V +RW
Sbjct  413   AGPRTCLGKEVAFTQLKAVAATIIHNYHVRVVKGQKIVPNISVILYIKQGLKVKVSKRW  471



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/479 (63%), Positives = 368/479 (77%), Gaps = 10/479 (2%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M   L  HV +IHD  A +L   G TFL KGPWF N+D+L T DPANVHYIMS NF NFP
Sbjct  1     MFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EF+K+F+VLGDGIFN+D + W+NQRKL +++I + RFHR+L + ++NKVEKGL+P+L
Sbjct  61    KGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +  + E+G VVDLQDVFQR TFDTTC LVTG+D  CLS++FP+VPF+ A++D EE +F R
Sbjct  121   DHLS-EQGRVVDLQDVFQRLTFDTTCMLVTGFDTKCLSIEFPEVPFATALEDVEEAVFYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H LPE+LW+L +WLGIG EKKL +  + LD  I +YI+MKR+EL     ++       DE
Sbjct  180   HALPETLWRLLRWLGIGKEKKLRKGWKTLDHTIAEYISMKREEL-----SKGITKLREDE  234

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +G DLLTSY+  ++    +GLK D KFLRDTILN MIAGRDTTSSALTWF WLVS +P V
Sbjct  235   DGADLLTSYMTEDNA---IGLKCDGKFLRDTILNFMIAGRDTTSSALTWFFWLVSKNPLV  291

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
             E  IR+E+ TA+   ED K   +FK E L  LVYLHAA+CE+LRLYPPVPFQHK+P+Q D
Sbjct  292   ESKIREEIETAIPEKEDRKGRHIFKTEGLNKLVYLHAAMCEALRLYPPVPFQHKAPIQPD  351

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV P  ++ F +YAMGRM  IWGKD  EFKPERWI+ E G +KHEPSYKF +FN
Sbjct  352   VLPSGHKVDPKMKIFFPVYAMGRMTAIWGKDCLEFKPERWIS-ELGKIKHEPSYKFFSFN  410

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             AGPRTC+GKEVAFTQMKAVAA IIHNYHV  VK H  +PNVSIILYMK G KVRV +RW
Sbjct  411   AGPRTCIGKEVAFTQMKAVAATIIHNYHVEMVKGHHVAPNVSIILYMKRGFKVRVSKRW  469



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/520 (62%), Positives = 388/520 (75%), Gaps = 18/520 (3%)
 Frame = -2

Query  1815  FEIFVA---FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS-LHGGT  1648
             FE+ +A   FF L +W   R+  R     PL GMLP+L  HV +IHD C  +L     GT
Sbjct  3     FEVILAAVWFFALWLW---RNKKRIAWNWPLIGMLPALLHHVGRIHDGCTEILRRTRRGT  59

Query  1647  FLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKN  1468
             F  KGPWF+ ++IL TV+PANVHYIMS NF NFPKG +F++IFDVLGDGIFNSD D W++
Sbjct  60    FHFKGPWFSGMEILGTVNPANVHYIMSANFHNFPKGPKFREIFDVLGDGIFNSDADSWRH  119

Query  1467  QRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTC  1288
             QR+ AR  + H+RFHR+LV+ S +KV  GL+PVLE A+ E   V+DLQD+FQR TFDTTC
Sbjct  120   QRRAARGFLSHRRFHRFLVKISRDKVAYGLVPVLEMASKE-NWVLDLQDIFQRLTFDTTC  178

Query  1287  TLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRAC  1108
              LVTG+DPGCLSVD P+VPFSKAMDD EE +F+RH+LPE +WK+ +WL +G E+K+S   
Sbjct  179   ALVTGFDPGCLSVDLPEVPFSKAMDDVEEAIFLRHVLPEKIWKMLRWLRVGSERKMSDGS  238

Query  1107  EILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETT----MGLK  940
             +ILD VIGKYI+ KR EL    K +  +++  D +G DLLTSYIN  D  +     +   
Sbjct  239   KILDDVIGKYISKKRDELRDGNKKKFIEDENEDGDGDDLLTSYINGGDSISQTLDPIQTA  298

Query  939   FDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF-  763
              +DKFLRDTILNLMIAGRDTTSSALTWF WLVSTH EVE+ I +EL + + S +DP +  
Sbjct  299   DEDKFLRDTILNLMIAGRDTTSSALTWFTWLVSTHQEVERKILEELKSVI-SDQDPSEGE  357

Query  762   --RLFKAEELKN-LVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSL  592
               R+FK EE+ N  VYLH ALCE+LRLYPPVPFQHK P Q DILPSGH V P+ ++MF L
Sbjct  358   FPRVFKVEEITNKAVYLHGALCEALRLYPPVPFQHKEPNQPDILPSGHYVHPEMKVMFFL  417

Query  591   YAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKA  412
             YAMGRM+ +WGKD  EFKPERWI  ERG++KHEPSYKFLAFNAGPRTCLGKEVAF QMK 
Sbjct  418   YAMGRMESVWGKDCLEFKPERWIT-ERGSIKHEPSYKFLAFNAGPRTCLGKEVAFVQMKM  476

Query  411   VAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             VAA II+NY VR V  H   PN S+ILYM+ GLKVRV +R
Sbjct  477   VAATIIYNYRVRVVDGHRVEPNCSVILYMRDGLKVRVSKR  516



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/515 (59%), Positives = 377/515 (73%), Gaps = 10/515 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MAS+   EIF+A    VI     +   +P+  P+FGMLP    H+ +IH R   VL   G
Sbjct  1     MASLTLLEIFIAITSYVILRCFFNKNGQPINWPVFGMLPDTLYHLHRIHQRTTEVLERAG  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              T   KGPWF+N+ IL TVDP N+HYIMS NF NFPKG EF KIFD+LGDGIFNSD + W
Sbjct  61    STLYYKGPWFSNVKILATVDPTNIHYIMSSNFSNFPKGPEFSKIFDILGDGIFNSDSNSW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             KNQRKLA  LI    FH++L+ T  + VEKGL+PVLE  + ++   VDLQD+FQRFTFD 
Sbjct  121   KNQRKLAHTLINRGCFHKFLINTCQDMVEKGLLPVLEHVS-DQDLEVDLQDLFQRFTFDI  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC LVTGY+P CLS++ P V FSKAMDDAEE LF RHL PE +WKLQ+WLGIG EKK+++
Sbjct  180   TCALVTGYNPRCLSIELPLVEFSKAMDDAEEALFYRHLTPEFVWKLQRWLGIGQEKKMAK  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A ++LD     YI+ KR++L+   KN N   +     G DLLTSY+N  +G+  +G   D
Sbjct  240   ARKVLDDTSRNYISRKREQLV---KNNNIQEN---GEGVDLLTSYMN--EGDKILGTIPD  291

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             +KFLRDTI+NL++AGRDTTSS L+WF WL+S +P  E  IR E+      G+    +   
Sbjct  292   EKFLRDTIINLLLAGRDTTSSGLSWFFWLISKNPRAESKIRQEIQEITLQGKKANTWCAL  351

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
               +E+ +LVYLHAALCESLRLYPPVPFQHKSPLQ D+LPSGH+VSP+ +++F LY+MGRM
Sbjct  352   NVQEVNSLVYLHAALCESLRLYPPVPFQHKSPLQNDVLPSGHEVSPEMKIVFCLYSMGRM  411

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
               IWG+D  EFKPERWI+   G +KHEPSYKFLAFNAGPRTCLGKEVAFTQMK VAA+I+
Sbjct  412   ASIWGEDCLEFKPERWIS-GGGKIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKIVAASIL  470

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             HNY+V+ V++H  +P+ SIIL+MKHGLKV V RRW
Sbjct  471   HNYNVKVVEDHPVTPSASIILHMKHGLKVNVSRRW  505



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/520 (60%), Positives = 384/520 (74%), Gaps = 15/520 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDG-YRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS-L  1660
             MA I  FE+ +A  C +    LR+  +  P   PL GM+P L L+  +IHD C  +L   
Sbjct  1     MAFICIFEVLLAIICFLFLFCLRNNVHGTPKNFPLVGMMPGLLLNTHRIHDWCTEILERC  60

Query  1659  HGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLD  1480
                T+L +GPWF  +++L+T DPAN+HYIMS NF NFPKG EFK+IFD+LGDGIFN+D+D
Sbjct  61    QCSTYLFQGPWFAKMNMLVTCDPANIHYIMSSNFCNFPKGSEFKEIFDILGDGIFNADMD  120

Query  1479  LWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTF  1300
             LWK QRK A+  + HQ F+ +L+RTS  KVEKGLIPVLE  A +RG V++L+DVFQRF F
Sbjct  121   LWKKQRKAAQGFMRHQLFYLFLLRTSRAKVEKGLIPVLEHVA-KRGLVLNLEDVFQRFAF  179

Query  1299  DTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKL  1120
             D+TC LVTGYDP CLSV+FP+V FSKA+DDAEE +F R + P+S  KLQ+WL +G E+K 
Sbjct  180   DSTCILVTGYDPECLSVEFPEVLFSKALDDAEEAIFYRQIRPQSFVKLQRWLNMGQERKY  239

Query  1119  SRACEILDQVIGKYITMKRQELILTYKNQNPDNDIN--DENGFDLLTSYINNNDGETTMG  946
              +A E+LD +I KYI  KR+EL     N+  +  ++  DE G DLLTSYI     E T  
Sbjct  240   RKAWEVLDDIIPKYICQKREEL-----NKLKEGFVSEIDEEGVDLLTSYITE---EKTTD  291

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
             LK DDKFLRDTILN+M+AGRDTTSS LTWF WLVS HP+VE  I  E L ++   E+ KK
Sbjct  292   LKCDDKFLRDTILNMMLAGRDTTSSGLTWFFWLVSRHPKVENKIIAE-LESIIPAEETKK  350

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +RLF AEE+KNLVYLH ALCE+LRLYPPVPFQHK PL+ D LPSGH V P T+++FSLYA
Sbjct  351   WRLFNAEEVKNLVYLHGALCEALRLYPPVPFQHKEPLKPDSLPSGHPVYPKTKILFSLYA  410

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+D  EFKPERWI  +RG  KHEPSYKFL+FNAGPRTCLGKEVAF QMK VA
Sbjct  411   LGRMKSVWGEDCFEFKPERWIT-DRGGNKHEPSYKFLSFNAGPRTCLGKEVAFVQMKCVA  469

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             +AII+NY ++ ++     P VSIIL+ K+GL  RV RRW 
Sbjct  470   SAIIYNYRIQVLEETPVVPAVSIILHTKNGLMARVSRRWA  509



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/516 (58%), Positives = 374/516 (72%), Gaps = 14/516 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MAS+   EIF+A    VI     +    P+  P+FGMLP    H+ ++++     +   G
Sbjct  1     MASLTLLEIFMAIASYVILRCFFNKNGLPINWPIFGMLPETLYHLHRLYEWLTEKIERAG  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              TF  KGPWF+N+ ILITVDP NVHY+MS NF NFPKG EF KIFD+LGDGIFN+D   W
Sbjct  61    LTFFYKGPWFSNVKILITVDPTNVHYVMSSNFSNFPKGSEFSKIFDILGDGIFNADSHSW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K QRKL + LI    FH +L+      VEKGL+PV+E A+ ++  VVDLQD+FQRFTFD 
Sbjct  121   KTQRKLVQTLINRGCFHNFLIEACQEMVEKGLVPVIEHAS-DQDSVVDLQDLFQRFTFDI  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC LVTGY+P  LS +FP + FSKA+DDAEE LF RH++PE +WK Q+WLGIG EKK+++
Sbjct  180   TCELVTGYNPRSLSTEFPKIEFSKALDDAEEALFYRHIIPEFIWKFQRWLGIGQEKKMAK  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A ++LD    KYI+ KR++L+   KN       N   G D+LTSY+N  +GE  +  K D
Sbjct  240   AEKVLDDTSRKYISRKREQLV---KN-------NKGEGVDMLTSYMN--EGEKILESKPD  287

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             +KFLRDTI+NL++AGRDTTSSALTWF WL+S +P  E  IR E+      G+    +   
Sbjct  288   EKFLRDTIINLLLAGRDTTSSALTWFFWLISKNPRAESKIRQEIQEITLQGKKANTWCAL  347

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
               +E+ +LVYLHAALCE+LRLYPPVPFQHKSPLQ D+LPSGH+V+P+ +++   YAMGRM
Sbjct  348   NVQEVNSLVYLHAALCETLRLYPPVPFQHKSPLQKDVLPSGHEVNPEMKIVICSYAMGRM  407

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
               IWG+D  EFKPERWI  E G +KHEPSYKFLAFNAGPRTCLGKEVAFTQMK VAA+II
Sbjct  408   ASIWGEDCLEFKPERWIT-EGGKIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKIVAASII  466

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             HNYHV+ V++H  SPNVSIIL+MKHGLKV+V RRW 
Sbjct  467   HNYHVKVVEDHPVSPNVSIILHMKHGLKVKVTRRWV  502



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 385/524 (73%), Gaps = 17/524 (3%)
 Frame = -2

Query  1848  IITCAMASIDYFEIFVAFFCLVIWIILRDGYRR--PL-KVPLFGMLPSLFLHVRKIHDRC  1678
             + + A   + YFE+ +    +V +I LR   R   PL   P+ GMLPSL  ++  +HD  
Sbjct  1     MTSMAFMGMGYFEMLLLSLAVVCFIYLRRLSRNDSPLPDWPVLGMLPSLLRNIHHVHDWT  60

Query  1677  AAVLSLHGG-TFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDG  1501
               +L      TF  +GPW   +D++ T DPANVHYIMS +F NFPKG EFK IFDVLGDG
Sbjct  61    TKLLEQSRSYTFTFRGPWLAGMDMVWTCDPANVHYIMSTHFSNFPKGPEFKNIFDVLGDG  120

Query  1500  IFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQD  1321
             IFNSD DLWK QRK+A  LI  +RF R+L RTS   VE+GLIPVL+  + E+G +VDLQD
Sbjct  121   IFNSDSDLWKTQRKVAHGLISRRRFCRFLERTSRKNVEEGLIPVLDHIS-EQGMIVDLQD  179

Query  1320  VFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLG  1141
             VFQRFTFD+TCTL++G DPGCLSV+FPDV FSKA+DD EE +F RH++P+S WKLQ+WLG
Sbjct  180   VFQRFTFDSTCTLISGIDPGCLSVEFPDVAFSKALDDVEEAIFFRHIVPKSYWKLQRWLG  239

Query  1140  IGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDG  961
             IG EKK+SRA + LD+ I   I++KR+EL       N   + N+E G DLLTSY+ ++ G
Sbjct  240   IGEEKKMSRAWKTLDRYIAHCISLKREEL-------NNRTNKNEEEGIDLLTSYMEDDYG  292

Query  960   ETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG  781
                +     DK LRDT+LN MIAGRDTTS+AL+WF WLV+ +P VE  IR+EL + +   
Sbjct  293   SDWLK---SDKLLRDTMLNFMIAGRDTTSAALSWFFWLVAKNPSVETKIREELKSNL-PA  348

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
             E+ +K+R+F A EL  L YLH ALCE+LRL+PPVPF+HKSP+  D+LPSGH+V   T+++
Sbjct  349   EEAEKWRVFDAGELSGLAYLHGALCEALRLFPPVPFEHKSPVCPDVLPSGHRVDERTKIL  408

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
             FSLY MGRM+ +WGKD  EFKPERWI  ERG ++HEPSYKFLAFNAGPRTCLGKEVAFTQ
Sbjct  409   FSLYGMGRMEGLWGKDCLEFKPERWIT-ERGRIRHEPSYKFLAFNAGPRTCLGKEVAFTQ  467

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             MK VAAA IHNYHV  ++ H  SPN+SIIL+MKHGL VRV +RW
Sbjct  468   MKVVAAAFIHNYHVEVIEGHPVSPNLSIILHMKHGLMVRVTKRW  511



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/518 (58%), Positives = 377/518 (73%), Gaps = 13/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWII--LRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSL  1660
             MAS+  F IF AF C++  +I  LR     P+  PL GMLPSL +HV + HD    VL  
Sbjct  1     MASVVLFAIFFAFICVLCSLIFCLRKNNVLPMNWPLVGMLPSLLVHVHRFHDHVTDVLEQ  60

Query  1659  HGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLD  1480
                TF  KGPWF ++DIL+T DPAN+HYIMS NF NF KG +F K FD+LG GI N+D D
Sbjct  61    SKCTFQFKGPWFGDMDILVTADPANIHYIMSSNFSNFEKGSDFNKRFDILGHGILNADRD  120

Query  1479  LWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTF  1300
             LWKNQRK+A+AL+ H+ F++ LV+T  +KVE+GLIPVLE    ++  V+DLQDVFQRF F
Sbjct  121   LWKNQRKVAQALVNHRLFYQRLVKTIQDKVERGLIPVLEHVC-KQSLVLDLQDVFQRFAF  179

Query  1299  DTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKL  1120
             D T  +VT +DPGCLS+D P+V FSKA+D+A E +F RH+LPES WKLQ+WLGIG EKKL
Sbjct  180   DATSMIVTSFDPGCLSIDLPEVAFSKAIDNAMEAIFYRHVLPESTWKLQRWLGIGKEKKL  239

Query  1119  SRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLK  940
              +A E LD++I + I+ KR+EL    +    D +     G DLLTSY++ N     MG K
Sbjct  240   KKARETLDRIIAEIISKKREELSKGNRLMQEDGE-----GIDLLTSYMSEN---YNMGFK  291

Query  939   FDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFR  760
              DD+FLRDTI+N M+AGRDT SS L+WF WLVS +P     IR+EL T +   E  K+ R
Sbjct  292   SDDEFLRDTIVNFMLAGRDTVSSCLSWFFWLVSKNPAAGAKIREELKTTLPEKEAEKR-R  350

Query  759   LFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMG  580
             LF  EE+K LVYLH ALCESLRLYPPV  + KSPL+ DILPSGH+V+P T+++FSLYAMG
Sbjct  351   LFNIEEIKKLVYLHGALCESLRLYPPVHSEFKSPLRRDILPSGHQVNPKTKIVFSLYAMG  410

Query  579   RMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAA  400
             RM  +WG D  EFKPERWI  +RG +KHEPSYKF +FNAGPRTCLGK+VAFTQMKAV AA
Sbjct  411   RMSSVWGDDCFEFKPERWIT-DRGGMKHEPSYKFFSFNAGPRTCLGKDVAFTQMKAVVAA  469

Query  399   IIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             II+NY V+ V  H   P+ S+IL+MKHG+KV++ +RW 
Sbjct  470   IIYNYQVQVVDEHTVPPSQSVILHMKHGMKVKLTKRWA  507



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/517 (58%), Positives = 376/517 (73%), Gaps = 12/517 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWII-LRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MAS+  FEIF AF C +  I  LR     P   PL GMLP L   V + HD    VL   
Sbjct  1     MASVVLFEIFFAFICFLSLIFCLRKNNGLPKNWPLIGMLPGLLFQVHRFHDWVTDVLEQS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
               TF  KGPWF ++DIL+T DPAN+HYI S NF NF KG +F K FD+LGDGI N+D DL
Sbjct  61    KCTFQFKGPWFGDMDILVTADPANIHYITSSNFSNFEKGSDFNKRFDILGDGIINADRDL  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK+QRK+A+AL+ H+ F++ LV+T  +KVE+GLIPVLE    ++  V+DLQD+FQRFTFD
Sbjct  121   WKSQRKVAQALVNHRLFYQRLVKTIQDKVERGLIPVLEHVY-KQSLVLDLQDLFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
              TC +VTG+DPGCLS+D P+V FSKAMD+A E +F RH+LPES W+LQ+WLGIG EKKL 
Sbjct  180   ATCVIVTGFDPGCLSIDLPEVAFSKAMDNAMEAIFYRHVLPESTWRLQRWLGIGKEKKLK  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             +A E LD++I + I+MKR+EL    +    D +     G DLLTSY++ +     MG K 
Sbjct  240   KARETLDRIIAEIISMKREELSKGNRLMEEDGE-----GIDLLTSYMSED---YNMGFKS  291

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DD+FLRDTI+  M+AGRDT SS L+WF WLVS +P     IR+EL T +   E  K+ RL
Sbjct  292   DDEFLRDTIVTFMLAGRDTVSSCLSWFFWLVSKNPAAGAKIREELKTTLPEKEAEKR-RL  350

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F  EE+K LVYLH ALCESLRLYPP+  + KSP++ DILPSGH+V+P T+++FSLYAMGR
Sbjct  351   FDIEEIKKLVYLHGALCESLRLYPPIHSEFKSPVRQDILPSGHRVNPKTKIVFSLYAMGR  410

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M  +WG D  EFKPERWI  +RG +KHEPSYKF +FNAGPRTCLGK+VAFTQMKAV AAI
Sbjct  411   MSSVWGDDCFEFKPERWIT-DRGGMKHEPSYKFFSFNAGPRTCLGKDVAFTQMKAVVAAI  469

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             I+NY V+ V  H  +P+ S+IL+MKHG+KV++ +RW 
Sbjct  470   IYNYQVQVVDEHTVTPSQSVILHMKHGMKVKLTKRWA  506



>emb|CDP12890.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/444 (67%), Positives = 362/444 (82%), Gaps = 9/444 (2%)
 Frame = -2

Query  1617  LDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALII  1438
             +DI+ TVDP +V+++M  NF N+PKG E K+IFDVLGDGIF SD D WKNQRKLAR LI 
Sbjct  1     MDIVGTVDPDDVYHVMIANFANYPKGPEMKRIFDVLGDGIFTSDFDPWKNQRKLARLLIN  60

Query  1437  HQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGC  1258
             HQRF +++V+T+W+KVE+GLIPVLE  A E   +VD+QDVFQR TFDTT   +TGYDPGC
Sbjct  61    HQRFQKFMVKTNWDKVEQGLIPVLEHFA-ENSQIVDMQDVFQRLTFDTTSKFITGYDPGC  119

Query  1257  LSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKY  1078
             L+VDFP+V F+KAMD+ EE + +R+ LPE++ K   ++GIG  K  S+A   LDQ + KY
Sbjct  120   LAVDFPEVEFAKAMDEVEEAIVMRYFLPENVLKFLSFVGIGRMKTTSKAYATLDQAVAKY  179

Query  1077  ITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLM  898
             I+MK++EL     N++ + D N E GFDLLTSY+   +GE  MG+ FDDKF RDT LNLM
Sbjct  180   ISMKKEEL--KKGNKSYEGDDNGE-GFDLLTSYVK--EGER-MGMVFDDKFFRDTTLNLM  233

Query  897   IAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN-SGEDPKKFRLFKAEELKNLVYL  721
             IAGRDTTSS LTWF+WLVSTHPEVEK IR+EL  +++ SGE+ +KFR+FK +E+KNLVYL
Sbjct  234   IAGRDTTSSGLTWFLWLVSTHPEVEKKIREELKASISPSGEEDEKFRIFKFDEIKNLVYL  293

Query  720   HAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEF  541
             HAALCE+LRLYPPVPFQHK+PL+ DILPSG  V+P  ++MF LYAMGRM+ IWGKD KEF
Sbjct  294   HAALCETLRLYPPVPFQHKTPLKPDILPSGLHVTPKMKVMFPLYAMGRMESIWGKDCKEF  353

Query  540   KPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNH  361
             KPERWI+ ERG VKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY+++ V+ H
Sbjct  354   KPERWIS-ERGRVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYNIQLVEGH  412

Query  360   DASPNVSIILYMKHGLKVRVQRRW  289
                PNVS+ILY+K+GLKVRV +RW
Sbjct  413   PVIPNVSVILYIKNGLKVRVTKRW  436



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/519 (58%), Positives = 376/519 (72%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MASI   EIF+A    V+   L +    P+  P+ GMLP    +  +IH+R A VL  +G
Sbjct  1     MASISLLEIFLAVISFVVLRYLLNTKGMPINWPVVGMLPDTIFNFHRIHERFAEVLEQNG  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              TFL  GPWF+N+ IL TVDPAN+HY+MS NF NFPKG EF KIF++LGDGIFNSD D W
Sbjct  61    LTFLYAGPWFSNVKILGTVDPANIHYVMSSNFANFPKGSEFSKIFNILGDGIFNSDSDSW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             KNQRK A+ALI HQRFH++LV+T  N VEKGL+PVLE  A +   V+DLQD+FQRFTFD 
Sbjct  121   KNQRKTAQALINHQRFHQFLVKTCRNMVEKGLLPVLEHVADQE-SVMDLQDIFQRFTFDI  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             TC LVTGY+P CLS+ FP+V FSKA+DDAEE LF RH  PE  WKLQ+WLG G E K+ +
Sbjct  180   TCILVTGYNPKCLSIAFPEVEFSKAIDDAEEALFYRHFCPEYTWKLQRWLGFGQEWKMEK  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDI--NDENGFDLLTSYINNNDGETTMGLK  940
             A ++LD V  ++++ KR++L         +  I   D  G DLLTSY+++     + G +
Sbjct  240   AWKVLDDVSARFVSRKREQL--------KEGSILREDGEGVDLLTSYMSSE--VESNGPQ  289

Query  939   FDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFR  760
              +DKFLRDTI+N ++AGRDTTSSALTW  WLV  +P+V   IR+E+   +   +D +K R
Sbjct  290   PEDKFLRDTIINFLLAGRDTTSSALTWLFWLVCKNPQVLSKIREEIKAKIPENQD-EKCR  348

Query  759   LFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMG  580
             +F  +EL +LVYLH A CESLRLYPPVPFQHK+PL+ D+LPSGHKVSPD +++F LY+MG
Sbjct  349   MFNPQELNSLVYLHGAFCESLRLYPPVPFQHKAPLREDVLPSGHKVSPDMKIIFCLYSMG  408

Query  579   RMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAA  400
             RM  IWG+D  EFKPERWI    G +KHEPSYKFLAFNAGPRTCLGKE+AF QMK VAA 
Sbjct  409   RMASIWGEDCLEFKPERWIT--GGKIKHEPSYKFLAFNAGPRTCLGKEIAFIQMKTVAAF  466

Query  399   IIHNYHVRAVKNHDASPNV-SIILYMKHGLKVRVQRRWT  286
             +++NY+V  V+    SP   SIIL+MK+GLKV V RRW 
Sbjct  467   VLNNYNVHLVEGQHVSPATNSIILHMKYGLKVSVSRRWV  505



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/518 (57%), Positives = 387/518 (75%), Gaps = 17/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C  +  +L    DG   P   PL GMLP+L+L++  +HD    +L 
Sbjct  1     MALIGFLEIFLAVICFAVLCLLGKSDDGL--PNNWPLVGMLPALWLNLSHVHDWATGILE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                  FL +  WF+ +D+L+T DPANVHYIMS NFENFPKG EFK++FDVLGDGIFNSD 
Sbjct  59    RSCCNFLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             D+W+ QR++A+  +  QRFHR+L +T+ +KVE GL+ VL+    +RG  VDLQD+FQRFT
Sbjct  119   DMWRMQRRVAQVFMNDQRFHRFLAKTTRDKVENGLLRVLD-ELSQRGVAVDLQDLFQRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD+ C  VTG+DPG LSV+FP+VPFS+A+DDAEEV+F RHL P     LQ+WLG+G E+K
Sbjct  178   FDSACRFVTGFDPGSLSVEFPEVPFSRALDDAEEVIFYRHLYPAWFGTLQRWLGLGVEEK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA E++DQ++G+YI MK+ EL      +       DENG DLLTSY+  N  ET   L
Sbjct  238   LRRAWEVMDQIVGRYIEMKKAEL-----REGTSKVKGDENGADLLTSYMVEN--ETLGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRDTILNLMIAG+DTTS ALTWF W +ST+P VE  IR+E+ +A+   E+ +  
Sbjct  291   ECNDKFLRDTILNLMIAGKDTTSLALTWFFWALSTNPSVEMKIREEIKSAIL--EEEQNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             ++FK  E + N+VYLH ALCESLRLYPP+PF+HK P++ D+LPSGHKV+P T+++  LYA
Sbjct  349   KVFKIGEHVHNMVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPSTKILILLYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ +WG+D  EF+PERWI+ ERG ++HEPSYKFLAFNAGPRTCLGKEVAFTQMK +A
Sbjct  409   MGRMKSVWGEDCFEFRPERWIS-ERGGIRHEPSYKFLAFNAGPRTCLGKEVAFTQMKMIA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA+I+NY V  V++H   P+ SIIL++KHGL+V+  RR
Sbjct  468   AAMIYNYEVHLVESHPVRPSNSIILHIKHGLRVKFARR  505



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/518 (57%), Positives = 385/518 (74%), Gaps = 17/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C  +  +L    DG   P   PL GMLP+L+L++  +HD    +L 
Sbjct  1     MALIGFLEIFLAVICFAVLCLLGKSDDGL--PNNWPLVGMLPALWLNLSHVHDWATGILE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                  FL +  WF+ +D+L+T DPANVHYIMS NFENFPKG EFK++FDVLGDGIFNSD 
Sbjct  59    RSCCNFLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             D+W+ QR++A+  +  QRFHR+L +T+ +KVE GL+ VL+    +RG  VDLQD+FQRFT
Sbjct  119   DMWRMQRRVAQVFMNDQRFHRFLAKTTRDKVENGLLRVLD-ELSQRGVAVDLQDLFQRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD+ C  VTG+DPG LSV+FP+VPFS+A+DDAEEV+F RHL P     LQ+WLG+G E+K
Sbjct  178   FDSACRFVTGFDPGSLSVEFPEVPFSRALDDAEEVIFYRHLYPAWFGTLQRWLGLGVEEK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA E++DQ++G+YI MK+ EL      +       DENG DLLTSY+  N  ET   L
Sbjct  238   LRRAWEVMDQIVGRYIEMKKAEL-----REGTSKVKGDENGADLLTSYMVEN--ETLGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRDTILNLMIAG+DTTS  LTWF W +ST+P VE  IR+E+ + +   E+ +  
Sbjct  291   ECNDKFLRDTILNLMIAGKDTTSLELTWFFWALSTNPSVEMKIREEIKSVIL--EEEQNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             ++FK  E + N+VYLH ALCESLRLYPP+PF+HK P++ D+LPSGHKV+P T+++  LYA
Sbjct  349   KVFKIGEHVHNMVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPSTKILILLYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ +WG+D  EF+PERWI+ ERG ++HEPSYKFLAFNAGPRTCLGKEVAFTQMK +A
Sbjct  409   MGRMKSVWGEDCFEFRPERWIS-ERGGIRHEPSYKFLAFNAGPRTCLGKEVAFTQMKMIA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA+I+NY V  V++H   P+ SIIL++KHGL+V+  RR
Sbjct  468   AAMIYNYEVHLVESHPVRPSNSIILHIKHGLRVKFARR  505



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/519 (58%), Positives = 385/519 (74%), Gaps = 13/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCL-VIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             M +I Y EIF+A  C  +I  + R G   P   P  GMLPS+ +H+ + H RC  +L  +
Sbjct  2     MVNIQYPEIFLAVVCFFLICYLTRHGI--PWNWPFLGMLPSILIHLHRTHHRCVDILQGN  59

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
               +FL KGPWF N+D L+TVDPAN+ +IMS NF N+PKG+EF KIFD+LG+GIFNSD +L
Sbjct  60    NCSFLFKGPWFANMDFLMTVDPANIQHIMSSNFTNYPKGEEFLKIFDILGNGIFNSDGEL  119

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK+ RALI H+ F R+LV+ ++NKV+KGL+P+L+ A  + G V+DLQDVFQR TFD
Sbjct  120   WKLQRKITRALINHRSFIRFLVKITYNKVQKGLVPILQHAYKD-GLVIDLQDVFQRLTFD  178

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC LV+G+DPGCLS++FP VPFS+A+DDAEE +  RHLLP + W+L +WLG+G  KKLS
Sbjct  179   TTCLLVSGHDPGCLSLEFPHVPFSQALDDAEEAIAFRHLLPHNFWELLKWLGLGQPKKLS  238

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQ-NPDNDINDENGFDLLTSYINNNDGETTMGLK  940
             +A ++LD  I   I+MKR+ L    K+    + +  +E G DLLTS++N    + T G+ 
Sbjct  239   QAWKVLDHFIDYIISMKREGLRGGKKSPFKLEQEEEEEEGIDLLTSFLNEETRDVTNGIN  298

Query  939   F-DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRDTILNLM+AGRDTTSSALTWF WL++ HP VE+ IR+EL    N      ++
Sbjct  299   TKDDKFLRDTILNLMLAGRDTTSSALTWFTWLITQHPIVEEKIRNELKGIAN------EW  352

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
              +F+ EE   L YLHAALCE LRLYPPVPFQHKSP+Q + LPSGH V+P T+++FSLYAM
Sbjct  353   HVFQIEETNKLTYLHAALCECLRLYPPVPFQHKSPIQPETLPSGHHVNPKTKVLFSLYAM  412

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ IWG+D  EFKPERWI  E G +K+EP YKFL+FNAGPRTCLGKEVAFTQ+K V+A
Sbjct  413   GRMKGIWGEDCFEFKPERWITKE-GKIKYEPPYKFLSFNAGPRTCLGKEVAFTQLKMVSA  471

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              +IHNY    V    A P++SI+L+MKHGLKV+V  RW+
Sbjct  472   TLIHNYKFHVVHGQHAEPDMSIVLHMKHGLKVKVSNRWS  510



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/519 (59%), Positives = 379/519 (73%), Gaps = 15/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFC-LVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA I   +IF+A  C L++     +    P   P+ G LP L L+V +IHD    VL   
Sbjct  1     MALIGLLDIFLAIICFLILRYCFSNNNGIPKNFPVVGTLPHLLLNVHRIHDYSTEVLEKT  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
               TFL KGPWF N+DIL TVDPANVH+IMS NF NFPKG EFK+IFD+LGDGIFNSD DL
Sbjct  61    QCTFLFKGPWFANMDILATVDPANVHHIMSSNFSNFPKGPEFKRIFDILGDGIFNSDSDL  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WKNQR+ A+AL+    F+++LV+++  K+EKGLIP+L+  + ++G  VDLQD+FQRFTFD
Sbjct  121   WKNQRRFAQALMNRHSFYKFLVKSNQAKLEKGLIPILDHMS-KQGTTVDLQDLFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             +T   VTGYDPGCLS++FP+V    A++DAEE +F RH++PESLWKLQ+WLGIG EKKL 
Sbjct  180   STSLFVTGYDPGCLSIEFPEVRLLMALEDAEESIFYRHVVPESLWKLQRWLGIGEEKKLK  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG--L  943
             +A E LD VI + I  KR+E+       N +    + +G DLL SY++ N  +T MG   
Sbjct  240   KAKETLDSVIFELIQRKRREI-------NEEILSKEIDGVDLLASYMHEN--KTIMGELQ  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + DD FLRDT+LN MIAGRDTTSSALTWF WL+S +P+ E  IR+E L+++   E   K+
Sbjct  291   RADDNFLRDTVLNFMIAGRDTTSSALTWFFWLISKNPKAETKIREE-LSSIVPAEKLGKW  349

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
               F  ++L  LVYLH ALCE+LRLYPPVPFQHK PL  D LPSGH+  P T+++FSLYAM
Sbjct  350   WDFDTQKLNQLVYLHGALCEALRLYPPVPFQHKVPLVPDTLPSGHRAVPRTKILFSLYAM  409

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ IWG+D  EF+PERWI+ E G +K EPSYKF +FNAGPRTCLGKEVAFTQMKAVAA
Sbjct  410   GRMKSIWGEDCLEFRPERWIS-ESGGIKWEPSYKFFSFNAGPRTCLGKEVAFTQMKAVAA  468

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              +IHNY ++ V+     PNVSIILYMKHGLKVRV  RW 
Sbjct  469   GVIHNYDIQVVEGQRPGPNVSIILYMKHGLKVRVHDRWA  507



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/523 (54%), Positives = 372/523 (71%), Gaps = 20/523 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFC-LVIWIILRDGYR------RPLKVPLFGMLPSLFLHVRKIHDRCA  1675
             MASID+  I  AF    +++IIL   +R       P   P+ GM P++  H+ + HDR  
Sbjct  1     MASIDFSSILFAFIIPFLVFIILSRIWRWDFHGIIPWNWPIVGMTPTVIAHIHRPHDRVT  60

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              VL     TF  KG WF+ +D L TVDP+N+H+I+S NFE +PKG +FK IF+VLGDGIF
Sbjct  61    EVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDGIF  120

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             NSD D+WKNQRK A  L+ H  F ++L + + NKV+ GL+P+L+ +  E G V+DLQD+F
Sbjct  121   NSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKVKTGLVPILD-SVCENGSVLDLQDLF  179

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRF+FD+TC +VTG+D   LS++FP+VPFSKAMDDAEEV+F+RH  P+++W+ Q+ L IG
Sbjct  180   QRFSFDSTCMMVTGFDLNSLSLEFPEVPFSKAMDDAEEVIFVRHFFPKTIWEFQKKLQIG  239

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
               K+L RA EI+D+ I K I  KR+ L    KN+  + D N + G DL+TSYI N     
Sbjct  240   QPKRLKRAWEIIDETIAKLIASKRKSL----KNEMKEEDDNGKEGVDLITSYITN-----  290

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                ++ DD+FLRDT+LN MIAGRDT SSAL+WF + +S HP V + IR+EL T + + E 
Sbjct  291   ---IENDDEFLRDTVLNFMIAGRDTLSSALSWFFFXLSNHPTVVEKIREELRTTIPTNEA  347

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
               + R+F  EE+ NLVY H  LCE+LRLYPPVP QHK  +Q DILPSGH + P T+++FS
Sbjct  348   YDQRRIFSIEEVDNLVYFHGTLCEALRLYPPVPLQHKVSIQHDILPSGHHIKPKTKILFS  407

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LYA+GRM  +WGKD  EFKPERWIN E G +KH PSYKFLAFNAGPRTCLGK VAFT++K
Sbjct  408   LYALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFTELK  467

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              VAAAIIHNY++     H+  P+ SIIL+MKHG KV+V +RW+
Sbjct  468   IVAAAIIHNYNIIQQAGHEVVPSASIILHMKHGFKVKVTKRWS  510



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/523 (54%), Positives = 372/523 (71%), Gaps = 20/523 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFC-LVIWIILRDGYR------RPLKVPLFGMLPSLFLHVRKIHDRCA  1675
             MASID+  I  AF    +++IIL   +R       P   P+ GM P++  H+ + HDR  
Sbjct  1     MASIDFSSILFAFIIPFLVFIILSRIWRWDFHGIIPWNWPIVGMTPTVIAHIHRPHDRVT  60

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              VL     TF  KG WF+ +D L TVDP+N+H+I+S NFE +PKG +FK IF+VLGDGIF
Sbjct  61    EVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDGIF  120

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             NSD D+WKNQRK A  L+ H  F ++L + + NKV+ GL+P+L+ +  E G V+DLQD+F
Sbjct  121   NSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKVKTGLVPILD-SVCENGSVLDLQDLF  179

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRF+FD+TC +VTG+D   LS++FP+VPFSKAMDDAEEV+F+RH  P+++W+ Q+ L IG
Sbjct  180   QRFSFDSTCMMVTGFDLNSLSLEFPEVPFSKAMDDAEEVIFVRHFFPKTIWEFQKKLQIG  239

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
               K+L +A EI+D+ I K I  KR+ L    KN+  + D N + G DL+TSYI N     
Sbjct  240   QPKRLKQAWEIIDETIAKLIASKRKSL----KNEMKEEDDNGKEGVDLITSYITN-----  290

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                ++ DD+FLRDT+LN MIAGRDT SSAL+WF + +S HP V + IR+EL T + + E 
Sbjct  291   ---IENDDEFLRDTVLNFMIAGRDTLSSALSWFFFCLSNHPTVVEKIREELRTTIPTNEA  347

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
               + R+F  EE+ NLVY H  LCE+LRLYPPVP QHK  +Q DILPSGH + P T+++FS
Sbjct  348   YDQRRIFSIEEVDNLVYFHGTLCEALRLYPPVPLQHKVSIQHDILPSGHHIKPKTKILFS  407

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LYA+GRM  +WGKD  EFKPERWIN E G +KH PSYKFLAFNAGPRTCLGK VAFT++K
Sbjct  408   LYALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFTELK  467

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              VAAAIIHNY++     H+  P+ SIIL+MKHG KV+V +RW+
Sbjct  468   IVAAAIIHNYNIIQQAGHEVVPSASIILHMKHGFKVKVTKRWS  510



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/518 (56%), Positives = 375/518 (72%), Gaps = 17/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA + + EIF+A  C     +L    DG   P   PL GMLP+LFL++  +HD   + L 
Sbjct  1     MALVGFLEIFLATICFAFLRLLGKSHDGL--PQNWPLVGMLPALFLNLGSVHDWVTSFLE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                G FL +  WF+ +D+L+T DPANVHYIMS NFENFPKG EFK++FDVLGDGI NSD 
Sbjct  59    RSRGNFLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             D+W+ QR++A+  +  QRF ++L +T+ +KVE GL+ VL+    +RG  VDLQD+FQRFT
Sbjct  119   DVWRMQRRVAQVFMNDQRFCQFLAKTTRDKVENGLLRVLD-ELSQRGVAVDLQDLFQRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD  C  VTG+DPG LSV+FP+VPFSKA+DDAEEV+F RH+ PE    LQ+WLG+G E+K
Sbjct  178   FDAACRFVTGFDPGSLSVEFPEVPFSKALDDAEEVIFYRHMYPEWFGALQRWLGLGVEEK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L  A E++DQV+G YI MKR EL      +       DENG DLLT Y+   + E    L
Sbjct  238   LRSAWEVMDQVVGSYIEMKRVEL-----REGTSKAERDENGADLLTLYM--VEKEILGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRDTILNLMIAG+DTTS  LTWF W +ST+  VE  IR+E+ + +   E+ +  
Sbjct  291   ECNDKFLRDTILNLMIAGKDTTSLVLTWFFWALSTNRSVEMKIREEIKSVIP--EEEQNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             ++FK  E + NLVYLH ALCESLRLYPP+PF+HK P++ D+LPSGHKV+P  +++  LYA
Sbjct  349   KVFKIGEHVHNLVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPGKKILIHLYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ +WG+D  EF+PERWI+ + G V+HEPSYKFLAFNAGPRTCLGK+VAFTQMK +A
Sbjct  409   MGRMKSVWGEDCFEFRPERWIS-KSGGVRHEPSYKFLAFNAGPRTCLGKQVAFTQMKMIA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V+ H   P+ SIIL+MKHGL+V++ RR
Sbjct  468   AVVIHNYEVHVVEGHLVRPSNSIILHMKHGLRVKLARR  505



>gb|EPS67771.1| hypothetical protein M569_06997, partial [Genlisea aurea]
Length=490

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/512 (56%), Positives = 364/512 (71%), Gaps = 27/512 (5%)
 Frame = -2

Query  1815  FEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS-LHGGTFLL  1639
             F + V+   ++   + R+  R     P+ GM+P L ++  ++H+ C  VL+     TF  
Sbjct  1     FSVLVSISWVIGLWMWRNRRRMTWNWPIVGMMPKLAMNAGRVHEICTEVLAGSRRETFWF  60

Query  1638  KGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRK  1459
             KGPWF+ ++IL T + ANVHY+MS NF NFPKG +FK++FDV GDGIFNSD D W+ QRK
Sbjct  61    KGPWFSGMEILGTSNAANVHYVMSANFGNFPKGAKFKEMFDVFGDGIFNSDSDSWQRQRK  120

Query  1458  LARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLV  1279
              ARALI H+ F  ++   +  K+E GLIPV+E A   +   +DLQ++FQR TFDTTC ++
Sbjct  121   TARALINHRGFQGFVSEITRRKIETGLIPVMEMAC-RKTTPIDLQEIFQRLTFDTTCAVI  179

Query  1278  TGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEIL  1099
             TGYDP CLS + P+VPFS AMD AE+ +F+RH+LPE++WKLQ+W+GIG EK+L +A +IL
Sbjct  180   TGYDPLCLSPELPEVPFSAAMDAAEDSIFMRHILPETIWKLQRWIGIGSEKRLKQAKQIL  239

Query  1098  DQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYI---NNNDGETTMGLKFDDK  928
             D VI +YIT KR+EL+             +  G DLLTSYI    NND         DDK
Sbjct  240   DTVIAEYITRKREELL-----------TGNSGGSDLLTSYILDSENNDP--------DDK  280

Query  927   FLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKA  748
             FLRDTILNLMIAGRDTTSSALTW +WLVSTH  V+  IR EL +A+     P    +F  
Sbjct  281   FLRDTILNLMIAGRDTTSSALTWLLWLVSTHSHVQNRIRAELKSALPEKTSPPW--IFTE  338

Query  747   EELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQF  568
             EE +N VYLHAA+CESLRLYPPVPFQHK P + D LPSGH+VS  T+++  LYAMGRM+ 
Sbjct  339   EETRNTVYLHAAVCESLRLYPPVPFQHKEPAEDDTLPSGHRVSRRTKVVLFLYAMGRMES  398

Query  567   IWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  388
             IWGKD  EFKPERWI+ ERG ++H+PSYKFLAFNAGPRTCLG+E A +Q+K VAAAII N
Sbjct  399   IWGKDCGEFKPERWIS-ERGTIRHQPSYKFLAFNAGPRTCLGREAALSQIKMVAAAIIQN  457

Query  387   YHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             Y V   + H A+PN S+ILYMK+GLKV ++RR
Sbjct  458   YEVGLAEGHVAAPNCSVILYMKNGLKVWIRRR  489



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/488 (56%), Positives = 355/488 (73%), Gaps = 13/488 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GM P++  H  + HDR   VL     TF  KG WF+  D L TVDP+N+H+I+
Sbjct  36    PWNWPIVGMTPTVIAHFHRPHDRVTEVLQQTAFTFFFKGIWFSGTDFLFTVDPSNIHHIL  95

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NFE +PKG +FK IF+VLGDGIFNSD D+WK+QRK A  L+ H+ F ++L + + NKV
Sbjct  96    SANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKSQRKTAHHLVRHESFLQFLEKITLNKV  155

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             + GL+PVL+ +  E G V+DLQD+FQRF+FD+TC +VTG+D   LS++ P+VPFSKAMDD
Sbjct  156   KTGLVPVLD-SVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLHSLSLESPEVPFSKAMDD  214

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             AEEV+F+RH  P+++W+ Q+ L IG  K+L +A EI+D+ I K I  KR+ L    KNQ 
Sbjct  215   AEEVIFLRHFFPKTIWEFQKKLQIGQPKRLKQAWEIIDETIAKLIASKRKSL----KNQM  270

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              +   +D+ G DL+TSYI N        +++DD+FLRDT+LN MIAGRDT SSAL+WF +
Sbjct  271   KEEGGDDKEGVDLITSYITN--------IEYDDEFLRDTVLNFMIAGRDTLSSALSWFFF  322

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
              VS +P V + IR+EL T++ + E   + R+F  EE+ NLVYLH  LCE+LRLYPPVP Q
Sbjct  323   CVSNNPTVVEKIREELRTSIPTNEAYDQRRIFSLEEVDNLVYLHGTLCEALRLYPPVPLQ  382

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK   Q DILPSGH + P T+++FSLYA+GRM  +WGKD  EFKPERWIN E G +KH P
Sbjct  383   HKVSTQHDILPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKHVP  442

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             SYKFLAFNAGPRTCLGK VAFT++K VAAAIIHNY++     H+  P+ SIIL+MKHG K
Sbjct  443   SYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIHNYNIIQQTGHEVVPSASIILHMKHGFK  502

Query  309   VRVQRRWT  286
             V+V +RW+
Sbjct  503   VKVTKRWS  510



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/519 (54%), Positives = 369/519 (71%), Gaps = 14/519 (3%)
 Frame = -2

Query  1839  CAMASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAV  1669
             C MA + + E  +AF C +I+  ++ +   R  L   P+ GMLPSL + + +++D    V
Sbjct  54    CLMAFLGFLEASIAFICFLIFGFLLFKKSNRDVLTNWPILGMLPSLVVQIPRVYDWSVDV  113

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TFL KGPW   +D+L+TVDPAN+H+IMS NF+N+PKG EFKKIFDVLGDGIFN 
Sbjct  114   LEASNLTFLFKGPWLAGMDLLVTVDPANIHHIMSSNFKNYPKGHEFKKIFDVLGDGIFNV  173

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLWK+ RK A+ +  HQ F  + VRTS +K+EKGL+P+L+  +G    VVDLQDVFQR
Sbjct  174   DSDLWKDLRKSAQTMFNHQDFQTFTVRTSISKLEKGLLPLLDHVSGH-DIVVDLQDVFQR  232

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L+TGYDPGCLS++ P++ F+KA+DDAEE +F RH+ PE +WKLQ ++G+G E
Sbjct  233   FTFDTTFILMTGYDPGCLSLEMPEIEFAKALDDAEEAIFFRHIKPEFVWKLQNYVGLGVE  292

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             KK+ RA    D++  KYI+ KR+E+ L   ++         +  DLLTSY++ +  +  +
Sbjct  293   KKMRRAQATFDRLCAKYISTKREEISLGIHSKG--------DAKDLLTSYMSVDTTKYEL  344

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DDKFLRDTIL  MIAGRDTT SALTWF WL+  +PE    IR E+ T +   E+  
Sbjct  345   LNPGDDKFLRDTILTFMIAGRDTTGSALTWFFWLLCNNPEAVTKIRQEIRTKLPRTENRN  404

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
             +  L  + +L  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGH+V   ++++FSLY
Sbjct  405   ENSL-DSTDLNKLVYLHGALCEALRLYPPVPFQHKSPARPDVLPSGHRVDAGSKILFSLY  463

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             A+GRM+ +WG+DA EF+PERWI+ ERG ++HEPS+KFL+FNAGPRTCLGKEVAF QMK V
Sbjct  464   ALGRMRSVWGEDASEFRPERWIS-ERGGLRHEPSFKFLSFNAGPRTCLGKEVAFMQMKTV  522

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY ++ V+ H   P  SIIL+M+HG  V V +R
Sbjct  523   AVKIIQNYDIKIVEGHRVDPVPSIILHMRHGFNVTVTKR  561



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/516 (55%), Positives = 359/516 (70%), Gaps = 13/516 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCL-VIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA I + EIF+A  CL V+ ++ +     P K PL GMLP+L L++   HD    V+   
Sbjct  1     MALIGFLEIFLAGICLGVLRLLSKSDDGLPRKWPLVGMLPTLLLNLSHFHDWATGVVERS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
              G F  + PWF+ +D+L+T DPANVHYIMS NF NFPKG EFK++FD+LGDGIFNSD +L
Sbjct  61    HGNFFFRLPWFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNL  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W  QR++A+  +  QRFHR+L  T+ +K E GL+ VL+    +RG  VDLQD+F RFTFD
Sbjct  121   WSTQRRVAQVFMKDQRFHRFLSSTTRDKAENGLLMVLD-ELSQRGVTVDLQDLFHRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             + C  VTG+DPG LSV+FP+VP SKAM DAEEV+F RHL PE    LQ+ LGIG E+KL 
Sbjct  180   SACRFVTGFDPGSLSVEFPEVPISKAMGDAEEVIFYRHLYPEWFGTLQRLLGIGVEEKLR  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             RA E  DQ++G YI MKR EL      +       DENG DLLT Y+  N  ET   L+ 
Sbjct  240   RAWEATDQILGNYIAMKRVEL-----RERTSKVKGDENGADLLTLYMVEN--ETLGALEC  292

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             +DKFLRDTILN M AG +TT S LTWF W +S +P VE  IR+E+ + +   E  +  R+
Sbjct  293   NDKFLRDTILNFMTAGIETTGSTLTWFFWALSMNPSVEMRIREEIRSVIPKEE--QNLRV  350

Query  756   FK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMG  580
             F  +E +  +VYLH A+CESLRLYPPVPF HK P   D+LPSGHKV P  +++   YAMG
Sbjct  351   FNISEHMHKMVYLHGAICESLRLYPPVPFLHKCPANPDVLPSGHKVDPSAKIVVHTYAMG  410

Query  579   RMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAA  400
             RM+ IWG+D  EF+PERWI+ ERG ++H+PSYKF+AF  GPRTCLGK+VAFTQ+K V A 
Sbjct  411   RMKSIWGEDCLEFRPERWIS-ERGGIRHQPSYKFIAFGDGPRTCLGKDVAFTQIKMVTAT  469

Query  399   IIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +IHNY V  V++H   P+ S+IL MKHGLKV++ RR
Sbjct  470   VIHNYEVHVVEHHPVRPSNSVILNMKHGLKVKLARR  505



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/518 (54%), Positives = 370/518 (71%), Gaps = 22/518 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA + + EIF+A  C     +L    DG   P   PL GMLP+LFL++ ++HD     L 
Sbjct  1     MALVGFLEIFLAAICFAFLRLLGKSHDGL--PKNWPLVGMLPALFLNLGRVHDWVTGFLE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                G FL +  WF+ +D+L+T DPANVHYIMS NFENFPKG EFK++FDVLGDGI NSD 
Sbjct  59    RSHGNFLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             D+W+ QR++A+  +  +RF R+L +T+ +KVE GL+ VL+    ++G  VDLQD+FQRFT
Sbjct  119   DMWRMQRRVAQVFMNDRRFCRFLAKTTRDKVENGLLRVLD-ELSQKGVAVDLQDLFQRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD  C  VTG     LSV+FP+VPFSKA+DDAEEV+F RH+ PE    L++WLG+G E+K
Sbjct  178   FDAACRFVTG-----LSVEFPEVPFSKALDDAEEVIFYRHMYPEWFGTLRRWLGLGVEEK  232

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L  A +++DQV+G YI MKR EL      +       DENG DL T Y+   + ETT  L
Sbjct  233   LRSAWKVMDQVVGSYIEMKRVEL-----REGTSKAERDENGADLFTLYM--VEKETTGAL  285

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + ++KFLRD ILNLMIAG+DTTS  LTWF W +ST+  VE  IR+E+ + +   E+ +  
Sbjct  286   ECNEKFLRDAILNLMIAGKDTTSLVLTWFFWALSTNRSVEMKIREEIRSVIP--EEEQNL  343

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             ++FK  E++ NLVYLH ALCESLRLYPP+PF+HK P++ D+LPSGHKV P  +++  LYA
Sbjct  344   KVFKIGEQVHNLVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVDPGKKILIHLYA  403

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ +WG+   EF+PERWI+ + G V+HEPSYKFLAFNAGPRTCLGK+VAFTQMK +A
Sbjct  404   MGRMKSVWGEYCFEFRPERWIS-KSGGVRHEPSYKFLAFNAGPRTCLGKQVAFTQMKMIA  462

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V+ H   P+ SIIL+MKHGL+V++ RR
Sbjct  463   AVVIHNYEVHVVEGHPVRPSNSIILHMKHGLRVKLARR  500



>gb|AJD25224.1| cytochrome P450 CYP96A84 [Salvia miltiorrhiza]
Length=485

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/510 (56%), Positives = 362/510 (71%), Gaps = 36/510 (7%)
 Frame = -2

Query  1818  YFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVL-SLHGGTFL  1642
             Y EIF+    L +W I    +R  L  PL GMLPSL L+V +IH+ C  VL +   GTF 
Sbjct  7     YLEIFLIIVSLCLWRI----HRSILNWPLVGMLPSLLLNVGRIHEICTQVLQNCRRGTFH  62

Query  1641  LKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQR  1462
              +GPWF N+DIL+T  PANVHYIM+ NF NFPKG  F+++FDVLGDGIF +D D W++QR
Sbjct  63    FRGPWFANMDILLTAHPANVHYIMTSNFHNFPKGARFREMFDVLGDGIFTADSDSWRDQR  122

Query  1461  KLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTL  1282
             + A ALI    F R+L R +  K E  L+P+L+ AA     V+DLQD+FQRFTFDT+C L
Sbjct  123   RAAMALIAGPTFLRFLARVTHQKAEAALLPLLDAAAAVDNRVIDLQDLFQRFTFDTSCVL  182

Query  1281  VTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEI  1102
             +TGYDPGCLS D P VPF++AMD AEE +F+RH+LPE +WKLQ+W+G+G E+KL RA +I
Sbjct  183   ITGYDPGCLSPDLPHVPFAEAMDAAEESIFMRHVLPERVWKLQRWIGVGSERKLMRARKI  242

Query  1101  LDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFL  922
             LD VIG  I  KR                N+E G DLL+SY+N N          D +FL
Sbjct  243   LDGVIGNLIASKR----------------NNE-GDDLLSSYMNMNQ---------DSRFL  276

Query  921   RDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEE  742
             RDT+LNLMIAGRDTTSSALTW +WLVSTHPEVE+ +RDE+ +A          R+F  +E
Sbjct  277   RDTVLNLMIAGRDTTSSALTWLMWLVSTHPEVEERMRDEVRSAGGG-----GRRVFGVDE  331

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
             +K +VY+H A+ E+LRLYPPVPFQHK  L++DILPSGH V PD ++MFSLYAMGRM+ IW
Sbjct  332   VKKMVYIHGAVLEALRLYPPVPFQHKEALESDILPSGHTVGPDVKVMFSLYAMGRMESIW  391

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             G+D  EF+PERWI+    +++H P+YKFLAFNAGPR+CLGKEVA  Q+KAVAA +I+NY 
Sbjct  392   GEDCLEFRPERWISGAGASIRHTPAYKFLAFNAGPRSCLGKEVALAQIKAVAATLIYNYR  451

Query  381   VRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              R  + H    N S+ILYM+HGLKV+V  R
Sbjct  452   FRVAEGHRVEHNCSVILYMRHGLKVKVASR  481



>gb|KGN48435.1| hypothetical protein Csa_6G487560 [Cucumis sativus]
Length=507

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/519 (52%), Positives = 368/519 (71%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEI---FVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MAS+ + EI   F+ F  +++++ ++  Y   P  +P FGM  ++  ++ +I D    +L
Sbjct  1     MASMSFLEILLTFIPFLSVLLFLSVKWKYNEIPWNLPFFGMTLTILRNLHRIQDHFTHIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              L   TF  KG WF +LD   T DP+N+H+I+S NFE +PKG +FK IF++LGDGIFNSD
Sbjct  61    RLSSFTFFFKGAWFADLDFYFTSDPSNIHHILSTNFERYPKGPDFKYIFEILGDGIFNSD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              D+WK+ RK A +L+   ++ +++ + +  KV+ GL+PVL+ +  E G V+DLQD+FQRF
Sbjct  121   SDVWKSLRKTAHSLVHDHKYVQFVEKITLKKVKAGLVPVLD-SVCENGSVLDLQDLFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             +FD+TC  VTG+D   LS++FP+VPFSKAMD+AEEV+F+RH +P+ +WK Q  L IGP  
Sbjct  180   SFDSTCMFVTGFDLQSLSLEFPEVPFSKAMDEAEEVIFLRHFIPKKIWKFQNKLQIGPPT  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             +L +A E +D+ IGK I  KR+ L    +NQ  +       G DL+TSYI N+  +    
Sbjct  240   RLKQAWETIDETIGKLIASKRESL----RNQMKEEGDEQREGVDLITSYITNDTNK----  291

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDT+LN MIAGRDT SSAL+WF + +S +P V + IR+EL TA+ + E   +
Sbjct  292   ---DDKFLRDTVLNFMIAGRDTLSSALSWFFFCLSNNPTVVEKIREELKTAIPADESRDQ  348

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +R+F  +ELK LVY H A CE+LRLYPPVPFQHK  +Q D LPSGH + P T+++FSLYA
Sbjct  349   WRIFSIDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDTLPSGHHIKPKTKIVFSLYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM  +WGKD  EFKPERWI+ E+G++KH PSYKFLAFNAGPRTCLGKEVAFT+MK VA
Sbjct  409   LGRMSEVWGKDCLEFKPERWIS-EKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKLVA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             AA+IHNY++     H   PN SIIL+MKHG KV+V +RW
Sbjct  468   AAMIHNYNITQQIGHKVVPNPSIILHMKHGFKVKVTKRW  506



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/523 (53%), Positives = 359/523 (69%), Gaps = 19/523 (4%)
 Frame = -2

Query  1833  MASIDY-FEIFVAFFCLVIWIILRDGYRR------PLKVPLFGMLPSLFLHVRKIHDRCA  1675
             M SI++   I +A   L ++II    +RR      P   P+ GM PS+  H+ + HDR  
Sbjct  1     MTSINFSAAILLASIILFLFIIFCRIWRRNFHGAVPWNWPIVGMTPSVVTHIHRSHDRIT  60

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              V+   G TF  KG WF+ +D L+T DP+N+H+I+S NFE +PKG +FK IF+VLGDGIF
Sbjct  61    EVIQEVGSTFFFKGVWFSGMDFLLTADPSNIHHILSANFERYPKGPDFKYIFEVLGDGIF  120

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             NSD   WK+QRK AR+L+  ++F ++L + + NKV+ G++PVL+    E G V+DLQD+F
Sbjct  121   NSDSYAWKDQRKTARSLVHDEKFLQFLEKITLNKVKTGIVPVLD-GVCENGSVLDLQDLF  179

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRF+FD+TC +VTG+D   LS++ P VPFSKAMDD EEV+F+RH  P+ +W+ Q+ L IG
Sbjct  180   QRFSFDSTCMMVTGFDLQSLSLESPAVPFSKAMDDVEEVIFLRHFFPKKIWEFQKKLQIG  239

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
                +L +A +I+D+ I K I +KR  L    KNQ          G DL+ SY+ NN  + 
Sbjct  240   QPMRLKQAWKIIDETIAKLIALKRGSL----KNQVNKEGDEQGRGVDLIASYMINNTNK-  294

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                   DDKF RDT+LN MIAGRDT SSAL+WF + +S +P V K IR+EL T + S E 
Sbjct  295   ------DDKFFRDTVLNFMIAGRDTLSSALSWFFFCLSKNPTVVKMIREELKTTIPSNEA  348

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
               + R+F  EE+  LVY HA LCE+LRLYPPVPFQHK   Q DILPSGH + P T+++FS
Sbjct  349   CDQLRIFSMEEVNKLVYFHATLCEALRLYPPVPFQHKVATQHDILPSGHHIKPKTKIVFS  408

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LYA+GRM  +WGKD  EFKPERWIN E G +KH PSYKFLAFNAGPRTCLGK VAF ++K
Sbjct  409   LYALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFIELK  468

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              VAAAIIHNY++     H   PN SIIL+MKHG KV+V +RWT
Sbjct  469   IVAAAIIHNYNIIQQTGHQVVPNASIILHMKHGFKVKVTKRWT  511



>ref|XP_004166589.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=507

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/519 (52%), Positives = 367/519 (71%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEI---FVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MAS+ + EI   F+ F  +++++ ++  Y   P  +P FGM  ++  ++ +I D    +L
Sbjct  1     MASMSFLEILLTFIPFLSVLLFLSVKWKYNEIPWNLPFFGMTLTILRNLHRIQDHFTHIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              L   TF  KG WF +LD   T DP+N+H+I+S NFE +PKG +FK IF++LGDGIFNSD
Sbjct  61    RLSSFTFFFKGAWFADLDFYFTSDPSNIHHILSTNFERYPKGPDFKYIFEILGDGIFNSD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              D+WK+ RK A +L+   ++ +++ + +  KV+ GL+PVL+ +  E G V+DLQD+FQRF
Sbjct  121   SDVWKSLRKTAHSLVHDHKYVQFVEKITLKKVKAGLVPVLD-SVCENGSVLDLQDLFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             +FD+TC  VTG+D   LS++ P+VPFSKAMD+AEEV+F+RH +P+ +WK Q  L IGP  
Sbjct  180   SFDSTCMFVTGFDLQSLSLELPEVPFSKAMDEAEEVIFLRHFIPKKIWKFQNKLQIGPPT  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             +L +A E +D+ IGK I  KR+ L    +NQ  +       G DL+TSYI N+  +    
Sbjct  240   RLKQAWETIDETIGKLIASKRESL----RNQMKEEGDEQREGVDLITSYITNDTNK----  291

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDT+LN MIAGRDT SSAL+WF + +S +P V + IR+EL TA+ + E   +
Sbjct  292   ---DDKFLRDTVLNFMIAGRDTLSSALSWFFFCLSNNPTVVEKIREELKTAIPADESRDQ  348

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +R+F  +ELK LVY H A CE+LRLYPPVPFQHK  +Q D LPSGH + P T+++FSLYA
Sbjct  349   WRIFSIDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDTLPSGHHIKPKTKIVFSLYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM  +WGKD  EFKPERWI+ E+G++KH PSYKFLAFNAGPRTCLGKEVAFT+MK VA
Sbjct  409   LGRMSEVWGKDCLEFKPERWIS-EKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKLVA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             AA+IHNY++     H   PN SIIL+MKHG KV+V +RW
Sbjct  468   AAMIHNYNITQQIGHKVVPNPSIILHMKHGFKVKVTKRW  506



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/518 (53%), Positives = 362/518 (70%), Gaps = 17/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILR---DGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C  +  +L    DG+  P   PL GMLP+LFL++ ++HD    ++ 
Sbjct  1     MAVIGFLEIFLAGICFAVLCLLSKSDDGF--PRNWPLVGMLPALFLNLSRVHDWATGLVE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                G F  +  WF+++D+L+T DPAN HYIMS NF NFPKG EFK++FD+LGDGI NSD 
Sbjct  59    RSHGNFFFRSLWFSSMDMLVTADPANFHYIMSANFGNFPKGPEFKRVFDILGDGIINSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW  QR++A+  +  QRFHR+L+ T+ +K E GL+ VL+    +RG  VDLQD+F RFT
Sbjct  119   NLWSTQRRVAQVFMKDQRFHRFLLSTTRDKAENGLLRVLD-ELSQRGVTVDLQDLFHRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD+ C  VTG+DPG LSV+FP+VP SKA+ DAEEV+F RHL PE    LQ+ LGIG E+K
Sbjct  178   FDSACRFVTGFDPGSLSVEFPEVPISKALGDAEEVIFYRHLYPEWFGTLQRLLGIGVEEK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA + +DQ++G YI MKR EL      +  +    DENG DLLT Y+  N  ET   L
Sbjct  238   LRRAWKDIDQILGNYIAMKRVEL-----REGTNKVKGDENGADLLTLYMVEN--ETLGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRD I+N M AG +TT S LTWF W +S +P V+  IR+E+ + +   E  +  
Sbjct  291   ECNDKFLRDMIMNFMSAGIETTGSTLTWFFWALSMNPSVDMRIREEIRSVIPKEE--QNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
              +F  +E +  +VYLH A+CESLRLYPP+P   K P   D+LPSGHKV P  +++  +YA
Sbjct  349   MVFNISEHMHKMVYLHGAICESLRLYPPIPLLPKCPTNPDVLPSGHKVDPGAKIVVHMYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWG+D  EF+PERWI  ERG ++H+PSYKF+AFNAGPRTCLGK+VAFTQ+K VA
Sbjct  409   MGRMKSIWGEDCLEFRPERWI-LERGGIRHQPSYKFVAFNAGPRTCLGKDVAFTQIKMVA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V++H   P+ SIIL+MKHGLKV+V RR
Sbjct  468   ATVIHNYEVHVVEDHPVRPSNSIILHMKHGLKVKVTRR  505



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/525 (52%), Positives = 366/525 (70%), Gaps = 20/525 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             M  I  FEI +AFFC +++   +I +  +R  P   P FGM+P L + + +++D    +L
Sbjct  1     MVFISLFEISIAFFCFLLFRHFLINKKTHRLCPTNWPFFGMIPGLLVEIHRVYDFITEIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+   GP F NLD+L+TVDPAN+H+IMS NF N+PKG EFKK+FD+LGDGIFN+D
Sbjct  61    EVTNLTYPCTGPCFANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F ++ + TS  K+EKGL+P+L+  A E+   VDLQD+FQRF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQKFSLATSLKKLEKGLVPLLDHVAKEKLA-VDLQDMFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P+V F++A+DDAEE +F RH+ PE  W+LQ  LG+G EK
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEVEFARALDDAEEAIFFRHVKPEIFWRLQGLLGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A   LD+V  KYI +KR E+     N        D +  DLLTSY+N +  +  + 
Sbjct  240   KMTKARSTLDRVCSKYIAIKRDEVSRGTNNV-------DSHSKDLLTSYMNLDTTKYKLL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV-------N  787
                D++FLRDTIL  M+AGRDTT S LTWF WL+  +PEV   IR E+ TA+       +
Sbjct  293   NPSDERFLRDTILTFMLAGRDTTGSGLTWFFWLLIKNPEVIAKIRQEINTALFQRSKVDD  352

Query  786   SGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTR  607
                +      F  +ELK LVYLH A+CESLRLYPPVPFQHKSP + D+LPSGHKV  +++
Sbjct  353   DASNNNDSDSFSPQELKKLVYLHGAICESLRLYPPVPFQHKSPTKPDVLPSGHKVDANSK  412

Query  606   LMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAF  427
             ++F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA 
Sbjct  413   ILFCLYSLGRMKSVWGEDALEFKPERWIS-ESGNSVHEPSYKFLSFNAGPRTCLGKEVAM  471

Query  426   TQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              QMK+VA  II NY ++ V+     P  S+IL+MKHGLKV V +R
Sbjct  472   MQMKSVAVKIIQNYEMKIVEGQQIEPAPSVILHMKHGLKVTVTKR  516



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/518 (54%), Positives = 360/518 (69%), Gaps = 19/518 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILR---DGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C ++  +L    DG   P   PL GMLP+L L++   HD    V+ 
Sbjct  1     MALIGFLEIFLAGICFLVLRLLSKSDDGI--PRNWPLVGMLPALLLNLSHFHDWATGVVE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                G F  +  WF+ ++IL+T DPANVHYIMS NF NFPKG EFK++FD+LGDGIFNSD 
Sbjct  59    RSQGNFFFRFHWFSGMEILLTADPANVHYIMSTNFGNFPKGPEFKRVFDILGDGIFNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW  QR++A+  +  QRFH++L  T  +K E GL+ VL+    +RG  VDLQD+F RFT
Sbjct  119   NLWSTQRRVAQVFMKDQRFHQFLSLTIRDKAENGLLRVLD-ELSKRGVTVDLQDLFHRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD+ C  +TG DPG LSV+FP+VP SKA  DAEEV+F RHL PE    LQ+ LGIG E+K
Sbjct  178   FDSACRFLTGIDPGSLSVEFPEVPMSKAFGDAEEVIFYRHLYPEWFGTLQRLLGIGMEEK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA + +DQ++G YI MKR EL      +       DENG DLLT   N    ET   L
Sbjct  238   LRRAWKDIDQILGNYIAMKRVEL-----REGTSKVKGDENGADLLTLVEN----ETLGAL  288

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFL+DTILN M AG ++TSS LTWF W +S +P +E  IR+E+ + +   E  +  
Sbjct  289   ECNDKFLKDTILNFMTAGIESTSSTLTWFFWALSMNPSIEMRIREEIRSVIPKEE--QNL  346

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             R+F  +E +  +VYLH A+CESLRLYPPVPFQHK P   D+LPSGH+V P T+++  +YA
Sbjct  347   RVFNISEHMHKMVYLHGAICESLRLYPPVPFQHKCPANPDVLPSGHEVDPSTKIIVVMYA  406

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWG+D  EF+PERWI+ ERG ++HEPSYKF+AFNAGPRTCLGK+VAFTQ+K  A
Sbjct  407   MGRMKSIWGEDCLEFRPERWIS-ERGGIRHEPSYKFIAFNAGPRTCLGKDVAFTQIKTAA  465

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V++H   P+ SI+L+MKHGLKV++ RR
Sbjct  466   ATVIHNYEVYVVEDHPVRPSNSIVLHMKHGLKVKLARR  503



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/525 (53%), Positives = 366/525 (70%), Gaps = 20/525 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA I  FEI +AFFC +++   +I +  +R  P   P  GM+P L + + +++D    +L
Sbjct  1     MALISLFEISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFITEIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+   GP F NLD+L+TVDPAN+H+IMS NF N+PKG EFKK+FD+LGDGIFN+D
Sbjct  61    EVTNLTYPCIGPCFANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F ++ + TS NK+EKGL+P+L+  A E+  VVDLQD+FQRF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQKFSLATSSNKLEKGLVPLLDHVAKEK-LVVDLQDMFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P+V F++A+DDAEE +F RH+ PE LW+LQ  LG+G EK
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEVEFARALDDAEEAIFFRHIKPEILWRLQGLLGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A   LD+V  KYI  KR E+     N        D +  DLLTSY+N +  +  + 
Sbjct  240   KMTKARATLDRVCSKYIATKRDEVSRGTNNV-------DSHSKDLLTSYMNLDTTKYKLL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLT------AVNS  784
                D++FLRDTIL  M+AGRDTT S LTWF WL+   PEV   IR E+ T       VN+
Sbjct  293   NPSDERFLRDTILTFMLAGRDTTGSGLTWFFWLLIKTPEVIAKIRQEINTNLFQRSKVNA  352

Query  783   -GEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTR  607
                D      F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV  +++
Sbjct  353   DASDNNDSDSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKPDVLPSGHKVDANSK  412

Query  606   LMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAF  427
             ++F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA 
Sbjct  413   ILFCLYSLGRMKSVWGEDALEFKPERWIS-ESGNSVHEPSYKFLSFNAGPRTCLGKEVAM  471

Query  426   TQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              QMK VA  II NY ++ V+     P  S+IL+MKHGLKV V +R
Sbjct  472   MQMKTVAVKIIQNYEMKIVEGQQIEPAPSVILHMKHGLKVTVTKR  516



>ref|XP_008440140.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Cucumis melo]
Length=507

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/519 (52%), Positives = 361/519 (70%), Gaps = 16/519 (3%)
 Frame = -2

Query  1833  MASIDYFEI---FVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MASI + EI   F+ F  ++I++ ++  Y   P  +P FGM  ++  ++ +I D    +L
Sbjct  1     MASISFLEILLPFIPFLLVLIFLSVKWKYNELPWNLPFFGMTLTILCNLHRIQDHFTHIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              L   TF  KG WF +LD   T DP+N+H+I+S NFE +PKG +FK IF++LGDGIFNSD
Sbjct  61    RLSSSTFFFKGAWFADLDFFFTSDPSNIHHILSTNFERYPKGPDFKYIFEILGDGIFNSD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              D+WKN RK A +L+   ++ +++ + +  KV+ GL+PVL+  A E G V+DLQD+FQRF
Sbjct  121   SDVWKNLRKTAHSLVHDHKYLQFVEKITLKKVKSGLVPVLQ-TACENGSVLDLQDLFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             +FD+TC  VTG+D   LS++ P+VPFSKAMDDAEEV+F+RH +P+ +WK Q  L IGP  
Sbjct  180   SFDSTCMFVTGFDLQSLSLELPEVPFSKAMDDAEEVIFLRHFIPKKIWKFQNKLQIGPPM  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             ++ +A + +D+ +GK I  KR+ L    +NQ  +       G DL+TSYI ++       
Sbjct  240   RMKQAWDTIDETVGKLIASKRESL----QNQMKEEGDEQTEGVDLITSYITSSIDND---  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDT+LN MIAGRDT SSAL+WF + +S +P V + IR+EL   + + E   +
Sbjct  293   ---DDKFLRDTVLNFMIAGRDTLSSALSWFFFCLSNNPTVIEKIREELKLTIPTDEPHDQ  349

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +R+F  +ELK LVY H ALCE+LRLYPPVPFQHK   Q D LPSGH + P T+++FSLYA
Sbjct  350   WRIFSIDELKKLVYFHGALCEALRLYPPVPFQHKVATQHDKLPSGHHIKPKTKIVFSLYA  409

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GR   +WGKD  EFKPERWI+ E+G++KH PSYKFLAFNAGPRTCLGKEVAFT+MK VA
Sbjct  410   LGRTSEVWGKDCLEFKPERWIS-EKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKIVA  468

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             A IIHNY++     H   PN SIIL+MKHG KV V +RW
Sbjct  469   ATIIHNYNIIQQIGHKVVPNPSIILHMKHGFKVNVTKRW  507



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/518 (54%), Positives = 362/518 (70%), Gaps = 28/518 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C V++ +L    DG   P   PL  MLP+LFL++ + HD   +VL 
Sbjct  1     MALIGFMEIFLAAICFVVFHLLGKSHDGL--PKNWPLVRMLPALFLNLGRAHDWGTSVLE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                  F  + PWF+ +D+L+  DPANVHYIMS NFENFPKG EFK++FD+LGDGI NSD 
Sbjct  59    QSRCNFFFRSPWFSGMDVLVAADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             D+W+ QR+ A+  +  QRF R+L +T+ +KVE GL+ VL+    +RG  VDLQD+FQRFT
Sbjct  119   DMWRAQRRDAQVFMNDQRFCRFLAKTTRDKVENGLLRVLD-DLSQRGVEVDLQDLFQRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
              D+ C  VTG+D    S++FP+VPFSKA+DDAEE +F RHL          WLG+G E+K
Sbjct  178   LDSACRFVTGFDLSSFSIEFPEVPFSKALDDAEEAIFYRHL----------WLGLGMEEK  227

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA E++DQ+IG YI MKR EL              DENG DLLT Y+  N  ET   L
Sbjct  228   LKRAREVMDQIIGSYIEMKRVEL-----RDGTSKVKGDENGADLLTLYMVEN--ETLGVL  280

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +D FLRDTIL  MIAG +TTS ALTW  W +ST+P VE  IR E+ + +   E+ +  
Sbjct  281   ECNDVFLRDTILTFMIAGNNTTSLALTWLFWALSTNPSVEMKIR-EIKSVIP--EEEQNL  337

Query  762   RLFKAEE-LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             R+FK +E +  +VYLH ALCESLRLYPP+PF+ K P++ DILPSGHKV P  R++F+LYA
Sbjct  338   RVFKMDEHMHKMVYLHGALCESLRLYPPIPFELKCPVKPDILPSGHKVDPSKRILFNLYA  397

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWG+D  EF+PERWI+ E G V+HEPSYKFLAFNAGPRTCLGK+VAFTQMK +A
Sbjct  398   MGRMKSIWGEDCFEFRPERWIS-EGGGVRHEPSYKFLAFNAGPRTCLGKQVAFTQMKMIA  456

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V+ H   P+ SI+L+MK GL+V++ RR
Sbjct  457   AVVIHNYEVHVVEGHPMRPSNSIVLHMKQGLRVKLARR  494



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/488 (55%), Positives = 348/488 (71%), Gaps = 14/488 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GM PS+  H  + HDR   V+   G TF  KG WF+ +D L+TVDP+N+H+I+
Sbjct  36    PWNWPIIGMTPSVVTHFYRSHDRITEVIQEAGSTFFFKGVWFSGMDFLLTVDPSNIHHIL  95

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NFE +PKG +FK IF+VLGDGIFNSD   WK+QRK AR+L+  + F ++L + +  KV
Sbjct  96    SANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDENFLQFLEKITLKKV  155

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             +  L+PVL+ +  E G V+DLQD+FQRF+FD+TC +VTG+D   LS++FP+VPFSKAMDD
Sbjct  156   KTALVPVLQ-SVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLQSLSLEFPEVPFSKAMDD  214

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQ-  1033
             AEEV+F+RH  P+ +W+ Q+ L IG   +L +A EI+D+ I K I +KR  L    KNQ 
Sbjct  215   AEEVIFLRHFFPKKIWEFQKKLQIGQPMRLKQAWEIIDETIAKLIALKRGSL----KNQV  270

Query  1032  NPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFI  853
             N + D     G DL+ SY+ NN  +       DDKFLRDT+LN MIAGRDT SSAL+WF 
Sbjct  271   NKEGDEQGAGGVDLIKSYMINNTNK-------DDKFLRDTVLNFMIAGRDTLSSALSWFF  323

Query  852   WLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPF  673
             + +S +P V + IR+EL   + + E   ++R+F  +ELK LVY H ALCE+LRLYPPVPF
Sbjct  324   FCLSNNPTVIEKIREELKLTIPTDEPHDQWRIFSIDELKKLVYFHGALCEALRLYPPVPF  383

Query  672   QHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHE  493
             QHK   Q D LPSGH + P T+++FSLYA+GR   +WGKD  EFKPERWI+ E+G++KH 
Sbjct  384   QHKVATQHDKLPSGHHIKPKTKIVFSLYALGRTSEVWGKDCLEFKPERWIS-EKGSIKHV  442

Query  492   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGL  313
             PSYKFLAFNAGPRTCLGKEVAFT+MK VAA IIHNY++     H   PN SIIL+MKHG 
Sbjct  443   PSYKFLAFNAGPRTCLGKEVAFTEMKIVAATIIHNYNIIQQIGHKVVPNPSIILHMKHGF  502

Query  312   KVRVQRRW  289
             KV V +RW
Sbjct  503   KVNVTKRW  510



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/518 (54%), Positives = 360/518 (69%), Gaps = 17/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILR---DGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C  +  +L    DG   P   PL GMLP+L L++   H+     L 
Sbjct  1     MALIGFLEIFLAGICFAVLRLLSKRDDGL--PKNWPLVGMLPALLLNLSHFHEWATGFLE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                G F L+  WF+ +D+L T DPANVHYI+S NF NFPKG EFK++FD+LGDGIFNSD 
Sbjct  59    RSRGNFFLRFHWFSGMDMLFTADPANVHYILSANFGNFPKGPEFKRVFDILGDGIFNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW  QR++A+  +   RFHR+L+ T+ +K+E GL+ VL+    +RG  VDLQD+FQRF 
Sbjct  119   NLWSTQRRVAQVFMKDLRFHRFLLMTTRDKLENGLLRVLD-ELSQRGVTVDLQDLFQRFA  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
              D+ C  VTG+DPG LSV+FP+VP SKA+ DAEEVLF RH  PE    LQ+ LGIG EKK
Sbjct  178   LDSACRFVTGFDPGSLSVEFPEVPISKALADAEEVLFYRHFYPEWFGTLQRLLGIGVEKK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA E  DQ++G YI  KR EL      +       DENG DLLT Y+  N  ET   L
Sbjct  238   LRRAWEDGDQILGYYIAKKRVEL-----REGTGKVKGDENGADLLTLYMVEN--ETLGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRDTILN + AG +TT SALTWF W +S +P VE  IR+E+ + +   E  +  
Sbjct  291   ECNDKFLRDTILNFISAGIETTGSALTWFFWALSMNPSVEMRIREEIRSVIPKEE--QNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             R+F  +E +  LVYLH A+CESLRLYPP+PFQ K P + D+LPSGH+V P T+++  +YA
Sbjct  349   RVFNISEHMHKLVYLHGAVCESLRLYPPLPFQRKCPAKPDVLPSGHEVDPGTKIIVVMYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGR++ IWG+D  EFKPERWI+ ERG ++HEPSYKF+AFNAGPRTCLGK+VAFTQ+K VA
Sbjct  409   MGRIKSIWGEDFLEFKPERWIS-ERGGIRHEPSYKFVAFNAGPRTCLGKDVAFTQIKTVA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V++H   P+  I+L+MKHGLKV++ RR
Sbjct  468   ATVIHNYEVHVVEDHPVRPSNFIVLHMKHGLKVKLARR  505



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/521 (51%), Positives = 365/521 (70%), Gaps = 18/521 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRR--PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +  FEI +AF C  ++   ++   + R  P   P  G++P L + + +++D    +L
Sbjct  1     MAFLSLFEISIAFLCFFLFRHFLINKKHHRLCPTNWPFLGVIPGLLVEIHRVYDFITEIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+  KGP +  LD+L+TVDP+N+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A+++++H  F ++ + TS +K+EKGL+P+L+ AA E+  VV+L DVFQRF
Sbjct  121   SELWKDLRKSAQSMMMHPEFQKFSLATSMSKLEKGLVPLLDHAANEK-LVVNLGDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTTC L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE LWK++ ++G+G EK
Sbjct  180   TFDTTCVLATGYDPGCLSVEMPEIEFARALDDAEEAIFFRHVKPEILWKMESFIGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A    D+V  KYI  KR E+I T  +  P +        DLLTSY+N    +  + 
Sbjct  240   KMTKARATFDRVCSKYIASKRDEVI-TNIDSPPASQ-------DLLTSYMNLETTKYKLL  291

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN----SGE  778
                DD+FLRDTIL  M+AGRDTT S LTW  WL+   PE    IR E+ T ++    + +
Sbjct  292   DPSDDRFLRDTILTFMLAGRDTTGSGLTWLFWLLLKFPEAMDKIRQEIKTVLSPKTKTDD  351

Query  777   DPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMF  598
             D      F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP +TD+LPSGHKV  +++++F
Sbjct  352   DDDDSDSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVEANSKILF  411

Query  597   SLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQM  418
              LY++GRM+ +WG+DA EFKPERW++ E G   HEPSYKFL+FNAGPRTCLGKEVA TQM
Sbjct  412   CLYSLGRMKTVWGEDALEFKPERWVS-ESGKSVHEPSYKFLSFNAGPRTCLGKEVALTQM  470

Query  417   KAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             K+VA  II NY ++ V+     P  S+IL+ KHGLKV V +
Sbjct  471   KSVAVKIIQNYEIKMVEGQKIEPAPSVILHTKHGLKVTVTK  511



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/521 (51%), Positives = 366/521 (70%), Gaps = 18/521 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +  FEI +AF C  ++   +I +  +R  P   P  G++P L + + +++D    +L
Sbjct  1     MAFLSLFEISIAFLCFFLFRHFLINKKPHRLCPTNWPFLGVIPGLLVEIHRVYDFITEIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+  KGP +  LD+L+TVDP+N+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A+++++H  F ++ + TS +K+EKGL+P+L+  A E+  VV+L+DVFQRF
Sbjct  121   SELWKDLRKSAQSMMMHPEFQKFSLATSMSKLEKGLVPLLDHVANEK-LVVNLEDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTTC L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE LWK++ ++G+G EK
Sbjct  180   TFDTTCVLATGYDPGCLSVEMPEIEFARALDDAEEAIFFRHVKPEILWKMESFIGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A    D+V  KYI  KR E+I T  +  P +        DLLTSY+N    +  + 
Sbjct  240   KMTKARATFDRVCSKYIASKRDEVI-TNIDSPPASQ-------DLLTSYMNLETTKYKLL  291

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN----SGE  778
                DD+FLRDTIL  M+AGRDTT S LTW  WL+   PE    IR E+ T ++    + +
Sbjct  292   DPSDDRFLRDTILTFMLAGRDTTGSGLTWLFWLLLKFPEAMDKIRQEIKTVLSPKTKTDD  351

Query  777   DPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMF  598
             D      F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP +TD+LPSGHKV  +++++F
Sbjct  352   DDDDSDSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVEANSKILF  411

Query  597   SLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQM  418
              LY++GRM+ +WG+DA EFKPERW++ E G   HEPSYKFL+FNAGPRTCLGKEVA TQM
Sbjct  412   CLYSLGRMKTVWGEDALEFKPERWVS-ESGKSVHEPSYKFLSFNAGPRTCLGKEVALTQM  470

Query  417   KAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             K+VA  II NY ++ V+     P  S+IL+ KHGLKV V +
Sbjct  471   KSVAVKIIQNYEIKMVEGQKIEPAPSVILHTKHGLKVTVTK  511



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/518 (54%), Positives = 359/518 (69%), Gaps = 17/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILR---DGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C  +  +L    DG   P   PL GMLP+L L++   H+     L 
Sbjct  1     MALIGFLEIFLAGICFAVLRLLSKSDDGL--PKNWPLVGMLPALLLNLSHFHEWATGFLE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                G F L+  WF+ +DIL T DP NVHYI+S NF NFPKG EFK++FDVLGDGIFNSD 
Sbjct  59    RSHGNFFLRFHWFSGMDILFTADPVNVHYILSANFGNFPKGPEFKRVFDVLGDGIFNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW  QR++A+  +   RFHR+L+ T+ +K+E GL+ VL+    + G  VDLQ +FQRF 
Sbjct  119   NLWSTQRRVAQVFMKDLRFHRFLLMTTRDKLENGLLRVLD-ELSQSGVTVDLQVLFQRFA  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
              D+ C  VTG+DPG LSV+FP+V  SKA+DDAEEVLF RH  PE    LQ+ LGIG EKK
Sbjct  178   LDSACRFVTGFDPGSLSVEFPEVLISKALDDAEEVLFYRHFYPEWFGTLQRLLGIGVEKK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L +A E  DQ++G  I MKR EL      +       DENG DLLT Y+  N  ET   L
Sbjct  238   LRKAWEDGDQILGNCIAMKRVEL-----REGTGKVKEDENGADLLTLYMVEN--ETLGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRDTILN + AG +TT SALTWF W +S +P VE  IR+E+ + +   E  +  
Sbjct  291   ECNDKFLRDTILNFISAGIETTGSALTWFFWALSMNPSVEMRIREEIRSVIPKEE--QNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             R+F  +E +  LVYLH A+CESLRLYPP+PFQ KSP + D+LPSGH+V P T+++  +YA
Sbjct  349   RVFNISEHMHKLVYLHGAVCESLRLYPPLPFQRKSPAKPDVLPSGHEVDPGTKIIVVMYA  408

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWG+D  EFKPERWI+ ERG ++HEPSYKF+AFNAGPRTCLGK+VAFTQ+K VA
Sbjct  409   MGRMKSIWGEDCLEFKPERWIS-ERGGIRHEPSYKFVAFNAGPRTCLGKDVAFTQIKTVA  467

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A +IHNY V  V++H   P+ SI+L+MK+GLKV++ RR
Sbjct  468   ATVIHNYEVHVVEDHPVRPSNSIVLHMKYGLKVKLARR  505



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/519 (52%), Positives = 359/519 (69%), Gaps = 22/519 (4%)
 Frame = -2

Query  1818  YFEIFVAFFCLVIWIILR----DGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGG  1651
             Y EI ++  C   +   R    +G   P+  P  GMLP+L +H+ ++HD    +L   G 
Sbjct  17    YPEILISVACFFFFYCYRKRMNEGTGIPVNWPFVGMLPALLVHLHQLHDWGTMILKETGC  76

Query  1650  TFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWK  1471
              F   GPW++ +D+LIT DPANV+++ S NF N+PKG +F +IFDVLGDGIFNSD + W+
Sbjct  77    NFFFHGPWYSGMDMLITCDPANVYHVFSANFHNYPKGDDFSEIFDVLGDGIFNSDAESWR  136

Query  1470  NQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTT  1291
              QR  A +LI  +RF  ++ ++S +KVEKGLIP+L+  A E+   VDLQDVF R TFDTT
Sbjct  137   RQRMKAHSLINDRRFRAFVAQSSRSKVEKGLIPLLDQLA-EQEVAVDLQDVFLRLTFDTT  195

Query  1290  CTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRA  1111
             C LV G DPGCLS+ FP +PF+KAMDDA   L +RH +P + WKLQ+WL +G EKK++ A
Sbjct  196   CYLVFGVDPGCLSIGFPTIPFAKAMDDATGALLVRHTVPPAWWKLQRWLRVGVEKKMALA  255

Query  1110  CEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNND------GETTM  949
              E++DQ I + I  K++E       +N      +E   DLL+SY++  D       E  M
Sbjct  256   WEVMDQFIAQRIAEKKEE-------RNRSRSHEEEAPRDLLSSYVDVCDDLHLVDAENPM  308

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                  DKFLRDT +N MIAGRDTT +ALTWF WL+S +P VE  I +EL +         
Sbjct  309   EF---DKFLRDTAMNFMIAGRDTTGAALTWFFWLLSKNPLVESKILEELKSLRKKSSCFD  365

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                LF AEELK LVYLHAALCESLRLYPPVPF+HK  LQ+++LPSG K  P T+++FSLY
Sbjct  366   NMTLFDAEELKGLVYLHAALCESLRLYPPVPFEHKGVLQSEVLPSGDKAQPSTKILFSLY  425

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             +MGRM+ +WGKD  EFKPERWI+ E+G ++HEPSYKF +FN+GPRTC+GK++AFTQMKAV
Sbjct  426   SMGRMEGVWGKDCLEFKPERWIS-EKGRLRHEPSYKFTSFNSGPRTCIGKDMAFTQMKAV  484

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              AA+++N+HV  V+ H   P +SIIL+MK+GL VR+++R
Sbjct  485   VAAMVYNFHVDVVEGHVVQPKISIILHMKNGLMVRIRKR  523



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/519 (52%), Positives = 362/519 (70%), Gaps = 14/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA I  FEI +AFFC +++   +I +  +R  P   P  GM+P L + + +++D    +L
Sbjct  1     MALISLFEISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFVTDIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+   GP F+ LD+L+TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EVTNLTYPCVGPLFSGLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              DLWK+ RK A++++++  F ++ + TS NK+EKGL+P+L+  A E+   VDLQDVFQRF
Sbjct  121   SDLWKDLRKSAQSMMMNPEFQKFSLATSLNKLEKGLVPLLDHVAKEKLA-VDLQDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P+V F+KA+DDAEE +F RH+ PE  W++Q  LG+G EK
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEVEFAKALDDAEEAIFYRHVKPEIFWRIQGLLGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A   LD+V  + I  +R E+     ++  DN   D    DLLTSY+N +  +  + 
Sbjct  240   KMTKARMTLDRVCSECIASRRDEI-----SRGIDN--VDSPSKDLLTSYMNLDTTKYKLL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG-EDPK  769
                DD+FLRDT+L  M+AGRDTT S LTWF WL+   PE+   IR E+   +  G E   
Sbjct  293   NPSDDRFLRDTVLTFMLAGRDTTGSGLTWFFWLLCKTPEIMAKIRQEINKNLTDGSESDV  352

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV  +++++F LY
Sbjct  353   DSGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTEADVLPSGHKVDANSKILFCLY  412

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             ++GRM+ +WG DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA  QMK V
Sbjct  413   SLGRMKSVWGDDALEFKPERWIS-ESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQMKTV  471

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY ++ V+     P  S+IL+MKHG+KV V +R
Sbjct  472   AVKIIQNYEMKIVEGQKIEPAPSVILHMKHGVKVTVTKR  510



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/521 (53%), Positives = 356/521 (68%), Gaps = 16/521 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW----IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   EI V+F C   +    +I++  +R  P   P  GMLP L + + +++D     
Sbjct  1     MAMISLLEISVSFLCFSYFFGYFLIMKKPHRSFPTNWPFLGMLPGLLVEIPRVYDYVTEF  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TF  KGP F  LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+
Sbjct  61    LEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLWK+ RK A++++    F R+ +RT+ +K+EKGL+P+L+  A E+  V DLQDVFQR
Sbjct  121   DSDLWKDLRKSAQSMMSRPEFQRFTLRTNMSKLEKGLVPILDHFA-EKKLVFDLQDVFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG DPGCLS++ P++ F+KA+D+AEE +F RH  PE +WK+Q+ LG G E
Sbjct  180   FTFDTTFVLATGIDPGCLSIEMPEIEFAKALDEAEEAIFFRHFKPEIVWKMQRLLGFGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+S A    D+V  K I  KR E+     +        D +  DLL SY++ +  +  +
Sbjct  240   LKMSIAHSTFDRVCSKCIASKRDEITRGVTSI-------DSSSKDLLMSYMDVDTTKYKL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN--SGED  775
                 DDKFLRD IL+ M+AGRDTT SALTWF WL+S +PEV   IR E+ T ++  +  D
Sbjct  293   LNPGDDKFLRDMILSFMLAGRDTTGSALTWFFWLLSKNPEVTTKIRQEINTKLSPRTDND  352

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
             P  F  F  +EL  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGH+V P T+++F 
Sbjct  353   PVHFSSFNPQELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHRVDPSTKIVFC  412

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LY++GRM+ +WG+DA EFKPERWI+ E G + H PS+KFL+FNAGPRTCLGKEVA TQMK
Sbjct  413   LYSLGRMKSVWGEDASEFKPERWIS-ETGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMK  471

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              VA  II NY V+ V+ H   P  SIIL+MK GL+V V +R
Sbjct  472   TVAVKIIQNYEVKIVEGHKIEPVPSIILHMKQGLRVMVTKR  512



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/520 (52%), Positives = 358/520 (69%), Gaps = 15/520 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI----WIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   E+ V+F C  +    ++I +  +   P   P  GMLP L + + +++D    V
Sbjct  1     MALIGLLEVSVSFLCFSVLFAYFLISKKPHPSFPTNWPFLGMLPGLLVEIHRVYDYMTEV  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     T+  +GP F  LD+LITVDPAN+H+IMS NF N+PKG EFKKIFDVLGDGIFN+
Sbjct  61    LEASNLTYPFRGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LWK+ RK A++++ H  F R+ +RTS +K+EKGLIP+L   A E+  VVDLQDVFQR
Sbjct  121   DSELWKDLRKSAQSMMSHPEFQRFTLRTSISKLEKGLIPLLNLVA-EKKLVVDLQDVFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG+DPGCLS++ P++ FS+A+D+AEE +F RH+ PE  WK+Q+ +G+G E
Sbjct  180   FTFDTTFVLATGFDPGCLSIEMPEIEFSRALDEAEEAIFFRHVKPEMFWKMQRLIGVGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+ +A    D+V  K I  KR E+     N +P ++       DLLTSY++ +  +  +
Sbjct  240   LKMKKAHSTFDRVCSKCIASKRDEITRGAVNIDPSSE-------DLLTSYMHVDTIKYKL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNS-GEDP  772
                 DD+FLRD IL+ M+AGRDTT SALTWF WL+S +P+    IR E  T ++    + 
Sbjct  293   LNPSDDRFLRDMILSFMLAGRDTTGSALTWFFWLLSKNPKATTKIRQEFNTKLSPRPNND  352

Query  771   KKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSL  592
               F  F  +EL  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGH+V   ++++F L
Sbjct  353   SYFDSFNPQELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHRVGASSKIVFCL  412

Query  591   YAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKA  412
             Y++GRM+ +WG+DA EFKPERWI+ E G + H PS+KFL+FNAGPRTCLGKEVA TQMK 
Sbjct  413   YSLGRMKSVWGEDASEFKPERWIS-ESGKLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKI  471

Query  411   VAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             VA  II NY +  V+ H   P  S+IL+MKHGLKV V +R
Sbjct  472   VAVKIIQNYEINIVEGHKIEPVPSVILHMKHGLKVLVTKR  511



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/519 (51%), Positives = 359/519 (69%), Gaps = 14/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA I  FEI +AFFC +++   +I +  +R  P   P  GM+P +   + +++D    +L
Sbjct  1     MALISLFEISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGMLAEIHRVYDFVTDIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+   GP F+ LD+L+TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EVTNLTYPCVGPLFSGLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              DLWK+ RK A+ ++++  F ++ + TS NK+EKGL+P+L+ AA E+   VDLQD+FQRF
Sbjct  121   SDLWKDLRKSAQNMMMNPEFQKFSLATSLNKLEKGLVPLLDHAANEKLA-VDLQDMFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLS++ P+V F++A+DDAEE +F RH+ PE  W++Q  LG+G EK
Sbjct  180   TFDTTFVLATGYDPGCLSLEMPEVEFARALDDAEEAIFYRHVKPEIFWRIQGLLGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A + LD+V  + I  +R E+     N        D    DLLTSY+N +  +  + 
Sbjct  240   KMTKARKTLDRVCSECIASRRDEISSGINNV-------DSPSKDLLTSYMNLDTAKYKLL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG-EDPK  769
                DD+FLRDT+L  M+AGRDTT S LTW  WL+   PEV   IR E+   +  G E   
Sbjct  293   NPSDDRFLRDTVLTFMLAGRDTTGSGLTWLFWLLCQTPEVMAKIRQEINKNLTDGSESGV  352

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV  +++++F LY
Sbjct  353   DSGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTEADVLPSGHKVDANSKILFCLY  412

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             ++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA  QMK V
Sbjct  413   SLGRMKSVWGEDALEFKPERWIS-ESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQMKTV  471

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY ++ V+     P  S+IL+MKHG+KV V +R
Sbjct  472   AVKIIQNYEMKIVEGQKIEPAPSVILHMKHGVKVTVTKR  510



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/523 (51%), Positives = 361/523 (69%), Gaps = 16/523 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +   EI +AF C +I+   +++    RP     P+ GMLP L   + +++D    +L
Sbjct  1     MALVSLLEISIAFTCFLIFHFFLIKKKQHRPFLTNWPILGMLPGLLPELPRVYDFITELL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
                   FL KGP    LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSNFANYPKGTEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK +++++ H  F R+ + TS +K+EKGL+P+L+  A E+  VVDLQDVFQRF
Sbjct  121   SELWKDLRKFSQSMMSHPEFQRFSLATSLSKLEKGLVPLLDHVAKEK-IVVDLQDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE +WK+Q+W+G+G E 
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEIEFARALDDAEEAIFYRHIKPEMVWKMQRWIGVGDEL  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL RA  + D+V  + I  KR E+     ++   ++I+  +  DLL S IN +  +  + 
Sbjct  240   KLKRAHAVFDRVCSECIASKRDEI-----SRGRTDNISSSSSKDLLMSSINVDTTKYKLL  294

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV-----NSG  781
                DD+FLRDTIL+ M+AGRDTT SALTWF WL+  + E    IR E+ T +      +G
Sbjct  295   NPSDDRFLRDTILSFMLAGRDTTGSALTWFFWLLCKNQEAVAKIRQEINTNLFPGNKTAG  354

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
                     F  +++K LVYLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV  +++++
Sbjct  355   SVSYDSDSFNPQDVKKLVYLHGAICEALRLYPPVPFQHKSPTEPDVLPSGHKVDANSKIL  414

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
             F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA TQ
Sbjct  415   FCLYSLGRMKSVWGEDAFEFKPERWIS-ESGRSLHEPSYKFLSFNAGPRTCLGKEVAMTQ  473

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             MK VA  II NY  + V+ H   P  S+IL+MKHGLKV V +R
Sbjct  474   MKTVAVKIIQNYEFQVVEGHKIEPAPSVILHMKHGLKVTVSKR  516



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/523 (52%), Positives = 361/523 (69%), Gaps = 17/523 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +   EIF+AF C +I+   +++    RP     P+ GMLP L   + +++D    VL
Sbjct  1     MALVSLLEIFIAFTCFLIFHFFLIKKKQHRPFLTNWPILGMLPGLLPELPRVYDFITDVL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
                   FL KGP    LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EGGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSNFANYPKGTEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK +++++ H  F ++ + TS +K+EKGL+P+L+  A E+  VVDLQDVFQRF
Sbjct  121   SELWKDLRKSSQSMMSHPEFQKFSLATSLSKLEKGLVPLLDHVAKEK-LVVDLQDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P++ F++A+DDAEE +F RHL PE +WK+Q+ +G+G E 
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEIEFARALDDAEEAIFYRHLKPEMVWKMQRLIGVGGEL  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL RA  + D+V  + I  KR E+     ++  DN I+  +  DLL S+IN +  +  + 
Sbjct  240   KLKRAHAVFDRVCSECIASKRDEI-----SRGSDN-ISSSSSKDLLMSFINVDTTKYKLL  293

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV-----NSG  781
                DD+FLRDTIL+ M+AGRDTT SALTWF WL+  + E    IR E+ T +       G
Sbjct  294   NPSDDRFLRDTILSFMLAGRDTTGSALTWFFWLLCKNQEAVARIRQEINTNLLPGNKTDG  353

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
                     F  +E+K LVYLH A+CESLRLYPPVPFQHKSP + D+LPSGHKV  +++++
Sbjct  354   SVSYDSDSFNPQEVKKLVYLHGAICESLRLYPPVPFQHKSPTEPDVLPSGHKVDANSKIL  413

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
             F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA TQ
Sbjct  414   FCLYSLGRMKSVWGEDALEFKPERWIS-ESGRSLHEPSYKFLSFNAGPRTCLGKEVAMTQ  472

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             MK VA  II NY  + V+ H   P  S+IL+MKHGLKV V +R
Sbjct  473   MKTVAVKIIQNYEFQVVEGHKIEPAPSVILHMKHGLKVTVSKR  515



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 354/518 (68%), Gaps = 15/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW-IILRDGYRRPLKV---PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +   +I +AFFC +I+ I L      P  +   P  GMLP L L + +++D    VL
Sbjct  1     MALVSLLDISIAFFCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
                   +L KGP+   LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN D
Sbjct  61    EHGNLNYLFKGPFLGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F  + + TS NK+EKGL+P+L+  A E+  VVDLQDVFQRF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQSFSIATSLNKLEKGLVPLLDHVAKEKL-VVDLQDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFD+T  L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE +WK+Q+  G+G E 
Sbjct  180   TFDSTFVLATGYDPGCLSVEMPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLFGLGDEL  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL RA  ILD+   K I+ KR ++             N+    DLLT+Y+N +  +  + 
Sbjct  240   KLKRAHNILDRACFKCISSKRDDI---------SRGTNNSGSKDLLTAYLNVDTTKYKLL  290

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DD+FLRDT+L+ M+AGRDTT SALTWF WL+  + E    I  E+   ++       
Sbjct  291   NPNDDRFLRDTVLSFMLAGRDTTGSALTWFFWLLCKNEEAITKILQEINKNISPRTKTDD  350

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +  F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP +TD+LPSGHKV   ++++F LY+
Sbjct  351   YGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDAGSKILFCLYS  410

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+DA EFKPERWI  E G   HEPSYKFL+FNAGPRTCLGKEVA  QMK VA
Sbjct  411   LGRMKSVWGEDALEFKPERWIT-ENGTSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVA  469

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               II NY ++ V+ H   P  SIIL+MKHGLKV V +R
Sbjct  470   VKIIQNYDIKVVEGHKVEPAPSIILHMKHGLKVTVSKR  507



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 354/518 (68%), Gaps = 15/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW-IILRDGYRRPLKV---PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +   +I +AFFC +I+ I L      P  +   P  GMLP L L + +++D    VL
Sbjct  1     MALVSLLDISIAFFCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
                   +L KGP+   LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN D
Sbjct  61    EHGNLNYLFKGPFLGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F  + + TS NK+EKGL+P+L+  A E+  VVDLQDVFQRF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQSFSIATSLNKLEKGLVPLLDHVAKEKL-VVDLQDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFD+T  L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE +WK+Q+  G+G E 
Sbjct  180   TFDSTFVLATGYDPGCLSVEMPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLFGLGDEL  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL RA  ILD+   K I+ KR ++             N+    DLLT+Y+N +  +  + 
Sbjct  240   KLKRAHNILDRACFKCISSKRDDI---------SRGTNNSGSKDLLTAYLNVDTTKYKLL  290

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DD+FLRDT+L+ M+AGRDTT SALTWF WL+  + E    I  E+   ++       
Sbjct  291   NPNDDRFLRDTVLSFMLAGRDTTGSALTWFFWLLCKNEEAIIKILQEINKNISPRTKTDD  350

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +  F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP +TD+LPSGHKV   ++++F LY+
Sbjct  351   YGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDAGSKILFCLYS  410

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+DA EFKPERWI  E G   HEPSYKFL+FNAGPRTCLGKEVA  QMK VA
Sbjct  411   LGRMKSVWGEDALEFKPERWIT-ENGTSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVA  469

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               II NY ++ V+ H   P  SIIL+MKHGLKV V +R
Sbjct  470   VKIIQNYDIKVVEGHKVEPAPSIILHMKHGLKVTVSKR  507



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/522 (52%), Positives = 363/522 (70%), Gaps = 20/522 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA I  FEI +AFFC +++   +I +  +R  P   P  GM+P L + + +++D    VL
Sbjct  1     MALISLFEISIAFFCFLLFRYFLINKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFVTEVL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+   GP F  LD+LITVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EVTNLTYPCVGPCFAGLDMLITVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F ++ + TS NK+EKGL+P+L+  A E+  V+DLQD+FQRF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQKFSLATSLNKLEKGLVPLLDHVAKEK-LVLDLQDMFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P+V F++A+DDAEE +F RH+ PE LW++Q  +G+G EK
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEVEFARALDDAEEAIFYRHIKPEILWRMQGLVGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A   LD+V  + I+ +R E+     N        D    DLLTSY+N +  +  + 
Sbjct  240   KMTKARTTLDRVCSECISSRRGEVSRGINNV-------DSPSKDLLTSYMNLDTTKYKLL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN----SGE  778
                DD+FLRDTIL  M+AGRDTT S LTWF WL+   PEV   IR ++ T +     SG 
Sbjct  293   DPSDDRFLRDTILTFMLAGRDTTGSGLTWFFWLLCKTPEVMAKIRQDINTNLTDGWGSGV  352

Query  777   DPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMF  598
             D      F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV  +++++ 
Sbjct  353   DSDS---FNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILL  409

Query  597   SLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQM  418
              LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA  QM
Sbjct  410   CLYSLGRMKSVWGEDALEFKPERWIS-ESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQM  468

Query  417   KAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             K VA  II NY ++ V+     P  S+IL+MKHG+KV V ++
Sbjct  469   KTVAVKIIQNYELKIVEGQKIEPAPSVILHMKHGVKVTVTKK  510



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 354/518 (68%), Gaps = 15/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW-IILRDGYRRPLKV---PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA +   +I +AFFC +I+ I L      P  +   P  GMLP L L + +++D    VL
Sbjct  1     MALVSLLDISIAFFCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLILEIPRVYDFITEVL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
                   +L KGP+   LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN D
Sbjct  61    EHGNLNYLFKGPFLGGLDMLFTVDPANIHHIMSSNFSNYPKGAEFKKLFDVLGDGIFNVD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F  + + TS +K+EKGL+P+L+  A E+  VVDL+D+FQRF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQSFSIATSLSKLEKGLVPLLDHVAKEKL-VVDLEDIFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV  P++ F++A+DDAEE +F RH+ PE +WK+Q+  G+G E 
Sbjct  180   TFDTTFVLATGYDPGCLSVGMPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLFGLGDEL  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL RA  ILD+   K I+ KR E+             N+    DLLTSY+N +  +  + 
Sbjct  240   KLKRAHNILDRACFKCISSKRDEI---------SRGTNNIGSKDLLTSYLNVDTTKYKLL  290

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DD+FLRDT+L+ M+AGRDTT SALTWF WL+  + E    I  E+   ++       
Sbjct  291   NPNDDRFLRDTVLSFMLAGRDTTGSALTWFFWLLCKNEEAITKILQEINKNISPRTKTDD  350

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +  F  +ELK LVYLH A+CE+LRLYPPVPFQHKSP +TD+LPSGHKV   ++++F LY+
Sbjct  351   YGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDAGSKILFCLYS  410

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+DA EFKPERWI  E G   HEPSYKFL+FNAGPRTCLGKEVA  QMK VA
Sbjct  411   LGRMKSVWGEDALEFKPERWIT-ENGTSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVA  469

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               II NY+++ V+ H   P  SIIL+MKHGLKV V +R
Sbjct  470   VKIIQNYNIKVVEGHKVEPAPSIILHMKHGLKVTVSKR  507



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/525 (51%), Positives = 359/525 (68%), Gaps = 25/525 (5%)
 Frame = -2

Query  1833  MASIDYFEIF--------VAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDR  1681
             MASIDY  I         +      IW    +G    P   P+ GM+P L  H  ++HDR
Sbjct  1     MASIDYSAIIPLTFIISFLFIIFSRIWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDR  60

Query  1680  CAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDG  1501
              A VL      F  KG WF++ D L+T DP+NV++I+S +FE +PKG +F  IFD+LGDG
Sbjct  61    IAEVLIESSQNFFFKGVWFSSTDFLLTADPSNVNHILSVHFERYPKGPDFNYIFDILGDG  120

Query  1500  IFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQD  1321
             IFNSD D+WKNQRK A +L+ H+ FH++L + +  KV++GL+PVL+ +A E G V+DLQD
Sbjct  121   IFNSDSDVWKNQRKTALSLVGHESFHKFLEKITLKKVKEGLVPVLQ-SACENGSVLDLQD  179

Query  1320  VFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLG  1141
             +FQRF+FD+TC  VTG+D   LS++FP VPFS+A+D+AEEV+ IRH+ P+ LW  ++   
Sbjct  180   LFQRFSFDSTCLFVTGFDFHSLSLEFPQVPFSRAVDEAEEVILIRHVFPKMLWDFEEKFQ  239

Query  1140  IGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDG  961
             IG  KK+ +A +I+DQVI + I  KR+ L    K +       ++ G DL+TSY+ +   
Sbjct  240   IGQAKKMKQAWKIIDQVIAELIASKRESLKKNLKEK-------EDEGADLITSYMKDYKE  292

Query  960   ETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG  781
                     DDK LRDT+LN M+AGRDT S+AL+WF + +S +P V + IR+EL T V + 
Sbjct  293   N-------DDKVLRDTVLNFMVAGRDTLSAALSWFFFCLSKNPIVVEKIREELRTTVPTN  345

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
             E   ++R+F  EE+  LVY H +LCESLRLYPPVP  HK  +Q DILPSGH + P T+++
Sbjct  346   EACDQWRIFSIEEVDKLVYFHGSLCESLRLYPPVPVNHKVAVQPDILPSGHHIKPKTKIV  405

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
             FSLYA+GRM  +WGKD  EFKPERWI+ E G +KH PSYKFL+FNAGPRTCLGK+VAFT+
Sbjct  406   FSLYALGRMSDVWGKDCLEFKPERWIS-ENGKIKHFPSYKFLSFNAGPRTCLGKQVAFTE  464

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             +K VAAAIIHNY++     H   P  S++L+MKHG KV+V +RWT
Sbjct  465   LKIVAAAIIHNYNIIQQTGHQVIPKTSVVLHMKHGFKVKVTKRWT  509



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/528 (51%), Positives = 364/528 (69%), Gaps = 26/528 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MA I  FEI +AFFC  ++   +I++  +R  P   P  GM+P L + + +++D    +L
Sbjct  1     MALISLFEISIAFFCFFLFRYFLIIKKPHRLCPTNWPFLGMIPGLLVEIHRVYDFVTDIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   T+   GP F  LD+L+TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EVTNLTYPCIGPCFAGLDMLVTVDPANIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWK+ RK A++++++  F R+ + TS +K+EKGL+P+L+  A E+  VVDL+DVF RF
Sbjct  121   SELWKDLRKSAQSMMMNPEFQRFSLATSLSKLEKGLVPLLDHVANEK-LVVDLEDVFSRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTTC L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE LWK+Q  +G+G EK
Sbjct  180   TFDTTCVLATGYDPGCLSVEMPEIEFARALDDAEEAIFFRHIKPEILWKMQSLIGLGDEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A    D+V  KYI  KR E+     N        D    DLLTSY+N +  +  + 
Sbjct  240   KMTKARATFDRVCSKYIASKRDEISRGISNV-------DSPSQDLLTSYMNLDTTKYRLL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLT----------  796
                D++FLRDTIL  M+AGRDTT SALTWF+WL+  + +    IR E+            
Sbjct  293   NPSDERFLRDTILTFMLAGRDTTGSALTWFLWLLCKNQDAIAKIRQEINANLFAETKTEH  352

Query  795   AVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSP  616
             A NS E    F     +ELK LV+LH A+CE+LRLYPPVPFQHKSP +TD+LPSGHKV  
Sbjct  353   ASNSDEVSDSFN---PQELKKLVFLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDA  409

Query  615   DTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKE  436
             +++++F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKE
Sbjct  410   NSKILFCLYSLGRMKSVWGEDALEFKPERWIS-ESGKPVHEPSYKFLSFNAGPRTCLGKE  468

Query  435   VAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             VA  QMK+VA  II NY ++ V+     P  S+IL+MKHG KV V +R
Sbjct  469   VALMQMKSVAVKIIQNYEMKIVEGQTIEPAPSVILHMKHGFKVTVSKR  516



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/521 (52%), Positives = 355/521 (68%), Gaps = 13/521 (2%)
 Frame = -2

Query  1851  SIITCAMASIDYFEIFVAFFCLVIWIILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCA  1675
             ++IT   ASI YF  F   F    ++I +  +R  L   P+ GMLP L + + +I+D   
Sbjct  2     ALITLLEASI-YFLFFS--FIFGYFLISKKPHRSFLTDWPILGMLPGLLVEIPRIYDYLT  58

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              +L     T+  KGP F  LD+L+TVDPAN+HYIMS NF N+PKG EF+K+FDVLGDGIF
Sbjct  59    ELLEASNLTYPFKGPCFGGLDMLVTVDPANIHYIMSSNFANYPKGSEFRKLFDVLGDGIF  118

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             N+D +LWK+ RK A  ++ H  F R+ VRTS +K+EKGL+P+L+  A E+  VVDLQDVF
Sbjct  119   NADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKGLVPLLDCVA-EKKLVVDLQDVF  177

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRFTFD +  L TG DPGCLS + P++ F++A+D+AEE +F RH+ PE +WK+Q+W+G G
Sbjct  178   QRFTFDNSFVLATGVDPGCLSTEMPEIKFARALDEAEEAIFFRHVKPEMVWKMQRWIGFG  237

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
              E K+++A    D+V  K I  KR E+     N        D +  DLL SY+N +  + 
Sbjct  238   DELKMTKAHLTFDRVCSKCIASKRDEITRGVINI-------DSSSKDLLISYMNVDTSKY  290

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
              +    DDKFLRD IL+ M+AGRDTT SALTWF WL+S + EV   IR E+ T ++    
Sbjct  291   KLLNPSDDKFLRDMILSFMLAGRDTTGSALTWFFWLLSKNSEVITKIRQEINTKLSPRTS  350

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
                F  F   EL  LVYLH ALCESLRLYP VPFQHKSP ++D+LPSGHKV   ++++F 
Sbjct  351   GSDFDSFNPHELNKLVYLHGALCESLRLYPSVPFQHKSPTKSDVLPSGHKVDASSKIVFC  410

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LY++GRM+ +WG+DA EFKPERW++ E G + H PS+KFL+FNAGPRTCLGKEVA TQMK
Sbjct  411   LYSLGRMKSVWGEDASEFKPERWVS-ENGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMK  469

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               A  II NY ++ V+ H   P  SIIL+MKHGLKV V +R
Sbjct  470   ITAVKIIQNYDIKVVEGHKIEPVPSIILHMKHGLKVTVTKR  510



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   536 bits (1382),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/481 (53%), Positives = 336/481 (70%), Gaps = 9/481 (2%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P+ GMLP L + + +I+D    +L     T+  KGP    LD+L+T+DPAN+HYIMS NF
Sbjct  38    PIVGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCSGGLDMLVTIDPANIHYIMSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EF+K+FDVLGDGIFN+D +LWK+ RK A  ++ H  F R+ VRTS +K+EKGL
Sbjct  98    ANYPKGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L+  A ++  VVDLQDVFQRFTFD +  L TG DPGCLS + P + F++A+D+AEE 
Sbjct  158   VPLLDCVA-QKKLVVDLQDVFQRFTFDNSFVLATGVDPGCLSTEMPKIEFARALDEAEEA  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+ PE +WK+Q+W+G G E K+++A    D+V  K I  KR E+     N      
Sbjct  217   IFFRHVKPEMVWKMQRWIGFGDELKMTKAHSTFDRVCSKCIASKRDEISRGVIN------  270

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
               D +  DLL SY+N +  +  +    DDKFLRD IL+ M+AGRDTT SALTWF WL+S 
Sbjct  271   -TDSSSKDLLMSYMNVDTSKYKLLNPSDDKFLRDMILSFMLAGRDTTGSALTWFFWLLSK  329

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             +PEV   IR E+ T ++       F  F  +EL  LVYLH ALCESLRLYPPVPFQHKSP
Sbjct  330   NPEVITKIRQEINTKLSPRTSGSDFDSFNPQELNKLVYLHGALCESLRLYPPVPFQHKSP  389

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
              + D+LPSGHKV   ++++F LY++GRM+ +WG+DA EFKPERW++ E G + H PS+KF
Sbjct  390   TKPDVLPSGHKVDASSKIVFCLYSLGRMESVWGEDASEFKPERWVS-ESGRLIHVPSFKF  448

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             L+FNAGPRTCLGKEVA TQMK VA  +I NY +  V+ H   P  SIIL+MKHGLKV V 
Sbjct  449   LSFNAGPRTCLGKEVAMTQMKTVAVKMIQNYEIEVVEGHKIEPVPSIILHMKHGLKVTVT  508

Query  297   R  295
             +
Sbjct  509   K  509



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   535 bits (1378),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/485 (53%), Positives = 344/485 (71%), Gaps = 16/485 (3%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M+P L + + +++D    +L +   T+   GP F NLD+L+TVDPAN+H+IMS NF N+P
Sbjct  1     MIPGLLVEIHRVYDFITEILEVTNLTYPCTGPCFANLDMLVTVDPANIHHIMSSNFANYP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFKK+FD+LGDGIFN+D +LWK+ RK A++++++  F ++ + TS  K+EKGL+P+L
Sbjct  61    KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLKKLEKGLVPLL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +  A E+   VDLQD+FQRFTFDTT  L TGYDPGCLSV+ P+V F++A+DDAEE +F R
Sbjct  121   DHVAKEKLA-VDLQDMFQRFTFDTTFVLATGYDPGCLSVEMPEVEFARALDDAEEAIFFR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H+ PE  W+LQ  LG+G EKK+++A   LD+V  KYI +KR E+     N        D 
Sbjct  180   HVKPEIFWRLQGLLGLGDEKKMTKARSTLDRVCSKYIAIKRDEVSRGTNNV-------DS  232

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +  DLLTSY+N +  +  +    D++FLRDTIL  M+AGRDTT S LTWF WL+  +PEV
Sbjct  233   HSKDLLTSYMNLDTTKYKLLNPSDERFLRDTILTFMLAGRDTTGSGLTWFFWLLIKNPEV  292

Query  825   EKNIRDELLTAV-------NSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQH  667
                IR E+ TA+       +   +      F  +ELK LVYLH A+CESLRLYPPVPFQH
Sbjct  293   IAKIRQEINTALFQRSKVDDDASNNNDSDSFSPQELKKLVYLHGAICESLRLYPPVPFQH  352

Query  666   KSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPS  487
             KSP + D+LPSGHKV  +++++F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPS
Sbjct  353   KSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWIS-ESGNSVHEPS  411

Query  486   YKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKV  307
             YKFL+FNAGPRTCLGKEVA  QMK+VA  II NY ++ V+     P  S+IL+MKHGLKV
Sbjct  412   YKFLSFNAGPRTCLGKEVAMMQMKSVAVKIIQNYEMKIVEGQQIEPAPSVILHMKHGLKV  471

Query  306   RVQRR  292
              V +R
Sbjct  472   TVTKR  476



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   536 bits (1380),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 262/487 (54%), Positives = 345/487 (71%), Gaps = 17/487 (3%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP L + + +++D    +L     T+  KGP F  LD+LITVDPAN+H+IMS NF
Sbjct  38    PFLGMLPGLLVEIPRVYDFVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EFKKIFDVLGDGIFN+D +LWK+ RK A++++ HQ F R+ +RT  +K+EKGL
Sbjct  98    ANYPKGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTIMSKLEKGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L++ A E+  VVDLQDVFQRFTFDT+  L TG DPGCLS + P + F++A+D+AEE 
Sbjct  158   VPLLDYVA-EKKQVVDLQDVFQRFTFDTSFVLATGVDPGCLSTEMPQIEFARALDEAEEA  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+ PE +WK+Q+++G G E K+ +A    D+V  K I  KR E+         +  
Sbjct  217   IFFRHVKPEIVWKMQRFIGFGDELKMKKAHSTFDRVCSKCIASKRDEIT--------NGV  268

Query  1017  IN-DENGFDLLTSYINNNDGETTMGLKF----DDKFLRDTILNLMIAGRDTTSSALTWFI  853
             IN D +  DLL  Y+N +    T   K     DDKFLRD IL+ M+AGRDTTSSALTWF 
Sbjct  269   INIDSSSKDLLMCYMNVDTICHTTKYKLLNPSDDKFLRDMILSFMLAGRDTTSSALTWFF  328

Query  852   WLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPF  673
             WL+S +P+    IR E+ T ++   +   F  F A+EL  LVY+H ALCE+LRLYPPVPF
Sbjct  329   WLLSKNPKAITKIRQEINTQLSPRTN--DFDSFNAQELNKLVYVHGALCEALRLYPPVPF  386

Query  672   QHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHE  493
             QHKSP ++D+LPSGH+V   ++++F LY++GRM+ +WG+DA EFKPERWI+ E G + H 
Sbjct  387   QHKSPTKSDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWIS-ESGRLIHV  445

Query  492   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGL  313
             PS+KFL+FNAGPRTCLGKEVA TQMK VA  II NY ++ V+ H   P  SIIL+MKHGL
Sbjct  446   PSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKVVEGHKIEPVPSIILHMKHGL  505

Query  312   KVRVQRR  292
             KV V +R
Sbjct  506   KVTVTKR  512



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   536 bits (1382),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 271/528 (51%), Positives = 355/528 (67%), Gaps = 16/528 (3%)
 Frame = -2

Query  1854  TSIITCAMASIDYFEIFVAFFCLVIW----IILRDGYRR-PLKVPLFGMLPSLFLHVRKI  1690
             +S +   MA I   EI V+F C   +    +I++  +R  P   P  GMLP L + + ++
Sbjct  12    SSSVFSLMAMISLLEISVSFLCFSYFFGYFLIMKKPHRSFPTNWPFLGMLPGLLVEIPRV  71

Query  1689  HDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVL  1510
             +D     L     TF  KGP F  LD+L TVDPAN+H+IMS NF N+PKG EFKK+FDVL
Sbjct  72    YDYVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVL  131

Query  1509  GDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVD  1330
             GDGIFN+D DLWK+ RK A++++    F R+ +RT+ +K+EKGL+P+L+  A E+  V D
Sbjct  132   GDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMSKLEKGLVPILDHFA-EKKLVFD  190

Query  1329  LQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQ  1150
             LQDVFQRFTFDTT  L TG DPGCLS++ P++ F++A+D+AEE +F RH  PE +WK+Q+
Sbjct  191   LQDVFQRFTFDTTFVLATGIDPGCLSIEMPEIEFARALDEAEEAIFFRHFKPEIVWKMQR  250

Query  1149  WLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN  970
              LG G E K+  A    D+V  K I  KR E+     +        D +  DLL SY++ 
Sbjct  251   LLGFGVELKMRIAHSTFDRVCSKCIASKRDEIARGVTSI-------DSSSKDLLMSYMDV  303

Query  969   NDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV  790
             +  +  +    DDKFLRD IL+ M+AGRDTT SALTWF WL+S +PEV   IR E+ T +
Sbjct  304   DTTKYKLLNPGDDKFLRDMILSFMLAGRDTTGSALTWFFWLLSKNPEVTTKIRQEINTKL  363

Query  789   N--SGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSP  616
             +  +  D   F  F  +EL  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGH V  
Sbjct  364   SPRTNNDSDHFSSFNPQELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHIVDV  423

Query  615   DTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKE  436
              T+++F LY++GRM+ +WG+DA EFKPERWI+ E G + H PS+KFL+FNAGPRTCLGKE
Sbjct  424   STKIVFCLYSLGRMKSVWGEDASEFKPERWIS-ETGRLIHVPSFKFLSFNAGPRTCLGKE  482

Query  435   VAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             VA TQMK VA  II NY V+ V+ H   P  SIIL+MK GL+V V +R
Sbjct  483   VAMTQMKTVAVKIIQNYEVKIVEGHKIEPVPSIILHMKQGLRVMVTKR  530



>ref|XP_010911437.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis]
Length=523

 Score =   536 bits (1381),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 275/518 (53%), Positives = 358/518 (69%), Gaps = 22/518 (4%)
 Frame = -2

Query  1818  YFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGT  1648
             Y EI ++  C   +      + G   P+  P  GM P+L  H+  +HD    VL   G T
Sbjct  16    YPEILISVTCFFFFYCYQKTKKGPGIPVNWPFVGMFPALLAHLHHLHDWGTMVLKESGCT  75

Query  1647  FLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKN  1468
             F  +GPWF+ +D+L T DPANVH++ + NF N+PKG +F +IFD+LGDGIFNSD + W++
Sbjct  76    FFFRGPWFSGMDMLFTCDPANVHHVFNANFLNYPKGDDFSEIFDILGDGIFNSDAESWRS  135

Query  1467  QRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTC  1288
             QR  A +LI  QRF  ++ ++S NKVEKG+IP+L+  A +   V DLQDVF R TFD TC
Sbjct  136   QRMKAHSLISDQRFRSFVSQSSRNKVEKGVIPLLDQLAKQEVAV-DLQDVFLRLTFDATC  194

Query  1287  TLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRAC  1108
              LV G DPGCLS+ FP VPF+KAMDDA   L  RH +P + WKLQ+W  IG EKKL+ A 
Sbjct  195   YLVFGVDPGCLSIGFPTVPFAKAMDDATAALLFRHTVPPAWWKLQRWFRIGEEKKLALAW  254

Query  1107  EILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDG------ETTMG  946
             E++DQ I + I  K++E     +N++  ++   E   DLL+SYI+N D       E  M 
Sbjct  255   EVIDQFIAQRIAEKKEE-----RNKSRSHE---EAPRDLLSSYIDNCDDLHVVDVENPME  306

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
             L   +KFLRDT +N MIAGRDTT +ALTWF WL+S +P VE  I +EL +          
Sbjct  307   L---NKFLRDTAMNFMIAGRDTTGAALTWFFWLLSKNPRVELKILEELKSLRKERSCSDG  363

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
               LF AEELK LVYLHAALCESLRLYPPVPF+HK  LQ++ LPSGHK  P T+++F LY+
Sbjct  364   MTLFDAEELKGLVYLHAALCESLRLYPPVPFEHKGVLQSEALPSGHKAQPGTKILFVLYS  423

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ +WGKD  EFKPERWI+ E+G ++HEPSYKFL+FN+GPRTCLGK++AFTQMKAVA
Sbjct  424   MGRMEGVWGKDCLEFKPERWIS-EKGKLRHEPSYKFLSFNSGPRTCLGKDMAFTQMKAVA  482

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA++ N+HV  V+ H   P +SIIL+MK+GL VR+++R
Sbjct  483   AAMVCNFHVDVVEGHVVEPKLSIILHMKNGLMVRIRKR  520



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   535 bits (1378),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 265/525 (50%), Positives = 358/525 (68%), Gaps = 25/525 (5%)
 Frame = -2

Query  1833  MASIDYFEIF--------VAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDR  1681
             MASIDY  I         +      IW    +G    P   P+ GM+P L  H  ++HDR
Sbjct  1     MASIDYSAIIPLTFIISFLFIIFSRIWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDR  60

Query  1680  CAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDG  1501
              A VL      F  KG WF++ D L+T DP+NV++I+S +FE +PKG +F  IFD+LGDG
Sbjct  61    IAEVLIESSQNFFFKGVWFSSTDFLLTADPSNVNHILSVHFERYPKGPDFNYIFDILGDG  120

Query  1500  IFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQD  1321
             IFNSD D+WKNQRK A +L+ H+ FH++L + +  KV++GL+PVL+ +A E G V+DLQD
Sbjct  121   IFNSDSDVWKNQRKTALSLVGHESFHKFLEKITLKKVKEGLVPVLQ-SACENGSVLDLQD  179

Query  1320  VFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLG  1141
             +FQRF+FD+TC  VTG+D   LS++FP VPFS+A+D+AEEV+ IRH+ P+ LW  ++   
Sbjct  180   LFQRFSFDSTCLFVTGFDFHSLSLEFPQVPFSRAVDEAEEVILIRHVFPKMLWDFEEKFQ  239

Query  1140  IGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDG  961
             IG  KK+ +A +I+DQVI + I  KR+ L    K +       ++ G DL+TSY+ +   
Sbjct  240   IGQAKKMKQAWKIIDQVIAELIASKRESLKKNLKEK-------EDEGADLITSYMKDYKE  292

Query  960   ETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG  781
                     DDK LRDT+LN M+AGRDT S+AL+WF + +S +P V + IR+EL T V + 
Sbjct  293   N-------DDKVLRDTVLNFMVAGRDTLSAALSWFFFCLSKNPIVVEKIREELRTTVPTN  345

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
             E   ++R+F  EE+  LVY H +LCESLRLYPPVP  HK  +Q DILPSGH + P T+++
Sbjct  346   EACDQWRIFSIEEVDKLVYFHGSLCESLRLYPPVPVNHKVAVQPDILPSGHHIKPKTKIL  405

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
              S+YA+GRM  +WGKD  EFKPERWI+ E G +KH PSYKFL+FNAGPRTCLGK+VAFT+
Sbjct  406   LSIYALGRMSDVWGKDCLEFKPERWIS-ENGKIKHFPSYKFLSFNAGPRTCLGKQVAFTE  464

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             +K VAAAIIHNY++     H   P  S++L+MKHG KV+V +RWT
Sbjct  465   LKIVAAAIIHNYNIIQQTGHQVIPKTSVVLHMKHGFKVKVTKRWT  509



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   535 bits (1378),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 265/525 (50%), Positives = 358/525 (68%), Gaps = 25/525 (5%)
 Frame = -2

Query  1833  MASIDYFEIF--------VAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDR  1681
             MASIDY  I         +      IW    +G    P   P+ GM+P L  H  ++HDR
Sbjct  1     MASIDYSAIIPLTFIISFLFIIFSRIWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDR  60

Query  1680  CAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDG  1501
              A VL      F  KG WF++ D L+T DP+NV++I+S +FE +PKG +F  IFD+LGDG
Sbjct  61    IAEVLIESSQNFFFKGVWFSSTDFLLTADPSNVNHILSIHFERYPKGPDFNYIFDILGDG  120

Query  1500  IFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQD  1321
             IFNSD D+WKNQRK A +L+ H+ FH++L + +  KV++GL+PVL+ +A E G V+DLQD
Sbjct  121   IFNSDSDVWKNQRKTALSLVGHESFHKFLEKITLKKVKEGLVPVLQ-SACENGSVLDLQD  179

Query  1320  VFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLG  1141
             +FQRF+FD+TC  VTG+D   LS++FP VPFS+A+D+AEEV+ IRH+ P+ LW  ++   
Sbjct  180   LFQRFSFDSTCLFVTGFDFHSLSLEFPQVPFSRAVDEAEEVILIRHVFPKMLWDFEEKFQ  239

Query  1140  IGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDG  961
             IG  KK+ +A +I+DQVI + I  KR+ L    K +       ++ G DL+TSY+ +   
Sbjct  240   IGQAKKMKQAWKIIDQVIAELIASKRESLKKNLKEK-------EDEGADLITSYMKDYKE  292

Query  960   ETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG  781
                     DDK LRDT+LN M+AGRDT S+AL+WF + +S +P V + IR+EL T V + 
Sbjct  293   N-------DDKVLRDTVLNFMVAGRDTLSAALSWFFFCLSKNPIVVEKIREELRTTVPTN  345

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
             E   ++R+F  EE+  LVY H +LCESLRLYPPVP  HK  +Q DILPSGH + P T+++
Sbjct  346   EACDQWRIFSIEEVDKLVYFHGSLCESLRLYPPVPVNHKVAVQPDILPSGHHIKPKTKIL  405

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
              S+YA+GRM  +WGKD  EFKPERWI+ E G +KH PSYKFL+FNAGPRTCLGK+VAFT+
Sbjct  406   LSIYALGRMSDVWGKDCLEFKPERWIS-ENGKIKHFPSYKFLSFNAGPRTCLGKQVAFTE  464

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             +K VAAAIIHNY++     H   P  S++L+MKHG KV+V +RWT
Sbjct  465   LKIVAAAIIHNYNIIQQTGHQVIPKTSVVLHMKHGFKVKVTKRWT  509



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score =   535 bits (1378),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 270/523 (52%), Positives = 356/523 (68%), Gaps = 22/523 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPS---------LFLHVRKIHDR  1681
             MA I   E+ V+FF    +I    GY    K P    L +         L + + +++D 
Sbjct  1     MALITLLEVSVSFF----FISFLFGYFLISKKPHPSFLTNWPLLGMLPGLLVEIPRVYDY  56

Query  1680  CAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDG  1501
                +L     T+ LKGP F  LD+L+T+DPAN+HYIMS NFEN+PKG EFKKIFDVLGDG
Sbjct  57    VTELLEASNLTYPLKGPCFGGLDMLVTIDPANIHYIMSSNFENYPKGSEFKKIFDVLGDG  116

Query  1500  IFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQD  1321
             IFN+D +LWK+ RK  ++++ H  F R+ +RTS +K+EKGL+P+L++ A E+  V+DLQD
Sbjct  117   IFNADSELWKDLRKSTQSMMSHHDFQRFTLRTSMSKLEKGLVPLLDYVA-EKKLVIDLQD  175

Query  1320  VFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLG  1141
             VFQRFTFDT+  L TG DPGCLS+D PD+ F++A+++AEE +F RH+ PE +WK+Q+W+G
Sbjct  176   VFQRFTFDTSFVLATGVDPGCLSIDLPDIEFARALNEAEEAIFFRHVKPEMVWKMQRWIG  235

Query  1140  IGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDG  961
             IG E K+ +A    D+V  K I  KR E+     N        D +  DLL SYIN +  
Sbjct  236   IGDELKMKKAHSTFDRVCSKCIASKRDEITRGVINI-------DSSSKDLLMSYINVDTT  288

Query  960   ETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSG  781
             +  +    D+KFLRD IL+ M+AGRDTT SALTWF WL+S +P+    IR E+ T +   
Sbjct  289   KYKLLNPSDEKFLRDMILSFMLAGRDTTGSALTWFFWLLSKNPKAIIKIRQEINTKLTPR  348

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
              +  KF  F  +EL  LVYLH AL ESLRLYPPVPFQHKSP + D+LPSGHKV   ++++
Sbjct  349   TNGSKFDSFNPQELNKLVYLHGALYESLRLYPPVPFQHKSPTKPDVLPSGHKVDASSKIV  408

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
             F LY++GRM+ +WG+DA EFKPERW++ E G + H PS+KFL+FNAGPRTCLGKEVA TQ
Sbjct  409   FCLYSLGRMKSVWGEDASEFKPERWVS-ESGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQ  467

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             MK VA  II NY ++ V+ H   P  SIIL+MKHGLKV V +R
Sbjct  468   MKTVAVKIIQNYEIKVVEGHKVEPVPSIILHMKHGLKVTVTKR  510



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   534 bits (1376),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 259/521 (50%), Positives = 361/521 (69%), Gaps = 20/521 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA +   EI +AFFC +I++I +  +R  P   P  GMLP L + + +++D     L   
Sbjct  1     MAMLSLLEISIAFFCFLIFLISKKRHRSFPTNWPFLGMLPGLLVEIPRVYDFVTEFLEDA  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
                FL KGP++  LD+L+TVDPAN+H+IMS NF N+PKG EFKK+FD+LGDGIFN+D +L
Sbjct  61    NLNFLFKGPFWGGLDMLVTVDPANIHHIMSSNFANYPKGTEFKKLFDILGDGIFNADSEL  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W + RK A++++++ +F ++ + TS +K+EKGL+P+L+  A E+  VVDL+DVFQRFTFD
Sbjct  121   WNDLRKSAQSMMMNPKFQKFSLATSLSKLEKGLLPLLDHVAKEK-LVVDLEDVFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TTC L TGYDPGCLSV+ P++ F++A+DDAEE +F RH++PE +WK+Q+ +G G E KL 
Sbjct  180   TTCVLATGYDPGCLSVEMPEIEFARALDDAEEAIFFRHVMPELVWKMQRLVGFGDELKLK  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             RA   +D+V   YI  +R  +     + +P          DLLTSY+N +  +  +    
Sbjct  240   RARATVDRVCSTYIASRRDMVSREIDSSSPTQ--------DLLTSYMNLDTTKYKLLNPS  291

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL------LTAVNSGED  775
             DD+FLRDTIL  M+AGRD  SSALTWF WL+  + +V   IR E+      +T  +  +D
Sbjct  292   DDRFLRDTILTFMLAGRDPISSALTWFFWLLYKNQDVIAKIRQEINTNLFQITKTDVSDD  351

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +    F  +ELK LVYLH A+ E LRLYPP+PF HKSP ++++LPSGHKV  +++++  
Sbjct  352   SES---FNPQELKKLVYLHGAIYEVLRLYPPLPFNHKSPTKSEVLPSGHKVDANSKIVLC  408

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LY++GRM+ +WG+DA EFKPERWI+ E G + HEPSYKFL+FNAGPRTCLGKE+A  Q+K
Sbjct  409   LYSLGRMKSVWGEDAFEFKPERWIS-ETGKLIHEPSYKFLSFNAGPRTCLGKELAMMQIK  467

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              VA  II NY ++ V+     P  S+IL+MKHGLKV V +R
Sbjct  468   TVAVKIIQNYEIKVVEGQKIEPAPSVILHMKHGLKVTVSKR  508



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   531 bits (1368),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 255/477 (53%), Positives = 337/477 (71%), Gaps = 9/477 (2%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP   + + +++D    +L     T+L KGP F NLD+L TVDPAN+H+IMS NF N+P
Sbjct  1     MLPGFLMEISRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSNFANYP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFKK+FDVLGDGIFN+D  LWK+ R+ A++++ +  + R+ +RTS +K+EKGL+P L
Sbjct  61    KGSEFKKLFDVLGDGIFNADSKLWKDLRQSAQSIMSNPEYQRFTLRTSMSKLEKGLVPFL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
                A E+  VVDLQD+FQRFTFDTT  L TG DPGCLS + P++ F++A+D+AEE +F R
Sbjct  121   NHVA-EKKLVVDLQDLFQRFTFDTTFVLTTGIDPGCLSTEMPEIEFARALDEAEEAIFFR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H  PE +WK+Q+ +G+G E K+++A    D+V  K I  KR E+     N        D 
Sbjct  180   HFKPEIVWKMQRLIGLGHELKMTKAHSTFDRVCSKCIASKRDEISRGVIN-------TDS  232

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +  DLL SY+N +  +  +    D+KFLRD IL+ M+AGRDTT SALTWF WL+S +P+V
Sbjct  233   SSKDLLMSYMNVDTSKYKLLNPSDEKFLRDMILSFMLAGRDTTCSALTWFFWLLSKNPQV  292

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
                IR E+ T ++ G     F  F  +EL  LVYLH ALCESLRLYPPVPFQHKSP + D
Sbjct  293   ITKIRQEINTKLSLGTKGCDFDSFNRQELNKLVYLHGALCESLRLYPPVPFQHKSPTKPD  352

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV   ++++F LY++GRM+ +WG+DA EFKPERW++ E G + H PS+KFL+FN
Sbjct  353   VLPSGHKVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWVS-ESGRLTHVPSFKFLSFN  411

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             AGPRTCLGKEVA TQMK VA  II NY ++ V+ H   P  SIIL+MKHGLKVRV +
Sbjct  412   AGPRTCLGKEVAMTQMKTVAVKIIQNYDIKVVEGHKIEPVPSIILHMKHGLKVRVTK  468



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   531 bits (1369),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 270/513 (53%), Positives = 350/513 (68%), Gaps = 28/513 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             M  + +  +F++FF  + W I R+    P   PL GML  L  +V +IHD  + +L    
Sbjct  1     MEYLKFSLVFLSFF--LFWNIFRNKSGTPTNWPLVGMLLPLLRNVNRIHDWVSEILETSQ  58

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              +FL KGPWFTN+++L+TVDPAN+H+IM+ NF N+PKG +F +IFDV+GDGIFN D DLW
Sbjct  59    LSFLFKGPWFTNMEMLVTVDPANIHHIMTKNFSNYPKGTKFNEIFDVMGDGIFNVDFDLW  118

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K  R +A   I H RF  +LV     KVEKGLIPVL+ AA ER  VVDLQD+F RFTFD 
Sbjct  119   KYHRSMAHTFIAHPRFRHFLVVKIQEKVEKGLIPVLDHAANER-LVVDLQDIFARFTFDN  177

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
              CTLV G+D G LS+D+P VPFSKA+DD EEV+  RH++P S+WK+ +WL IG E+K  R
Sbjct  178   ICTLVMGHDVGSLSIDWPHVPFSKALDDVEEVILYRHVVPMSVWKILRWLRIGKERKYKR  237

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A EILD+ I K I  KR EL             N+  G DLLT Y++ +           
Sbjct  238   AWEILDEFIYKCIAKKRAEL-----------GKNEGVGVDLLTLYMDKSQNVNVKDA--S  284

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             DKFLRDTIL+  IAGRDTTS AL+WF +L+  +P V   IRDEL           + ++ 
Sbjct  285   DKFLRDTILSYFIAGRDTTSLALSWFFYLLIKNPRVVSKIRDEL-----------EKKMT  333

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             K ++  NLVYLH ALCE+LRLYPPV FQ K P + D LPSGH+V+P+ +++FS+YAM RM
Sbjct  334   KIDDFNNLVYLHGALCEALRLYPPVVFQAKGPTKPDTLPSGHEVNPNMQIIFSMYAMARM  393

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + IWG D  EFKPERWI+ E G ++HEPSYK+L FNAGPRTCLGK++AFTQMK VAA I+
Sbjct  394   KSIWGNDCYEFKPERWIS-ESGKIRHEPSYKYLVFNAGPRTCLGKDMAFTQMKVVAATIV  452

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
              NY  +A++ H   P++SI+L +K+GLKV+V +
Sbjct  453   KNYEFQALEGHLVVPDISIMLRVKYGLKVQVSK  485



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   532 bits (1371),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 257/483 (53%), Positives = 342/483 (71%), Gaps = 11/483 (2%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP L + + +++D    +L     T+  KGP F  LD+LITVDPAN+H+IMS NF
Sbjct  38    PFLGMLPGLLVEIPRVYDYVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EFKKIFDVLGDGIFN+D +LWK+ RK A++++ HQ F R+ +RTS +K+EKGL
Sbjct  98    ANYPKGSEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTSMSKLEKGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L++ A E+  VVDLQDVFQRFTFDT+  L TG DPGCL+ + P + F++A+D+AE  
Sbjct  158   VPLLDYVA-EKKLVVDLQDVFQRFTFDTSFILATGVDPGCLATEMPQIEFARALDEAEAA  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+ PE +WK+Q+++G G E K+ +A    D+V  K I  KR E+         +  
Sbjct  217   IFFRHVKPEMVWKMQRFIGFGDEMKMRKAHSTFDRVCSKCIASKRDEIT--------NGV  268

Query  1017  IN-DENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVS  841
             IN D +  DLL SY++ +  +  +    DDKFLRD IL+ MIAGRDTT SALTWF WL+S
Sbjct  269   INIDSSSKDLLMSYMSVDTTKYKLLNPSDDKFLRDMILSFMIAGRDTTGSALTWFFWLLS  328

Query  840   THPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKS  661
              +P+    IR E+ T ++   +      F ++EL  LVYLH ALCE+LRLYPPVPFQHKS
Sbjct  329   KNPKAITKIRQEINTKLSPRTNDFDSDSFSSQELNKLVYLHGALCEALRLYPPVPFQHKS  388

Query  660   PLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYK  481
             P + D+LPSGH+V   ++++F LY++GRM+ +WG+DA EFKPERWI+ E G + H PS+K
Sbjct  389   PTKPDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWIS-ESGRLIHMPSFK  447

Query  480   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRV  301
             FL+FNAGPRTCLGKEVA TQ+K VA  II NY ++ V  H   P  SIIL+MKHGLKV V
Sbjct  448   FLSFNAGPRTCLGKEVAMTQLKTVAVKIIQNYEIKIVDGHKIEPVPSIILHMKHGLKVTV  507

Query  300   QRR  292
              +R
Sbjct  508   TKR  510



>ref|XP_004151191.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=481

 Score =   531 bits (1367),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 266/523 (51%), Positives = 349/523 (67%), Gaps = 50/523 (10%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFC-LVIWIILRDGYR------RPLKVPLFGMLPSLFLHVRKIHDRCA  1675
             MASID+  I  AF    +++IIL   +R       P   P+ GM P++  H+ + HDR  
Sbjct  1     MASIDFSSILFAFIIPFLVFIILSRIWRWDFHGIIPWNWPIVGMTPTVIAHIHRPHDRVT  60

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              VL     TF  KG WF+ +D L TVDP+N+H+I+S NFE +PKG +FK IF+VLGDGIF
Sbjct  61    EVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHILSANFERYPKGPDFKYIFEVLGDGIF  120

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             NSD D+WKNQRK A  L+ H  F ++L + + NKV+ GL+P+L+ +  E G V+DLQD+F
Sbjct  121   NSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKVKTGLVPILD-SVCENGSVLDLQDLF  179

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRF+FD+TC +VTG+D   LS++FP+VPFSKAMDDAEEV+F+RH  P+++W+ Q+ L IG
Sbjct  180   QRFSFDSTCMMVTGFDLNSLSLEFPEVPFSKAMDDAEEVIFVRHFFPKTIWEFQKKLQIG  239

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
               K+L +A EI+D+ I K I  KR+ L    KN+  + D N + G DL+TSYI N     
Sbjct  240   QPKRLKQAWEIIDETIAKLIASKRKSL----KNEMKEEDDNGKEGVDLITSYITN-----  290

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                ++ DD+FLRDT+LN MIAGRDT SSAL+WF + +S HP V + IR+EL T + + E 
Sbjct  291   ---IENDDEFLRDTVLNFMIAGRDTLSSALSWFFFCLSNHPTVVEKIREELRTTIPTNEA  347

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
               + R+F  EE+ NLVY H  LCE+LRLYPP                             
Sbjct  348   YDQRRIFSIEEVDNLVYFHGTLCEALRLYPP-----------------------------  378

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
              YA+GRM  +WGKD  EFKPERWIN E G +KH PSYKFLAFNAGPRTCLGK VAFT++K
Sbjct  379   -YALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFTELK  437

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              VAAAIIHNY++     H+  P+ SIIL+MKHG KV+V +RW+
Sbjct  438   IVAAAIIHNYNIIQQAGHEVVPSASIILHMKHGFKVKVTKRWS  480



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score =   530 bits (1364),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 266/521 (51%), Positives = 349/521 (67%), Gaps = 16/521 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW----IILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   EI V+F C   +    +I++  +R  P   P  GMLP L + + +++D     
Sbjct  1     MAMISLLEITVSFLCFSFFFGYFLIMKKPHRSFPTNWPFLGMLPGLLVEIPRVYDYVTEF  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TF  KGP F  LD+L TVDPAN+H+IMS NF N+PKG EFKK+F VLGDGIFN+
Sbjct  61    LEASNLTFPFKGPCFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFSVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLWK+ RK A++++    F R+ +RT+ +K+EKGL+P+L+  A E+  V DLQDVFQ 
Sbjct  121   DSDLWKDLRKSAQSMMSRPEFQRFTLRTNMSKLEKGLVPILDHFA-EKKLVFDLQDVFQS  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG DPGCLS++ P + F+KA+D+AEE +F RH  PE +WK+Q+ LG G E
Sbjct  180   FTFDTTFVLATGIDPGCLSIEMPKIEFAKALDEAEEAIFFRHFKPEIVWKMQRLLGFGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+SRA    D+V  + I  KR E+     + +  +        DLL SY++ +  +  +
Sbjct  240   LKMSRAHSTFDRVCSECIASKRDEITRGVTSIHSSSK-------DLLMSYMDVDTTKYKL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNS--GED  775
                 DDKFLRD IL+ M+AGRDTT SALTWF WL+S +PEV   IR E+ T ++     D
Sbjct  293   LNPGDDKFLRDMILSFMLAGRDTTGSALTWFFWLLSKNPEVTTKIRQEINTKLSPRINND  352

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
                F  F  ++L  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGH+V   T+++F 
Sbjct  353   SDHFSSFNPQDLNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHRVDASTKIVFC  412

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LY++GRM+ +WG+DA EFKPERWI+ E G + H PS+KFL+FNAGPRTCL KEVA TQMK
Sbjct  413   LYSLGRMKSLWGEDASEFKPERWIS-ETGRLIHVPSFKFLSFNAGPRTCLRKEVAMTQMK  471

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              VA  +I NY +  V+ H   P  SIIL+MK GLKV V +R
Sbjct  472   TVAVKVIQNYEIEIVEGHKIEPVPSIILHMKQGLKVMVTKR  512



>emb|CDY27160.1| BnaA08g07980D [Brassica napus]
Length=513

 Score =   529 bits (1363),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 266/519 (51%), Positives = 350/519 (67%), Gaps = 15/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWI----ILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   EI V+F C   +     I++  +R  P   P  GMLP L + + +++D     
Sbjct  1     MAMISLLEITVSFLCFSFFFGYFFIMKKPHRSFPTNWPFLGMLPGLLVEIPRVYDYITEF  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TFL KGP F  +++L TVDPAN+H+IMS NF N+PKG EFKKIFDVLGDGIFN+
Sbjct  61    LEASNLTFLFKGPCFVGVNMLFTVDPANIHHIMSSNFTNYPKGSEFKKIFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLW + RK A++++    F R+ +RT+  K+EKGL+P+L+  A E+  V+DLQDVFQR
Sbjct  121   DFDLWMDLRKSAQSMMSRPEFQRFTLRTNMRKLEKGLVPILDHFA-EKKLVLDLQDVFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG DPGCLS++ P++ F++A+D+A EV+F RH+ PE + K+Q+ LG G E
Sbjct  180   FTFDTTFVLATGIDPGCLSIEMPEIEFARALDEAMEVIFFRHIKPEIVCKIQRLLGFGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+  A   LD++  K I  KR E+     +        D +  DLL SY++ +  +   
Sbjct  240   LKMKIAHSTLDRICSKCIASKRDEITRGVTSI-------DSSSKDLLMSYMDVDTTKYKS  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DDKFLRD IL+ MIAGRDTT SALTWF WL++ +PEV   IR E+ T ++   +  
Sbjct  293   LNPDDDKFLRDMILSFMIAGRDTTGSALTWFFWLLTKNPEVTTKIRQEINTKISPRTNND  352

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 F ++EL  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGHKV P T+++F LY
Sbjct  353   SDH-FSSQELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHKVEPSTKIVFCLY  411

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             ++GRM+ +WG+DA +FKPERW N E G+  H PS+KFL+FNAGPRTCLGKEVA TQMK V
Sbjct  412   SLGRMKSVWGEDASDFKPERW-NSETGSSIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTV  470

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY ++ V+ H   P  S+IL MK GLKV V +R
Sbjct  471   AVKIIQNYEIKIVEGHTIEPVPSVILRMKQGLKVMVTKR  509



>ref|XP_009108130.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=513

 Score =   528 bits (1361),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 266/519 (51%), Positives = 351/519 (68%), Gaps = 15/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWI----ILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   EI V+F C   +     I++  +R  P   P  GMLP L + + +++D     
Sbjct  1     MAMISLLEITVSFLCFSFFFGYFFIMKKPHRSFPTNWPFLGMLPGLLVEIPRVYDYITEF  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TFL KGP F  +++L TVDPAN+H+IMS NF N+PKG EFKKIFDVLGDGIFN+
Sbjct  61    LEASNLTFLFKGPCFVGVNMLFTVDPANIHHIMSSNFTNYPKGSEFKKIFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLW + RK A++++    F R+ +RT+  K+EKGL+P+L+  A E+  V+DLQDVFQR
Sbjct  121   DFDLWMDLRKSAQSMMSRPEFQRFTLRTNMRKLEKGLVPILDHFA-EKKLVLDLQDVFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG DPGCLS++ P++ F++A+D+A EV+F RH+ PE + K+Q+ LG G E
Sbjct  180   FTFDTTFVLATGVDPGCLSIEMPEIEFARALDEAMEVIFFRHIKPEIVCKIQRLLGFGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+  A   LD++  K I  KR E+     +        D +  DLLTSY++ +  +   
Sbjct  240   LKMKIAHSTLDRICSKCIASKRDEITRGVTSI-------DSSSKDLLTSYMDVDTTKYKS  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DDKFLRD IL+ MIAGRDTT SALTWF WL++ +PEV   IR E+ T ++   +  
Sbjct  293   LNPGDDKFLRDMILSFMIAGRDTTGSALTWFFWLLTKNPEVTTKIRQEINTKISPRTNND  352

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 F ++EL  LVYLH ALCE+LRLYPPVPFQHKSP + D+LPSGHKV+P T+++F LY
Sbjct  353   SDH-FSSQELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHKVAPITKILFCLY  411

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             ++GRM+  WG+DA  FKPERWI+ E G+  H PS+KFL+FNAGPRTCLGKEVA TQMK V
Sbjct  412   SLGRMKSAWGEDASGFKPERWIS-ETGSSIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTV  470

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY ++ ++ H   P  S+IL MK GLKV V +R
Sbjct  471   AVKIIQNYEIKIIEGHTIEPVPSVILRMKQGLKVMVTKR  509



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   528 bits (1360),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 260/487 (53%), Positives = 342/487 (70%), Gaps = 14/487 (3%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP L   + +++D    VL      +L KGP+   +D+L TVDPAN+H+IMS NF
Sbjct  38    PFLGMLPGLLTQLPRVYDFLTEVLEDANLNYLFKGPFLGGIDMLFTVDPANIHHIMSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EFKK+FDVLGDGIFN+D +LWK+ RK +++++ H  F R+ + TS +K+EKGL
Sbjct  98    ANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQRFTLDTSLSKLEKGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L+  A E+  VVDLQDVFQRFTFDTT  L TGYDPGCLSV+ P++ F++A+DDAEE 
Sbjct  158   VPLLDHVAKEK-LVVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMPEIEFARALDDAEEA  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+ PE +WK+Q+ +G+G E KL RA  ILD+V  + I  KR+E+     ++  DN 
Sbjct  217   IFYRHVKPEMVWKMQRLIGVGGELKLKRAHAILDRVCSECIASKREEI-----SRGSDNI  271

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
              +     DLL S I+ +  +  +    DD+FLRDTIL+ M+AGRDTT SALTWF WL+  
Sbjct  272   SSSSK--DLLMSSIHVDTSKYKLLNPSDDRFLRDTILSFMLAGRDTTGSALTWFFWLLCK  329

Query  837   HPEVEKNIRDELLTAVNSGED-----PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPF  673
             + E    IR E+ T +  G             F  +E+K LVYLH A+CESLRLYPPVPF
Sbjct  330   NQEAMAKIRQEINTNLFPGNKIDGSVSYDSDSFNPQEIKKLVYLHGAICESLRLYPPVPF  389

Query  672   QHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHE  493
             QHKSP + D+LPSGHKV   ++++F LY++GRM+ +WG+DA EFKPERWI+ E G   HE
Sbjct  390   QHKSPTKPDVLPSGHKVEAKSKILFCLYSLGRMKSVWGEDALEFKPERWIS-ESGRSIHE  448

Query  492   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGL  313
             PSYKFL+FNAGPRTCLGKEVA TQMK VA  II NY ++ V+ H   P  S+IL+MKHGL
Sbjct  449   PSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIQVVEGHKIEPAPSVILHMKHGL  508

Query  312   KVRVQRR  292
             KV V ++
Sbjct  509   KVTVSKK  515



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   526 bits (1356),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 265/519 (51%), Positives = 349/519 (67%), Gaps = 15/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWI----ILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   EI V F C   +     I++  +R  P   P  GMLP L + + +++D     
Sbjct  1     MAMISLLEITVYFLCFSFFFGYFFIMKKPHRSFPTNWPFLGMLPGLLVEIPRVYDYITEF  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TFL KGP F  +++L TVDPAN+H+IMS NF N+PKG EFKKIFDVLGDGIFN+
Sbjct  61    LEASNLTFLFKGPCFVGVNMLFTVDPANIHHIMSSNFTNYPKGSEFKKIFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLW + RK A+ ++    F R+ +RT+  K+EKGL+P+L+  A ++  V+DLQDVFQR
Sbjct  121   DFDLWMDLRKSAQCMMSRPEFQRFTLRTNMRKLEKGLVPILDHFA-KKKLVLDLQDVFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG DPGCLS++ P++ F++A+D+A EV+F RH+ PE + K+Q+ LG G E
Sbjct  180   FTFDTTLVLATGIDPGCLSIEMPEIEFARALDEAMEVIFFRHIKPEIVCKIQRLLGFGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+  A   LD+V  K I  KR E+     +        D +  DLL SY++ +  +   
Sbjct  240   LKMKIAHSTLDRVCSKCIASKRDEITRGVTSI-------DSSSKDLLMSYMDVDTTKYKS  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DDKFLRD IL+ MIAGRDTT SALTWF WL++ +PEV   IR E+ T ++   +  
Sbjct  293   LNPGDDKFLRDMILSFMIAGRDTTGSALTWFFWLLTKNPEVTTKIRQEINTKISPRTNND  352

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 F ++EL  LVYLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV P T+++F LY
Sbjct  353   SDH-FSSQELNKLVYLHGAMCEALRLYPPVPFQHKSPTKPDVLPSGHKVEPSTKIVFCLY  411

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             ++GRM+ +WG+DA +FKPERWI+ E G+  H PS+KFL+FNAGPRTCLGKEVA TQMK V
Sbjct  412   SLGRMKSVWGEDASDFKPERWIS-ETGSSIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTV  470

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY ++ V+ H   P  S+IL MK GLKV V +R
Sbjct  471   AVKIIQNYEIKIVEGHTIEPVPSVILRMKQGLKVMVTKR  509



>ref|XP_011025646.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=503

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 359/517 (69%), Gaps = 15/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             M  I  FEIF+A      ++ LR+     +  PL GMLP+LFL+V +       +   + 
Sbjct  1     MTFIGIFEIFLAIISYFFFVFLRNRNEFCINWPLVGMLPNLFLNVHRFLPWSTELAERNN  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             G++L++GPWF N+DIL T++PANVH+IMS NF N+ KG EF+K+FD+ GDG+F +D D W
Sbjct  61    GSYLIRGPWFFNMDILATIEPANVHHIMSTNFSNYHKGPEFQKMFDIFGDGLFIADSDSW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             KNQRK+A AL  H++F+++LV+T+ +KVEKGLIPVLE  + ++G VVDLQ +  RF+ D 
Sbjct  121   KNQRKIAMALTTHRKFYQFLVKTTQDKVEKGLIPVLEHVS-KQGLVVDLQSLIHRFSLDV  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
                LVTG+D   LS++  +  FS+A+DDAEEV++ R+L PE LWKLQ  LG GPE+K+  
Sbjct  180   GFKLVTGHDRELLSIENREDTFSRALDDAEEVIYFRYLKPEILWKLQGLLGFGPEQKMKE  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A EI+DQV    I+ KR+EL           +I+   G DLLTSYI   +GE  +G K  
Sbjct  240   AWEIIDQVAATSISKKREEL--------RGGNISKREGEDLLTSYI-KMEGEIFIGSKSR  290

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             D+F+RDTI+N +IAGR+   + L WF WLV  +P VE  IR+EL + +   E   ++ LF
Sbjct  291   DEFMRDTIVNFLIAGRE---NCLAWFFWLVFKNPRVEARIREELQSIIPEKEAKDQWWLF  347

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
               EELKNLVYL AAL E+LRLYP VP +HK P+Q DILPSGH V+P  +++F  YAMGRM
Sbjct  348   HTEELKNLVYLQAALFETLRLYPAVPVEHKKPIQPDILPSGHHVNPKMKIVFLAYAMGRM  407

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
               IWGKD  EFKPER+I+ ERG +KH P+ KF+AFN GPRTC+GK +A TQMKA+AA II
Sbjct  408   TSIWGKDCLEFKPERFIS-ERGGMKHVPTNKFVAFNTGPRTCIGKNIALTQMKAMAANII  466

Query  393   HNYHVRAVKNHDASP-NVSIILYMKHGLKVRVQRRWT  286
             +NYHV+ ++ H   P   SI+L+MKHGL VR+ RRW 
Sbjct  467   YNYHVQVMEGHPVVPAGNSILLHMKHGLMVRIARRWA  503



>ref|XP_006404787.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
 gb|ESQ46240.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
Length=515

 Score =   524 bits (1350),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 272/520 (52%), Positives = 357/520 (69%), Gaps = 15/520 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI----WIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA +   E+ V+F C       ++I +  +R  P K PL GMLP L + + +++D    V
Sbjct  1     MALLSLLEVSVSFLCFSFLFGYFLISKKPHRSFPTKWPLLGMLPGLLVEIPRVYDYITEV  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TF  KGP F  LD+LITVDPAN+H+IMS NF N+PKG EFKKIFDVLGDGIFN+
Sbjct  61    LEASNLTFPFKGPSFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D DLWK+ RK A++++ HQ F R+ +RTS +K+EKGL+P+L+  A E+  VVDLQDVFQR
Sbjct  121   DSDLWKDLRKSAQSMMSHQEFQRFTLRTSMSKLEKGLVPLLDHVA-EKKLVVDLQDVFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TG DPGCLS++ P++ F++A+D+AEE LF RH+ PE +WK+Q+ +G G E
Sbjct  180   FTFDTTFVLATGIDPGCLSIEMPEIEFARALDEAEEALFFRHVKPEMVWKMQRLIGFGDE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              K+ RA    D+V  K I  KR E+     N        D +  DLL SY++ +  +  +
Sbjct  240   LKMKRAHSTFDRVCSKCIASKRDEVSRGLINI-------DSSSKDLLMSYMDVDTTKYKL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN-SGEDP  772
                 D+KFLRD IL+ MIAGRDTT SALTWF WL+S +P+    IR E+ T ++    D 
Sbjct  293   LNPSDEKFLRDMILSFMIAGRDTTGSALTWFFWLLSKNPQATAKIRQEINTKLSPRTNDG  352

Query  771   KKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSL  592
              +   F  +EL  LVYLH AL E+LRLYPPVPFQHKSP + D+LPSGH+V   ++++F L
Sbjct  353   SEIDSFNHQELSKLVYLHGALYEALRLYPPVPFQHKSPTKPDVLPSGHRVDASSKIVFCL  412

Query  591   YAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKA  412
             Y++GRM+ +WG+DA EFKPERWI+ E G   H PS+KFL+FNAGPRTCLGK+VA TQMK 
Sbjct  413   YSLGRMKTVWGEDAAEFKPERWIS-ESGRSIHVPSFKFLSFNAGPRTCLGKDVAMTQMKT  471

Query  411   VAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             VA  II NY ++ V+ H   P  S+IL+MK GLKV V +R
Sbjct  472   VAVKIIQNYEIKVVEGHKIEPVPSVILHMKQGLKVMVTKR  511



>gb|KGN48430.1| hypothetical protein Csa_6G487020 [Cucumis sativus]
Length=516

 Score =   522 bits (1344),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 257/513 (50%), Positives = 361/513 (70%), Gaps = 21/513 (4%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGP  1630
             IF+ F   + W    + +  P   P+ GM+P++  ++ ++HDR   +L     TF   G 
Sbjct  18    IFIFFSLFLKW----NPHGIPWNWPVLGMIPTVIHNIYRVHDRITEILQQTSCTFYFNGI  73

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WFTN   L+TVDP+N+H+IMS NF+N+PKG EFK IFDVLGDGIFNSD D WK+QRK+A+
Sbjct  74    WFTNTGFLMTVDPSNIHHIMSTNFQNYPKGPEFKYIFDVLGDGIFNSDSDSWKSQRKIAQ  133

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGY  1270
             +LI+H++F  ++ R +  KVEKGL+P+LE+   E   VVDL+D+F R  FD+TC +VTG+
Sbjct  134   SLIVHEKFLEFMARAAKEKVEKGLVPILEYFC-ESKKVVDLKDLFLRLAFDSTCMMVTGF  192

Query  1269  DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQV  1090
                 L ++FP++PFSKAMDD +EVLF+RHL P+  W+L + LGIG  K++ +AC+I+D+V
Sbjct  193   HLNSLCIEFPEIPFSKAMDDVQEVLFLRHLYPKFYWELLKKLGIGEGKRMKKACDIIDEV  252

Query  1089  IGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTI  910
             I   + +KR+ L    +++    D  D +G DL+T Y+ N   E    +  +DKFLRDT+
Sbjct  253   IANLMAVKRERL---QRDREVKEDQQD-HGADLITWYMVNEHDE----IDCNDKFLRDTV  304

Query  909   LNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL--LTAVNSGEDPKKF--RLFKAEE  742
             LN MIAGRD  S  L+WF +++S +P +   IR+EL  +T +   E  ++   R+F  EE
Sbjct  305   LNFMIAGRDALSVTLSWFFFVLSKNPAIVAKIREELKDITTIQQKEQEQQQKPRVFTIEE  364

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
             L NLVYLH ALCE+LRLYPP+ F+HKSP+  + LPSGH V P TR++FSLYA+GRM+ +W
Sbjct  365   LNNLVYLHGALCETLRLYPPIAFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMRSVW  424

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             G+D +EFKPERWI+ ++G +K EPSYKF +FNAGPRTCLGK VAF+Q+K V+AAI+HNY 
Sbjct  425   GEDCEEFKPERWIS-DKGTIKREPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHNYD  483

Query  381   VRAVK---NHDASPNVSIILYMKHGLKVRVQRR  292
             + AV    N+   P  S+IL+MK G +V+V +R
Sbjct  484   IEAVDEDINNVVVPAASVILHMKSGFRVKVSKR  516



>ref|XP_009397903.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   522 bits (1345),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 264/519 (51%), Positives = 355/519 (68%), Gaps = 21/519 (4%)
 Frame = -2

Query  1812  EIFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFL  1642
             +  ++F C V        +RR   P+  P+ GMLP L L  R+I+D  A ++   G TF+
Sbjct  12    DFLLSFVCFVFCYYFCQIFRRSNVPVNWPVAGMLPGLLLRCRRIYDWGACLVREVGCTFV  71

Query  1641  LKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQR  1462
              +GPW   ++ ++T DPAN+ +I S  F N+PKG+EF +IFDVLGDGIFNSD +LWK QR
Sbjct  72    FRGPWLLGMNYVLTCDPANLQHIFSAGFSNYPKGEEFSEIFDVLGDGIFNSDGELWKKQR  131

Query  1461  KLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTL  1282
               A  LI  + F  ++  +S  KVE+GLIP+L+  A  +G VVDLQDVF R TFD TC L
Sbjct  132   MRAHGLISSRSFRSFVAGSSRRKVEQGLIPLLDGIA-RQGTVVDLQDVFLRLTFDNTCHL  190

Query  1281  VTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEI  1102
             V G DP CLS++FP +PF++A+DDA   LF+RH++P + WKL +WLGIG EKKL+ A + 
Sbjct  191   VFGVDPCCLSIEFPTIPFARALDDAMGALFLRHIVPPAWWKLMRWLGIGEEKKLAMAWKE  250

Query  1101  LDQVIGKYITMKRQELILTYKNQNPDNDIND-ENGFDLLTSYINNNDGETTM-----GLK  940
             +D+ I +    K+++  L        N I+D E   DLL+SYI+++D E          K
Sbjct  251   MDRFIAERTAEKKKQRSLD------KNRIHDGEEKVDLLSSYIDDHDDEEQHMSQQESSK  304

Query  939   FDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV---NSGEDPK  769
             F DKFLRDT +N M+AGRDTT + LTWF WL+  +P VE  I +EL       N      
Sbjct  305   F-DKFLRDTTMNFMLAGRDTTGAGLTWFFWLLCNNPMVESKILEELKKVASLRNERSSSD  363

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                +F AEEL  LVYLHAALCESLRL+PPVPF+ K+ L+ ++LPSGH V P T+++  L+
Sbjct  364   DLVVFDAEELSKLVYLHAALCESLRLFPPVPFELKAALRHEVLPSGHGVGPGTKILVPLH  423

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             AM R++ IWG+D  EFKPERWI+ E+G V+HEPSYKFL+FN+GPRTCLGKEVAFTQMKAV
Sbjct  424   AMARLEGIWGEDCLEFKPERWIS-EKGRVRHEPSYKFLSFNSGPRTCLGKEVAFTQMKAV  482

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              AA+++N+HV  ++ H   P +SIIL+MK+GL+VR++RR
Sbjct  483   VAAMVYNFHVEVLQGHVVEPKLSIILHMKNGLRVRIKRR  521



>ref|XP_004157875.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score =   520 bits (1339),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 251/485 (52%), Positives = 350/485 (72%), Gaps = 17/485 (4%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M+P++  ++ ++HDR   +L     TF   G WFTN   L+TVDP+N+H+IMS NF+N+P
Sbjct  1     MIPTVIHNIYRVHDRITEILQQTSCTFYFNGIWFTNTGFLMTVDPSNIHHIMSTNFQNYP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFK IFDVLGDGIFNSD D WK+QRK+A++LI+H++F  ++ R +  KVEKGL+P+L
Sbjct  61    KGPEFKYIFDVLGDGIFNSDSDSWKSQRKIAQSLIVHEKFLEFMARAAKEKVEKGLVPIL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             E+   E   VVDL+D+F R  FD+TC +VTG+D   L ++FP++PFSKAMDD +EVLF+R
Sbjct  121   EYFC-ESKKVVDLKDLFLRLAFDSTCMMVTGFDLNSLCIEFPEIPFSKAMDDVQEVLFLR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             HL P+  W+L + LGIG  K++ +AC+I+D+VI   + +KR+ L    +++    D  D 
Sbjct  180   HLYPKFYWELLKKLGIGEGKRMKKACDIIDEVIANLMAVKRERL---QRDREVKEDQQD-  235

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +G DL+T Y+ N   E    +  +DKFLRDT+LN MIAGRD  S  L+WF +++S +P +
Sbjct  236   HGADLITWYMVNEHDE----IDCNDKFLRDTVLNFMIAGRDALSVTLSWFFFVLSKNPTI  291

Query  825   EKNIRDEL--LTAVNSGEDPKKF--RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
                IR+EL  +T +   E  ++   R+F  EEL NLVYLH ALCE+LRLYPP+ F+HKSP
Sbjct  292   VAKIREELKDITTIQQKEQEQQQKPRVFTIEELNNLVYLHGALCETLRLYPPIAFEHKSP  351

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
             +  + LPSGH V P TR++FSLYA+GRM+ +WG+D +EFKPERWI+ ++G +K EPSYKF
Sbjct  352   VVAETLPSGHHVRPGTRILFSLYALGRMRSVWGEDCEEFKPERWIS-DKGTIKREPSYKF  410

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK---NHDASPNVSIILYMKHGLKV  307
              +FNAGPRTCLGK VAF+Q+K V+AAI+HNY + AV    N+   P  S+IL+MK G +V
Sbjct  411   FSFNAGPRTCLGKGVAFSQLKIVSAAIVHNYDIEAVDEDINNVVVPAASVILHMKSGFRV  470

Query  306   RVQRR  292
             +V +R
Sbjct  471   KVSKR  475



>ref|NP_195658.3| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB44683.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80611.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87077.1| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=516

 Score =   521 bits (1342),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 268/524 (51%), Positives = 350/524 (67%), Gaps = 21/524 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW---IILRDGYRRPLKVPLFGMLPSLFLHV-RKIHDRCAAVL  1666
             MA +   EI +AFFC +I+   +I +  +R  L       +    L V  +++D    VL
Sbjct  1     MALVSLLEISIAFFCFLIFRIFLISKKPHRSFLTNWPLLGMLPGLLTVLPRVYDFITEVL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
                   +L  GP+   +D+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D
Sbjct  61    EDGNLNYLFIGPFLGGIDMLFTVDPANIHHIMSSNFANYPKGTEFKKLFDVLGDGIFNAD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              DLWK+ RK +++++ H  F R+ + TS +K+EKGL+P+L+  A E+  VVDLQDVFQRF
Sbjct  121   SDLWKDLRKSSQSMMNHPDFQRFSLATSLSKLEKGLVPLLDHVAKEK-LVVDLQDVFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  L TGYDPGCLSV+ P++ F++A+DDAEE +F RH  PE +WK+Q+ +G+G E 
Sbjct  180   TFDTTFVLATGYDPGCLSVEMPEIEFARALDDAEEAIFYRHFKPEVVWKMQRLIGVGAEL  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             KL RA  I D+V  K I  KR E+            I+  +  DLL S IN +  +  + 
Sbjct  240   KLKRAHAIFDRVCSKCIASKRDEI---------SQGIDSSSSKDLLMSSINVDTTKYKLL  290

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLT------AVNS  784
                DD+FLRDTIL+ M+AGRDTT SALTWF WL+  + E    IR E+ T        + 
Sbjct  291   NPSDDRFLRDTILSFMLAGRDTTGSALTWFFWLLCNNQEAMTKIRQEINTNLFPRNKTDD  350

Query  783   GEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRL  604
             G        F  +E+K LVYLH A+CE+LRLYPPVPF HKSP + D+LPSGHKV  ++R+
Sbjct  351   GSVSYDSDSFNPQEVKKLVYLHGAVCEALRLYPPVPFNHKSPAKPDVLPSGHKVKANSRI  410

Query  603   MFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFT  424
             +F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA T
Sbjct  411   LFCLYSLGRMKSVWGEDAMEFKPERWIS-ESGRSVHEPSYKFLSFNAGPRTCLGKEVAMT  469

Query  423   QMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             QMK VA  II NY +  V+ H   P  S+IL+MKHGLKV V +R
Sbjct  470   QMKTVAVKIIQNYDINVVEGHKIKPAPSVILHMKHGLKVTVSKR  513



>ref|XP_004142038.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score =   517 bits (1332),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 250/485 (52%), Positives = 349/485 (72%), Gaps = 17/485 (4%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M+P++  ++ ++HDR   +L     TF   G WFTN   L+TVDP+N+H+IMS NF+N+P
Sbjct  1     MIPTVIHNIYRVHDRITEILQQTSCTFYFNGIWFTNTGFLMTVDPSNIHHIMSTNFQNYP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFK IFDVLGDGIFNSD D WK+QRK+A++LI+H++F  ++ R +  KVEKGL+P+L
Sbjct  61    KGPEFKYIFDVLGDGIFNSDSDSWKSQRKIAQSLIVHEKFLEFMARAAKEKVEKGLVPIL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             E+   E   VVDL+D+F R  FD+TC +VTG+    L ++FP++PFSKAMDD +EVLF+R
Sbjct  121   EYFC-ESKKVVDLKDLFLRLAFDSTCMMVTGFHLNSLCIEFPEIPFSKAMDDVQEVLFLR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             HL P+  W+L + LGIG  K++ +AC+I+D+VI   + +KR+ L    +++    D  D 
Sbjct  180   HLYPKFYWELLKKLGIGEGKRMKKACDIIDEVIANLMAVKRERL---QRDREVKEDQQD-  235

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +G DL+T Y+ N   E    +  +DKFLRDT+LN MIAGRD  S  L+WF +++S +P +
Sbjct  236   HGADLITWYMVNEHDE----IDCNDKFLRDTVLNFMIAGRDALSVTLSWFFFVLSKNPAI  291

Query  825   EKNIRDEL--LTAVNSGEDPKKF--RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
                IR+EL  +T +   E  ++   R+F  EEL NLVYLH ALCE+LRLYPP+ F+HKSP
Sbjct  292   VAKIREELKDITTIQQKEQEQQQKPRVFTIEELNNLVYLHGALCETLRLYPPIAFEHKSP  351

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
             +  + LPSGH V P TR++FSLYA+GRM+ +WG+D +EFKPERWI+ ++G +K EPSYKF
Sbjct  352   VVAETLPSGHHVRPGTRILFSLYALGRMRSVWGEDCEEFKPERWIS-DKGTIKREPSYKF  410

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK---NHDASPNVSIILYMKHGLKV  307
              +FNAGPRTCLGK VAF+Q+K V+AAI+HNY + AV    N+   P  S+IL+MK G +V
Sbjct  411   FSFNAGPRTCLGKGVAFSQLKIVSAAIVHNYDIEAVDEDINNVVVPAASVILHMKSGFRV  470

Query  306   RVQRR  292
             +V +R
Sbjct  471   KVSKR  475



>ref|XP_004142036.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=483

 Score =   518 bits (1333),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/519 (50%), Positives = 350/519 (67%), Gaps = 41/519 (8%)
 Frame = -2

Query  1833  MASIDYFEI---FVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             MAS+ + EI   F+ F  +++++ ++  Y   P  +P FGM  ++  ++ +I D    +L
Sbjct  1     MASMSFLEILLTFIPFLSVLLFLSVKWKYNEIPWNLPFFGMTLTILRNLHRIQDHFTHIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              L   TF  KG WF +LD   T DP+N+H+I+S NFE +PKG +FK IF++LGDGIFNSD
Sbjct  61    RLSSFTFFFKGAWFADLDFYFTSDPSNIHHILSTNFERYPKGPDFKYIFEILGDGIFNSD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              D+WK+ RK A +L+   ++ +++ + +  KV+ GL+PVL+ +  E G V+DLQD+FQRF
Sbjct  121   SDVWKSLRKTAHSLVHDHKYVQFVEKITLKKVKAGLVPVLD-SVCENGSVLDLQDLFQRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             +FD+TC  VTG+D   LS++FP+VPFSKAMD+AEEV+F+RH +P+ +WK Q  L IGP  
Sbjct  180   SFDSTCMFVTGFDLQSLSLEFPEVPFSKAMDEAEEVIFLRHFIPKKIWKFQNKLQIGPPT  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             +L +A E +D+ IGK I  KR+ L    +NQ  +       G DL+TSYI N+  +    
Sbjct  240   RLKQAWETIDETIGKLIASKRESL----RNQMKEEGDEQREGVDLITSYITNDTNK----  291

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDT+LN MIAGRDT SSAL+WF + +S +P V + IR+EL TA+ + E   +
Sbjct  292   ---DDKFLRDTVLNFMIAGRDTLSSALSWFFFCLSNNPTVVEKIREELKTAIPADESRDQ  348

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             +R+F  +ELK LVY H A CE+LRLYPPVPFQHK  +Q D LPSGH +            
Sbjct  349   WRIFSIDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDTLPSGHHI------------  396

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
                         KEFKPERWI+ E+G++KH PSYKFLAFNAGPRTCLGKEVAFT+MK VA
Sbjct  397   ------------KEFKPERWIS-EKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKLVA  443

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             AA+IHNY++     H   PN SIIL+MKHG KV+V +RW
Sbjct  444   AAMIHNYNITQQIGHKVVPNPSIILHMKHGFKVKVTKRW  482



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   518 bits (1333),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/502 (52%), Positives = 339/502 (68%), Gaps = 23/502 (5%)
 Frame = -2

Query  1797  FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTN  1618
             +FC       R+    P   P+ GML  L  +V +IHD    VL      FL KGPWF N
Sbjct  16    YFCYS----FRNKNGVPTNWPIVGMLLPLLANVPRIHDWITEVLEKSQLNFLFKGPWFAN  71

Query  1617  LDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALII  1438
             +++ +T+DPANVHYIMS NF+N+PKG +F ++FDV GDGIFN D  LW+  RK+A   I 
Sbjct  72    MEMFVTLDPANVHYIMSKNFKNYPKGSKFNEMFDVFGDGIFNVDSKLWEYHRKMAHTFIG  131

Query  1437  HQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGC  1258
             H +FH++L    W KVEKGLIPVL+  A ++G VVDLQD+F RFTFDT CTL+ G D  C
Sbjct  132   HPKFHQFLHEKVWEKVEKGLIPVLD-DASKQGLVVDLQDLFSRFTFDTICTLIVGSDLRC  190

Query  1257  LSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKY  1078
             LSVD+P+ PF KA+DD EEV+F RH++P S+WK  +WLG+G E+K   A EILD+ I K 
Sbjct  191   LSVDWPNEPFLKALDDIEEVIFRRHVVPMSVWKFFRWLGVGKERKYKEAWEILDEFIYKR  250

Query  1077  ITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG---LKFDDKFLRDTIL  907
             I+ KR E +     Q          G DLLT Y++   G +++        DK LRDTIL
Sbjct  251   ISEKRSEELF---KQEELKHKEASVGVDLLTLYMDEAQGLSSINNVKNNLSDKLLRDTIL  307

Query  906   NLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLV  727
             N  IAGRDTTS+AL WF +L+S +P VE  IR+EL T ++  +D  K           LV
Sbjct  308   NFFIAGRDTTSTALAWFFYLLSKNPRVESKIREELDTIMDINQDHDK-----------LV  356

Query  726   YLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAK  547
             Y+H ALCE+LRLYPPV F+ K+ +++DILPSG  V P+ +++F+LYAMGRM+ IWG D  
Sbjct  357   YVHGALCEALRLYPPVAFEQKASMESDILPSGQHVYPNMQIIFNLYAMGRMKSIWGDDCN  416

Query  546   EFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK  367
             EFKPERWI+ ERG +KHEPSYKFL FNAGPR+CLGK +AFTQMKAV A I+ NY  +A++
Sbjct  417   EFKPERWIS-ERGNIKHEPSYKFLTFNAGPRSCLGKNMAFTQMKAVVATIVQNYKFQAIQ  475

Query  366   NHDASPNVSIILYMKHGLKVRV  301
                  P++S++L MK+G KV+V
Sbjct  476   GQLVVPDISLMLRMKNGFKVKV  497



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   516 bits (1329),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 263/525 (50%), Positives = 343/525 (65%), Gaps = 35/525 (7%)
 Frame = -2

Query  1833  MASIDYFEIFV-AFFCLVIWIILRDGYRR----PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MA+  Y EIF   F  +++  +LR    R    P   PL GMLP L    R+IH     +
Sbjct  1     MATFGYPEIFFFTFIVILLPAVLRSRSWRKSSGPTNWPLLGMLPWLLRISRRIHSSATQL  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             ++  GGTF  KGPWF N+D+LIT DPAN+H+I S NF N+PKG EF+KIFDVLGDGIFN+
Sbjct  61    MNESGGTFEFKGPWFCNMDMLITCDPANIHHIFSRNFSNYPKGPEFRKIFDVLGDGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LW+  R+   +   H RFH  L R  W KVE  L+PVL+ +  E+G  VDLQD+FQR
Sbjct  121   DFELWELHRRTTLSFFSHARFHTLLGRAVWGKVETALLPVLD-SFLEQGVAVDLQDIFQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             F+FD  C LV  YDP  LS+D P VP  KA + A E L  RH+LPESLWKLQ+WLG+G E
Sbjct  180   FSFDNICKLVLDYDPQSLSIDLPYVPCEKAFNGAIEALLYRHILPESLWKLQKWLGVGKE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQE------LILTYKNQNPDNDINDENGFDLLTSYINNN  967
             KKL  A +  D+ I  +IT+   E      L+ T++    + +I   NG  +        
Sbjct  240   KKLMEAWKAFDEFIYPHITLGNGEQKDDAKLLTTFRKAYEEKNIGSSNGLRV--------  291

Query  966   DGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN  787
                          FLRDT L+LM AGRDTTS+ LTW  WL++ +P  E  I +E+ + + 
Sbjct  292   -------------FLRDTALSLMFAGRDTTSTCLTWLFWLIAKNPLTETKILEEMESKLQ  338

Query  786   SGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTR  607
               ED KK+R F  EE + L+YLH ALCESLRL+PPV  +HK+P+  D LPSG+ + P+T+
Sbjct  339   LKED-KKWRFFSVEESRKLIYLHGALCESLRLFPPVALEHKAPIAPDTLPSGNYLEPNTK  397

Query  606   LMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAF  427
             ++ S Y+ GRM+ +WGKD  EFKPERWI+ + G  KHEPSYKF AFNAGPRTCLGKE+AF
Sbjct  398   IIVSFYSTGRMESVWGKDCLEFKPERWIS-KGGGTKHEPSYKFPAFNAGPRTCLGKEMAF  456

Query  426   TQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              QMK VAAAII++Y+++ V++H  +P+ S+IL  KHGLKVR+ RR
Sbjct  457   VQMKMVAAAIIYHYNLQLVEDHPVTPSDSVILQAKHGLKVRLFRR  501



>ref|XP_008441106.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
melo]
Length=513

 Score =   516 bits (1328),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/513 (51%), Positives = 346/513 (67%), Gaps = 21/513 (4%)
 Frame = -2

Query  1806  FVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG-GTFLLKGP  1630
             F+ F   + W    +G   P   P+ GMLP++  H+ +I+DR   +L      TF + G 
Sbjct  16    FIIFITFLKWNNPMNGI--PWNWPVLGMLPTVVFHMNRINDRATEILHQAARSTFFINGV  73

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WF+  D  +T +P+N+H+I+S NFE +PKG +FK IFD  GDGIFNSD   WK+QR  + 
Sbjct  74    WFSGTDFFLTANPSNIHHILSANFEQYPKGPDFKYIFDFFGDGIFNSDFASWKSQRDCS-  132

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGY  1270
                 +Q+F ++L +    KV+ GL PVL+ +  E G V+DLQD+FQR +FD+TC  VTG+
Sbjct  133   CFFRNQKFLQFLEKIISKKVKAGLFPVLQ-SFCENGSVLDLQDLFQRLSFDSTCMFVTGF  191

Query  1269  DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQV  1090
             D   LS++FP +PFSKAMDD ++V F+RH  P+ +W+ Q  L IG  KKL +A  I+D+ 
Sbjct  192   DLQSLSLEFPQIPFSKAMDDIKDVAFLRHFFPKKIWEFQNKLQIGQPKKLKQAWNIMDET  251

Query  1089  IGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYI--NNNDGETTMGLKFDDKFLRD  916
             I K I +K++ L    KNQ       D +  DLL+SYI  NNN  +   G   D KFL+D
Sbjct  252   IHKLIALKKESL----KNQEE----VDPDDRDLLSSYIITNNNVKDDDDG---DSKFLKD  300

Query  915   TILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK---KFRLFKAE  745
             T+LNLM+AGRD+ SSAL+WF + +S +P VE  IR+EL T V    D     +  +F  E
Sbjct  301   TVLNLMMAGRDSVSSALSWFFFCLSNNPIVEAKIREELETTVPLSSDDATRDQCHIFSYE  360

Query  744   ELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFI  565
             ELK LVY H ALCE+LRLYP VPFQHK P + DILPSGH+V P+T+++FSLYA+GRM  +
Sbjct  361   ELKKLVYFHGALCETLRLYPVVPFQHKVPSKPDILPSGHRVDPNTKILFSLYALGRMSDV  420

Query  564   WGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY  385
             WG+D  EFKPERWIN + G +KHEPSYKFLAFNAGPRTCLGKEVAF +MK +AAAI+HN+
Sbjct  421   WGEDCMEFKPERWINSKNGKIKHEPSYKFLAFNAGPRTCLGKEVAFIEMKLLAAAILHNF  480

Query  384   HVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             ++     H+   N SIIL MKHG KV+V +RWT
Sbjct  481   NITRQTEHEVVSNASIILQMKHGFKVKVTKRWT  513



>gb|KDP35253.1| hypothetical protein JCGZ_09412 [Jatropha curcas]
Length=498

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 262/515 (51%), Positives = 342/515 (66%), Gaps = 18/515 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MA +  FEI +A  C  I   L + Y      P  GMLPSL  HV   HD   A++   G
Sbjct  1     MALLGIFEILLAVICYSIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWSKALIERSG  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTFL KGPWF+N+DI+ T DPANV + +S NF N+PKG EFK++FDVLGDGIFN+D DLW
Sbjct  61    GTFLFKGPWFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K+QRK A ALI H RFH +LV+T++NK+ K L PVLE    E   V D QD+  RFTFD 
Sbjct  121   KHQRKNASALINHDRFHSFLVKTTYNKLAKELHPVLELLCKE-NKVFDFQDLIDRFTFDV  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
                 VTGYDP  +S   P   FS A+D AE+ +F RH+ P+  WKLQ+ LGIG E+KL  
Sbjct  180   AMIFVTGYDPESVSTKLPKDEFSIALDYAEQAVFYRHVFPKLFWKLQRLLGIGKEQKLKE  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A E LD++  KYI+M+R++L      +    DI  E   DLL SYI+       +G K  
Sbjct  240   AKETLDRMAAKYISMRREQL------ETHKYDIFPE---DLLASYISQGK---MIGSKSQ  287

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             D+FLRD I+N ++AGR    ++LTW  WL+S +   E  IR+EL +  ++GE     +LF
Sbjct  288   DEFLRDVIVNFLVAGR---VNSLTWLFWLLSKNQRAETRIREELKSIASTGETTGGLQLF  344

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             K E++  L+YLHAALCE+LRLYPPV ++HK PL+ D+LPSGH V P  ++++  Y MGR+
Sbjct  345   KQEKVNKLIYLHAALCETLRLYPPVVYEHKKPLKPDVLPSGHHVDPKMKILYLSYVMGRL  404

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + +WG+D  EFKPERWI+ E G +  +  YKFL FNAGPRTCLGKE+A T+MKAVAA I+
Sbjct  405   KSLWGEDCMEFKPERWIS-EEGRLIQQSPYKFLTFNAGPRTCLGKEIALTEMKAVAAFIL  463

Query  393   HNYHVRAVKNHDASPN-VSIILYMKHGLKVRVQRR  292
             HNY V+ ++ H   P   SIIL++K+GL VR+ RR
Sbjct  464   HNYQVKVIEGHVPEPTCASIILHIKNGLMVRISRR  498



>gb|KDP35254.1| hypothetical protein JCGZ_09413 [Jatropha curcas]
Length=498

 Score =   513 bits (1322),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 265/515 (51%), Positives = 343/515 (67%), Gaps = 18/515 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MA +  FEI +A  C  I   L + Y      P  GMLPSL  HV   HD   A++   G
Sbjct  1     MALLGIFEILLAVICYSIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWNKALIERSG  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTFL KGPWF+N+DI+ T DPANV + +S NF N+PKG EFK++FDVLGDGIFN+D DLW
Sbjct  61    GTFLFKGPWFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLW  120

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K+QRK A ALI H RF  +LV+T++NK+ K L PVLE    E   V DLQD+  RFTFD 
Sbjct  121   KHQRKNASALINHDRFRSFLVKTTYNKLAKELHPVLELLCKE-NKVFDLQDLIDRFTFDV  179

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
                LVTGYDP  +S   P   FS A+D AEE +F RH+ P+  WKLQ+ LGIG E+KL  
Sbjct  180   AMILVTGYDPESVSTKLPKDEFSIALDYAEEAVFYRHVFPKLFWKLQRLLGIGKEQKLKE  239

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
               EILD++  KYI+MKR++L      +    DI  E   D+L SYI+  +    +G K  
Sbjct  240   GKEILDRMAAKYISMKREQL------ETNKYDIFPE---DMLASYISQGE---MVGSKSQ  287

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             D+FLRD I+N +IAGR    ++LTWF WL+S +P VE  IR+EL +  ++ E     +LF
Sbjct  288   DEFLRDVIVNFLIAGR---VNSLTWFFWLLSKNPRVETRIREELKSIASTSETTGGLQLF  344

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
             + E++  L+YLHAALCE+LRLYPPV ++HK PL+ D+LPSGH V    ++++  Y MGR+
Sbjct  345   EQEKVNKLLYLHAALCETLRLYPPVVYEHKKPLKPDVLPSGHHVDQKMKILYLTYVMGRL  404

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + IW +D  EFKPERWI+ E   ++  P YKFLAFNAGPRTCLGKE A  +MKAVAA I+
Sbjct  405   KSIWEEDCMEFKPERWISGEGRLIQQSP-YKFLAFNAGPRTCLGKETALIEMKAVAAFIV  463

Query  393   HNYHVRAVKNHDASPN-VSIILYMKHGLKVRVQRR  292
             HNY V+ ++ H   P   SIIL++K+GL VR+ RR
Sbjct  464   HNYQVKVIEEHVPEPTCASIILHIKNGLMVRISRR  498



>ref|XP_010660343.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=503

 Score =   511 bits (1317),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 334/488 (68%), Gaps = 15/488 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   PL GMLP++     ++ D  A +L   GGTFL+KG W  + D+LIT  PA+ H++M
Sbjct  31    PWNWPLIGMLPTILFQYDQVLDLGAEILERCGGTFLVKGLWLAHSDMLITCIPADAHHVM  90

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF NFPKG EF+ + D  G+G+F SDL+ W   R++ RAL  HQRF +  V  + +KV
Sbjct  91    STNFWNFPKGPEFRMMLDAFGNGLFISDLEDWSFHRRIGRALFNHQRFQQLSVDITLDKV  150

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GL+PVLE A+ +R   VD QD+FQRF  D TC L+TG DP  L ++ PDVPF+ AM++
Sbjct  151   ENGLVPVLEHASQQRLA-VDFQDLFQRFGLDATCALITGCDPKSLCLELPDVPFASAMEE  209

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             A +V+F+RH+ P+ +WKLQ+WLGIG E+ L  A + L     ++++  R+          
Sbjct  210   AGKVIFLRHVYPKCIWKLQRWLGIGSERILIAAKKTLYDFAAEHVSFMRER---------  260

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              +   N   G D+L++YIN ++   +      DK L D IL+L++AG+DTTS+AL+WF W
Sbjct  261   SNMGTNQTEGLDILSAYINEDEAFQSSA---SDKVLIDNILSLLLAGKDTTSAALSWFFW  317

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             LVS +P VE  I +EL  AV + E  +K+ LF A+EL  LVYLH ALCESLRL+PPVP Q
Sbjct  318   LVSKNPSVETKIIEELKAAVPAKE-AEKWHLFDAKELSKLVYLHGALCESLRLFPPVPLQ  376

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              ++PLQ DILPSGH+V P T+++F  YAMGRM   WGKD  EFKPERW+   +G  KHEP
Sbjct  377   IRTPLQPDILPSGHRVDPSTKVIFHAYAMGRMACAWGKDCLEFKPERWLT-GKGRTKHEP  435

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             +YKFLAF+AGPR CLGKEVAF +MKAVAAAI+HNYH + VK H   P VSI+L+MKHGL+
Sbjct  436   AYKFLAFSAGPRICLGKEVAFFKMKAVAAAIMHNYHFQMVKGHRVVPTVSIVLHMKHGLR  495

Query  309   VRVQRRWT  286
             V V+ +W 
Sbjct  496   VNVKNKWA  503



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   509 bits (1310),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 256/513 (50%), Positives = 342/513 (67%), Gaps = 22/513 (4%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLL  1639
             I +  F    W  L  G+ +   P   PL GMLP L  +  ++HD   ++L   GGTF  
Sbjct  12    IIIMCFSYSTWWYLTKGWCKSSVPTNWPLVGMLPGLIRNAHRVHDFATSILVETGGTFEF  71

Query  1638  KGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRK  1459
              GP  TN ++L T DPAN+H+++S NF N+PKG EF+KIFD+LG+GIFN D +LW+  RK
Sbjct  72    YGPVLTNSNMLATSDPANIHHVLSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRK  131

Query  1458  LARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLV  1279
                +L+ H +F   L R  W+  EKGL P+L+  A E+G   DLQD+FQRFTFD    L+
Sbjct  132   TTMSLMSHAKFQTLLERNMWDTFEKGLQPILDTFA-EQGTPFDLQDIFQRFTFDAISKLL  190

Query  1278  TGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEIL  1099
               +DP  LS+  P VP  KA +DA + L  RH+LPE  WKLQ+WL IG EKKL +A E  
Sbjct  191   LDHDPKSLSIGLPHVPCEKAFNDAVDALLYRHILPEGCWKLQRWLQIGKEKKLIQAWEAF  250

Query  1098  DQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN----NDGETTMGLKFDD  931
             D+ +   I+ K++E +         N I  +  FDL T+Y+       +G+ T  ++   
Sbjct  251   DRFLYPCISRKQEEWM---------NKIIKDEDFDLFTAYVKAYNLWKNGDNTGNVQ---  298

Query  930   KFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFK  751
             +FLRDT LNLM AGRDTTS+A+TWF WL++ +P VE  IR+E+   +   ED    +LF 
Sbjct  299   EFLRDTFLNLMFAGRDTTSAAITWFFWLLAENPLVETKIREEIQQKLQLKED-GNLKLFN  357

Query  750   AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQ  571
              EE + L+YLHAALCE+LRL+P V  +HK PL++DILPSGH+V+P+TR++ S Y MGRM+
Sbjct  358   IEETRKLIYLHAALCETLRLFPSVSLEHKVPLESDILPSGHRVNPNTRIVLSFYTMGRME  417

Query  570   FIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIH  391
              IWGKD  EFKPERWI+ E+G +KHEPS+KF AFNAGPRTCLGKE+AF QMK + A IIH
Sbjct  418   TIWGKDCLEFKPERWIS-EKGKIKHEPSFKFPAFNAGPRTCLGKEMAFIQMKMMVATIIH  476

Query  390   NYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +YH++ V+    SP+ SII+ MKHGLKVR+ +R
Sbjct  477   SYHIQLVEGQTISPSASIIVQMKHGLKVRLFKR  509



>ref|XP_002866852.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43111.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   508 bits (1309),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 266/527 (50%), Positives = 355/527 (67%), Gaps = 23/527 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFG-----MLPSLFLHVRKIHDRCAAV  1669
             MA +   EI +AFFC +I+ I     ++P +  L       MLP L   + +++D    V
Sbjct  1     MALVSLLEISIAFFCFLIFQIFLIS-KKPHRSFLTNWPLLGMLPGLLPQLPRVYDFITEV  59

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L      +L KGP+   +D+L TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN 
Sbjct  60    LEDGNLNYLFKGPFLGGIDMLFTVDPANIHHIMSSNFANYPKGTEFKKLFDVLGDGIFNV  119

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LWK+ RK +++++    F R+ + TS +K+EKGL+P+L+ AA E+  VVDLQDVFQR
Sbjct  120   DSELWKDLRKSSQSMMNDPDFQRFSLATSLSKLEKGLVPLLDHAAKEK-LVVDLQDVFQR  178

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  L TGYDPGCLSV+ P++ F++A+DDAEE +F RH+ PE +WK+Q+ +G+G E
Sbjct  179   FTFDTTFVLATGYDPGCLSVEMPEIEFARALDDAEEAIFYRHVKPEMVWKIQRLIGVGDE  238

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
              KL RA  + ++V  + I  KR E+       N  +  +  N  DLL S +N +  +  +
Sbjct  239   LKLKRAHAVFNRVCSECIASKRDEI-------NRGDGSSSSN--DLLMSSLNVDTTKYKL  289

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV-----NS  784
                 DD+FLRDTIL+ M+AGRDTT SALTWF WL+  + E    IR E+ T +     N 
Sbjct  290   LNPSDDRFLRDTILSFMLAGRDTTGSALTWFFWLLCKNQEAMAKIRQEINTNLFPRNKND  349

Query  783   GEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRL  604
             G        F  + +K LVYLH A+CE+LRLYPPVPF HKSP + D+LPSGHKV  ++++
Sbjct  350   GSVSYDSDSFNPQGIKKLVYLHGAICEALRLYPPVPFNHKSPTKPDVLPSGHKVKANSKI  409

Query  603   MFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFT  424
             +F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA  
Sbjct  410   LFCLYSLGRMKSVWGEDALEFKPERWIS-ESGRSVHEPSYKFLSFNAGPRTCLGKEVAMM  468

Query  423   QMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR-WT  286
             QMK VA  II NY +  V+ H   P  S+IL+MKHGLKV V +R W+
Sbjct  469   QMKTVAVKIIQNYEINVVEGHKIKPAPSVILHMKHGLKVTVSKRCWS  515



>ref|XP_004160507.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=521

 Score =   509 bits (1310),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 264/534 (49%), Positives = 354/534 (66%), Gaps = 20/534 (4%)
 Frame = -2

Query  1875  LEKTSRTTSIITCAMASIDYFEIFVAFFCLVIWIILRD-GY--RRPLKVPLFGMLPSLFL  1705
             +   S   S I  A+ +I    IF+  F +   II+R   Y    P   P+ GM P++  
Sbjct  1     MASCSTDYSAIVFALTAIIIVPIFLFIFLVYHNIIMRYWNYLATVPWNWPILGMTPTVIA  60

Query  1704  HVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKK  1525
             H+ ++HDR   V+   G T+L KG WF+ +D+L TVD +N+++I+S NFE +PKG +FK 
Sbjct  61    HIHRVHDRLTEVIQEVGSTYLFKGVWFSGMDLLFTVDTSNINHILSVNFERYPKGPDFKY  120

Query  1524  IFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGER  1345
             IFD+LGDGIFNSD D+W+  RK A AL+   ++ ++L   +  KV + L+P+L+    E 
Sbjct  121   IFDILGDGIFNSDSDVWRALRKTAYALVHDHKYLKFLETITLKKVTEELVPILQ-TVSEN  179

Query  1344  GGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESL  1165
             G V+D QD+FQR +FD TC LVTG D   LS+ F  + FSKA+DD EEV+ +RH  P+ L
Sbjct  180   GSVLDFQDLFQRLSFDVTCMLVTGSDLHSLSLGFRHL-FSKAIDDVEEVILLRHFYPKKL  238

Query  1164  WKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND--INDENGFDL  991
             W+LQ+ L IG   KL +A EI+D+ I   I  KR+ L    KNQ  D +   +DE G DL
Sbjct  239   WELQKKLQIGQPVKLKQAWEIIDENISTLIASKRESL----KNQMKDKEGGDDDEEGADL  294

Query  990   LTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIR  811
             +TSYI N        +  DDKFLRDT+LN MIAGRD  S+ L+W  + +S +P V + IR
Sbjct  295   ITSYITN--------MNKDDKFLRDTVLNFMIAGRDGLSATLSWIFFCLSNNPIVVEKIR  346

Query  810   DELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSG  631
             +EL T + + E   ++R+F  EE+  LVYLHA L E+LRLYPP+PFQHK  +  D+LPSG
Sbjct  347   EELRTTIPTSEPCDQWRIFSTEEVDKLVYLHATLYETLRLYPPLPFQHKVSVHHDVLPSG  406

Query  630   HKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRT  451
             H + P T+++FSLYA+GRM  +WGKD  EFKPERWI+ E G +KH PSYKFLAFNAGPRT
Sbjct  407   HHIKPKTKILFSLYALGRMSEVWGKDCFEFKPERWIS-ENGKIKHVPSYKFLAFNAGPRT  465

Query  450   CLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             CLGK+VA   +K VAAAII+NY+V     H+  P+ SIIL+MK GLKVRV +RW
Sbjct  466   CLGKQVALIGVKIVAAAIIYNYNVIQQSGHEVVPSSSIILHMKRGLKVRVTKRW  519



>ref|XP_004151610.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48431.1| hypothetical protein Csa_6G487520 [Cucumis sativus]
Length=521

 Score =   508 bits (1309),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 262/532 (49%), Positives = 353/532 (66%), Gaps = 16/532 (3%)
 Frame = -2

Query  1875  LEKTSRTTSIITCAMASIDYFEIFVAFFCLVIWIILRD-GY--RRPLKVPLFGMLPSLFL  1705
             +   S   S I  A+ +I    IF+  F +   II+R   Y    P   P+ GM P++  
Sbjct  1     MASCSTDYSAIVFALTAIIIVPIFLFIFLVYHNIIMRYWNYLATVPWNWPILGMTPTVIA  60

Query  1704  HVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKK  1525
             H+ ++HDR   V+   G T+L KG WF+ +D+L TVD +N+++I+S NFE +PKG +FK 
Sbjct  61    HIHRVHDRLTEVIQEVGSTYLFKGVWFSGMDLLFTVDTSNINHILSVNFERYPKGPDFKY  120

Query  1524  IFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGER  1345
             IFD+LGDGIFNSD D+W+  RK A AL+   ++ ++L   +  KV++ L+P+L+    E 
Sbjct  121   IFDILGDGIFNSDSDVWRALRKTAYALVHDHKYLKFLETITLKKVKEELVPILQ-TVSEN  179

Query  1344  GGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESL  1165
             G V+D QD+FQR +FD TC LVTG D   LS+ F  + FSKA+DD EEV+ +RH  P+ L
Sbjct  180   GSVLDFQDLFQRLSFDVTCMLVTGSDLHSLSLGFRHL-FSKAIDDVEEVILLRHFYPKKL  238

Query  1164  WKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLT  985
             W+LQ+ L IG   KL +A EI+D+ I   I  KR+ L    K +   +D  DE G DL+T
Sbjct  239   WELQKKLQIGQPVKLKQAWEIIDENISTLIASKRESLKNQMKEKEGGDD--DEEGADLIT  296

Query  984   SYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDE  805
             SYI N +         DDKFLRDT+LN MIAGRD  S+ L+W  + +S +P V + IR+E
Sbjct  297   SYITNMNK--------DDKFLRDTVLNFMIAGRDGLSATLSWIFFCLSNNPIVVEKIREE  348

Query  804   LLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHK  625
             L T + + E   ++R+F  EE+  LVYLHA L E+LRLYPP+PFQHK  +  D+LPSGH 
Sbjct  349   LRTTIPTSEPCDQWRIFSTEEVDKLVYLHATLYETLRLYPPLPFQHKVSVHHDVLPSGHH  408

Query  624   VSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCL  445
             + P T+++FSLYA+GRM  +WGKD  EFKPERWI+ E G +KH PSYKFLAFNAGPRTCL
Sbjct  409   IKPKTKILFSLYALGRMSEVWGKDCFEFKPERWIS-ENGKIKHVPSYKFLAFNAGPRTCL  467

Query  444   GKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
             GK+VA   +K VAAAII+NY+V     H+  P+ SIIL+MK GLKVRV +RW
Sbjct  468   GKQVALIGVKIVAAAIIYNYNVIQQSGHEVVPSSSIILHMKRGLKVRVTKRW  519



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   508 bits (1308),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 256/513 (50%), Positives = 344/513 (67%), Gaps = 22/513 (4%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLL  1639
             I +  F    W  L   + +   P   PLFGMLP L  +  +IHD   ++L   GGTF  
Sbjct  12    IIIVCFTYSTWWYLTKRWCKSSTPTNWPLFGMLPGLIRNAHRIHDFATSILMETGGTFEF  71

Query  1638  KGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRK  1459
              GP  TNL++L+T DPAN+H+I+S NF N+PKG EF+KIFD+LG+GIFN D +LW+  RK
Sbjct  72    YGPVLTNLNMLVTSDPANIHHILSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRK  131

Query  1458  LARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLV  1279
                +L+ H +F   L R  W+ +EKGL P+L+  A E+G   DLQD+FQRFTFD    L+
Sbjct  132   TTMSLMSHAKFQTLLERNMWDTIEKGLRPILDTFA-EQGTPFDLQDIFQRFTFDAISKLL  190

Query  1278  TGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEIL  1099
               +DP  LS+  P VP  KA +D  + L  RH+LP+  WKLQ+WL IG EKKL +A E  
Sbjct  191   LDHDPKSLSIGLPHVPCEKAFNDIVDALLYRHVLPKGCWKLQRWLQIGKEKKLIQAWEAF  250

Query  1098  DQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN----NDGETTMGLKFDD  931
             DQ +   I+ +++EL+         N I  +  FDL T+YI       +G+ T  ++   
Sbjct  251   DQFLYPCISRQQEELM---------NKIIKDEDFDLFTAYIKAYNLWKNGDNTGNVQ---  298

Query  930   KFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFK  751
             +FLRDT LNLM+AGRDTTS+A+TWF WL++ +P VE  IR+E+L  +   ED +  + F 
Sbjct  299   EFLRDTFLNLMLAGRDTTSAAITWFFWLLAENPLVETKIREEILEQLQLKED-ENLKYFN  357

Query  750   AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQ  571
              EE + LVYLH ALCE+LRL+P V  +HK  L+ DILPSGH+V+P+TR++ S Y MGRM+
Sbjct  358   IEETRKLVYLHCALCETLRLFPSVSLEHKVSLEFDILPSGHRVNPNTRIVLSFYTMGRME  417

Query  570   FIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIH  391
              IWGKD  EFKPERWI+ E+G +KHEPS+KF AFNAGPRTCLGKE+A  QMK +AA II+
Sbjct  418   NIWGKDCLEFKPERWIS-EQGKIKHEPSFKFPAFNAGPRTCLGKEMALIQMKMIAATIIY  476

Query  390   NYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +YH++ ++    SP+ SII+ MKHGLKVR+ +R
Sbjct  477   SYHIQLMEAQTISPSASIIVQMKHGLKVRIVKR  509



>ref|XP_009400927.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   509 bits (1310),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 259/525 (49%), Positives = 352/525 (67%), Gaps = 27/525 (5%)
 Frame = -2

Query  1821  DYFEIFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGG  1651
              Y E+ ++ FC V +      +RR   P+  PL GMLP L L++  +HD C  +L + G 
Sbjct  22    SYPEVLLSIFCFVFFCYFGRVFRRSSFPVDWPLAGMLPGLLLNLDHLHDWCTDLLRVVGC  81

Query  1650  TFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWK  1471
              F  +GPWF  +D L+T DPAN+ ++ S NF N+PKG EF +IFD+LGDGIFNSD + WK
Sbjct  82    NFFFRGPWFLGMDYLVTCDPANLQHVFSANFSNYPKGGEFSEIFDILGDGIFNSDGESWK  141

Query  1470  NQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTT  1291
              QR  A  L+  +RF  ++  +  NKVEKGLIP+++     RG VVDLQDVF R TFD T
Sbjct  142   KQRMKAHGLMNGRRFRSFVASSIRNKVEKGLIPLVDDVV-RRGAVVDLQDVFMRLTFDAT  200

Query  1290  CTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRA  1111
               LV G DP CLS+  P VPF++A+DDA   L +RH +P + WKL +WL IG EKKL+ +
Sbjct  201   SYLVFGVDPCCLSIGLPTVPFARAIDDAMGALLLRHTVPPAWWKLARWLRIGDEKKLAMS  260

Query  1110  CEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYIN----------NNDG  961
              +++D+ I + I  K++  + + +N+    D+  E   DLL+SYIN          +  G
Sbjct  261   WKVIDRYIAESIAEKKK--LRSLRNK---KDVGSEAKADLLSSYINDDDDEEQQDSHRQG  315

Query  960   ETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV--N  787
              T       DKF+RDT +N M+AGRDTT +ALTWF WL+  +P VE  I +EL +     
Sbjct  316   STEF-----DKFVRDTAMNFMLAGRDTTGAALTWFFWLLCKNPLVESKILEELSSTPLRK  370

Query  786   SGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTR  607
                      +F  EEL  LVYLHAALCESLRL+PPVPF+HK+ L+ +ILPSGH+V   T+
Sbjct  371   QRSSSNDMTIFDTEELSKLVYLHAALCESLRLFPPVPFEHKAALRHEILPSGHRVEAGTK  430

Query  606   LMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAF  427
             ++ SLY+MGRM+ IWGKD  EF+PERWI+ E+G V+HEPSYKF+ FN+GPRTCLGKEVAF
Sbjct  431   ILVSLYSMGRMEGIWGKDCLEFRPERWIS-EKGRVRHEPSYKFMPFNSGPRTCLGKEVAF  489

Query  426   TQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             TQMKAV AA+++N+ V+ +  H   P +SIIL++K+GL+V+++RR
Sbjct  490   TQMKAVVAAMVYNFQVQVLPGHVVEPKLSIILHLKNGLRVKIKRR  534



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   507 bits (1305),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 245/519 (47%), Positives = 344/519 (66%), Gaps = 8/519 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWI-ILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA ++YF I +A  C++++    R+        P+ GMLP L    + +H+    +L   
Sbjct  1     MAILEYFHIIIALVCILLFCHWCRNTVSPVTNWPVVGMLPGLLFQAQNVHEYATQLLKQS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTF  KGPWF N++I +T DP NV +I + NF N+PKG E+KKIF+  GDG+ NSD + 
Sbjct  61    GGTFEFKGPWFANMNIFLTADPLNVRHISTKNFVNYPKGPEYKKIFEPFGDGVLNSDFES  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK+ RKL  ++I   +F  +L R+   K+ KGLIPVLE  + +    +D+QDVFQRFTFD
Sbjct  121   WKSFRKLIHSMIKDNKFQVFLERSLREKIVKGLIPVLEHVSRQEIE-LDMQDVFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
               C LV G+DP  LSVD P++ +  A DD EE  F RH++PES+WKLQ+WL +G EKKLS
Sbjct  180   NICLLVLGFDPQSLSVDLPEIAYKTAFDDVEEAAFYRHIVPESIWKLQKWLNVGEEKKLS  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL--  943
             +A + +D  + + I+ K++E+           + ND++ +DL+T+ I   +GE    +  
Sbjct  240   QAMDTIDNFLEQCISSKKEEIRQRKVQNMVQVEDNDQDDYDLITACI-KEEGEAAEQMDA  298

Query  942   -KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNS-GEDPK  769
              K  DK+LRD   N + AG+DT ++ALTWF WLV+TH EVEK I +E+   + S G+   
Sbjct  299   SKKTDKYLRDIGFNFIAAGKDTVNAALTWFFWLVATHHEVEKKIVEEIRANMKSKGDHTI  358

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 F  EEL  LVYLH A+CE+LRLYP VPF ++  ++ D LPSGH V  +T++MFSLY
Sbjct  359   NGMFFNLEELNKLVYLHGAICETLRLYPAVPFNYRVSVEADTLPSGHLVKANTKVMFSLY  418

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             +MG M+ IWG D   FKPERWI+ ERG + H PSYK++AFN GPR+CLGKE+ F QMK +
Sbjct  419   SMGSMEEIWGDDCLAFKPERWIS-ERGGIIHVPSYKYIAFNTGPRSCLGKEITFIQMKTI  477

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A AI+ N+H++ V+ H  SP +S++L+MKHGLK+RV +R
Sbjct  478   ATAILMNFHLQVVEGHPVSPGLSVMLHMKHGLKLRVTKR  516



>ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=504

 Score =   506 bits (1303),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 338/506 (67%), Gaps = 18/506 (4%)
 Frame = -2

Query  1803  VAFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGP  1630
              A FC + +   R   R PL    P+ GMLP L  ++ + HD    +L  HG T    GP
Sbjct  13    AALFCFLYFFHRRLCCRHPLLTDYPILGMLPQLLFNLWRAHDFFTEILKRHGPTGEFTGP  72

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WFT++D L+T DP NVH+++S NF N+ KG EF+ IF   GDGIF +D + WK  R L  
Sbjct  73    WFTSMDYLVTCDPINVHHMLSKNFHNYVKGPEFRHIFQAFGDGIFTADFEAWKYNRDLFH  132

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGY  1270
             +L   + F  +LV+T  NKV  GL+P+L+    ++G VVDLQDVF RFTFD  C++V G 
Sbjct  133   SLFKQKSFEVFLVKTIHNKVHNGLLPILDHVQ-QQGRVVDLQDVFNRFTFDNICSIVLGN  191

Query  1269  DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQV  1090
             DP CLS+DF +V   KA ++AEE +F RH++P  +WK+Q+WL IG EKK++ AC+ LDQ 
Sbjct  192   DPNCLSIDFSEVAIEKAFNEAEESIFYRHVVPRCVWKIQRWLQIGQEKKMTEACKTLDQF  251

Query  1089  IGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTI  910
             I   I  KR+EL     ++  +N++ + +  DLLT+ +         G   DDKFLRD +
Sbjct  252   IHARIASKREEL-----SKYNENEMGEAHHVDLLTALMRE-------GKAHDDKFLRDAV  299

Query  909   LNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNL  730
              NL +AGRDT +SALTWF WLV+T+P VE  I +E+   + + E  K   +   EE+K L
Sbjct  300   FNLFVAGRDTITSALTWFFWLVATNPSVEAKILEEMKEKLGTKE--KSLGVLSVEEVKRL  357

Query  729   VYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDA  550
             VYLH A+CE+LRL+PP+PF+ K  + +D+LPSGH+V+  T ++FSLYAMGR +  WGKD 
Sbjct  358   VYLHGAICEALRLFPPIPFERKQAISSDMLPSGHRVNSGTMILFSLYAMGRFEETWGKDC  417

Query  549   KEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAV  370
              EFKPERWI+ E+G + + PSYKF+AFNAGPRTCLGK+ +F QMK VA AI+H Y V+ V
Sbjct  418   FEFKPERWIS-EKGGIVYVPSYKFIAFNAGPRTCLGKDSSFIQMKMVATAILHKYRVQVV  476

Query  369   KNHDASPNVSIILYMKHGLKVRVQRR  292
             +   A+P++SI+L MK GLKV++ +R
Sbjct  477   EGFVATPSLSIVLLMKDGLKVQITKR  502



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   504 bits (1299),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 247/505 (49%), Positives = 340/505 (67%), Gaps = 14/505 (3%)
 Frame = -2

Query  1800  AFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPW  1627
             A FC++ +   R   R P+    P+ GMLP L  ++ + HD    VL   GGT    GPW
Sbjct  14    ALFCIMYFFHRRACCRYPILTDYPILGMLPQLLFNLSRCHDFFTEVLKQKGGTGEFTGPW  73

Query  1626  FTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARA  1447
             FTN++ L+T DP NVH+IMS +F N+ KG  F+ IF+  G+GIF +D + WK  R L  +
Sbjct  74    FTNMNYLVTSDPLNVHHIMSKSFHNYVKGPVFRDIFEAFGEGIFTADSETWKYNRDLFHS  133

Query  1446  LIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYD  1267
             L   + F  +L +T   KV+  L+PVL+    ++G VVDLQDVF RFTFD  C++V GYD
Sbjct  134   LFKQKSFEMFLEKTIHKKVQNSLLPVLDHVH-QQGSVVDLQDVFNRFTFDNICSIVLGYD  192

Query  1266  PGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVI  1087
             P CLS+DFP+V   KA ++AEE +F RH++P+ +WKLQ+WL IG EKK+  AC+ LD+ I
Sbjct  193   PNCLSLDFPEVEIEKAFNEAEETIFHRHVVPKCVWKLQKWLQIGQEKKMREACKTLDEFI  252

Query  1086  GKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTIL  907
                I  KR++L     ++  +N+  + +  DLLT  +    G+   G   DD FLRD + 
Sbjct  253   YACIESKREDL-----SKYDENEKEESSHVDLLTVLLREGKGK---GEAHDDIFLRDAVF  304

Query  906   NLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLV  727
             NL +AGRDT +SALTWF WLV+T+P VE  I +E+      G + KK  +   EE+K LV
Sbjct  305   NLFVAGRDTITSALTWFFWLVATNPLVEAKILEEMKEKF--GRNEKKAEVLSVEEVKKLV  362

Query  726   YLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAK  547
             YLH A+CESLRL+PP+PF+ K  L++D+LPSGH V+P T ++F LY+MGR + IWG+D  
Sbjct  363   YLHGAICESLRLFPPIPFERKEALKSDVLPSGHGVNPSTVILFCLYSMGRFEEIWGEDCM  422

Query  546   EFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK  367
             EFKPERWI+ + G V + PSYKF+AFNAGPRTCLGK+V+F QMK VA AI+H Y ++ V+
Sbjct  423   EFKPERWISQKGGNV-YVPSYKFIAFNAGPRTCLGKDVSFIQMKMVATAILHKYRLQVVE  481

Query  366   NHDASPNVSIILYMKHGLKVRVQRR  292
              + A PN+SI+L MK GLKV++++R
Sbjct  482   GYVAKPNLSIVLLMKDGLKVKIKKR  506



>gb|KFK30508.1| hypothetical protein AALP_AA7G271100 [Arabis alpina]
Length=438

 Score =   502 bits (1292),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 318/445 (71%), Gaps = 15/445 (3%)
 Frame = -2

Query  1611  ILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQ  1432
             +L+TVDPAN+H+IMS NF N+PKG EFKK+FDVLGDGIFN+D +LWK+ RK A++++++ 
Sbjct  1     MLVTVDPANIHHIMSSNFANYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNP  60

Query  1431  RFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLS  1252
              F ++ + TS NK+EKGL+P+L+  A E+  +VDL+DVFQRFTFD+TC L TGYDPGCLS
Sbjct  61    EFQKFSLATSLNKLEKGLVPLLDHVANEKL-IVDLEDVFQRFTFDSTCVLATGYDPGCLS  119

Query  1251  VDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYIT  1072
             VD P++ F++A+DDAEE +F RH+ PE LWK+Q  +G G EKK+++A    D+V  KYI 
Sbjct  120   VDMPEIGFARALDDAEEAIFFRHIKPEILWKMQSLIGFGDEKKMTKARATFDRVCSKYIA  179

Query  1071  MKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIA  892
              K+  +     + +P          DLLTSY+N +  +  +    DD+FLRDTIL  M+A
Sbjct  180   SKKDMVSREVDSSSPSQ--------DLLTSYMNLDTTKYKLLNPSDDRFLRDTILTFMLA  231

Query  891   GRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV-----NSGEDPKKFRLFKAEELKNLV  727
             GRDTT S LTW  WL+   PE    IR+E+ T +       G D      F  +ELK LV
Sbjct  232   GRDTTGSGLTWLFWLLLKTPEAMPKIREEINTNLYPNTKTDGSDSNDSDSFNPQELKKLV  291

Query  726   YLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAK  547
             YLH A+CE+LRLYPPVPFQHKSP + D+LPSGHKV  +++++F LY++GRM+ +WG+DA 
Sbjct  292   YLHGAICEALRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDAL  351

Query  546   EFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK  367
             EFKPERWI+ E G   HEPSYKFL+FNAGPRTCLGKEVA  QMK VA  II NY ++ V+
Sbjct  352   EFKPERWIS-ETGKSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEMKIVE  410

Query  366   NHDASPNVSIILYMKHGLKVRVQRR  292
                  P  S+IL+ KHGLKV V +R
Sbjct  411   GQKIEPAPSVILHTKHGLKVTVTKR  435



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   503 bits (1295),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 252/510 (49%), Positives = 337/510 (66%), Gaps = 16/510 (3%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRR----PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFL  1642
             I   F   ++W  LR  + +    P   P   MLP++ +++ +IH+    VL   GGT+ 
Sbjct  12    IIFGFTYFIVWY-LRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHEYMTEVLIDVGGTYE  70

Query  1641  LKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQR  1462
              +GP F NLD+ +T D AN+H+I S NF N+PKG EF+KIFD+LG+GIFN D +LW+  R
Sbjct  71    FEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIHR  130

Query  1461  KLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTL  1282
             K   +++ H +F   L R  W+ VEKGL P+L+ A  E+   +DLQDV QRFTFD+   L
Sbjct  131   KTTLSIMSHAKFQTLLERNLWDTVEKGLRPILD-AFTEQDKTLDLQDVLQRFTFDSITKL  189

Query  1281  VTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEI  1102
             +  +DP  LS+D P +P+ KA  DA + L  RH+ PE+ WKLQ+WL IG EKKL++A E 
Sbjct  190   LLDHDPRSLSIDLPYLPYEKAFGDALDALLHRHITPENCWKLQKWLQIGKEKKLTQAWES  249

Query  1101  LDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFL  922
              DQ I   I+ K +EL+           I DE  F  LT+YI   +      L    KFL
Sbjct  250   FDQFIYPCISQKLEELM--------KKTIKDEESFTFLTAYIRMYNLRNKGDLGTLQKFL  301

Query  921   RDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEE  742
             RDT LNLM AGRDTT +ALTWF WL++ +P VE  IR+E+   ++  +D +  + F  EE
Sbjct  302   RDTFLNLMFAGRDTTGAALTWFFWLLAKNPLVETKIREEIQQQLHLKKD-ENLKFFNKEE  360

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
              + LVYLHAA CE+LR +P V  +HK PL+ DILPSGH+V+P TR++   Y+MGRM+ IW
Sbjct  361   TRKLVYLHAAFCETLRFFPSVSLEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMETIW  420

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             GKD  EFKPERWI+ ERG +KHEPS+KF AFNAGPRTC+GKE+AF QMK VAA I++NY 
Sbjct  421   GKDCLEFKPERWIS-ERGGIKHEPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNYD  479

Query  381   VRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             ++ V+  ++SP  SII+ MKHGL VRV +R
Sbjct  480   IQLVEAQNSSPTTSIIMQMKHGLMVRVVKR  509



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   502 bits (1292),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/510 (49%), Positives = 336/510 (66%), Gaps = 16/510 (3%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRR----PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFL  1642
             I   F   ++W  LR  + +    P   P   MLP++ +++ +IH     VL   GGT+ 
Sbjct  12    IIFGFTYFIVWY-LRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHKYMTEVLIDVGGTYE  70

Query  1641  LKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQR  1462
              +GP F NLD+ +T D AN+H+I S NF N+PKG EF+KIFD+LG+GIFN D +LW+  R
Sbjct  71    FEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIHR  130

Query  1461  KLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTL  1282
             K   +++ H +F   L R  W+ VEKGL P+L+ A  E+   +DLQDV QRFTFD+   L
Sbjct  131   KTTLSIMSHAKFQTLLERNLWDTVEKGLRPILD-AFTEQDKTLDLQDVLQRFTFDSITKL  189

Query  1281  VTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEI  1102
             +  +DP  LS+D P +P+ KA  DA + L  RH+ PE+ WKLQ+WL IG EKKL++A E 
Sbjct  190   LLDHDPRSLSIDLPYLPYEKAFGDALDALLHRHITPENCWKLQKWLQIGKEKKLTQAWES  249

Query  1101  LDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFL  922
              DQ I   I+ K +EL+           I DE  F  LT+YI   +      L    KFL
Sbjct  250   FDQFIYPCISQKLEELM--------KKTIKDEESFTFLTAYIRMYNLRNKGDLGTLQKFL  301

Query  921   RDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEE  742
             RDT LNLM AGRDTT +ALTWF WL++ +P VE  IR+E+   ++  +D +  + F  EE
Sbjct  302   RDTFLNLMFAGRDTTGAALTWFFWLLAKNPLVETKIREEIQQQLHLKKD-ENLKFFNKEE  360

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
              + LVYLHAA CE+LR +P V  +HK PL+ DILPSGH+V+P TR++   Y+MGRM+ IW
Sbjct  361   TRKLVYLHAAFCETLRFFPSVSLEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMETIW  420

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             GKD  EFKPERWI+ ERG +KHEPS+KF AFNAGPRTC+GKE+AF QMK VAA I++NY 
Sbjct  421   GKDCLEFKPERWIS-ERGGIKHEPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNYD  479

Query  381   VRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             ++ V+  ++SP  SII+ MKHGL VRV +R
Sbjct  480   IQLVEAQNSSPTTSIIMQMKHGLMVRVVKR  509



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   502 bits (1292),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 260/521 (50%), Positives = 339/521 (65%), Gaps = 18/521 (3%)
 Frame = -2

Query  1833  MASIDYF-EIFVAFFCLV--IWIILRDGYRR----PLKVPLFGMLPSLFLHVRKIHDRCA  1675
             M  ++YF  + V   C     W  L + + +    P   PL GMLP L  +V ++H+   
Sbjct  1     MYVLEYFLSLLVIIMCFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIRNVHRVHEFAT  60

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              VL    GTF   GP   NL++L T DPAN+H+I+S NF N+PKG EF+K FD+LG+GIF
Sbjct  61    DVLVETKGTFEFHGPVLANLNMLATSDPANIHHILSKNFSNYPKGVEFRKFFDILGNGIF  120

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             N D +LW+  RK   +L+ H +F  +L R  W+ +E GL P+L+  A E+  + DLQD+F
Sbjct  121   NVDYELWEIHRKTTMSLMSHAKFQTFLERNLWDIIENGLRPILDTFA-EQDTLFDLQDIF  179

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRFTFD    L+  YDP  LS+D P VP  KA +D  + L  RH+LPE  WKLQ+WL IG
Sbjct  180   QRFTFDAISKLLLDYDPKSLSIDLPHVPCEKAFNDVVDALMYRHILPEGCWKLQKWLRIG  239

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
              EK+L +A E  DQ +   I+ K++EL+         + I DE  F  L  YI   +   
Sbjct  240   KEKQLIQAWEAFDQFLYPCISRKQEELM-------QKSTIKDEE-FTFLNEYIKMYNQWK  291

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                L     FLRDT LNLM+AGRDTTS+ALTWF WL++ +P VEK IR+E+   ++  ED
Sbjct  292   DGDLGTLQTFLRDTFLNLMLAGRDTTSAALTWFFWLLAKNPLVEKRIREEIQQQLHLKED  351

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +  + F  EE K LVYLH ALCE+LR +P V  +HK PL+ DILPSGH VSP+TR++ S
Sbjct  352   -ENLKCFNIEETKRLVYLHGALCETLRFFPSVAIEHKLPLEFDILPSGHHVSPNTRVVLS  410

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
              Y MGRM+ IWGKD  EFKPERWI+ ERG +KHEPSYKF AFNAGPRTC+GKE+AF QMK
Sbjct  411   FYTMGRMESIWGKDCLEFKPERWIS-ERGGIKHEPSYKFPAFNAGPRTCIGKEMAFIQMK  469

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              VAA II+NYH++  ++    PN S+I+ MKHGLKVR+ +R
Sbjct  470   IVAATIIYNYHIQLGEDQIILPNSSVIIQMKHGLKVRLVKR  510



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score =   498 bits (1283),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 239/478 (50%), Positives = 327/478 (68%), Gaps = 16/478 (3%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP L  ++ + HD    +L LHG T    GPWFTN+D L+T DP NVH+++S NF N+ 
Sbjct  1     MLPQLLFNLWRAHDFFTEILKLHGPTGEFTGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EF+ IF   GDGIF +D + WK  R L  +L   + F  +LV+T  NKV  GL+P+L
Sbjct  61    KGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHSLFKQKSFEVFLVKTIHNKVHNGLLPIL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +    ++G VVDLQDVF RFTFD  C++V G DP CLS+DF +V   KA ++AEE +F R
Sbjct  121   DHVQ-QQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSIDFSEVAIEKAFNEAEESIFYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H++P  +WK+Q+WL IG EKK++ AC+ LDQ I   I  KR+EL     ++  +N++ + 
Sbjct  180   HVVPRCVWKIQRWLQIGQEKKMTEACKTLDQFIHARIASKREEL-----SKYNENEMGEA  234

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +  DLLT+ +         G   DDKFLRD + NL +AGRDT +SALTWF WLV+T+P V
Sbjct  235   HHVDLLTALMRE-------GKAHDDKFLRDAVFNLFVAGRDTITSALTWFFWLVATNPSV  287

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
             E  I +E+   + + E  K   +   EE+K LVYLH A+CE+LRL+PP+PF+ K  + +D
Sbjct  288   EAKILEEMKEKLGTKE--KSLGVLSVEEVKRLVYLHGAICEALRLFPPIPFERKQAISSD  345

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGH+V+  T ++FSLYAMGR +  WGKD  EFKPERWI+ E+G + + PSYKF+AFN
Sbjct  346   MLPSGHRVNSGTMILFSLYAMGRFEETWGKDCFEFKPERWIS-EKGGIVYVPSYKFIAFN  404

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AGPRTCLGK+ +F QMK VA AI+H Y V+ V+   A+P++SI+L MK GLKV++ +R
Sbjct  405   AGPRTCLGKDSSFIQMKMVATAILHKYRVQVVEGFVATPSLSIVLLMKDGLKVQITKR  462



>ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=500

 Score =   499 bits (1286),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 240/482 (50%), Positives = 328/482 (68%), Gaps = 17/482 (4%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P+ GMLP L  ++ + HD    VL  HGGT    GPWFTN+D L+T DP NVH+++S NF
Sbjct  34    PIIGMLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINVHHMLSKNF  93

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+ KG EF+ IF   GDGIF +D + WK  R L  +L   + F  ++ +T  NKV  GL
Sbjct  94    HNYVKGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTIHNKVHNGL  153

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L+    ++G VVDLQDVF RFTFD  C++V G DP CLS+DF +V   KA ++ EE 
Sbjct  154   LPILDHVQ-QQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSIDFSEVAIEKAFNEVEES  212

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+LP  +WK+Q+WL IG EKK++ AC+ LDQ I   I  KR++L     ++  +N+
Sbjct  213   IFYRHVLPRCVWKIQRWLQIGQEKKMTEACKTLDQFIHACIASKREKL-----SKYNENE  267

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
             + + +  D LT+ +             DDKFLRD + NL +AGRDT +SALTWF WLV+T
Sbjct  268   MGEAHHVDFLTALMREETAH-------DDKFLRDAVFNLFVAGRDTITSALTWFFWLVAT  320

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             +P VE  I +E+   + + E  K   +   EE+K LVYLH A+CE+LRL+PP+PF+ K  
Sbjct  321   NPSVEAKILEEMKEKLGTKE--KTLGVLSVEEVKRLVYLHGAICEALRLFPPIPFETKQA  378

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
             ++ D+LPSGH+V+  T+++F LYAMGR +  WGKD  EFKPERWI+ E+G + + PSYKF
Sbjct  379   IKADMLPSGHRVNSGTKILFILYAMGRSEETWGKDCLEFKPERWIS-EKGGIVYVPSYKF  437

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             +AFNAGPRTCLGKE++F QMK VAAAI+H Y VR V +H A+P+ SI+L MK GLKV++ 
Sbjct  438   IAFNAGPRTCLGKEISFIQMKMVAAAILHKYRVRVV-DHVATPSPSIVLLMKDGLKVQIA  496

Query  297   RR  292
             +R
Sbjct  497   KR  498



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   499 bits (1286),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 250/517 (48%), Positives = 343/517 (66%), Gaps = 20/517 (4%)
 Frame = -2

Query  1833  MASIDY-FEIFVAFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA + Y   I  AFFC + +   R   R PL    P+ GMLP L  ++ + HD    VL 
Sbjct  1     MAMLAYEAAIIAAFFCFLYFFHRRQCCRHPLFTDFPILGMLPQLLFNLWRAHDYSTQVLK  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
               GGT    GPWFT ++ L+T DP NVH++MS +F N+ KG  F++IF   GDGIF +D 
Sbjct  61    QRGGTAEFTGPWFTKMNCLVTGDPINVHHVMSKSFPNYVKGPVFREIFQAFGDGIFTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             + WK  R L  +L  H+ F  +L +T  NKV+  L+P+L+    ++G VVDLQDVF RFT
Sbjct  121   EAWKYNRNLFHSLFKHRSFEVFLEKTIHNKVQNTLLPMLD-NLQQQGRVVDLQDVFNRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD  C++V GYDP CLS+DFP+V   KA + AEE +F R ++P   WKLQ+WL IG EKK
Sbjct  180   FDNICSMVLGYDPSCLSIDFPEVEIEKAFNQAEESIFYRQIVPICFWKLQKWLQIGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++ AC+ L+Q I   I  KR+EL     N+  +N++ + +  DLLT+ +         G 
Sbjct  240   MTEACKTLNQFIHACIASKREEL-----NKYKENEMGEAHK-DLLTALMRE-------GK  286

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DD FLRD++ NL +AGRDT +SALTWF WLV+T+P VE  I +E+     + E  K  
Sbjct  287   AHDDGFLRDSVFNLFVAGRDTITSALTWFFWLVATNPLVEAKILEEIKEQFETNE--KML  344

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
              +   EE+K LVYLH A+CE+LRL+PP+PF+ K  ++ D+LPSGH V+  T ++FSLYAM
Sbjct  345   GVLTVEEVKKLVYLHGAICEALRLFPPIPFERKLAIKADVLPSGHSVNSRTMILFSLYAM  404

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GR +  WGKD  EFKPERWI+ E+ ++ + PSYKF+AFNAGPRTCLGK+++F QMK VAA
Sbjct  405   GRFEETWGKDCLEFKPERWIS-EKRSIVYVPSYKFIAFNAGPRTCLGKDLSFFQMKMVAA  463

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AI+ NY V+ V+ + A+P++SI+L MK GLKV++ +R
Sbjct  464   AILSNYRVQVVEGYVATPSLSIVLLMKDGLKVKITKR  500



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   499 bits (1286),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 345/522 (66%), Gaps = 36/522 (7%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRR----------------PLKVPLFGMLPSLFLHVRKIHDRC  1678
             ++ A   LVI+I L   + R                P   P+FGMLP L L+  ++H   
Sbjct  1     MYTAIILLVIFIYLPYHFYRNYFHARKDKKSSPAPPPTDWPIFGMLPGLLLNCGRVHTFM  60

Query  1677  AAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGI  1498
               +L   GGTF LKG WF N+ +LIT DPANVHYI++ NF NF KG +FKK+FDVLGDGI
Sbjct  61    TELLESSGGTFYLKGAWFANMSMLITSDPANVHYILAKNFPNFEKGPQFKKMFDVLGDGI  120

Query  1497  FNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDV  1318
             FN++ + W+ Q++ A++L+ +  F  ++ RTSW+KVE  LIP+LE A+ E G  VDLQ++
Sbjct  121   FNAESESWEIQKRTAKSLMHNTSFPDFIARTSWSKVENALIPILELAS-ETGTEVDLQEL  179

Query  1317  FQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGI  1138
             FQRF FD +C  V G+DP  L  + P +P  KA  DAE+ +  RH+LPE  WKLQ WL I
Sbjct  180   FQRFAFDCSCITVLGHDPVSLCKELPHLPHEKAFADAEQAVLYRHMLPEFTWKLQSWLHI  239

Query  1137  GPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN--ND  964
             G E +L++A +++ + +   I+MK Q+  LT     P +D     G D+LTS +    ++
Sbjct  240   GKENELTKAKDVIHRFVSDCISMKHQDFNLT----GPKDD-----GLDMLTSCMRARADE  290

Query  963   GETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNS  784
             G       + D+  +DT+LNL+ AG+DT S+AL WF WLV+T+P  ++ IR E+      
Sbjct  291   GINAAPNNYSDEVWKDTLLNLIFAGKDTISAALAWFFWLVATNPAEQEKIRREI------  344

Query  783   GEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRL  604
               D   +R    EE K LVYLH ALCE+LRL+PPVPFQHK+P++ DILPSGH++SP+T+ 
Sbjct  345   --DDTNWRFTTIEESKKLVYLHGALCETLRLFPPVPFQHKAPVEHDILPSGHRISPNTKT  402

Query  603   MFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFT  424
             + S Y+MGRM+ IWG D  +FKP RWI+ E G V+ EPS+KF AFNAGPR+CLGK+V+F 
Sbjct  403   VLSFYSMGRMESIWGNDCLDFKPGRWIDPETGRVRTEPSFKFTAFNAGPRSCLGKDVSFI  462

Query  423   QMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             Q+K VAAAI+  +++R  +    +P++S+IL+MKHGLKV+V 
Sbjct  463   QLKIVAAAIVSRFNIRVARGFSVTPSISVILHMKHGLKVKVS  504



>ref|XP_004142039.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=467

 Score =   498 bits (1281),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 241/475 (51%), Positives = 326/475 (69%), Gaps = 18/475 (4%)
 Frame = -2

Query  1704  HVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKK  1525
             H+ +IHDR   +L     TF  +G WFTN  +LITVDP+N+H+IM+ NF+N+PKG +FK 
Sbjct  5     HIDRIHDRITEILQQTSCTFFFEGIWFTNTSLLITVDPSNIHHIMTSNFQNYPKGPDFKY  64

Query  1524  IFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGER  1345
             IFDVLGDGIFNSD D WKNQRK+A++LI+H++F  ++   +  KVEKGL+P+LE+   E 
Sbjct  65    IFDVLGDGIFNSDSDSWKNQRKIAQSLIVHEKFFEFMCGVAKEKVEKGLVPILEYFC-ES  123

Query  1344  GGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESL  1165
               VVDL+D+F R  FDTTCT+V G+D   LS+DFPD+PF+KAMDD +EV+F RHL P+  
Sbjct  124   KKVVDLKDLFLRLMFDTTCTMVAGFDFNSLSIDFPDIPFTKAMDDIQEVIFFRHLYPKFY  183

Query  1164  WKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLT  985
             W+L + LG+G  KK+    + ++QVI   I +K+Q L L  ++   D         DL+T
Sbjct  184   WELLKKLGLGDAKKMKNGTDTINQVIAHLIALKKQRLKLQQEDDGGDP--------DLIT  235

Query  984   SYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDE  805
              Y+ N       G+ ++DKF RD IL  +IAGRD  S AL+W    +S +P +  NIR+E
Sbjct  236   RYMMNEHD----GIDYNDKFFRDLILTYLIAGRDGLSIALSWLFLTLSKNPTIIANIREE  291

Query  804   LLTAVNSGEDPKKFR--LFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSG  631
             L        + +K +  +F +EEL NL YLH A+CE LRLYPPV F+HKS ++ D LPSG
Sbjct  292   LKNIPQKESESRKGKPQIFGSEELSNLAYLHGAICEILRLYPPVAFEHKSSVEADTLPSG  351

Query  630   HKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRT  451
             H V   TR++ S YA+GR++ +WG+D +EFKPERWI+ E+G +K EPSYKF  FN GPR+
Sbjct  352   HLVKAGTRIVLSTYALGRIKSVWGEDCEEFKPERWIS-EKGRIKREPSYKFFTFNTGPRS  410

Query  450   CLGKEVAFTQMKAVAAAIIHNYHVRAV--KNHDASPNVSIILYMKHGLKVRVQRR  292
             CLGKEV   Q+K ++AAIIHNY + AV   N+  +P  SIIL+MK G KVRV +R
Sbjct  411   CLGKEVTIAQLKIISAAIIHNYDIEAVVEDNNGIAPVASIILHMKTGFKVRVSKR  465



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   499 bits (1285),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 252/519 (49%), Positives = 338/519 (65%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWII--LRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             M  + Y  + +   C   +I   LR+ + +   P   P  GMLP++ L+  +IHD    V
Sbjct  1     MDFLKYSLLILIILCFTYFITCYLRNRWTKTSAPTYWPFVGMLPAIILNFHRIHDYITKV  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L   GGTF  KGP F  +D+LIT DPAN+H+I S NF N+PKG EF+KIFD+LG+GIFN 
Sbjct  61    LIETGGTFEFKGPIFAYMDMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNV  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LW+  RK   +++ H +F   L R  WN +EK   P+L+ A  E+G  +DLQD+ QR
Sbjct  121   DSELWELHRKTTMSIMSHAKFQTLLERNMWNIIEKRFRPILD-AFAEQGNSLDLQDILQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
              +FD+   L+  +DP  LS+DFP VP  KA  DA + L  RH++PES WKLQ+WL IG E
Sbjct  180   LSFDSITKLLLDHDPRSLSIDFPHVPCEKAFTDAIDALLFRHIIPESCWKLQKWLQIGKE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             KKL++A E  D+ +   I+ K++EL+           I DE  F  L +YI   +     
Sbjct  240   KKLTQAWEAFDEFLYPCISQKQEELM--------KKTIKDEE-FTFLAAYIKMYNSWNKG  290

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
              L     FLRDT LNLM+AGRD+TSSA+TWF W ++ +P VE  IR+E+   ++  ++ +
Sbjct  291   DLGTLQNFLRDTFLNLMLAGRDSTSSAITWFFWFLAKNPLVETKIREEIQQQLHLKKE-E  349

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
               + F  EE+  LVYLH ALCE+LR +P +  +HK PL  DILPSGH V+P TRL+   Y
Sbjct  350   NLKFFNNEEMLKLVYLHGALCETLRFFPSLSLEHKVPLAHDILPSGHHVTPKTRLIIPFY  409

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             + GRM+ IWGKD  EFKPERWI+ ERG +KHEPS+KF AFNAGPRTC+GK +AFT +K V
Sbjct  410   STGRMETIWGKDYLEFKPERWIS-ERGGIKHEPSFKFPAFNAGPRTCIGKNMAFTHLKIV  468

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA IIHNYH++ V+  + SP  SII+ +KHGLKVRV +R
Sbjct  469   AATIIHNYHIQLVEAQNISPTTSIIMLVKHGLKVRVVKR  507



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score =   498 bits (1283),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 246/517 (48%), Positives = 347/517 (67%), Gaps = 21/517 (4%)
 Frame = -2

Query  1833  MASIDYFEIFV-AFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA + Y  + V A  C++ ++  +   R PL    P+ GMLP +  ++ + HD  + VL 
Sbjct  1     MAMLVYEAVIVTAVLCMLYFLHRKRCCRHPLFPDYPIIGMLPPVLCNLWRAHDLISDVLK  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
              HGGT    GPWFT ++ LI+ DP NVH++MS NF N+ KG  F+ IF   GDGIF +D 
Sbjct  61    QHGGTGEFTGPWFTIMNCLISSDPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             + WK  R L  +L  ++ F  +L +T  NKV+  L+P+L+    +R  VVDLQDVF RFT
Sbjct  121   EAWKYNRDLFHSLFKNRSFEFFLEKTIQNKVQNSLLPMLDHMHQQRK-VVDLQDVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD  C+LV GYDP CLSVD P+V   KA ++AEE +F RH +P+ +WKLQ+WL IG EKK
Sbjct  180   FDNICSLVLGYDPNCLSVDIPEVAIEKAFNEAEESIFYRHTVPKCVWKLQKWLQIGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++ AC+ LDQ I   I  KR EL       + DN++ + +  DL+T+ +           
Sbjct  240   MTEACKTLDQFIHACIASKRVEL-------SNDNEMGEAHHVDLITALMREKQTH-----  287

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DD+F+RD + NL +AGRDT +SALTWF WLV+T+P VE  I +E+   + + E  K  
Sbjct  288   --DDRFIRDAVFNLFVAGRDTITSALTWFFWLVATNPLVEAKILEEIKEKLETNE--KTL  343

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
              +   E++K LVYLH A+CE+LRL+PP+PF+ K  ++ D+LPSGH+V+P T ++ SLYAM
Sbjct  344   GVLSVEKVKKLVYLHGAICETLRLFPPIPFERKLAIKADMLPSGHRVNPRTMILISLYAM  403

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GR++  WGKD  EFKPERWI+ E+G + + PSYKF+AFNAGPRTCLGK+++F QMK VAA
Sbjct  404   GRLEETWGKDCLEFKPERWIS-EKGGIVYVPSYKFIAFNAGPRTCLGKDLSFIQMKMVAA  462

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AI++ YHV+ V+++ A+P++SI+L +K GLKV + +R
Sbjct  463   AILYKYHVQVVEDYVATPSLSIVLLIKDGLKVMITKR  499



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   498 bits (1283),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 253/519 (49%), Positives = 339/519 (65%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWII--LRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             M  ++Y  + +   C   +I   LR  + +   P+  P  GMLP++ L+   IHD    V
Sbjct  1     MDFLEYSLLLLIILCFTYFITWYLRKRWTKTSAPIYWPFVGMLPAIILNFHHIHDYITKV  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L+  GGTF  KGP F N+D+LIT DPAN+H+I S NF N+PKG EF+KIFD+LG+GIFN 
Sbjct  61    LTETGGTFEFKGPIFANMDMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNV  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LW+  RK+  +++ H +F   L    W  ++K L P+L+  A E+G   DLQD+ QR
Sbjct  121   DSELWELHRKITMSIMSHAKFQTLLENNMWGIMDKRLRPILDVFA-EQGNSFDLQDILQR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
              +FD+   L+  +DP  LS+D P VP  KA  DA + L  RH++PES WKLQ+WL IG E
Sbjct  180   LSFDSITKLLLDHDPRSLSIDVPHVPCEKAFTDAIDALLFRHIMPESCWKLQKWLQIGKE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             KKLS+A E  D+ +   I+ K++EL+   K    D D      F  L +YI   +     
Sbjct  240   KKLSQAWEAFDEFLYPCISHKQEELM---KKTAKDED------FTFLAAYIKMYNSWNKG  290

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
              L    KFLRDT LNLM+AGRD+TSSALTWF   ++ HP VE  IR+E+   ++  +D +
Sbjct  291   DLGTLQKFLRDTFLNLMLAGRDSTSSALTWFFLFLAKHPLVETKIREEIQQKMHLKKD-E  349

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
               + F  EE+  LVYLH ALCE+LR +P +  +HK PL  DILPSGH V+P T+++   Y
Sbjct  350   NLKFFNKEEMLKLVYLHGALCETLRFFPSLSLEHKVPLAHDILPSGHHVTPKTKMIIPFY  409

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
              MGRM+ IWGKD  EFKPERWI+ E+G +KHEPS+KF AFNAGPRTC+GK +AFTQ+K V
Sbjct  410   TMGRMETIWGKDYLEFKPERWIS-EQGKIKHEPSFKFPAFNAGPRTCIGKNMAFTQLKIV  468

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA IIHNYH++ V+  + SP  SII+ +KHGLKVRV +R
Sbjct  469   AATIIHNYHIQLVEAQNISPTTSIIMLVKHGLKVRVVKR  507



>ref|XP_009123569.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
 emb|CDY41980.1| BnaA01g05520D [Brassica napus]
Length=503

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/518 (48%), Positives = 347/518 (67%), Gaps = 22/518 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MAS+   E  VA  C +I+  ++ +  + R LK  P+ GMLP   + + +I+D    VL 
Sbjct  1     MASLSLLEASVALLCFLIFHHLLFKKPHDRFLKNWPVLGMLPGFLIVLHRIYDFSVEVLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGPWFT +DIL+TVDPAN+HYI+S NF N+ KG +FK++FDV G+ IFNSD 
Sbjct  61    QTNLTFPFKGPWFTGMDILVTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEMIFNSDG  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLE-FAAGERGGVVDLQDVFQRF  1306
             D+W+NQR+ A+ ++ HQ F +  +  +  K++ GL+P+ + F+  E   VVDLQ+VFQRF
Sbjct  121   DMWRNQRRAAQYMLNHQGFQKLSMSATRAKLDDGLVPLFDRFSKKEM--VVDLQNVFQRF  178

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDTT  LVTG+DP  LSV+ P+  ++KA+D   + +F RH++P+ LWKLQ+W+G G EK
Sbjct  179   TFDTTFVLVTGFDPKTLSVEMPEDEYAKALDVLGDGIFFRHVVPKFLWKLQKWIGFGQEK  238

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             +   A    D+V  KYI+ KR+E+      +  D   N E   DLLTS++  +  +  + 
Sbjct  239   RTMEAGATFDRVSAKYISAKRKEM------RTQDQQSNGECHEDLLTSHMKLDTTKYEIL  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDTIL   +AGRDTT+SAL+WF WL+S +P V   IR E++T +N       
Sbjct  293   NPSDDKFLRDTILAFNLAGRDTTASALSWFFWLLSENPRVVTKIRQEIITNIN-------  345

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
               L     L  LVYL AAL ES+RLYPPVPFQ KSP++ D+LPSGHKV   + +M  LYA
Sbjct  346   --LHGQHNLDKLVYLQAALYESMRLYPPVPFQRKSPIKPDLLPSGHKVDSSSTIMIFLYA  403

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+DA EFKPERW++ + G ++HEPS+KFL+FNAGPRTC GK++A T MK VA
Sbjct  404   LGRMRAVWGEDAMEFKPERWVS-QSGCLRHEPSFKFLSFNAGPRTCPGKQLALTLMKTVA  462

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               I+ NY ++ +K     P+  +ILYMKHGL+V + +R
Sbjct  463   VEILQNYDIKVIKGQKIEPDPGLILYMKHGLRVTITKR  500



>ref|XP_010653011.1| PREDICTED: cytochrome P450 86B1-like [Vitis vinifera]
Length=478

 Score =   497 bits (1279),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 234/487 (48%), Positives = 334/487 (69%), Gaps = 12/487 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP + LH   +H++   +L L  GT L+KG WF N+D+L T +P NVH+++
Sbjct  3     PRNWPIVGMLPMILLHFHCMHEKYTKILELSKGTILIKGAWFANIDMLTTSNPDNVHHVL  62

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG +F++IF++LG+G+FNSD D W+  R LA+  + H++FHR++ + + + +
Sbjct  63    STNFSNYPKGPKFRRIFNILGNGLFNSDFDEWRKIRGLAQGFVNHKQFHRFMAKINHDFL  122

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E  L+PVL+  A ++  VVDLQDVFQR   D TC   T Y+P  L + FP+VPF KA+D+
Sbjct  123   ENKLVPVLD-NASQQNLVVDLQDVFQRLMLDATCITATSYNPNSLCIGFPEVPFLKALDN  181

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             A E +F RHL+PE   K Q+WLGIG EKKLS+ACE+LD ++ KYI+M+++EL    K + 
Sbjct  182   AGEAIFFRHLVPEGFLKSQRWLGIGKEKKLSKACEVLDHIVAKYISMRQEEL---GKGKR  238

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
             P+    +++ FD L   +   +     G    +K++RD IL L+ AG+D+TS+ALTW  W
Sbjct  239   PE---ENKDSFDALKYQLTETE---IFGTTPTNKYMRDAILGLIFAGQDSTSAALTWLFW  292

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L+S +P VE NI++EL + +   +   K  +F  EEL  LVYLH AL E+LRL+PP P Q
Sbjct  293   LLSKNPSVETNIKEELKSKLPVNK-ANKLHIFTEEELNKLVYLHGALYETLRLFPPAPLQ  351

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              ++ +  D LPSGHKV+   +++FS YAMGRM  +WG D  EFKPERWI  E+G +KH P
Sbjct  352   VRTCIHPDTLPSGHKVNSKMKIVFSAYAMGRMTSVWGNDCLEFKPERWIT-EKGGIKHVP  410

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KFLAF+ GPR CLGKE A T+ K+VAA I+HNYHV+ ++    +P  SI+L+MK+GL+
Sbjct  411   SHKFLAFSVGPRICLGKESAITRKKSVAAVILHNYHVQVMEGQFVTPKASIVLHMKNGLR  470

Query  309   VRVQRRW  289
             VR +  W
Sbjct  471   VRNKNTW  477



>ref|XP_008440137.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=434

 Score =   494 bits (1273),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 327/447 (73%), Gaps = 22/447 (5%)
 Frame = -2

Query  1605  ITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRF  1426
             +TVDP+N+H+IMS NF N+PKG +FK IFDVLGDGIFNSD D WKNQRK+A++LI+H++F
Sbjct  1     MTVDPSNIHHIMSTNFHNYPKGPDFKYIFDVLGDGIFNSDSDSWKNQRKIAQSLIVHEKF  60

Query  1425  HRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVD  1246
               ++ R +  KVEKGL+P+LE+   E   VVDL+D+F R  FD+TC +VTG+D   LS++
Sbjct  61    LEFMARAAKEKVEKGLVPILEYFC-ESKNVVDLKDLFLRLAFDSTCMMVTGFDLNSLSIE  119

Query  1245  FPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMK  1066
             FP++PFSKAMDD +EV+F+RHL P+  W+L + LGIG  K++ +AC+I+D+VI   + +K
Sbjct  120   FPEIPFSKAMDDVQEVIFLRHLYPKFYWELLKKLGIGDGKRMKKACDIIDEVIANLMAVK  179

Query  1065  RQELILTYKNQNPDNDINDE--NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIA  892
             R+ L         D ++ +E  +G DL+T Y+ N   E    +  +DKFLRDT+LN MIA
Sbjct  180   RERL-------QRDREVKEEQDHGADLITWYMVNEHDE----IDCNDKFLRDTVLNFMIA  228

Query  891   GRDTTSSALTWFIWLVSTHPEVEKNIRDEL----LTAVNSGEDPKKFRLFKAEELKNLVY  724
             GRD  S  L+W  +++S +P +   IR+EL      + N  E  +K R+F  +EL NLVY
Sbjct  229   GRDALSVTLSWLFFVLSKNPTIVAKIREELKGIPTISQNEQEQQQKPRVFTIQELNNLVY  288

Query  723   LHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKE  544
             LH ALCE+LRLYPP+ F+HKSP++ + LPSGH V P  R++FSLYA+GRM+ +WG+D +E
Sbjct  289   LHGALCETLRLYPPIAFEHKSPVEAETLPSGHHVRPGMRILFSLYALGRMRSVWGEDCEE  348

Query  543   FKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAV--  370
             FKPERWI+ ++G +K EPSYKF +FNAGPRTCLGK VAF+Q+K V+AAIIHNY + AV  
Sbjct  349   FKPERWIS-DKGTIKREPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIIHNYDIEAVDE  407

Query  369   -KNHDASPNVSIILYMKHGLKVRVQRR  292
               N+  +P  S+IL+MK G +V+V +R
Sbjct  408   DSNNAVAPAASVILHMKSGFRVKVTKR  434



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   498 bits (1281),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 255/522 (49%), Positives = 342/522 (66%), Gaps = 21/522 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLV--IWIILRDGYRR-----PLKVPLFGMLPSLFLHVRKIHDRCA  1675
             M  ++Y  +F+  FC    IW I+   YRR     P   P+   LP +  ++ + H    
Sbjct  1     MDFLEYSLLFLLIFCSTYSIWFII---YRRTKTSAPTNWPILRELPGVIGNLHRGHAYMT  57

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              VL  +GGT+  KGP FTN+D+  T DPAN+HYI S NF N+PKG EF+KIFD+LG+GIF
Sbjct  58    EVLIEYGGTYDFKGPIFTNVDMFFTCDPANIHYIFSKNFSNYPKGPEFRKIFDMLGNGIF  117

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             N D +LW+  R+   +++ H +F   L +T W+ +EKGL P+L+ A  ++G  +DLQDV 
Sbjct  118   NVDHELWELHRRTTMSIMSHAKFQMLLEKTMWDIIEKGLKPILD-AFAKQGKTLDLQDVL  176

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRFTFD+   L+  +DP  LS+D P +P+ KA  DA + L  RH+ P+ LWKLQQWL IG
Sbjct  177   QRFTFDSITRLLLDHDPKSLSMDLPYLPYEKAFGDALDALLHRHITPQRLWKLQQWLRIG  236

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
              EKKL  ACE  DQ I   I  K++EL+   + +        E  F  L +YI   +   
Sbjct  237   KEKKLMHACEAFDQFIYPCIARKQEELMHKSRIK--------EEEFAFLNAYIKVYNQWN  288

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                L     FLRDT LNLM+AG+DTTS+ALTWF  L++ +P VEK IR+E+   ++  ED
Sbjct  289   GGDLGTLQTFLRDTFLNLMLAGKDTTSAALTWFFVLLAKNPLVEKKIREEIQQQLHVKED  348

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +  + F  EE + L+YLH ALCE+LRLYP V  +HK PL  DILP+GH+VSP TR++  
Sbjct  349   -ENLKFFTKEESRKLIYLHGALCETLRLYPSVSLEHKVPLDHDILPTGHRVSPKTRMILP  407

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
              Y MGRM+ +WGKD  EFKPERWI+ ERG +KHEPS+KF AFNAGPRTCLGKE+AF QMK
Sbjct  408   FYVMGRMETLWGKDCLEFKPERWIS-ERGGIKHEPSFKFPAFNAGPRTCLGKEMAFIQMK  466

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRW  289
              VAA IIHNY+++ V+  +  P  SII+ +K+GL V+V +R+
Sbjct  467   IVAATIIHNYNIQVVEPQNVYPTTSIIMQVKNGLMVKVVKRY  508



>gb|KDP46408.1| hypothetical protein JCGZ_10248 [Jatropha curcas]
Length=510

 Score =   496 bits (1278),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 249/519 (48%), Positives = 346/519 (67%), Gaps = 13/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLV-IWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             M  + Y EI +AF  LV +W+  R+     +  P+FGM+P L  +  +IHD    VL  +
Sbjct  1     MGILGYGEIVLAFIFLVFLWVWARNRSSPIIYWPVFGMIPQLLWNASRIHDFSTYVLQCY  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTFL+KGPWF++LD L+T D  N+HY ++ NF N+PKG E K+IF+ LGDGI NSD D 
Sbjct  61    GGTFLVKGPWFSDLDFLVTSDSMNIHYTLNKNFPNYPKGAESKEIFEPLGDGILNSDCDS  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W+ QR++  +    +RF   +  +   K+ KGL PVLE A+  R   +D+Q+VFQRFTFD
Sbjct  121   WRTQRRIIHSFFKDKRFELAIKTSIEQKILKGLFPVLENASKLRNE-IDIQEVFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
              +C LV G+DP  LS++ P+VP  K +  AEE L  RH  P SLWKL++WL IG EK L 
Sbjct  180   NSCQLVLGFDPNSLSIELPEVPIEKVLGGAEEALLYRHFYPTSLWKLKKWLQIGTEKNLK  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG--L  943
             +A +ILD  + + IT K+++L          N I +E+ FDLLT  +  +D +      L
Sbjct  240   KAWDILDDFLQQSITRKQKQL------SQSRNQIQEED-FDLLTYILTISDEQEDQNGIL  292

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
                ++FLRD  L+L++AGRDT S++LTW IW+V+THP VEK I +EL   +   +   K 
Sbjct  293   IKSNRFLRDITLSLLLAGRDTISASLTWLIWVVATHPCVEKKILEELKEYLQV-DTKGKS  351

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
             RLF   EL  LVYLHA +CE LRLYPP+PF HK  ++ DILPSGH +  + R+++SLY+M
Sbjct  352   RLFNFGELSKLVYLHAVVCEVLRLYPPLPFNHKVSIEPDILPSGHHIPKNMRIIYSLYSM  411

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ IWG+D  EFKPERWI+ E G +KH P+YKF+AF  GPR+CLGK +A  ++K +A 
Sbjct  412   GRMKEIWGEDCLEFKPERWIS-ETGQIKHVPAYKFIAFGTGPRSCLGKHMALMELKVIAC  470

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             A+I NY ++  +NH  SP++S+IL++K+GLKV+V  R T
Sbjct  471   AVIWNYSLQIAENHPISPDISVILHIKNGLKVKVSERST  509



>gb|KHN27469.1| Cytochrome P450 86B1 [Glycine soja]
Length=463

 Score =   494 bits (1273),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 238/478 (50%), Positives = 325/478 (68%), Gaps = 17/478 (4%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP L  ++ + HD    VL  HGGT    GPWFTN+D L+T DP NVH+++S NF N+ 
Sbjct  1     MLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EF+ IF   GDGIF +D + WK  R L  +L   + F  ++ +T  NKV  GL+P+L
Sbjct  61    KGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTIHNKVHNGLLPIL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +    ++G VVDLQDVF RFTFD  C++V G DP CLS+DF +V   KA ++ EE +F R
Sbjct  121   DHVQ-QQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSIDFSEVAIEKAFNEVEESIFYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H++P  +WK+Q+WL IG EKK++ AC+ LDQ I   I  KR++L     ++  +N++ + 
Sbjct  180   HVVPRCVWKIQRWLQIGQEKKMTEACKTLDQFIHACIASKREKL-----SKYNENEMGEA  234

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
             +  D LT+ +             DDKFLRD + NL +AGRDT +SALTWF WLV+T+P V
Sbjct  235   HHVDFLTALMREETAH-------DDKFLRDAVFNLFVAGRDTITSALTWFFWLVATNPSV  287

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
             E  I DE+   + + E  K   +   EE+K LVYLH A+CE+LRL+PP+PF+ K  ++ D
Sbjct  288   EAKILDEMKEKLGTKE--KTLGVLSVEEVKRLVYLHGAICEALRLFPPIPFETKQAIKAD  345

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGH+V+  T+++F LYAMGR +  WGKD  EFKPERWI+ E+G + + PSYKF+AFN
Sbjct  346   MLPSGHRVNSGTKILFILYAMGRSEETWGKDCLEFKPERWIS-EKGGIIYVPSYKFIAFN  404

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AGPRTCLGKE++F QMK VAAAI+H Y VR V +H A+P+ SI+L MK GLKV++ +R
Sbjct  405   AGPRTCLGKEISFIQMKMVAAAILHKYRVRVV-DHVATPSPSIVLLMKDGLKVQIAKR  461



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 247/485 (51%), Positives = 328/485 (68%), Gaps = 9/485 (2%)
 Frame = -2

Query  1737  PLFGMLPSL-FLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGN  1561
             P+ GM+P L F  +  +HD    VL   GGT L +GPWF+ ++ L+T DP NV YI+S N
Sbjct  32    PVVGMIPGLLFRPISSVHDFATYVLQRSGGTLLFQGPWFSGMNFLMTSDPMNVQYIVSKN  91

Query  1560  FENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKG  1381
             F N+PKG +F++IF+VLGDGIFN D D W+ QR++  +L+  +RFH  + RT  +K+ KG
Sbjct  92    FANYPKGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRFHLAVERTVEHKILKG  151

Query  1380  LIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEE  1201
             L  VL+    E    VD+QDVFQRFTFD+ C L   YDP  LS++FP VPF+KA DD EE
Sbjct  152   LFVVLD-NVSELASEVDIQDVFQRFTFDSICILALSYDPDSLSIEFPHVPFAKAFDDIEE  210

Query  1200  VLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDN  1021
              +  R+L+P S+WKLQ+ L IG EKKL  A +  D+ + + IT KR++ +   KNQ    
Sbjct  211   AVLYRYLVPSSIWKLQKRLRIGKEKKLRNAWDTFDRFLEQCITRKREQ-VRRSKNQKE--  267

Query  1020  DINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVS  841
                D++ FDLLT Y    +G         +K LRDT   L+IAGRDT S+AL WF WL+ 
Sbjct  268   --RDQDYFDLLTYYFMEVEGGDVNVPVKSNKLLRDTATALLIAGRDTVSAALAWFFWLIG  325

Query  840   THPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKS  661
             THP  EK I +E+   V    +  ++R F  E L  LVYLHAA+CE+LRLYP +P  HK 
Sbjct  326   THPSAEKKILEEIKAKVQPDTN-DEWRHFSLEALNKLVYLHAAICETLRLYPSIPINHKM  384

Query  660   PLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYK  481
              ++ D+LPSGH+V  +TR+++ LY+MGRM+ IWGKD  EFKPERWI  E+G +KH PSYK
Sbjct  385   SVEADVLPSGHRVPGNTRILYFLYSMGRMEEIWGKDCSEFKPERWIC-EKGQIKHIPSYK  443

Query  480   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRV  301
             ++AFNAGPRTCLGK++ F QMK VA+AII NY ++ V N  A+P  S++L+MK GLKVRV
Sbjct  444   YIAFNAGPRTCLGKDLTFLQMKIVASAIIWNYSLQVVDNRPATPCNSVVLHMKGGLKVRV  503

Query  300   QRRWT  286
              +RW 
Sbjct  504   SKRWN  508



>gb|KFK30522.1| hypothetical protein AALP_AA7G273500 [Arabis alpina]
Length=506

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 251/517 (49%), Positives = 345/517 (67%), Gaps = 17/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             M SI   E  +   C +I+  +I +  + R L+  P+ GMLP   + + +I+D    VL 
Sbjct  1     MVSISLLEASIVILCFLIFRFLIFKKPHDRFLRNWPVLGMLPGFLMVLHRIYDFSVEVLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGPWFT +D+L+TVDPAN+HYI+S NF N+ KG +FK++F+V G+ IFNSD 
Sbjct  61    KTDLTFPFKGPWFTGMDLLVTVDPANIHYILSSNFSNYTKGADFKEVFEVFGEMIFNSDA  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKNQRK A+ ++ HQ F +  +  + +K++ GL+P+    + E   VVDLQDVFQR T
Sbjct  121   ELWKNQRKAAQFMLNHQGFQKLSLSATRSKLKDGLVPLFNHLS-EEEMVVDLQDVFQRLT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDTT  LVTG+DP  LS DFP+V +++A+DD  E +F RH++P+ LWKLQ  +G G EK+
Sbjct  180   FDTTFFLVTGFDPKSLSTDFPEVEYAQALDDLGEGIFYRHVIPKFLWKLQNRIGFGKEKR  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++ A    D+V  KYI+ KR+EL    ++Q  D+  N +   DLLTS+I  +  +  +  
Sbjct  240   MTEADATFDRVSAKYISAKRKEL----RSQGLDHHSNRDKE-DLLTSHIKLDTTKYQLLN  294

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRDTIL   +AGRDTT SAL+WF WL+S +P V   IR E++     G + +  
Sbjct  295   PSDDKFLRDTILAFNLAGRDTTGSALSWFFWLLSENPRVVTKIRQEIIDENLPGRNGQ--  352

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                  E L  LVYLH AL ES+RLYPPVPFQ KSP++ D+LPSGHKV   + +M  LYA+
Sbjct  353   -----ENLDKLVYLHCALYESMRLYPPVPFQRKSPIKPDLLPSGHKVDAKSNIMIFLYAL  407

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA EFKPERWI  + G ++HEPS+KFL+FNAGPRTC GK++A T MK V  
Sbjct  408   GRMRAVWGEDALEFKPERWIT-KTGWLRHEPSFKFLSFNAGPRTCPGKQLAMTLMKTVVV  466

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              I+ NY ++ +K     PN  +ILYMKHGL+V + +R
Sbjct  467   EILQNYDIKVIKGQKIEPNPGLILYMKHGLRVTITKR  503



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 247/521 (47%), Positives = 344/521 (66%), Gaps = 21/521 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYR--RPLKVPLFGMLPSLFLHVRKIHDRCAAVLSL  1660
             M  + Y+ I +   C   W +     +  +P   P+FGMLP L  +  +IH     +L  
Sbjct  4     MDVLGYYVIPLIILCFTYWNLKNKWAKSSKPTNWPIFGMLPGLVHNAHRIHSFFTDILLE  63

Query  1659  HGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLD  1480
                 F  +GP F N+D+L T DPAN+H+I+S NF N+PKG EF++IFD+LG+GIFN D +
Sbjct  64    TTSNFEFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSE  123

Query  1479  LWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTF  1300
             LW+  RK   +L+ H +F   L R  W+ ++KG++P L+  A ++   VDLQD+FQRF+F
Sbjct  124   LWEIHRKTTMSLMNHSKFQTLLQRNVWDTIDKGIVPTLDILA-KQDTPVDLQDIFQRFSF  182

Query  1299  DTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKL  1120
             DT   L+  +DP  LSV+ P VP  KA +D  + L  RH+LPE  WKLQ+WL IG EK L
Sbjct  183   DTISKLLLDHDPKSLSVNLPHVPCEKAFNDMVDALLYRHVLPERYWKLQKWLRIGKEKNL  242

Query  1119  SRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYIN-----NNDGET  955
              +A E  DQ I   I+ ++++LI        +N+I D++ FDL + Y+       N+ + 
Sbjct  243   MKAWESFDQFIYPAISKRQEKLI--------NNEIKDDD-FDLFSDYVKAYKEWTNEDDK  293

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
              +G    +KFLRDT LNLM AGRDTTSS LTWF WL+S +P V K IR+E+   ++  ED
Sbjct  294   NLGSV--EKFLRDTFLNLMFAGRDTTSSNLTWFFWLLSKNPLVVKKIREEIQQQLHLKED  351

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +  + F  +E + LVYLH ALCE+LRL+PPV  +HKSPLQ D+LPSGH+VSP+T+++ S
Sbjct  352   -ESLKFFNIQESRKLVYLHGALCEALRLFPPVSIEHKSPLQLDVLPSGHRVSPNTKILIS  410

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
              Y MGRM+ +WGKD  EF+PERWI  ERG +KHEPSYKF AF AGPRTC+GKE+AF QMK
Sbjct  411   FYTMGRMESLWGKDCLEFRPERWIT-ERGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMK  469

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              VAA +IHNY+++ V+    SP  ++++ M +GL V+V ++
Sbjct  470   MVAATMIHNYNIQLVEAQTISPTATVVIRMTNGLMVKVGKK  510



>ref|XP_010416946.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 235/486 (48%), Positives = 327/486 (67%), Gaps = 9/486 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP + + + +I+D  A +L L   TF+ KGPWF+ +++LIT DPAN+ ++ 
Sbjct  32    PRNWPVLGMLPGVLIMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+ KG EFK+IFD LG+GIF +D  LW++ RK A  ++ HQ F  + +RT   K+
Sbjct  92    SSNFTNYDKGPEFKEIFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRKI  151

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             + G++PVL+  A E   + DLQDVFQR  FD T TLV GYD   LS++ P   ++KAMDD
Sbjct  152   KNGVVPVLDHFA-EANMIFDLQDVFQRLAFDVTLTLVAGYDSNSLSIEMPMNEYAKAMDD  210

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             AEEV+  RH+ P  LWKLQ W+G+G EKK+++A    D+   KYI+ KR+ELI   ++  
Sbjct  211   AEEVVVYRHVKPMILWKLQNWIGVGEEKKMTKANAAFDRSCAKYISAKREELISRCRS--  268

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
               N   + +  DLL+ Y+N +  +  +    DD FL+D I + M+AGRD  ++ LTWF W
Sbjct  269   --NIGEEAHDVDLLSVYMNLDASKYELLKPTDDNFLKDIIKSFMLAGRDAIATTLTWFFW  326

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L+S +PE    IR E    +N+   P       A++L  +VYLHAALCESLRLY P+PF+
Sbjct  327   LLSKNPEAVTKIRQE----INNTNLPSSGMSLDADKLNKMVYLHAALCESLRLYAPIPFE  382

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              KSP++ D+LPSGHKV  + +++FS+YA+GRM+ +WG+DA EFKPERWI+   G +KHEP
Sbjct  383   RKSPIKQDVLPSGHKVDANWKILFSVYALGRMKAVWGEDASEFKPERWISERNGGLKHEP  442

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KF  FN+GPR CLGK ++F QMK VA  II NY ++ V+ H   P  SI+L+MKHGLK
Sbjct  443   SFKFFVFNSGPRNCLGKNLSFLQMKTVAVEIIRNYDIKVVEGHKIEPASSIVLHMKHGLK  502

Query  309   VRVQRR  292
             V V +R
Sbjct  503   VTVAKR  508



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   494 bits (1273),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/507 (48%), Positives = 337/507 (66%), Gaps = 20/507 (4%)
 Frame = -2

Query  1794  FCLVIWIIL--RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFT  1621
             F    W ++  R     P   PL GMLP L  +  +IH+    +L   G  F  +GP  +
Sbjct  15    FTYFTWFLINRRSKSSAPTDWPLAGMLPGLIQNAHRIHEFFTDILLETGNNFEFRGPVIS  74

Query  1620  NLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALI  1441
             N+++L T DPAN+H+I+S NF N+PKG EF+KIF++LG+GIFN D +LW+  RK+  +L+
Sbjct  75    NMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLM  134

Query  1440  IHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPG  1261
              H +F   L +  W+ VEKGL+PVL+ A  ERG   DLQD+FQRFTFD    L+  +DP 
Sbjct  135   SHAKFQILLKKNVWDTVEKGLVPVLD-AFAERGTTFDLQDIFQRFTFDNISKLLLDHDPK  193

Query  1260  CLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGK  1081
              LS+D P +P  K  +D  + L  RH+LP+S W+LQ+ L IG EK LS+A E  DQ I  
Sbjct  194   SLSIDLPHLPCEKGFNDMVDALLYRHVLPDSYWQLQKKLNIGKEKNLSQAWEAFDQFIYP  253

Query  1080  YITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN----NDGETTMGLKFDDKFLRDT  913
              I+ K+++L+L   N++ D        FDL   YI       +G+T+  ++   +FLRDT
Sbjct  254   AISQKQEKLLLNKTNKDED--------FDLFADYIKAYNQWTNGDTSGNVQ---EFLRDT  302

Query  912   ILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKN  733
              LNLM AGRDTTS+ LTWF WL++ +P VE  IR+E+   ++  +D +  + F  EE + 
Sbjct  303   FLNLMFAGRDTTSTTLTWFFWLLAKNPLVETKIREEIEQQLHLKKD-ENLKFFDIEESRK  361

Query  732   LVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKD  553
             LVYLH ALCE+LRL+PPV  +HKSPL+ D+LPSGH+V+PD +++ S Y MGR+Q IWGKD
Sbjct  362   LVYLHGALCEALRLFPPVSLEHKSPLELDVLPSGHRVTPDMKILISFYTMGRLQTIWGKD  421

Query  552   AKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRA  373
               EFKPERWI+ ER  +KH PSY+F AFNAGPRTC+GK++ F QMK VAA II+NYH++ 
Sbjct  422   CLEFKPERWIS-ERRGIKHVPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIIYNYHIQL  480

Query  372   VKNHDASPNVSIILYMKHGLKVRVQRR  292
             V+    SP  ++++ M +GLKVRV +R
Sbjct  481   VEGQTISPTATVVIRMTNGLKVRVVKR  507



>gb|KEH24773.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   494 bits (1273),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 236/482 (49%), Positives = 318/482 (66%), Gaps = 4/482 (1%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP    ++ +IHD  A +L   GGT    GPWFT +  +IT DP NVHYIMS +F
Sbjct  38    PFLGMLPQFLWNISQIHDFSAKLLKSKGGTIEFLGPWFTGMYGVITTDPLNVHYIMSKSF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
             +NF KG  F+++F+  G GIF +D D WK  R L + L   + F  +  +   NKVEK L
Sbjct  98    DNFVKGDLFREMFEPFGLGIFTTDSDQWKYNRNLLQYLFKQRSFEAFQEKIIHNKVEKSL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             IP+L     ++G VVDLQDVF RFTFD  C ++ G+DP CLS DFP+VP  KA + AEE 
Sbjct  158   IPILNHVLQQKGSVVDLQDVFNRFTFDNICLIILGHDPNCLSTDFPEVPSEKAFNQAEES  217

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH +P  +WKLQ WL IG EKK++ AC++ DQ +   I  KR+EL         + +
Sbjct  218   IFYRHTVPICVWKLQSWLQIGEEKKMTEACKVFDQFLFSCIASKREELKKNCNKNEINAE  277

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
              +D +  D+LT+ I     + +      DKFLRD   NL +AGRDT +SALTW  +LV+T
Sbjct  278   SDDAHHVDMLTALIREEKNKGSESEALGDKFLRDAAFNLFVAGRDTITSALTWLFYLVAT  337

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             HP VE  I +E+       E P    +   +++K LVYLH A+CE+LRL+PP+PF+ K  
Sbjct  338   HPLVEAKILEEIKENFGYKEKP---WILSVDDVKKLVYLHGAICEALRLFPPIPFERKEA  394

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
             ++ DILPSGH V P+  ++FSLYAMGR + IWGKD  EFKPERWI+ ERG + + PSYKF
Sbjct  395   VKPDILPSGHHVYPNNMILFSLYAMGRDENIWGKDCLEFKPERWIS-ERGGIVYAPSYKF  453

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
              +FNAGPRTCLG+E+AF Q+K VAA+++ NY V  V++H  +PN+SI+L M+HGLKV++ 
Sbjct  454   FSFNAGPRTCLGRELAFIQVKMVAASVLWNYCVHVVEDHQVTPNLSIVLLMEHGLKVKIT  513

Query  297   RR  292
             +R
Sbjct  514   KR  515



>emb|CAN68037.1| hypothetical protein VITISV_011827 [Vitis vinifera]
Length=658

 Score =   499 bits (1286),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 247/488 (51%), Positives = 328/488 (67%), Gaps = 15/488 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   PL GMLP++     ++ D  A +L   GGTFL+KG W  + D+L T  PA+ H++M
Sbjct  69    PWNWPLIGMLPTILFQYDQVLDLGAEILERCGGTFLVKGLWXAHSDMLXTCIPADAHHVM  128

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF NFPKG EF+ + D  G+G+F SDL+ W   R++ RAL  HQRF +  V  + +KV
Sbjct  129   STNFWNFPKGXEFRMMLDAFGNGLFISDLEDWSFHRRIGRALFNHQRFQQLSVDITLDKV  188

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GL+PVLE A+ +R   VD QD+FQRF  D TC L+TG DP  L ++ PDVPF+ AM++
Sbjct  189   ENGLVPVLEHASQQRLA-VDFQDLFQRFGLDATCALITGCDPKSLCLELPDVPFASAMEE  247

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             A +V+F+RH+ P+ +WKLQ+WLGIG E+ L  A + L     ++++  R         + 
Sbjct  248   AGKVIFLRHVYPKCIWKLQRWLGIGSERILIAAKKTLYDFAAEHVSFMR---------ER  298

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              +   N   G D+L++YIN ++   +      DK L D IL+L++AG+DTTS+AL+WF W
Sbjct  299   SNMGTNQTEGLDILSAYINEDEAFQSSA---SDKVLIDNILSLLLAGKDTTSAALSWFFW  355

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             LVS +P VE  I +EL  AV + E  +K+ LF A EL  LVYLH ALCESLRL+PPVP Q
Sbjct  356   LVSKNPSVETKIIEELKAAVPAKE-AEKWHLFDAXELSKLVYLHGALCESLRLFPPVPLQ  414

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              ++PLQ DILPSGH+V P T+++F  YAMGRM   WGKD  EFKPERW+   +G  KHEP
Sbjct  415   IRTPLQPDILPSGHRVDPSTKVIFHAYAMGRMACAWGKDCLEFKPERWLT-GKGRTKHEP  473

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             +YKFLAF+AGPR CLGKEVAF +MKAVAAAI+HNYH + VK H   P VSI+L+M HGL+
Sbjct  474   AYKFLAFSAGPRICLGKEVAFFKMKAVAAAIMHNYHFQMVKGHRVVPTVSIVLHMXHGLR  533

Query  309   VRVQRRWT  286
               +   W 
Sbjct  534   ADLVECWV  541



>ref|XP_006404644.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
 gb|ESQ46097.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
Length=513

 Score =   493 bits (1270),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 234/519 (45%), Positives = 344/519 (66%), Gaps = 14/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKV-----PLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   E+F+A    + +  L   +++P K+     PL GMLP + + + +I+   A +
Sbjct  1     MAYIGLLEVFIAILIYIFFHFLI--HKKPHKILPRNWPLLGMLPGVVVMLHRINGYLAEI  58

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L +   TF+ KGPWF+ +++LIT DPANV ++ S NF N+ KG EFK++FD LG+GIF +
Sbjct  59    LEVSNLTFVFKGPWFSGMNMLITADPANVQHVFSSNFSNYDKGSEFKEMFDFLGEGIFTA  118

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D  LW+  R+ +  ++ HQ F  + ++T  +K++ GL PVL+  A E   V DLQDVFQR
Sbjct  119   DSKLWEEMRRSSLVMLSHQGFQSFSLKTIASKIKNGLAPVLDHFA-EANTVFDLQDVFQR  177

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
               FD T TLVTGYD   LS++ P   ++KAMDDAEEV+ +RH+ P  LWK+Q W+G+G E
Sbjct  178   LAFDVTLTLVTGYDSNSLSIEMPKNDYAKAMDDAEEVVVVRHVKPMILWKMQNWIGLGGE  237

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             KK+++A    D+   +YI+ KR+E+I    +Q+   +    +  DLL+ Y+N +  +  +
Sbjct  238   KKMTKANATFDRSCAEYISAKREEIISQRIHQHSTIE-EKAHDVDLLSFYMNLDTSKYEL  296

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DD FL+D I + M+AGRD  ++ LTWF WL+S +PE    IR+E+         P+
Sbjct  297   LNPKDDNFLKDIIKSFMLAGRDAIATTLTWFFWLLSKNPEAVTKIREEI-----KNNQPR  351

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
               + F  +++  +VYLH ALCE+LRLY P+PF+ KSP++ D+LPSGHKV  + +++FS+Y
Sbjct  352   SGKSFDPDKISKMVYLHGALCEALRLYAPIPFERKSPIKQDVLPSGHKVDANWKILFSVY  411

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             A+GRM+ +WG+DA EFKPERW++   G +KHEPS+KF  FN+GPR CLGK+++F QMK V
Sbjct  412   ALGRMKAVWGEDASEFKPERWVSERNGGLKHEPSFKFFVFNSGPRNCLGKKLSFLQMKIV  471

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA II NY ++  + H   P  SI+L+MKHGLKV V +R
Sbjct  472   AAEIIQNYDIKVAEGHTIEPASSIVLHMKHGLKVTVAKR  510



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score =   494 bits (1271),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/512 (47%), Positives = 344/512 (67%), Gaps = 13/512 (3%)
 Frame = -2

Query  1827  SIDYFEIFVAFFCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGG  1651
             S+ +F I +   C   + I +  +   P   P  GMLP+L   + +I+D  A +L     
Sbjct  22    SVVFFLISLLAICFFFFFINKKTHAVFPTNWPFLGMLPALLQMLHQIYDYSADLLESSNM  81

Query  1650  TFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWK  1471
             TFLLKGPWF  +D+LITVDPAN+H+IMS NF N+ KG EF ++F+V G+ IFN+D DLWK
Sbjct  82    TFLLKGPWFAGIDMLITVDPANIHHIMSSNFLNYTKGPEFNEVFEVFGEAIFNTDSDLWK  141

Query  1470  NQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTT  1291
             ++RK A+ ++ H  F R+ + T+ NK++KGL+P+L+ AA +    +DLQDVFQRF FDTT
Sbjct  142   DKRKSAQVMLNHHGFQRFTLSTTVNKIKKGLVPLLDHAA-KLNVALDLQDVFQRFAFDTT  200

Query  1290  CTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRA  1111
               LV+G+D   LS++ P+V  ++A+DDAEE +  RH+ P+ LW++Q W+G G EKK+ RA
Sbjct  201   FFLVSGFDAKSLSIEMPEVELARALDDAEEAIVYRHVKPKFLWRMQNWIGFGSEKKIRRA  260

Query  1110  CEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDD  931
              E  D+V  +YI++KR+E+   + ++            DLLTSY+N +  +  +    +D
Sbjct  261   RETFDRVCRRYISVKREEIRTGFHSEG--------ESMDLLTSYMNLDTTKYKLLNPKED  312

Query  930   KFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFK  751
             +FL+D IL  M+AG +T +SAL+W  W++S +P     IR+E+ T + S  + +    F 
Sbjct  313   QFLQDIILTFMVAGTNTIASALSWLFWILSKNPNAVAKIREEISTKLPSTGNLE--HSFD  370

Query  750   AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQ  571
               EL  LVYLH ALCE+LRLYPPVPFQ KSP++ DILPSGHKV    +++F++YA+GR +
Sbjct  371   PAELNKLVYLHGALCETLRLYPPVPFQRKSPIKPDILPSGHKVDAKLKIIFAVYALGRAR  430

Query  570   FIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIH  391
              +WG DA EFKPERWI+ + G +KH PS+KF +F  GPRTCLG++VAF QMK VA  ++ 
Sbjct  431   AVWGDDASEFKPERWIS-DNGGLKHVPSFKFYSFGTGPRTCLGRDVAFVQMKLVAMELLQ  489

Query  390   NYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             NY  + V+ H   P VS+IL MKHGLKV V +
Sbjct  490   NYDFKVVEGHLVEPVVSMILQMKHGLKVTVTK  521



>gb|EYU24054.1| hypothetical protein MIMGU_mgv1a025585mg, partial [Erythranthe 
guttata]
Length=375

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 254/456 (56%), Positives = 300/456 (66%), Gaps = 90/456 (20%)
 Frame = -2

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
             GTF  +GP F N+D+L TVDP N+HYIM+ NF NFPKG EF+KIFD              
Sbjct  8     GTFHFQGPCFANMDMLGTVDPENIHYIMTSNFRNFPKGPEFRKIFD--------------  53

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             K+QR ++RALIIH+ FHR L   S  KVEKGLIPVLE AA E   V+DLQD+FQ F FD+
Sbjct  54    KDQRNVSRALIIHRSFHRLLAVISCEKVEKGLIPVLENAALE-NRVLDLQDLFQMFNFDS  112

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
              C LVTGY+PGCLS+D  DVPFSKAMDD EE +F+RH+LPE++WKLQ+ LG+        
Sbjct  113   ICQLVTGYNPGCLSLDLADVPFSKAMDDVEESIFLRHVLPENIWKLQRRLGV--------  164

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
                                               ++NG DLLT+Y+N  DG       +D
Sbjct  165   ---------------------------------ENKNGEDLLTAYMNRGDG-------YD  184

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             D+FLRDTILNLMIAGRDTT+SALTWF+WLVSTHP+VEK IRDEL T + SGE   +   F
Sbjct  185   DEFLRDTILNLMIAGRDTTNSALTWFVWLVSTHPQVEKKIRDELKTILPSGE---RRVFF  241

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
               +E K LVYLH ALCE+LR+YPPVPFQHK P++ D LPSGH V P  +++FSLYAMGRM
Sbjct  242   SVDEAKKLVYLHGALCEALRMYPPVPFQHKEPVEPDTLPSGHFVKPKMKVLFSLYAMGRM  301

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             +                        HEPSYKFLAFNAGPR CLGKEVAFTQMKAVAAA++
Sbjct  302   E------------------------HEPSYKFLAFNAGPRICLGKEVAFTQMKAVAAALV  337

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             HNY VR V  H   PN SIILY + GLKVRV  RW+
Sbjct  338   HNYRVRVVDGHRVVPNCSIILYTRDGLKVRVASRWS  373



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score =   493 bits (1268),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/517 (48%), Positives = 338/517 (65%), Gaps = 15/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVA---FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ VA   F  L  ++  +   R     P+  MLP+L + + +I+D    +L 
Sbjct  1     MASISLLQVSVAILGFLTLHYFLFKKPHGRFRRNWPVLRMLPALHMALHRIYDYSVKILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF  KGP F  +D+LITVDPAN+H+IM+ NF N+ KG  F+ +FDV GDGI  +D 
Sbjct  61    ISNMTFPFKGPRFAGMDMLITVDPANIHHIMTSNFSNYIKGPAFQDVFDVFGDGIITTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKN RK  +A+I  Q F R+ + T   K++ G++P+L+  A E+G  VDLQDVF RFT
Sbjct  121   ELWKNLRKSYQAMIHRQEFQRFSMSTMTRKLKDGIVPLLDHFA-EKGTSVDLQDVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT   L+TGYDP  LS++ P+   +KA+DD  E +  RH+ P  LWKLQ W+G G EKK
Sbjct  180   FDTILILITGYDPRSLSIEMPEDELAKALDDVGEGILYRHVKPRFLWKLQNWVGFGEEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++RA    D+V  KYI+ KR+E+    K      DI+     DLLTS+I  N  +  +  
Sbjct  240   MTRANATFDRVCAKYISAKREEI----KRSQVVTDISVAESGDLLTSFIKLNTTKYKLLN  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRDTIL L++AGRDTT+SAL+WF WL+S +P+V   IR E +    S     + 
Sbjct  296   PSDDKFLRDTILTLILAGRDTTASALSWFFWLLSENPKVVAKIRQEAINTDISRTGNGQ-  354

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                  E L  LVYLH ALCE++RLYPPV F  KSP+++D+LPSGHKV  +++++  LYA+
Sbjct  355   -----EHLDKLVYLHGALCEAVRLYPPVCFGRKSPIKSDVLPSGHKVDANSKIIICLYAL  409

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA +FKPERWI  E G +KHEPS+KFL+FNAGPRTCLGK +A  QMK VA 
Sbjct  410   GRMRAVWGEDALQFKPERWIT-ENGGIKHEPSFKFLSFNAGPRTCLGKHIAMAQMKIVAV  468

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              I+ NY ++ V+     P + IIL MKHGL++ V +R
Sbjct  469   EILQNYDIKVVQGQKIEPALGIILSMKHGLRITVTKR  505



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   493 bits (1268),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 254/521 (49%), Positives = 340/521 (65%), Gaps = 21/521 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLV--IWIILRDGYRR-----PLKVPLFGMLPSLFLHVRKIHDRCA  1675
             M  ++Y  +F+  FC    IW I+   YRR     P   P+   LP++  ++ + H    
Sbjct  1     MDFLEYSILFLLIFCFTYSIWFII---YRRTKTSAPTNWPILRELPAVIGNIHRGHAYMT  57

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              VL  +G T+  KGP FTN+D+L T DP ++HYI S NF N+PKG EF+KIFD+LG+GIF
Sbjct  58    EVLIEYGSTYKFKGPIFTNMDMLFTCDPGDIHYIFSKNFSNYPKGPEFRKIFDILGNGIF  117

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             N D +LW+  RK   +++ H +F   L +T W+ +EKGL P+L+ A  ++G  +DLQDV 
Sbjct  118   NVDHELWELHRKTTMSIMSHAKFQILLEKTLWDIIEKGLRPILD-AFAKQGKTLDLQDVL  176

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRFTFD+   L+  +DP  LS+D P +P+ KA  DA + L  RH+ P+ LWKLQQWL IG
Sbjct  177   QRFTFDSITRLLLDHDPRSLSMDLPYLPYEKAFGDALDALLHRHITPKCLWKLQQWLRIG  236

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
              EKKL +ACE  DQ I   I  K++EL+           I DE  F  L +YI   +   
Sbjct  237   KEKKLMQACEAFDQFIYPCIARKQEELM-------HKTTIKDEE-FAFLNAYIKMYNQWN  288

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                L     FLRDT +NLM AGRDTTS+ALTWF  L++ +P VEK IR+E+   ++  ED
Sbjct  289   DGDLGTLQTFLRDTFINLMFAGRDTTSAALTWFFVLLAKNPLVEKKIREEIQQQLHVKED  348

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +  + F  EE + L+YLH ALCE+LRL+P V  +HK PL  DILPSGH+VSP TR++  
Sbjct  349   -ENLKFFTKEESRKLIYLHGALCETLRLFPSVSLEHKVPLDHDILPSGHRVSPKTRMILP  407

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
              Y MGRM+ +WGKD  EFKPERWI+ ERG +KHEPS+KF AFNAGPRTCLGKE+AF QMK
Sbjct  408   FYVMGRMETLWGKDCLEFKPERWIS-ERGGIKHEPSFKFPAFNAGPRTCLGKEMAFVQMK  466

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              V+A IIHNY+++ V+  +  P  SII+ +K+GL V V ++
Sbjct  467   IVSAIIIHNYNIQVVEPENVYPTTSIIMQVKNGLMVNVVKK  507



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score =   492 bits (1267),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 238/482 (49%), Positives = 324/482 (67%), Gaps = 15/482 (3%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP +  ++   HD    VL  HGGT    GPWFTN++ L+T DP NVH+++S NF
Sbjct  36    PFVGMLPQVLCNLWHAHDYSTQVLKQHGGTAEFGGPWFTNMNYLVTCDPLNVHHMLSKNF  95

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+ KG EF+ IF   GDGIF +D + WK  R L  +L  H+ F   L +T   KV+  L
Sbjct  96    HNYVKGPEFRDIFQAFGDGIFTADGEAWKYSRDLFHSLFKHKSFEVLLEKTIHKKVQNSL  155

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +PVL+    ++G VVDLQD+F RFTFD  C+ V G DP CLS+DFP+V   KA + AEE 
Sbjct  156   LPVLDHVQ-QQGRVVDLQDLFNRFTFDNICSTVLGRDPECLSIDFPEVAVEKAFNQAEEC  214

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH++P+S+WK+QQWL IG E+K++ AC+ LD+ I   I  KR++L+        +N+
Sbjct  215   IFYRHIVPKSVWKVQQWLQIGQERKMTEACKTLDEFIYSCIASKREDLM--------ENE  266

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
                    DLLT+ +    G+   G   DD FLRD + NL +AGRDT +SALTWF WLV+T
Sbjct  267   TGKTFQVDLLTTLMREGKGK---GEAHDDTFLRDAVFNLFVAGRDTITSALTWFFWLVAT  323

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             +P VE  I +E+      G + +K  +   EE+K LVYLH A+CE+LRL+PP+PF+ K  
Sbjct  324   NPLVEAKILEEI--KETYGRNEEKAEVLSVEEVKKLVYLHGAICETLRLFPPIPFERKQA  381

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
             L+ D+LPSGH V   T+++  LYAMGR++  WGKD  EFKPERWI+ +RG   +EPSYKF
Sbjct  382   LEADMLPSGHGVDSRTKILLFLYAMGRLEETWGKDCMEFKPERWIS-KRGGNVYEPSYKF  440

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             +AFNAGPR CLGK+++F Q+K VAAAI+ NY V+ V+ + ASP++SI+L MK GLKV++ 
Sbjct  441   IAFNAGPRNCLGKDLSFIQLKMVAAAILRNYCVKVVEGYVASPSLSIVLLMKDGLKVKIT  500

Query  297   RR  292
             +R
Sbjct  501   KR  502



>ref|XP_002521476.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40966.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   492 bits (1266),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/484 (51%), Positives = 332/484 (69%), Gaps = 15/484 (3%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P+ GM+P LF ++   HD   + L    GTFL KGPWF+ ++ L+T DP  VH+ +S NF
Sbjct  32    PVVGMIPGLFSNLYHAHDFLTSRLLQSEGTFLFKGPWFSGMNFLVTADPMIVHHTLSKNF  91

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+ KG +FK+I +VLGDGIFN+D D W+ QR+    L+    F   + RT   KV KGL
Sbjct  92    ANYVKGADFKQILEVLGDGIFNADSDSWRFQRRTIHFLLKQPSFQMAVERTMKLKVSKGL  151

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
               VL+  A + G  VD+QDVFQRFTFD+ C LV  +DP CLSV+FP+VPF KA D  EEV
Sbjct  152   FSVLD-NASKLGCEVDIQDVFQRFTFDSICMLVLSFDPECLSVEFPNVPFEKAFDCIEEV  210

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F R+++P S+WKLQ+WL IG E+ + +A E  D  + + +  KR++L          N 
Sbjct  211   IFYRYIVPISIWKLQRWLQIGQERTMRKAWETFDFFVEQCLARKREQL------DQRKNT  264

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
             +  EN FDLLT ++  + GE  +  K  +KF+RD   NL++AGRDT  + L W  WLV+ 
Sbjct  265   VESEN-FDLLTYFLVEDGGEDGVFTK-SNKFVRDMTFNLLLAGRDTVGAGLVWLFWLVAA  322

Query  837   HPEVEKNIRDELLTAV--NSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHK  664
             HP VE+ I +E+   +  N+GE   K+RLF  EEL  LVYLHA +CE+LRLYPPVPF+ K
Sbjct  323   HPFVEQKILEEIREHLGENTGE---KWRLFNVEELSKLVYLHAVVCETLRLYPPVPFEVK  379

Query  663   SPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSY  484
              P+++DILP GH V+ D ++++SLY+MGRM+ IWGKD  +F+PERWI+ E G +K  PSY
Sbjct  380   VPVESDILPGGHHVNRDIKILYSLYSMGRMEDIWGKDCLKFRPERWIS-EAGKIKQVPSY  438

Query  483   KFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVR  304
             KF AFNAGPRTCLGKE+ F +MK VA+AII NY ++ V++H  SP++S+ILYMK GLKVR
Sbjct  439   KFTAFNAGPRTCLGKELGFVEMKLVASAIIWNYSIKVVEDHPVSPSLSLILYMKDGLKVR  498

Query  303   VQRR  292
             V +R
Sbjct  499   VAKR  502



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   492 bits (1266),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 328/486 (67%), Gaps = 12/486 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   PL GMLP L  +  ++H+     L    GTF   GP   NL++L+T DPAN+H+I+
Sbjct  22    PTNWPLVGMLPGLIRNAHRVHEFVTDALIETKGTFEFHGPVLANLNMLLTSDPANIHHIL  81

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG EF+KIFD+LG+G+FN D +LW+  RK   +L+ H +F   L R  W+ +
Sbjct  82    SKNFSNYPKGVEFRKIFDMLGNGMFNVDYELWEMHRKTTMSLMNHAKFQTLLERNMWSII  141

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GL PVL+    E+G + DLQD+FQRFTFD    L+  +DP  LS+  P VP   A +D
Sbjct  142   ENGLQPVLD-GFAEQGTLFDLQDIFQRFTFDAISKLLLDHDPKSLSIGLPHVPCENAFND  200

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             + + L  RH LPES WKLQ+WL IG EKKL +A E +DQ +   I+ K++EL+  +++  
Sbjct  201   SLDALMYRHFLPESCWKLQKWLRIGKEKKLIQAWEAIDQFLYPCISRKQEELM--HESTA  258

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              D++      F  L +YI   +      L     FLRDT LNLM+AGRDTTS+ALTWF W
Sbjct  259   KDDE------FTFLNAYIKMYNQWKDGDLGTLQTFLRDTFLNLMLAGRDTTSAALTWFFW  312

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L++ +P VEK IR+E+    N  E  +  + F+ EE + LVYLH ALCE+LR +P V  +
Sbjct  313   LLAENPLVEKKIREEIQQQFNLKEG-ENLKFFEIEEARKLVYLHGALCETLRFFPSVAIE  371

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK PL+ DILPSGH VSP+TR++ S Y MGRM+ IWGKD  EFKPERWI+ ERG +KHEP
Sbjct  372   HKLPLEFDILPSGHHVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWIS-ERGGIKHEP  430

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             SYKF AFNAGPRTC+GKE+AF QMK VAA II+NYH++ +++    PN S+I+ MKHGLK
Sbjct  431   SYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIK-LEDQIILPNSSVIIQMKHGLK  489

Query  309   VRVQRR  292
             VR+ +R
Sbjct  490   VRLVKR  495



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   492 bits (1266),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 243/507 (48%), Positives = 335/507 (66%), Gaps = 22/507 (4%)
 Frame = -2

Query  1797  FFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTN  1618
             F C       R   R P   P+ GMLP    ++ + H+    VL  +GGTF  KGPWFTN
Sbjct  9     FLCYGKIFHARKEKRTPTNWPVLGMLPGALANIGRPHEYITEVLQQNGGTFYHKGPWFTN  68

Query  1617  LDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALII  1438
             L+I+ T DP NVHYI + NF NF KG EFKK+FD++G+GI  ++ + W+NQR+ A++LI 
Sbjct  69    LNIMFTCDPVNVHYIQAKNFSNFQKGPEFKKMFDIMGEGILTAESESWENQRRSAKSLIN  128

Query  1437  HQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGC  1258
             +  F  ++  T+ NK+E  LIP+LE A+ E G  VD+Q++F+R TFD++C LV G+DP  
Sbjct  129   NTSFLEFVATTTSNKMETALIPILEVAS-ETGLEVDMQELFERLTFDSSCILVLGHDPVS  187

Query  1257  LSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKY  1078
             L  + P +P  KA  DAEE +F RH+LPE  WKLQ WL IG E K+S+A EI+ + +   
Sbjct  188   LCKELPYLPHEKAFVDAEEAIFYRHVLPEFTWKLQSWLRIGKENKMSKAKEIIPRFLSYC  247

Query  1077  ITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGE-------TTMGLKFDDKFLR  919
             I+ K Q        ++ +NDIN   G ++LTSY N    E         + +  D+K  +
Sbjct  248   ISAKHQ--------KHGNNDIN---GLNMLTSYNNRALAEKGALNEPNNINISDDEKVWK  296

Query  918   DTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEEL  739
             DT+LNLM AG+ T S+ALTW  WL++T+PE E+ IR E+LT ++  +   K++    E+L
Sbjct  297   DTLLNLMFAGKGTISAALTWLFWLLATNPEEEEKIRQEMLTNLHVDKSSSKWKF---EDL  353

Query  738   KNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWG  559
             K L YLH A+CE+LRLYP + FQ KS ++ DILPSGH ++ +T+ + SLY+MGRM+ IWG
Sbjct  354   KKLNYLHGAVCETLRLYPTIAFQFKSTVEHDILPSGHAINANTKTVLSLYSMGRMESIWG  413

Query  558   KDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHV  379
             KD   FKP RWIN E G +K EPS+KF AFN+GPR+CLGKE+ F QMK VAAAI+  +H 
Sbjct  414   KDCLNFKPGRWINPETGRIKTEPSFKFSAFNSGPRSCLGKEITFIQMKIVAAAIMSRFHF  473

Query  378   RAVKNHDASPNVSIILYMKHGLKVRVQ  298
             R  + H  SP+ S++L+MKHGLKV+V 
Sbjct  474   RVAQGHLISPSASVVLHMKHGLKVKVS  500



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   492 bits (1267),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 244/517 (47%), Positives = 343/517 (66%), Gaps = 5/517 (1%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWI-ILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA ++YF I +A  C++++    R+        P+ GMLP L    + IH+    +L   
Sbjct  1     MAILEYFHIIIALVCILLFCHWCRNTVSPVTNWPVVGMLPGLLFKAQNIHEYATRLLKQS  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTF  KGPWF N++I +T DP NV +I + NF N+PKG E+KKIF+  GDG+ NSD + 
Sbjct  61    GGTFEFKGPWFANMNIFLTADPLNVRHISTTNFVNYPKGPEYKKIFEPYGDGVLNSDFES  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK+ RKL  ++I   +F   L R+   K+ +GLIPVLE A+ +    +D+QDVFQRFTFD
Sbjct  121   WKSFRKLIHSMIKDNKFQVSLERSLREKIVEGLIPVLEHASRQEIE-LDMQDVFQRFTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
               C LV G+DP  LSVD P++ +  A DD EE +F RH++PES+WKLQ+WL +G EKKLS
Sbjct  180   NICLLVLGFDPQSLSVDLPEIAYKTAFDDVEEAVFYRHIVPESIWKLQKWLNVGEEKKLS  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM-GLK  940
             +A + +D  + + I+ K++E+           + ND++ +DL+T+ I   +    M   K
Sbjct  240   QAMDTIDNFLEQCISSKKEEIRQRKAQNMVQVEDNDQDDYDLITACIKEGEAAEQMDASK  299

Query  939   FDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNS-GEDPKKF  763
               DK+LRD   N + AG+DT ++ALTWF WLV+TH EVE+ I +E+   + S G+     
Sbjct  300   RTDKYLRDIGFNFIAAGKDTVNAALTWFFWLVATHHEVEEKIVEEIRANMKSKGDHTING  359

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
               F  EEL  LVYLH A+CE+LRLYP VPF ++  ++ D LPSGH V  +T++MFSLY+M
Sbjct  360   MFFNLEELNKLVYLHGAICETLRLYPAVPFNYRVSVEADTLPSGHLVKENTKVMFSLYSM  419

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             G M+ IWG D   FKPERWI+ ERG + H PSYK++AFN GPR+CLGKE+ F QMK +A 
Sbjct  420   GSMEEIWGDDCLAFKPERWIS-ERGGIIHVPSYKYIAFNTGPRSCLGKEITFIQMKTIAT  478

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AI+ N+H++ V+ H  SP +S++L+MKHGLK+RV +R
Sbjct  479   AILLNFHLQVVEGHPVSPGLSVMLHMKHGLKLRVTKR  515



>ref|XP_006405739.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
 gb|ESQ47192.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
Length=516

 Score =   492 bits (1266),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 350/518 (68%), Gaps = 9/518 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAF--FCLVIWIILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI  FE F+A   F ++++ +L+  ++   +  P+ GMLP L + + +++D  A +L 
Sbjct  1     MASISLFETFIAIISFLIILYSLLKKPHKNLARNWPVLGMLPDLLMALHRVYDFLAEILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF  KG WF  +D+LITVDPAN+HYI+S NF N+ KG EFK++FDV  D IFN+D 
Sbjct  61    MSNLTFQFKGLWFAGMDMLITVDPANIHYILSSNFSNYTKGPEFKEVFDVFKDVIFNTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKN RK A++ + HQ F R+ V  + +K++ GL+P+ +  A E G  V+LQDVFQRFT
Sbjct  121   ELWKNLRKAAQSRLNHQGFQRFSVTATRSKLKNGLVPLFDHFAKE-GTTVNLQDVFQRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDTT  L+TG DP  LS++ PD  F+KA+ DA E +  RH+ P  LWKLQ W+G+G EKK
Sbjct  180   FDTTMVLITGSDPISLSIEMPDNEFAKAITDAGEAIMYRHIKPRLLWKLQSWMGLGLEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L  A  + D+V  KYI+ KR+E+ L   + +P   IN E G DLLTSYI  +  +  +  
Sbjct  240   LLEADAVFDRVCAKYISTKREEVRLQGISNHP---INGE-GEDLLTSYIKLDTTKYELLN  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
                D+FL++ ILN +IAGRDT +SALTWF WL+S +P+V   I  E+ T +   +  ++ 
Sbjct  296   PSKDQFLKEVILNFIIAGRDTVASALTWFFWLLSKNPQVVAKIHQEINTVLPRSKYGQEK  355

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
               F + +L  LVYLH AL ES+RLYPP+PF+ KS ++ D+LPSGHKV  +++++  LYA+
Sbjct  356   LSFDSTQLNKLVYLHGALYESMRLYPPIPFERKSAIKPDVLPSGHKVDANSKVIIVLYAL  415

Query  582   GRMQFIWGKDAKEFKPERWINWE-RGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             GRM+ +WG+DA EFKPERW++    G+++HEPS+KFL FNAGPR+CLGK++A   MK V 
Sbjct  416   GRMRAVWGEDALEFKPERWVSKTCGGSLRHEPSFKFLPFNAGPRSCLGKQLAMILMKTVV  475

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               I+ +Y ++A+K         +IL MKHG +V + +R
Sbjct  476   MEILQSYDIKAIKGQKVESLPGLILRMKHGFEVTITKR  513



>ref|XP_006294050.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
 gb|EOA26948.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
Length=508

 Score =   491 bits (1265),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 238/518 (46%), Positives = 342/518 (66%), Gaps = 14/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYR-RPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA +   E+ +AF   + +  +I +  +R  P   P+ GMLP + + + +I+D  A VL 
Sbjct  1     MAYVGLLELCIAFLVFIFFHFLIHKKPHRILPRNWPVLGMLPGVLIMLHRINDYVAEVLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF+ KGPWF+ +++LIT DPAN+ ++ S NF N+ KG EFK++FD LG+GIF +D 
Sbjct  61    VSSLTFVFKGPWFSGMNMLITADPANIQHVFSSNFSNYDKGPEFKEMFDFLGNGIFTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
              LW++ RK +  ++ HQ F  + +RT   K++ G++PVL+  A E   + DLQDVFQR  
Sbjct  121   KLWEDMRKSSLVVLSHQGFQSFSLRTITRKIKYGVVPVLDHFA-EENKIFDLQDVFQRLA  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD T TLVTG +   LS++ P+  ++KAMDDAEEV+  RH+ P  LWKLQ W+G+G EKK
Sbjct  180   FDVTLTLVTGSESNSLSIEMPNNEYAKAMDDAEEVVVYRHVKPMILWKLQNWIGVGEEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE-NGFDLLTSYINNNDGETTMG  946
             +  A    D+   KYI+ KR+E+I T+ +      I +E +G DLL+ ++  +  +  + 
Sbjct  240   MKEANAAFDRSCAKYISSKREEIISTHHSS-----IGEEAHGEDLLSVFMKLDTSKYELL  294

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DD FL+D I + M+AGRD  ++ LTWF WL+S +P+    IR E    +N    P+ 
Sbjct  295   NPTDDNFLKDIIKSFMLAGRDAIATNLTWFFWLISKNPDALTKIRQE----INHTSLPRS  350

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
                  A++L  +VYLH ALCESLRLY P+PF+ KSP++ D+LPSGHKV  + +++FS+YA
Sbjct  351   GMSLDADKLNKMVYLHGALCESLRLYAPIPFERKSPIKEDVLPSGHKVDENWKILFSVYA  410

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WGKDA EFKPERWI+   G +KHEPS+KF  FN+GPR CLGK ++F QMK VA
Sbjct  411   LGRMKAVWGKDASEFKPERWISERHGGIKHEPSFKFFVFNSGPRNCLGKNLSFLQMKIVA  470

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               II NY ++ V+ H   P  SI+L+MKHGLKV V +R
Sbjct  471   VEIIRNYDIKVVEGHKIEPASSIVLHMKHGLKVTVAKR  508



>ref|XP_002878579.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54838.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   490 bits (1262),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/517 (46%), Positives = 334/517 (65%), Gaps = 14/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA +   E+F+AF   + +  L   +  +  P   P+ GMLP +   +  I+D  A +L 
Sbjct  1     MAYVGLLEVFIAFLVFIFFHFLIHKKAHHILPRNWPVLGMLPGVLFMLHMINDYVAEILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF  KGPWFT +++LIT DPAN+ ++   NF N+ KG EFK++FD LG+GIF +D 
Sbjct  61    VSNLTFAFKGPWFTGMNMLITADPANIQHVFCSNFSNYDKGPEFKEMFDFLGNGIFTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
              LW++ RK A  ++ HQ F  + +RT   K++ GL+PVL+  + E   V DLQDVFQR  
Sbjct  121   KLWEDMRKSALVVLSHQGFQSFSLRTITRKIKNGLVPVLDHFS-EANTVFDLQDVFQRLA  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD T TLVTGYD   LS++ P   ++KAMDDAEEV+  RH+ P  LWKLQ W G+G EKK
Sbjct  180   FDVTLTLVTGYDSSSLSIEMPKNEYAKAMDDAEEVVVYRHVKPLILWKLQNWFGLGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +++A    D+   KYI+ KR+E+I    + N      +E   DLL+ Y+N +  +  +  
Sbjct  240   MTKANAAFDRSCAKYISAKREEII--SHHSNIGGKAREE---DLLSVYMNLDTSKYELLN  294

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DD FL+D I + M+AGRD  ++ LTWF WL+S +PE    IR E+ T +     P   
Sbjct  295   PEDDNFLKDIIKSFMLAGRDAIATTLTWFCWLLSKNPEAVTKIRQEINTNL-----PGSG  349

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                 A+ L  +VYLH ALCESLRLY P+PF+ K+P++ D+LPSGHKV  + +++FS+YA+
Sbjct  350   MSLDADMLNKMVYLHGALCESLRLYAPIPFERKTPIKQDVLPSGHKVDANWKILFSVYAL  409

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA EFKPERWI+   G +KHEPS+KF  FN+GPR CLGK ++F QMK VA 
Sbjct  410   GRMKAVWGEDACEFKPERWISERNGGLKHEPSFKFFVFNSGPRNCLGKSLSFLQMKTVAI  469

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              II NY ++ V+ H   P  SI+L+MKHGLKV V +R
Sbjct  470   EIIRNYDIKVVEGHKIEPASSIVLHMKHGLKVTVAKR  506



>gb|KHN19680.1| Cytochrome P450 86B1 [Glycine soja]
Length=572

 Score =   492 bits (1267),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 244/514 (47%), Positives = 345/514 (67%), Gaps = 21/514 (4%)
 Frame = -2

Query  1833  MASIDYFEIFV-AFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA + Y  + V A  C++ ++  +   R PL    P+ GMLP +  ++ + HD  + VL 
Sbjct  1     MAMLVYEAVIVTAVLCMLYFLHRKRCCRHPLFPDYPIIGMLPPVLCNLWRAHDLISDVLK  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
              HGGT    GPWFT ++ LI+ DP NVH++MS NF N+ KG  F+ IF   GDGIF +D 
Sbjct  61    QHGGTGEFTGPWFTIMNCLISSDPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             + WK  R L  +L  ++ F  +L +T  NKV+  L+P+L+    +R  VVDLQDVF RFT
Sbjct  121   EAWKYNRDLFHSLFKNRSFEFFLEKTIQNKVQNSLLPMLDHMHQQRK-VVDLQDVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD  C+LV GYDP CLSVD P+V   KA ++AEE +F RH +P+ +WKLQ+WL IG EKK
Sbjct  180   FDNICSLVLGYDPNCLSVDIPEVAIEKAFNEAEESIFYRHTVPKCVWKLQKWLQIGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++ AC+ LDQ I   I  KR EL       + DN++ + +  DL+T+ +           
Sbjct  240   MTEACKTLDQFIHACIASKRVEL-------SNDNEMGEAHHVDLITALMREKQTH-----  287

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DD+F+RD + NL +AGRDT +SALTWF WLV+T+P VE  I +E+   + + E  K  
Sbjct  288   --DDRFIRDAVFNLFVAGRDTITSALTWFFWLVATNPLVEAKILEEIKEKLETNE--KTL  343

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
              +   E++K LVYLH A+CE+LRL+PP+PF+ K  ++ D+LPSGH+V+P T ++ SLYAM
Sbjct  344   GVLSVEKVKKLVYLHGAICETLRLFPPIPFERKLAIKADMLPSGHRVNPRTMILISLYAM  403

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GR++  WGKD  EFKPERWI+ E+G + + PSYKF+AFNAGPRTCLGK+++F QMK VAA
Sbjct  404   GRLEETWGKDCLEFKPERWIS-EKGGIVYVPSYKFIAFNAGPRTCLGKDLSFIQMKMVAA  462

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRV  301
             AI++ YHV+ V+++ A+P++SI+L +K GLK+ +
Sbjct  463   AILYKYHVQVVEDYVATPSLSIVLLIKDGLKMEI  496



>ref|XP_006405740.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
 gb|ESQ47193.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
Length=516

 Score =   490 bits (1261),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/518 (47%), Positives = 350/518 (68%), Gaps = 9/518 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAF--FCLVIWIILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI  FE F+A   F ++++ +L+  ++   +  P+ GMLP L + + +++D  A +L 
Sbjct  1     MASISLFETFIAIISFLIILYSLLKKPHKNLARNWPVLGMLPDLLMALHRVYDFLAEILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF  KG WF  +D+LITVDPAN+HYI+S NF N+ KG EFK++FDV  D IFN+D 
Sbjct  61    MSNLTFQFKGLWFAGMDMLITVDPANIHYILSSNFSNYTKGPEFKEVFDVFKDVIFNTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKN RK A++ + HQ F R+ V  + +K++ GL+P+ +  A E G  V+LQDVF+RFT
Sbjct  121   ELWKNLRKAAQSRLNHQGFQRFSVTATRSKLKNGLVPLFDHFAKE-GTTVNLQDVFRRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDTT  L+TG DP  LS++ PD  F+KA+ DA E +  RH+ P  LWKLQ W+G+G EKK
Sbjct  180   FDTTMVLITGSDPISLSIEMPDNEFAKAITDAGEAIMYRHIKPRLLWKLQSWMGLGLEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L  A  + D+V  KYI+ KR+E+ L   + +P   IN E G DLLTSYI  +  +  +  
Sbjct  240   LLEADAVFDRVCAKYISTKREEVRLQGISNHP---INGE-GEDLLTSYIKLDTTKYELLN  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
                D+FL++ ILN +IAGRDT +SALTWF WL+S +P+V   I  E+ T +   +  ++ 
Sbjct  296   PSKDQFLKEVILNFIIAGRDTVASALTWFFWLLSKNPQVVAKIHQEINTVLPRSKYGQEK  355

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
               F + +L  LVYLH AL ES+RLYPP+PF+ KS ++ D+LPSGHKV  +++++  LYA+
Sbjct  356   LSFDSTQLNKLVYLHGALYESMRLYPPIPFERKSAIKPDVLPSGHKVDANSKVIIVLYAL  415

Query  582   GRMQFIWGKDAKEFKPERWINWE-RGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             GRM+ +WG+DA EFKPERW++    G+++HEPS+KFL FNAGPR+CLGK++A   MK V 
Sbjct  416   GRMRAVWGEDALEFKPERWVSKTCGGSLRHEPSFKFLPFNAGPRSCLGKQLAMILMKTVV  475

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               I+ +Y ++A+K         +IL MKHG +V + +R
Sbjct  476   MEILQSYDIKAIKGQKVESLPGLILRMKHGFEVTITKR  513



>ref|XP_010526618.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=513

 Score =   488 bits (1255),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 249/521 (48%), Positives = 333/521 (64%), Gaps = 18/521 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI + EI +AF  L+ +    +       P  +P  GMLP L +   + +D    VL 
Sbjct  1     MASIAFLEISIAFISLLAFYFFINKKPHECFPRNLPFLGMLPGLLVAFDRFYDLAVDVLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGPWF  +D+L TVDPAN+H++MS NF N+PKG +FK+IFDV+GDGI N D 
Sbjct  61    KSNMTFPFKGPWFMGMDVLATVDPANIHHVMSSNFGNYPKGDDFKEIFDVIGDGIINVDG  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW+N RK   A+  H+ F R+ +  +  KV+KGLIP L+  A E   VVDLQDV +R+ 
Sbjct  121   ELWENLRKSTLAIFSHEGFKRFSIIANVKKVKKGLIPFLDHVAKE-NMVVDLQDVLERYV  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDTTC  +TGYDP  LSV+ P+V F  A++DA E +  RH+ P  LWKLQ+ +G G EKK
Sbjct  180   FDTTCITITGYDPSNLSVEMPEVEFYAALNDAVEAIVYRHVKPRILWKLQKRIGFGVEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             + RA    D++  +Y+  KR+E  L   +             DLLTSY+N +  +     
Sbjct  240   MRRAHATFDRICEEYVAAKREETRLGLHSNG--------EAMDLLTSYMNLDAAKYGTFD  291

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
              +DDKF RDT+L  MIAG     SALT F WL+S +PE    IR E+ T +   E     
Sbjct  292   PYDDKFQRDTLLTFMIAGMG-VGSALTRFFWLLSANPEAITKIRQEIKTVLPRIESRDDD  350

Query  762   RL----FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
                   F  ++LK LVYLH ALCE+LRLYPP+PF+ KSP++ D+LPSGHKV P+  ++  
Sbjct  351   DDDELSFDPKDLKKLVYLHGALCETLRLYPPIPFERKSPIRPDVLPSGHKVGPNATILII  410

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             +YAMGRM+ IWG+DA +FKPERWI+ + G +KHEPSYKFL+FNAGPRTCLGKE+AFTQ+K
Sbjct  411   IYAMGRMKAIWGEDAPDFKPERWIS-DSGGLKHEPSYKFLSFNAGPRTCLGKEMAFTQLK  469

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              V   II NY +  ++  +    VS+IL +K+GL+V V +R
Sbjct  470   TVIVEIIRNYDIHVIEGQEVESLVSVILRIKNGLRVTVSKR  510



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   488 bits (1256),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/509 (46%), Positives = 330/509 (65%), Gaps = 5/509 (1%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGP  1630
             + V F  L  W  +R         P+ GMLP L ++   +++     L  +GGT   KGP
Sbjct  12    VLVCFLLLRCWDQIRKLDADKRNWPIVGMLPRLLINSSNVYEYTTRTLRNNGGTSKFKGP  71

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WF N+D +IT DP NVH+I+S NF N+PKG  +KKIF+ LGDGI NSD + W+ QRK+ +
Sbjct  72    WFANMDFVITSDPKNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRKMIQ  131

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAA-GERGGVVDLQDVFQRFTFDTTCTLVTG  1273
               + + ++   + +T   K+ +GL P+L+  +  E   ++D+QDV QRF +D+ C  V G
Sbjct  132   LFMKNNKYKELVEKTILQKLVQGLFPILDHVSRKEMSEIIDMQDVIQRFMYDSNCMSVLG  191

Query  1272  YDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQ  1093
             +DP CL+++FP+V  +KA D  EE +F RH++PE  WK Q+WL IG EKKLSRA +  DQ
Sbjct  192   FDPNCLTIEFPEVAHAKAFDIMEEAVFYRHIVPEFYWKFQKWLQIGEEKKLSRALQTFDQ  251

Query  1092  VIGKYITMKRQELILTYKNQNPDNDINDENG--FDLLTSYINNNDGETTMGLKFDDKFLR  919
              + K I+  R E +L       +N + ++    FDLLT+YI     E        +KFLR
Sbjct  252   FMYKCIST-RCEQVLNENKAKMENIVEEKEAADFDLLTAYIKVQMKEHGNSAASSNKFLR  310

Query  918   DTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEEL  739
             DT  NL++AGRDT S+ L WF WLV+ HP VE  I +E+  A    E   K R+F AEE+
Sbjct  311   DTATNLLVAGRDTPSAGLVWFFWLVAEHPLVESKILEEIRAANLVKEKDGKLRVFSAEEV  370

Query  738   KNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWG  559
               LVYLHAA+CE+LRLYP V   HK+ ++ D LPSGH++    +++ S Y+MGRM+ IWG
Sbjct  371   NGLVYLHAAMCETLRLYPSVHTNHKAAVEEDTLPSGHRIRRKMQVLISFYSMGRMEAIWG  430

Query  558   KDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHV  379
             KD  EFKPERWI+ ++G + H P YKF AFN GPRTCLGK+V+F QMK VA A++ NYHV
Sbjct  431   KDCLEFKPERWIS-DKGGIIHVPPYKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNYHV  489

Query  378   RAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             + V+ H   P+V+++L+MK+GLKVR+ +R
Sbjct  490   QVVEGHQVFPSVAVVLHMKNGLKVRITKR  518



>ref|XP_010473744.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   488 bits (1255),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 233/485 (48%), Positives = 323/485 (67%), Gaps = 9/485 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP +   + +I+D  A +L L   TF+ KGPWF+ +++LIT DPAN+ ++ 
Sbjct  32    PRNWPVLGMLPGVLAMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+ KG EFK++FD LG+GIF +D  LW+N RK A  ++ HQ F  + +RT   K+
Sbjct  92    SSNFTNYDKGPEFKEMFDFLGNGIFTADSKLWENMRKSALVVLSHQGFQSFSLRTITRKI  151

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E G++PVL+  A E   + DLQDVFQR  FD T TLV GYD   LS++ P   ++KAMDD
Sbjct  152   ENGVVPVLDHFA-EANMIFDLQDVFQRLAFDVTLTLVAGYDSNSLSIEMPMNEYAKAMDD  210

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             AEEV+  RH+ P  LWKLQ W+G+G EKK+++A    D+   KYI+ KR+E+I + +  N
Sbjct  211   AEEVVVYRHVKPMILWKLQNWIGVGEEKKMTKANAAFDRSCAKYISAKREEII-SRRRSN  269

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
                + +D    DLL+ Y+N +  +  +    DD FL+D I + M+AGRD  ++ LTWF W
Sbjct  270   IGEEAHD---MDLLSVYMNLDASKYELLKPTDDNFLKDIIKSFMLAGRDAIATTLTWFFW  326

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L+S +PE    IR E    +N+   P       A++L  +VYLHAALCESLRLY P+PF+
Sbjct  327   LLSKNPEAVTKIRQE----INNTNLPSSGMSLDADKLNKMVYLHAALCESLRLYAPIPFE  382

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              KSP++ D+LPSGHKV  + +++FS+YA+GRM+ +WG+DA EFKPERWI+   G +KHEP
Sbjct  383   RKSPIKQDVLPSGHKVDANWKILFSVYALGRMKAVWGEDATEFKPERWISERNGGLKHEP  442

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KF  FN+GPR CLGK ++F QMK VA  II  Y +  V+ H   P  SI+L+MKHGL 
Sbjct  443   SFKFFVFNSGPRNCLGKNLSFLQMKKVAVEIIRTYDIIVVEGHKIEPASSIVLHMKHGLI  502

Query  309   VRVQR  295
             V V +
Sbjct  503   VTVAK  507



>gb|KFK22353.1| hypothetical protein AALP_AAs42226U000100 [Arabis alpina]
Length=466

 Score =   486 bits (1250),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 239/481 (50%), Positives = 323/481 (67%), Gaps = 19/481 (4%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P+ GMLP + + + +I+D  A VL     T+  +GPW + +DIL TVDP N+HYI+S NF
Sbjct  4     PVLGMLPGMLIQLPRIYDWLAEVLQATDMTYPFRGPWLSVMDILFTVDPENIHYILSSNF  63

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EFK+IFD+LGD IFN D +LW++ R  A A+  HQ F ++ V TS  K+++  
Sbjct  64    VNYPKGVEFKEIFDILGDAIFNVDSELWEDMRNSAHAIFSHQDFQKFSVDTSVKKLKQAF  123

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+LE A  E+  +VDLQD+FQRF FDT+  L+ G+DP CLS+D P V +  A+D A + 
Sbjct  124   VPILENAV-EKNTIVDLQDLFQRFLFDTSLILMAGFDPKCLSIDMPKVEYGDAIDGAADG  182

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH  P  LWKLQ WLG+G EKK+ R+  + +  +   I  +R EL         ++D
Sbjct  183   IFYRHFKPVFLWKLQYWLGVGVEKKMRRSLAVANNFLENIIKDRRAEL-------KTNHD  235

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
               +EN  D+LT YI  +  +       +DKFLRD IL  ++AGRDTTSSALTWF WL+S 
Sbjct  236   SKEEN-LDVLTYYITVDTTKYKHLKPSNDKFLRDAILGFLLAGRDTTSSALTWFFWLLSK  294

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             HPE    IR E+          KK   F   +L  LVYL AA+CESLRLYP VPF HKSP
Sbjct  295   HPEAMIKIRQEI---------NKKMPKFDPADLDKLVYLDAAVCESLRLYPSVPFNHKSP  345

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
              + D+LPSGHKV  + +++ S+YA+GRM+ IWG DA++F+PERWI+ ++G ++HEPSYKF
Sbjct  346   AKPDVLPSGHKVDENWKIVISIYAVGRMRSIWGDDAEDFRPERWIS-DKGKLRHEPSYKF  404

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             LAFNAGPR+CLGK+++F Q+K VA  II NY ++ V  H A P  S++L MKHGLKV V 
Sbjct  405   LAFNAGPRSCLGKKLSFLQIKTVAVEIIRNYDIKVVDGHKAEPAPSVLLRMKHGLKVSVT  464

Query  297   R  295
             +
Sbjct  465   K  465



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   487 bits (1253),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 243/509 (48%), Positives = 332/509 (65%), Gaps = 25/509 (5%)
 Frame = -2

Query  1794  FCLVIWIIL--RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFT  1621
             F    W+ +  R     P   PL GMLP L  +  +IHD    +L   G  F   GP   
Sbjct  15    FTYFTWLFINRRSKTSEPTNWPLVGMLPGLIQNAHRIHDFFTDILLETGNNFEFYGPALG  74

Query  1620  NLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALI  1441
             N+++L T DPAN+H+I+S NF N+PKG EF+KIF++LG+GIFN D +LW+  RK+  +L+
Sbjct  75    NMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLM  134

Query  1440  IHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPG  1261
              H +F   L +  WN VEKGL+PVL+ A  ERG   DLQD+FQRFTFD    L+   DP 
Sbjct  135   SHAKFQILLKKNVWNTVEKGLVPVLD-AFAERGTTFDLQDIFQRFTFDNISKLLLDCDPK  193

Query  1260  CLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGK  1081
              L +D P +P  K  +D  + L  RH++PES W+LQ+ L IG EK LS+A    DQ I  
Sbjct  194   SLFIDLPHLPCEKGFNDMVDALLYRHVVPESYWQLQKKLNIGKEKNLSQAWVAFDQFIYP  253

Query  1080  YITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNND----GETTMGLKFDDKFLRDT  913
              I+ K+++L+         N  N +  FDL + YI   +    G+T+  ++   +FLRDT
Sbjct  254   AISQKQEKLL---------NKTNKDEDFDLFSDYIKAYNQWTIGDTSGNVQ---QFLRDT  301

Query  912   ILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTA--VNSGEDPKKFRLFKAEEL  739
              LNLM AGRDTTS+ALTWF WL++ +P VE  I++E+     +  GE+    + F  EE 
Sbjct  302   FLNLMFAGRDTTSTALTWFFWLLTKNPLVETKIKEEIEQQFHLKKGEN---LKFFDIEES  358

Query  738   KNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWG  559
             + LVYLH ALCE+LRL+PPV  +HK+PL+ D+LPSGH+V+PD +++ S Y MGRMQ +WG
Sbjct  359   RKLVYLHGALCEALRLFPPVSIEHKAPLELDVLPSGHRVTPDMKILISFYTMGRMQTLWG  418

Query  558   KDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHV  379
             KD  EFKPERWI+ ERG +KH PSY+F AFNAGPRTC+GK++ F QMK VAA I++NYH+
Sbjct  419   KDCLEFKPERWIS-ERGGIKHVPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIVYNYHI  477

Query  378   RAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             + V+    SP  ++++ M +GLKVRV +R
Sbjct  478   QLVEGQAISPTATVVIRMTNGLKVRVVKR  506



>emb|CDY42628.1| BnaC01g00400D [Brassica napus]
Length=557

 Score =   488 bits (1257),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 245/517 (47%), Positives = 346/517 (67%), Gaps = 16/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MAS+   E  VA  C +I+  ++ +  + R LK  P+ GMLP   + + +I+D    VL 
Sbjct  1     MASLSLLEASVALLCFLIFHHLLSKKPHDRFLKNWPVLGMLPGFLIVLHRIYDFSVEVLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGPWFT +DIL+TVDPAN+HYI+S NF N+ KG  FK++FDV G+ IFNSD 
Sbjct  61    QTNLTFPFKGPWFTGMDILVTVDPANIHYILSSNFSNYTKGANFKEVFDVFGEMIFNSDG  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             DLW+NQR+ A+ ++ HQ F +  +  +  K++ GL+P+ +  + E   VVDLQ++FQRFT
Sbjct  121   DLWRNQRRAAQYMLNHQGFQKLSMSATRTKLDDGLVPLFDRFSKEE-MVVDLQNLFQRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             +DTT  LVTG+DP  LSV+ P+  +++A+D   E +F RH++P+ LWKLQ+W+G G EK+
Sbjct  180   YDTTFVLVTGFDPKTLSVEMPEDEYAEALDVLGEGIFFRHVIPKFLWKLQKWIGFGQEKR  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
                A    D+V  KYI  KR E++   +  +     N E   DLLTS++  +  +  +  
Sbjct  240   TMEADATFDRVSAKYILAKRHEVL--SQGIHDQQQSNGECHEDLLTSHMKLDTTKYELLN  297

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRDTIL   +AGRDTT+SAL+WF WL+S +P V   IR E++T ++        
Sbjct  298   PSDDKFLRDTILAFNLAGRDTTASALSWFFWLLSENPRVVTKIRQEIITNIS--------  349

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
              L   + L  LVYL AAL ES+RLYPPVPFQ KSP++ D+LPSGHKV  ++ +M  LYA+
Sbjct  350   -LHGQDNLDKLVYLQAALYESMRLYPPVPFQRKSPIKPDLLPSGHKVEANSTIMIFLYAL  408

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA EFKPERW++ + G ++HEPS+KFL+FNAGPRTC GK++A T +K VA 
Sbjct  409   GRMRAVWGEDAMEFKPERWVS-QSGCLRHEPSFKFLSFNAGPRTCPGKQLALTLIKTVAV  467

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              I+ NY ++ +K     P+  +ILYMKHGL+V + +R
Sbjct  468   EILQNYDIKVIKGQKIEPDPGLILYMKHGLRVTITKR  504



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   486 bits (1252),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 243/486 (50%), Positives = 328/486 (67%), Gaps = 12/486 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   PL GMLP L  +  ++H+     L    GTF   GP   NL++L+T DPAN+H+I+
Sbjct  36    PTNWPLVGMLPGLIQNTHRVHEFVTDALVESKGTFEFHGPVLANLNMLLTSDPANIHHIL  95

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG EF+KIFD++G+GIFN D +LW+  RK   +L+ H +F   L R  W+ +
Sbjct  96    SKNFSNYPKGVEFRKIFDMIGNGIFNVDYELWEMHRKTTMSLMNHPKFQTMLERNMWSII  155

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GL P+L+    E+G + DLQD+FQRFTFD    L+  +DP  LS+  P VP   A +D
Sbjct  156   ENGLWPILD-GFAEQGTLFDLQDIFQRFTFDAITKLLLDHDPKSLSIGLPHVPCENAFND  214

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             + +    RH LPES WKLQ+WL IG EKKL +A E +DQ I   I+ K++EL+ T + ++
Sbjct  215   SLDAFMYRHFLPESCWKLQKWLRIGKEKKLIQAWEAIDQFIYPCISRKQEELMHTSRAKD  274

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              +        F  L +YI   +      L     FLRDT L+L+ AGRDTTS+ALTWF W
Sbjct  275   EE--------FIFLNAYIRMYNQWKDGDLGTLQTFLRDTFLSLLFAGRDTTSAALTWFFW  326

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L++ +P VEK IR+E+   +N  E  +  + F+ EE + LVYLH ALCE+LRL+P V  +
Sbjct  327   LLAKNPSVEKRIREEIQQQLNLKEG-ENLKFFEIEEARKLVYLHGALCETLRLFPSVAIE  385

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK PL+ D+LPSGH+VSP+TR++ S Y MGRM+ IWGKD  EFKPERWI+ ERG +KHEP
Sbjct  386   HKLPLEFDLLPSGHRVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWIS-ERGGIKHEP  444

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KF AFNAGPRTC+GKE+AF QMK VAA II+NY+++ +++    PN S+I+ MK+GLK
Sbjct  445   SFKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYYIK-LEDQIILPNSSVIIQMKNGLK  503

Query  309   VRVQRR  292
             VRV +R
Sbjct  504   VRVFKR  509



>gb|KDP35252.1| hypothetical protein JCGZ_09411 [Jatropha curcas]
Length=491

 Score =   485 bits (1248),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 252/519 (49%), Positives = 338/519 (65%), Gaps = 31/519 (6%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             MA I  FEI +A  C V    LR+  +     PL G LPSL  ++ ++ D    +    G
Sbjct  1     MALIGIFEILLATLCYVAGCWLRNRRKLIRSWPLIGTLPSLLRNINRLPDWMIELAGRKG  60

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIF-DVLGDGIFNSDLDL  1477
             GT + KG  FT L ++ T DP N+ +IMS NF N+PKG E+K+I+ DVLGDGIFNSD +L
Sbjct  61    GTTIYKGS-FTGLYVICTTDPENIKHIMSTNFSNYPKGSEYKEIYSDVLGDGIFNSDSEL  119

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W+NQRK A +LI H++F ++L RT+  KVEKGL PVLE    E   + DLQD+  RFT D
Sbjct  120   WRNQRKNAVSLINHEKFRKFLFRTANVKVEKGLFPVLELICSENKEI-DLQDLVHRFTAD  178

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
              T TLVTGYD   LS          A++  EE LF RH+ P+ LWK Q WLG G E+K+ 
Sbjct  179   ITFTLVTGYDQETLSTGLLGDKLGTALEYIEEALFYRHIQPKMLWKFQNWLGFGTERKVK  238

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
              A +++D V  KYI+M+RQ ++             +  G +LLT Y+N            
Sbjct  239   DALKMVDDVTAKYISMRRQGIV------------EEGGGVNLLTPYVNEKS---------  277

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGE-DPKKFR  760
              DKFLRDTI N M+AGR+   ++L+WF WL+S +P VE  IR+EL + V   E   KK +
Sbjct  278   -DKFLRDTIYNFMVAGRE---NSLSWFFWLLSKNPRVEAKIREELSSIVPESERGEKKIQ  333

Query  759   LFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMG  580
             L + E++  L+YLHAALCE+LR+YPPV +++K+PLQ DILPSGH V P  +++ S Y MG
Sbjct  334   LLELEKVNKLLYLHAALCETLRIYPPVTYEYKAPLQNDILPSGHYVDPKMKILLSSYLMG  393

Query  579   RMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAA  400
             R++ +WG+D  EFKPERWI+ E+G + H+  YKFLAFNAGPRTC+GK++AF QMKA+AA 
Sbjct  394   RLKSLWGEDCFEFKPERWIS-EQGRIIHQSPYKFLAFNAGPRTCVGKDIAFVQMKAMAAF  452

Query  399   IIHNYHVRAVKNHDASPN-VSIILYMKHGLKVRVQRRWT  286
             ++HNY++  V+ H   P   SIIL+MK+GLKVR+ RRW 
Sbjct  453   LLHNYNIEVVEEHAVVPKYTSIILHMKYGLKVRISRRWA  491



>ref|XP_009117361.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
 emb|CDY63371.1| BnaA09g55910D [Brassica napus]
Length=510

 Score =   485 bits (1248),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 236/517 (46%), Positives = 339/517 (66%), Gaps = 14/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAF--FCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I   ++F+ F  F L  ++I +  ++  P   P+ GMLP + + + KI+     VL 
Sbjct  1     MAYIGLLDVFIVFLIFILFHFLIHKKTHKLFPRNWPVLGMLPGVLVMLHKINGYLVEVLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF+ KGPWF+ +++LIT DP NV ++ S NF N+ KG EFK++FD LG+GIF +D 
Sbjct  61    VSNLTFVFKGPWFSGMNMLITADPENVQHVFSSNFSNYDKGSEFKEMFDFLGEGIFTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
              LW+  R+ +  ++ HQ F  + ++T  +K++ GL+PVL+  A E   V DLQDVFQR  
Sbjct  121   KLWEEMRRSSMVMLSHQGFQSFSLKTIASKIKNGLVPVLDHFAKE-NMVFDLQDVFQRLA  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD T TLVTGYD   LS++ P   ++KAMDDAEEV+ +RH+ P  LWKLQ WLG+G EKK
Sbjct  180   FDVTLTLVTGYDSNSLSIEMPKNEYAKAMDDAEEVVVVRHVKPMFLWKLQNWLGLGEEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +++A    D+   KYI+ KR+E+          +D+      DLL  Y+N +  +  +  
Sbjct  240   MTQANAAFDRSCAKYISAKREEIHQHSIIGEKAHDV------DLLKFYMNLDTTKYELLN  293

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DD FL+D I + M+AGRD  ++ LTWF WL+S +P+    IR E+ T +    D    
Sbjct  294   PKDDSFLKDIIKSFMLAGRDAIATTLTWFFWLLSKNPQALTKIRQEINTYLPRSSD----  349

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
             + F  +++  +VYLH ALCE+LRLY P+PF+ KSP++ D+LPSGHKV    +++FS+YA+
Sbjct  350   KGFDQDKISKMVYLHGALCEALRLYAPIPFERKSPIKQDVLPSGHKVDAKWKILFSVYAL  409

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA EFKPERWI+   G +KHEPS+KF  FN+GPR CLGK+++F QMK VAA
Sbjct  410   GRMKAVWGEDASEFKPERWISERNGGLKHEPSFKFFVFNSGPRNCLGKKLSFLQMKIVAA  469

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              II NY ++ ++ H   P  SI+L+MKHGLKV V +R
Sbjct  470   EIIQNYDIKVLEGHKIEPASSIVLHMKHGLKVTVTKR  506



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   485 bits (1249),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 235/510 (46%), Positives = 333/510 (65%), Gaps = 6/510 (1%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGP  1630
             + V F  L  W  +R         P+ GMLP L ++   +++     L  +GGT   KGP
Sbjct  12    VLVCFLLLRCWDQIRKLDADKANWPVVGMLPRLLINSSNVYEYTTQALRNNGGTSKFKGP  71

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WF N+D +IT DP NVH+I+S NF N+PKG  +KKIF+ LGDGI NSD + W+ QRK+ +
Sbjct  72    WFANMDFVITSDPRNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRKMIQ  131

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAA-GERGGVVDLQDVFQRFTFDTTCTLVTG  1273
               + + ++   + +T   K+ +GL P+L+  +  E   ++D+QDV QRF +D+ C  V G
Sbjct  132   LFMKNNKYKGLVEKTILQKLVQGLFPILDHVSRKEMSEIIDMQDVIQRFMYDSNCMSVLG  191

Query  1272  YDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQ  1093
             +DP CL+++FP+V  +KA D  EE +F RH++PE  WK Q+WL IG EKKLSRA +  DQ
Sbjct  192   FDPNCLTIEFPEVAHAKAFDIMEEAIFYRHIVPEFYWKFQKWLQIGEEKKLSRALQTFDQ  251

Query  1092  VIGKYITMKRQELILTYKNQNPDNDINDENG--FDLLTSYINNNDGETTMGLKFDDKFLR  919
              + K I+  R E +L       +N + ++    FDLLT+YI     E        +KFLR
Sbjct  252   FMYKCIST-RCEQVLNENKAKMENLVEEKEAADFDLLTAYIKVQMKEHGNSAASSNKFLR  310

Query  918   DTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTA-VNSGEDPKKFRLFKAEE  742
             DT  NL++AGRDT  + L WF WLV+ HP VE  I +E+  A +   +D  K R+F AEE
Sbjct  311   DTATNLLVAGRDTPGAGLVWFFWLVAEHPLVENKILEEIRAANLVKEKDIGKLRVFSAEE  370

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
             +  LVYLHAA+CE+LRLYP V   HK+ ++ DILPSGH++    +++ S Y+MGRM+ IW
Sbjct  371   VNGLVYLHAAMCETLRLYPSVHTNHKAAVEEDILPSGHRIRRKMQVLISFYSMGRMEAIW  430

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             GKD  EFKPERWI+ ++G + H P YKF AFN GPRTCLGK+V+F QMK VA A++ NYH
Sbjct  431   GKDCLEFKPERWIS-DKGGIIHVPPYKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNYH  489

Query  381   VRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             V+ +++H   P+V+++L+MK+GLKVR+ +R
Sbjct  490   VQVIEDHQVFPSVAVVLHMKNGLKVRITKR  519



>gb|KEH24772.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   485 bits (1248),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 233/482 (48%), Positives = 311/482 (65%), Gaps = 4/482 (1%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP    ++  IHD  A +L+  GGT    GPWFTN+  +IT DP NVHYIMS  F
Sbjct  38    PFVGMLPQFLWNISDIHDFSAKLLTSKGGTMEFIGPWFTNMYAVITNDPLNVHYIMSKRF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
             +NF KG+ F++ F   G GIF +D   WK  R L + L   + F  +  +   NKVEK L
Sbjct  98    DNFEKGERFRETFQPFGLGIFTTDSHQWKYNRNLLQYLFKQRSFEAFQEKIIHNKVEKSL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             IP+L     + G VVDLQDVF RFTFD  C+++ G+DP CLS+DFP+V   KA + AEE 
Sbjct  158   IPLLNHVQQQNGSVVDLQDVFNRFTFDNICSIILGHDPNCLSIDFPEVVCEKAFNQAEES  217

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH +P  +WKLQ WL IG EKK++ AC++ DQ +   I  K +EL         +  
Sbjct  218   IFYRHTVPACVWKLQSWLQIGEEKKMTEACKVFDQFLYSCIASKCEELKKNGNKNEINGQ  277

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
              ND +  DLLT+ I   + + +      +KFLRD   NL +AGRDT +SALTW  +LV+T
Sbjct  278   SNDAHHVDLLTALIREENSKGSESESIGNKFLRDAAFNLFVAGRDTITSALTWLFYLVAT  337

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             HP VE  I +E+       E P    +   +E+K LVYLH A+CE+LRL+PP+PF+ K  
Sbjct  338   HPLVEAKIVEEIKENFGHKEKP---WILSVDEVKKLVYLHGAICEALRLFPPIPFERKQA  394

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
             ++ DILPSGH V P+  + FSLY+MGR   IWG+D  EFKPERWI+ ERG + + PSYKF
Sbjct  395   IEADILPSGHHVFPNKMVFFSLYSMGRDANIWGEDCLEFKPERWIS-ERGGIVYAPSYKF  453

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
              +FNAGPRTCLG+E+A  Q+K +AA+I+ NY V  V +H  +P++SI+L MKHGLKV++ 
Sbjct  454   FSFNAGPRTCLGRELALIQVKMIAASILWNYCVHVVGDHQVTPSLSIVLLMKHGLKVKIS  513

Query  297   RR  292
             +R
Sbjct  514   KR  515



>ref|XP_010432764.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   484 bits (1247),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 339/518 (65%), Gaps = 16/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAF---FCLVIWIILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MASI   ++ VA    F  + +++ +  Y R  +  P+  MLP+L   + +I+D    +L
Sbjct  1     MASISLLQVSVAMILGFLTLPYLLFKKPYGRFQRNWPVLRMLPALLRALHRIYDYSVKIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   TF  KGP F  +D+L+TVDPAN+H+IM+ NF N+ KG  F+ +FDV GDGI  +D
Sbjct  61    EISNLTFPFKGPRFAGMDMLVTVDPANIHHIMTSNFSNYIKGPAFQDVFDVFGDGIITTD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
             L+LWK  RK  +A++  Q F RY + T   K++ GL+P+L+  A E+G  VDLQDVF RF
Sbjct  121   LELWKTLRKSYQAILHRQEFQRYSMSTMTRKLKDGLVPLLDHFA-EKGTTVDLQDVFGRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFD    LVTG DP  LSV+ P+  F+KA+DD  E +  RH+ P  LWKLQ W+G G E+
Sbjct  180   TFDIILILVTGSDPRSLSVELPEDEFAKALDDVGEGILYRHVKPRFLWKLQNWVGFGEER  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A  I D+V  KYI+ KR+E+    K      DI++    D+LTS+I  +  +  + 
Sbjct  240   KMTKANAIFDRVCAKYISAKREEM----KRSQGVIDISNVESEDILTSFIKLDTTKYKLL  295

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDTIL  ++AGRDTT+SAL+WF WL+S +P+V   IR E++    S     +
Sbjct  296   NPSDDKFLRDTILTFILAGRDTTASALSWFFWLLSENPKVVAKIRQEVINTDLSRTGNSQ  355

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
                   E L  LVYLH ALCE+LRLYPPV +  KSP+++D+LPSGHKV  ++ ++  LYA
Sbjct  356   ------ENLDKLVYLHGALCEALRLYPPVCYGRKSPIKSDVLPSGHKVDANSNIVICLYA  409

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+DA +FKPERWI  E G +KHEPS+KFL+FNAGPRTCLGK +A  QMK VA
Sbjct  410   LGRMRAVWGEDALQFKPERWIT-ENGGIKHEPSFKFLSFNAGPRTCLGKHIALNQMKIVA  468

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               I+  Y ++ V+     P + IIL MKHGL++ V +R
Sbjct  469   VEILQKYDIKVVEGQKIEPVLGIILSMKHGLRITVTKR  506



>ref|XP_010447431.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=508

 Score =   484 bits (1246),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 244/517 (47%), Positives = 340/517 (66%), Gaps = 15/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAF--FCLVIWIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ VA   F ++ +++ +  Y R  L  P+  MLP+L   + +I+D    +L 
Sbjct  1     MASISLLQVSVAILGFLILHYLLFKKLYGRFRLNWPVLRMLPALLRALHRIYDYSVKILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TF  +GP F  +D+L+TVDPAN+H+IM+ NF N+ KG  F+ +FDV GDGI  +DL
Sbjct  61    ISNLTFPFEGPQFAGMDMLVTVDPANIHHIMTSNFTNYIKGPAFQDVFDVFGDGIITTDL  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWK  RK  +A++  Q F R+ + T   K++ GL+P+L+  A E+G  VDLQDVF RFT
Sbjct  121   ELWKTLRKSYQAILHRQEFQRFSMSTMTRKLKDGLVPLLDHFA-EKGTTVDLQDVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT   L TG DP  LSV+ P+  F+KA+DD  E +  RH+ P  LWKLQ W+G+G EKK
Sbjct  180   FDTILILATGSDPRSLSVEMPEDEFAKALDDVGEGILYRHVKPRFLWKLQNWVGLGEEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +++A  I D+V  KYI+ KR+E+    K      D ++    D+LTS+I  +  +  +  
Sbjct  240   MTKANAIFDRVCAKYISGKREEM----KRSQGVIDKSNVESEDILTSFIKLDTTKYKLLN  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRD IL  ++AGRDTT+SAL+WF WL+S +P+V   IR E++    S     + 
Sbjct  296   TSDDKFLRDNILTFILAGRDTTASALSWFFWLLSENPKVVAKIRQEVINTDLSRTGNSQ-  354

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                  E L  LVYLH ALCE+LRLYPPV F  KSP+++D+LPSGHKV  ++ ++  LYA+
Sbjct  355   -----ENLDKLVYLHGALCEALRLYPPVCFGRKSPIKSDVLPSGHKVDANSNIVICLYAL  409

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA +FKPERWI  E G +KHEPS+KFL+FNAGPRTCLGK +A  QMK VA 
Sbjct  410   GRMRAVWGEDALQFKPERWIT-ENGGMKHEPSFKFLSFNAGPRTCLGKHIALNQMKIVAV  468

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              I+ NY ++ V+     P + IIL MKHGL++ V +R
Sbjct  469   EILQNYDIKVVEGQKIEPVLGIILSMKHGLRITVTKR  505



>ref|XP_007150922.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
 gb|ESW22916.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
Length=509

 Score =   484 bits (1246),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 237/505 (47%), Positives = 334/505 (66%), Gaps = 13/505 (3%)
 Frame = -2

Query  1800  AFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPW  1627
             A FC++ +   R   R PL    P+ GMLP +  ++ +IHD    VL   GGT    GPW
Sbjct  14    ALFCIIYFFHRRLSCRYPLLTDYPILGMLPEVLCNLWRIHDFATEVLKQKGGTGDFTGPW  73

Query  1626  FTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARA  1447
             FTN++ L T DP NV ++MS +F N+ KG  F+ IF+  G+G+  +D + WK  R L   
Sbjct  74    FTNMNYLFTSDPLNVRHVMSTSFHNYVKGPVFRDIFEAFGEGLAAADSEAWKYNRDLIHY  133

Query  1446  LIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYD  1267
             L+  + F  +L +T   KV+  L+PVL+    ++G VVDLQD+F RFTFD  C +V G+D
Sbjct  134   LLKQKNFEGFLEKTVHKKVQSSLLPVLDHVH-QQGSVVDLQDLFNRFTFDNICYIVLGHD  192

Query  1266  PGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVI  1087
             P CLSVDFP+V   KA ++A E +F RH++P+ +WKLQ+WL IG EKK++ AC+ LD+ I
Sbjct  193   PNCLSVDFPEVEIEKAFNEAGETIFHRHVVPKCVWKLQKWLHIGQEKKMTEACKTLDEFI  252

Query  1086  GKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTIL  907
                I  KR+ L    +     N+  + +  DLLT+ +     +   G ++DD FLRDT+ 
Sbjct  253   YACIASKRKNLSKCIEK----NETEETSDVDLLTTLMREGKEK---GEEYDDIFLRDTVF  305

Query  906   NLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLV  727
             N  +AGRD  +SALTWF WLV+T+P VE  I +E+   + S E  K   +   EE+K LV
Sbjct  306   NFFVAGRDAVTSALTWFFWLVATNPLVEAKILEEMKEKIGSNE--KAMDVLSVEEVKKLV  363

Query  726   YLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAK  547
             YLH A+CESLRL+PP+PF+ K  L++D+LPSGH V+P T ++F LY+MGR + IWG+D  
Sbjct  364   YLHGAICESLRLFPPIPFERKEALKSDLLPSGHGVNPSTVILFFLYSMGRSEEIWGEDCM  423

Query  546   EFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK  367
             EFKPERWI+ E+G + + PSYKF+AFN GPRTCLGK+V+F Q+K VA AI+H Y ++ V+
Sbjct  424   EFKPERWIS-EKGGIVYVPSYKFVAFNTGPRTCLGKDVSFIQIKMVATAILHKYRLQVVE  482

Query  366   NHDASPNVSIILYMKHGLKVRVQRR  292
              + A PN+SI+L +K GLKV +++R
Sbjct  483   GYVAKPNLSIVLLIKDGLKVTIKKR  507



>gb|KFK30510.1| hypothetical protein AALP_AA7G271300 [Arabis alpina]
Length=501

 Score =   484 bits (1245),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 245/514 (48%), Positives = 337/514 (66%), Gaps = 20/514 (4%)
 Frame = -2

Query  1824  IDYFEIFVAFFCLVIW--IILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             I   EI +AF   +++   +     RR L    P+ GMLP L +++ +I+D    VL   
Sbjct  3     IGLLEILIAFLFFLVFQGFLHHKKTRRHLATNWPVLGMLPGLLVNLPRIYDCITEVLEAA  62

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             G T+  KGPW +  DIL+T DPAN+ Y++S NF N+ KG EF++IF+ LGDGIFN D +L
Sbjct  63    GMTYHFKGPWLSRTDILLTADPANIQYVLSSNFVNYHKGLEFQEIFEFLGDGIFNVDSEL  122

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W++ R  + A+  HQ F ++ V T+ +K+++GL+P+LE +A E   +VDLQD+FQRF FD
Sbjct  123   WEDMRNSSHAMFSHQEFQKFSVSTTLSKLKQGLVPILE-SAVEENIIVDLQDLFQRFLFD  181

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TT  L+TGYDP CLS++ P V F +A+D   +  F RH  P  LWKLQ WLG+G EKK++
Sbjct  182   TTSILMTGYDPKCLSIERPKVEFGEAVDGVADGSFYRHAKPVFLWKLQNWLGVGVEKKMT  241

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             R   + DQ + K I+ +R+EL    K+    +D   E   D+LT Y+  +  +       
Sbjct  242   RGIVVFDQFLEKIISARREEL----KSHRTHHDSVGE-AMDVLTYYMTVDTTKYKHLKPS  296

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             +DKFLRD ILN +IAGRDT SSALTWF WL+S +PE    IR E+     + + PK    
Sbjct  297   NDKFLRDVILNFLIAGRDTVSSALTWFFWLLSKNPEAMTKIRQEI-----NNKMPK----  347

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F   +L  LVYL  A+CESLRLYPPVPF HKSP + D+LPSGH+V  D +++ S YA+GR
Sbjct  348   FDPTDLDKLVYLRGAVCESLRLYPPVPFNHKSPTKPDVLPSGHRVDEDMKIVISTYAVGR  407

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ +WG DA++F+PERWI+ + G  K E SYKFLAFNAGPR+CLGK++ F QMK VA  I
Sbjct  408   MRSVWGDDAEDFRPERWIS-DSGKSKEESSYKFLAFNAGPRSCLGKKLTFLQMKTVAVEI  466

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             I NY ++ ++ H   P  S++L M+HGLKV V +
Sbjct  467   IRNYDIKVIEGHKIQPVPSVLLRMQHGLKVTVTK  500



>ref|NP_176713.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
 gb|AAC27155.1| Similar to cytochrome P450 gb|X90458 from A. thaliana [Arabidopsis 
thaliana]
 gb|AEE34360.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
Length=503

 Score =   483 bits (1244),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 240/481 (50%), Positives = 322/481 (67%), Gaps = 16/481 (3%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP L L V +I+D    VL     TF  KGP  + +DIL+TVDP N+HYI+S NF
Sbjct  38    PALGMLPGLLLQVPRIYDWITEVLEATDMTFCFKGPCLSGMDILLTVDPVNIHYILSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EFKKIF+V+GD IFN D  LW++ R  + A+  +Q F  + V TS  K+ +GL
Sbjct  98    ANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIFSNQDFQMFWVSTSVRKLRQGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+LE AA ++  +VDLQD+FQRF FDT+  L+TGYDP CLSV+ P V F  A+D   + 
Sbjct  158   VPILENAA-DKNILVDLQDLFQRFLFDTSLILMTGYDPKCLSVEMPKVEFGDAVDGVSDG  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+ P  LW+LQ  +G+G EK+L R   + DQ++ K IT KR+E+     N +  + 
Sbjct  217   VFYRHVKPVFLWRLQYLIGVGVEKRLKRGLAVFDQLLEKIITAKREEI-----NSHGTHH  271

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
              +     D+LT Y+  +  +       DD+F++DTIL  +IA RDTTSSALTWF WL+S 
Sbjct  272   PSRGEAIDVLTYYMTMDTTKYKYLEPSDDRFIKDTILGFLIAARDTTSSALTWFFWLMSK  331

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             +PE    IR E    VN     KK   F   +L+ LVYLH A+CE+LRLYPPVPF HKSP
Sbjct  332   NPEAINKIRQE----VN-----KKMPRFDPADLEKLVYLHGAVCETLRLYPPVPFNHKSP  382

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
              + D+LPSGH+V    +++ S+YA+GRM+ +WG DA++F+PERWI+ + G +KHEPSYKF
Sbjct  383   AKPDVLPSGHRVDEKWKIVISMYALGRMKSVWGDDAEDFRPERWIS-DSGRLKHEPSYKF  441

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             LAFNAGPR CLGK++ F QMK VAA II NY ++ V+ H   P  S++  M+HGLKV + 
Sbjct  442   LAFNAGPRACLGKKLTFLQMKTVAAEIIRNYDIKVVEGHKTEPVPSVLFRMQHGLKVNIT  501

Query  297   R  295
             R
Sbjct  502   R  502



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   483 bits (1244),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 236/511 (46%), Positives = 330/511 (65%), Gaps = 18/511 (4%)
 Frame = -2

Query  1818  YFEIFVAFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTF  1645
             Y  I  + FC +     R   + PL    P+ GMLP +  ++ +IHD C  VL   GGT 
Sbjct  7     YAAITASLFCFLYLFHRRRSCKHPLMRDYPILGMLPPILFNLWRIHDFCTEVLKKQGGTG  66

Query  1644  LLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQ  1465
               KGPWFT +  LIT D  NV +++  +F+N+ KG EF++IF+  GDG+  +D + WK  
Sbjct  67    EFKGPWFTKMHYLITCDSLNVQHMLCKSFDNYIKGPEFREIFEPFGDGVVTADSETWKYF  126

Query  1464  RKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCT  1285
             R +  +LI  +RF  ++ +T   KV   L+P+L+    ++G +VDLQDVF RFTFD  C+
Sbjct  127   RTVLHSLIKQRRFETFVDKTVQKKVHTSLLPILDHVQ-QQGEMVDLQDVFNRFTFDNICS  185

Query  1284  LVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACE  1105
              + G+DP CLS+DFP+V   +A +++EE +F RH +P S+WK Q+WL IG EKK++ AC+
Sbjct  186   TIVGHDPKCLSIDFPEVAIERAFNESEESIFYRHTVPSSVWKFQKWLQIGQEKKMTEACK  245

Query  1104  ILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKF  925
               D+ I   I  KRQEL     ++    ++++E  FDLLT+ I    G        DDKF
Sbjct  246   TFDEFIYSCIASKRQEL-----SKCSREEMDNEAPFDLLTALITEERGRV-----HDDKF  295

Query  924   LRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAE  745
             LRD   N  +AGR+T +SALTWF WLV+ HP VE  I +E+     +  +     +   E
Sbjct  296   LRDAAFNFFVAGRETMTSALTWFFWLVTKHPLVEAKILEEIKDNFEANYEG----VVGIE  351

Query  744   ELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFI  565
             E+K LVYLH ALCE+LRL+PPVP + K  ++ D LPSGH+V+ +T ++FSLYAMGR + I
Sbjct  352   EVKKLVYLHGALCEALRLFPPVPIERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCEEI  411

Query  564   WGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY  385
             WGKD  EFKPERWI+ ERG V + P+YKF+AFNAGPR CLGK++AF QMK VAA+I+  Y
Sbjct  412   WGKDCLEFKPERWIS-ERGEVVYAPAYKFIAFNAGPRICLGKDLAFVQMKMVAASILRKY  470

Query  384   HVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               + V+ H  +P+ SI+L MK+GLK R+ +R
Sbjct  471   RFQVVEGHSPTPSHSIVLLMKNGLKARIMKR  501



>ref|XP_010431920.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=424

 Score =   480 bits (1236),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 236/430 (55%), Positives = 308/430 (72%), Gaps = 11/430 (3%)
 Frame = -2

Query  1575  IMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWN  1396
             IMS NF N+PKG EFKK+FDVLGDGIFN+D DLWK+ RK A++++++  F ++ + TS +
Sbjct  1     IMSSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMMNPEFQKFSLATSLS  60

Query  1395  KVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAM  1216
             K+EKGL+P+L+  A E+  V DLQDVFQRFTFDTT  L TGYDPGCLSV+ P+V F++A+
Sbjct  61    KLEKGLVPLLDHVAREKLAV-DLQDVFQRFTFDTTFVLATGYDPGCLSVEMPEVEFARAL  119

Query  1215  DDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKN  1036
             DDAEE +F RH+ PE LW++Q   G+G EKK+++A   LD+V  + I  +R E+     +
Sbjct  120   DDAEEAIFYRHVKPEILWRMQGLFGLGDEKKMTKARMTLDRVCSECIASRRDEI-----S  174

Query  1035  QNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWF  856
             +  DN   D    DLLTSY+N +  +       DD+FLRDT+L  M+AGRDTT S LTWF
Sbjct  175   RGIDN--VDSPSKDLLTSYMNLDTNKYKFLNPSDDRFLRDTVLTFMLAGRDTTGSGLTWF  232

Query  855   IWLVSTHPEVEKNIRDELLTAVNSG--EDPKKFRLFKAEELKNLVYLHAALCESLRLYPP  682
              WL+  +PEV   IR+E+   +  G  E       F  +ELK LVYLH A+CE+LRLYPP
Sbjct  233   FWLLCKNPEVMAKIREEINKNLTDGSHESDVDSGSFNPQELKKLVYLHGAICEALRLYPP  292

Query  681   VPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAV  502
             VPFQHKSP + D+LPSGHKV  +++++F LY++GRM+ +WG DA EFKPERWI+ E G  
Sbjct  293   VPFQHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKSVWGDDALEFKPERWIS-ESGRS  351

Query  501   KHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMK  322
              HEPSYKFL+FNAGPRTCLGKEVA  QMK VA  II NY ++ V+     P  S+IL+MK
Sbjct  352   VHEPSYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNYEMKIVEGQKIEPAPSVILHMK  411

Query  321   HGLKVRVQRR  292
             HG+KV V +R
Sbjct  412   HGVKVTVTKR  421



>ref|XP_010470317.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=497

 Score =   483 bits (1243),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/482 (49%), Positives = 322/482 (67%), Gaps = 24/482 (5%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLPSL   + ++ D    VL +   TF LKG WFT  D+L T DP N+H+I+S NF
Sbjct  39    PFLGMLPSLLHQIPRLIDWTTEVLDVSDLTFALKGAWFTGTDLLFTADPRNLHHILSSNF  98

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG EF+KIFD+LGDGI  +D +LW++ RK    +  HQ F    V ++ +K++KGL
Sbjct  99    RNYPKGPEFRKIFDILGDGILAADSELWEDLRKSGHTIFHHQDFLEISVSSNVSKLKKGL  158

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P L+ AAGE   ++DLQD+FQRF FDT+  L+TGYDP  LS++ P+V F +A+D  EE 
Sbjct  159   VPFLDNAAGE-NIIIDLQDLFQRFMFDTSMILMTGYDPMSLSIEMPEVEFGEAVDHGEEA  217

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH  P  LWKLQ W+GIG E+K+      ++Q++GK I+ +R+E+          + 
Sbjct  218   IFYRHFKPVILWKLQYWIGIGLERKMRATMVTINQMLGKIISSRREEI----------SR  267

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
                E   D+LT Y+N +  +  +     D+F+RD +L+L++AGRDTTSSALTWF WL+ T
Sbjct  268   GKRETSMDVLTYYMNVDTTKYKLLKPRSDRFIRDVVLSLLVAGRDTTSSALTWFFWLLCT  327

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             HP+V   IR E+ T            +F   +L+ LVYLHAAL ES+RLYPPVP  HKSP
Sbjct  328   HPQVMAKIRHEIKT------------MFDPSDLEKLVYLHAALSESMRLYPPVPLNHKSP  375

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
              ++D+LPSGHKV    +++ S+YA+GRM+ +WG+DA +FKPERWI+ E G + HEPSYKF
Sbjct  376   SKSDVLPSGHKVEAHAKIIISIYALGRMRSVWGEDASDFKPERWISAE-GVLIHEPSYKF  434

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQ  298
             LAFNAGP+ CLGK +A  QMK VA  II NY  + V+ H   P  S+IL MKHGLKV V 
Sbjct  435   LAFNAGPKACLGKHLALLQMKIVAMHIIRNYDFKIVEGHKIEPVPSVILRMKHGLKVTVS  494

Query  297   RR  292
             ++
Sbjct  495   KK  496



>ref|XP_004489209.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=511

 Score =   483 bits (1244),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 235/483 (49%), Positives = 321/483 (66%), Gaps = 11/483 (2%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP    ++  IH+  A +L+  GGT    GPWFTN+  +IT DP NVH+IMS +F
Sbjct  37    PFIGMLPQFLRNLSNIHEFSAKLLNSKGGTIEFIGPWFTNMKGVITTDPMNVHHIMSKSF  96

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+ KG  F+++F   G GIF +D  LWK  R L + +   + F     R   NKVE  L
Sbjct  97    TNYVKGDLFREMFKPFGVGIFTTDSHLWKFNRNLLQYIFKQRSFEDLQERIIHNKVETSL  156

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             IP+L     ++G +VDLQD+F RFTFD  C+++ G+DP CLS+DFP++   KA + AEE 
Sbjct  157   IPLLNHVQQQKGLIVDLQDIFNRFTFDNICSIILGHDPNCLSIDFPEIECEKAFNQAEES  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH +P  +W+LQ+WL IG EKK++ AC++ D  +   I  KR+EL    KN N + +
Sbjct  217   IFYRHTVPLCVWRLQKWLQIGEEKKMTDACKVFDHFLYDCIASKREELT---KNSNKNQN  273

Query  1017  I-NDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVS  841
             I  DE+  DLLT  I     E   G   DDKFLRD   NL +AGRDT +S+LTW  +LV+
Sbjct  274   IETDESHVDLLTYLITE---EEKKGESNDDKFLRDAAFNLFVAGRDTITSSLTWLFYLVA  330

Query  840   THPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKS  661
             THP VE  I +E+       E P    +   +E+KNLVYLH A+CE+LRL+PP+PF+ K 
Sbjct  331   THPLVEAKILEEIKEKFGHKEKP---WILNVDEVKNLVYLHGAICEALRLFPPIPFERKE  387

Query  660   PLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYK  481
              ++ D+LPSGH V P+T ++FSLYAMGR + IWG+D  EFKPERWI+ ERG + + PSYK
Sbjct  388   SVEKDVLPSGHHVHPNTMILFSLYAMGRSENIWGEDCLEFKPERWIS-ERGGIVYAPSYK  446

Query  480   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRV  301
             F +FNAGPRTCLGK++AF Q+K VAA+I+ NY +  V+ +  +P++SI+L MKHGLKV++
Sbjct  447   FFSFNAGPRTCLGKDLAFIQIKMVAASILWNYGIHVVEGNCVTPSLSIVLLMKHGLKVKI  506

Query  300   QRR  292
              +R
Sbjct  507   TKR  509



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   484 bits (1245),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 255/527 (48%), Positives = 333/527 (63%), Gaps = 19/527 (4%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILR------DGYRRPLKVPLFGMLPSLFLHVRKIHDRCA  1675
             A+ S     IF+    L  ++IL+      D    P   PL GM+P+L  +  ++H+   
Sbjct  4     AICSTAVAFIFIIVLSLGCYMILKLRCRSSDDKVVPRNWPLVGMMPALLKNAHRVHEFAT  63

Query  1674  AVLSLHGGTFLLKGPW-FTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGI  1498
              VL   GGTF  KGP  F NL +L T DPAN+H+++S NF N+PKG EF+KIFD+LGDGI
Sbjct  64    DVLKHSGGTFEFKGPAAFANLSMLATSDPANIHHVLSKNFSNYPKGPEFRKIFDILGDGI  123

Query  1497  FNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDV  1318
             FN D  LW+  RK   + + H +F+  L    W+KVEKGL+PVL++ A E G   DLQDV
Sbjct  124   FNVDSQLWELHRKTTLSFLNHAQFYTLLQTNVWHKVEKGLLPVLDWFA-EEGAEFDLQDV  182

Query  1317  FQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGI  1138
             FQRFTFD    LV  +DP  L +  P VP  KA + A + L  RH+ PES WKLQ WLGI
Sbjct  183   FQRFTFDAISKLVLHHDPESLCLGLPYVPCEKAFNHAVDALLYRHIFPESFWKLQNWLGI  242

Query  1137  GPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGE  958
             G EKKL +A    D+ I  Y  +KR E  +     N DN+ +D++   L T+Y+     +
Sbjct  243   GKEKKLIQAYRAFDEFI--YSALKRLEERMMMITPNIDNN-SDDHHLSLFTAYVQAYKQQ  299

Query  957   -----TTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTA  793
                    +      KF RDT L+LM AGRDTTSS LTWF +L++ +P V+ N RDE+   
Sbjct  300   EQPQAALLTTTTTTKFPRDTFLSLMFAGRDTTSSTLTWFFYLLAQNPLVQANARDEIENK  359

Query  792   VNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPD  613
             +N  ++ K+F  FK EE   LVYLHAALCE+LRL+PP+  QHK     D+LPSGH V P+
Sbjct  360   LNLKQEIKRF--FKLEECHKLVYLHAALCETLRLFPPLAIQHKVSTAMDVLPSGHLVKPN  417

Query  612   TRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEV  433
             TR++   Y+ GRM  IWG+D  EFKPERWI+   G +KHEPSYKF AFNAGPRTCLGKE+
Sbjct  418   TRIILLFYSSGRMDSIWGEDCMEFKPERWIS-GNGRIKHEPSYKFPAFNAGPRTCLGKEM  476

Query  432   AFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +F QMK +AA I+H+Y  + V +H  SP+ SII+  KHGLKV+  +R
Sbjct  477   SFVQMKMIAAIILHHYEFQVVDSHSVSPSDSIIIQAKHGLKVKFTKR  523



>gb|KEH24777.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   483 bits (1243),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 249/523 (48%), Positives = 338/523 (65%), Gaps = 27/523 (5%)
 Frame = -2

Query  1851  SIITCAMASIDYFEIFVAFFCLVIWIILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRC  1678
             + I CA+ S         F C++  I  R   + P+ +     GMLPSL  ++  IHD  
Sbjct  7     TTIACAIFS---------FLCIIFQIHRRRCCKYPILIDYTFLGMLPSLLWNLWNIHDFL  57

Query  1677  AAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGI  1498
             AA+L  H G+    GPWFT ++  IT DP NVH+IMS  F+N+ KG EF +IF+  GDGI
Sbjct  58    AALLKQHRGSGEFMGPWFTKMNYFITSDPMNVHHIMSKRFDNYVKGHEFHEIFEAFGDGI  117

Query  1497  FNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDV  1318
             FN+D   WK  R L  ++   + F  +  +   NK+E+ LIP+L+    ++G VVDLQDV
Sbjct  118   FNADSKTWKYNRSLLHSIFKQRSFELFQEKIIQNKLERSLIPLLDHVQ-QQGSVVDLQDV  176

Query  1317  FQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGI  1138
             F RFTFD  C++V G DP CLS+DFPDV   KA D  EE +F RH++P S+W+LQQ L +
Sbjct  177   FNRFTFDNICSVVLGCDPNCLSIDFPDVACEKAFDQIEECIFYRHVVPRSVWRLQQLLQV  236

Query  1137  GPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGE  958
             G EKK+++AC+  DQ I   I  KR EL    KN        DE G DLLT+ +N   G 
Sbjct  237   GQEKKMTKACKEFDQFIYSNIESKRVELRKGTKNI-------DEMG-DLLTTLMNEEKGS  288

Query  957   TTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNS-G  781
                 ++ DDKFLRD   NL +AGRDT +SALTW  +LV+THP VE  I +E+     +  
Sbjct  289   QV--VQHDDKFLRDAAFNLFVAGRDTITSALTWLFYLVATHPLVETKILEEIKEHFGTIN  346

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
              D KK      +E+K LVYLH A+CE++RL+PP+PF+ K  ++ D+LPSGH ++P+T ++
Sbjct  347   IDQKK---LGVDEVKKLVYLHGAICEAIRLFPPIPFERKKAIKGDVLPSGHIINPNTIIL  403

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
             FSLY+MGR + IWG+D  EFKPERWI+ ERG++ HEPSYKF +FNAGPRTCLGK+++F Q
Sbjct  404   FSLYSMGRFEEIWGEDCLEFKPERWIS-ERGSIVHEPSYKFFSFNAGPRTCLGKDLSFIQ  462

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +K +A AI+  Y V+ V  H    + SI+L MK+GLKVR+ +R
Sbjct  463   VKMIAIAILSKYCVQVVDGHVPILSHSIVLLMKNGLKVRITKR  505



>ref|NP_179782.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD20408.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07237.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   483 bits (1243),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 321/486 (66%), Gaps = 11/486 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP + + + +I+D  A +L +   TF  KGPWF+ +++LIT DP+N+ ++ 
Sbjct  32    PRNWPVLGMLPGVLVMLHRINDYVAEILEVSNLTFAFKGPWFSGMNMLITADPSNIQHVF  91

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+ KG EFK++FD LG+GIF +D  LW++ RK A  ++ HQ F  + +RT   K+
Sbjct  92    SSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITCKI  151

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             + GL+PVL+  A E   V DLQDVFQR  FD T TLVTG D   LS++ P   ++KAMDD
Sbjct  152   KNGLVPVLDHFA-EANTVFDLQDVFQRLAFDVTLTLVTGCDSSSLSIEMPKNEYAKAMDD  210

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             AEEV+  RH+ P  LWKLQ W+G+G EKK+  A    D+   KYI+ KR+E+I  + N  
Sbjct  211   AEEVVVYRHVKPVVLWKLQNWIGLGEEKKMKEANAAFDRSCAKYISAKREEIISHHSNIG  270

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
                   + +  DLL+ Y+N +  +  +    DD FL+D I + M+AGRD  ++ LTWF W
Sbjct  271   -----GEAHAEDLLSVYMNLDISKYELLNPNDDNFLKDIIKSFMLAGRDAIATTLTWFFW  325

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L+S +PE    IR E+ T +     P       A++L  +VYLH ALCESLRLY P+PF+
Sbjct  326   LLSKNPEAVTKIRQEINTNL-----PGSGMSLDADKLNKMVYLHGALCESLRLYAPIPFE  380

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              K+P++ D+LPSGH V  + +++FS+YA+GRM+ +WG+DA EFKPERWI+   G +KHEP
Sbjct  381   RKTPIKQDVLPSGHMVDKNWKILFSVYALGRMRSVWGQDASEFKPERWISERNGGLKHEP  440

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KF  FN+GPR CLGK ++F QMK VA  II NY ++ V+ H   P  SIIL+MKHGLK
Sbjct  441   SFKFFVFNSGPRNCLGKNLSFLQMKTVAVEIIRNYDIKVVEGHKIEPASSIILHMKHGLK  500

Query  309   VRVQRR  292
             V V +R
Sbjct  501   VTVSKR  506



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 245/518 (47%), Positives = 336/518 (65%), Gaps = 29/518 (6%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGP  1630
             +F+   CL  W   R    R        ML +L L+  ++H+    VL    GT   KGP
Sbjct  6     LFILIGCL--WSFKRSSRTR--------MLSTLVLNAHQLHEFATRVLQKSRGTLEFKGP  55

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WF  +D +IT DP NVHYI S NF N+PKG + + I +  GDG+F +D +LWK QRK+  
Sbjct  56    WFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRKMIH  115

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGY  1270
             +++ H +F   L +T + K+E GLIPVL+ A+ E G  VDLQDVFQRFTFD  C  V G 
Sbjct  116   SVMKHNKFESALEKTIYQKLENGLIPVLDHAS-EVGIKVDLQDVFQRFTFDNICMSVLGI  174

Query  1269  DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQV  1090
             DP  LS +FP V ++ A +  E+ +F RH++P+S WKLQ+WL IG EKKLS+A +  D+ 
Sbjct  175   DPNYLSFEFPQVAYANAFNATEQAVFYRHIVPKSWWKLQKWLHIGKEKKLSKAMKTFDRF  234

Query  1089  IGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYI-------NNNDGETTMGLKFDD  931
             + + I++KR+ L ++ K         +E  FD+LT+++         N+      L+ +D
Sbjct  235   LYECISLKRERLQISRKAST-----EEEEEFDVLTAFMVEGEEEEEMNEDRKIGALRRND  289

Query  930   KFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL-LTAVNSGEDPKKFR--  760
             KFLRDT  NL+ AG++T SS L WF WLV+THP VE NI +E+    V   E+ ++ R  
Sbjct  290   KFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENNILEEMKANMVMQKEEEEEHRDK  349

Query  759   --LFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
               LF A+E+  +VYLHAALCE+LRLYPPVP+ HK   Q D+LPSGH+++ +  ++ S YA
Sbjct  350   RLLFDAKEVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYA  409

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWGKD  EFKPERWI  E+G++ H PSYKF AF+AGPR CLGK+ AF QMK VA
Sbjct  410   MGRMEVIWGKDCLEFKPERWIT-EKGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVA  468

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A I+ NY V+ V+ H  SP  S++L+MK+GLKV++ +R
Sbjct  469   ALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKR  506



>ref|XP_009107985.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=502

 Score =   481 bits (1237),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 233/487 (48%), Positives = 327/487 (67%), Gaps = 21/487 (4%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP L +H+ +I+D    +L     TF  KGPW +  DILITVDPAN+ YI+
Sbjct  34    PTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYIL  93

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF+N+PKG EFK+IF+VLGD IFN D +LW++ R  + A+  HQ F R+ V TS +K+
Sbjct  94    SSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSKL  153

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
              +GL+P+LE A  E+  +VDLQD+F RF FDT+  L+TGYDPGCLS++ P V FS A+D 
Sbjct  154   NQGLVPILENAV-EKNIIVDLQDLFHRFLFDTSSILITGYDPGCLSIEMPKVNFSDAVDG  212

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
               + LF RH  P   WKLQ W+G+G EK + R   + D+++ K I+ KR+E+ +      
Sbjct  213   VADGLFYRHAKPVLFWKLQYWIGVGVEKSMRRGIAVFDEMLQKIISAKREEIKI------  266

Query  1029  PDNDINDENG--FDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWF  856
               + I D  G   D+LT Y+  +  +       +DKF+RDTIL ++IA +DTTSSAL+WF
Sbjct  267   --HGIRDSEGEAMDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGVLIAAKDTTSSALSWF  324

Query  855   IWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVP  676
              WL+S +PE    IR E+     + + PK    F   +L  LVYL  A+CE+LRLYP VP
Sbjct  325   FWLLSKNPEAMIKIRQEI-----NNKMPK----FNPADLDKLVYLDGAVCETLRLYPSVP  375

Query  675   FQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKH  496
             F HKSP + D+LP+GH+V  + +++ S+YA+GRM+ +WG DA++F+PERWI+ + G ++H
Sbjct  376   FNHKSPAKPDVLPTGHRVDDNWKIVISIYALGRMKSVWGDDAEDFRPERWIS-DNGMLRH  434

Query  495   EPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHG  316
             EPS+KFLAF+AGPR+CLGK++ F Q+K VA  II  Y +  V+   + P  S++L M+HG
Sbjct  435   EPSHKFLAFSAGPRSCLGKKLTFLQIKTVAVKIIQKYEIEVVEGQKSEPVPSVLLRMQHG  494

Query  315   LKVRVQR  295
             LKV V R
Sbjct  495   LKVSVTR  501



>ref|XP_010437945.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   481 bits (1237),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 245/522 (47%), Positives = 339/522 (65%), Gaps = 24/522 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAF---FCLVIWIILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVL  1666
             MASI   ++ VA    F ++ +++ +  Y R  +  P+  MLP+L   + +I+D    +L
Sbjct  1     MASISLLQVSVAMILGFLILHYLLFKKPYGRFRRNWPVLRMLPALLRALHRIYDYSVKIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   TF  KGP F  +D+L+TVDPAN+H+IM+ NF N+ KG  F+ +FDV GDGI  +D
Sbjct  61    EISNLTFPFKGPRFAGMDMLVTVDPANIHHIMTSNFSNYIKGPAFQDVFDVFGDGIITTD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
             L+LWK  RK  +A++  Q F R+ + T   K++ GL+P+L+  A E+G  VDLQDVF RF
Sbjct  121   LELWKTLRKSYQAVLHRQEFQRFSMSTMTRKLKDGLVPLLDHFA-EKGTTVDLQDVFGRF  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFD    LVTG DP  LS++ P+  FSKA+DD  E +  RH+ P  LWKLQ W+G G EK
Sbjct  180   TFDIILILVTGSDPRSLSIEMPEDEFSKALDDVGEGILYRHVKPRFLWKLQNWVGFGEEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+++A    D+V  KYI+ KR+E+    K      D ++    D+LTS+I  +  +  + 
Sbjct  240   KMTKANATFDRVCAKYISGKREEM----KRSQGVIDKSNVESEDILTSFIKLDTTKYKLL  295

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL----LTAVNSGE  778
                DDKFLRD IL  +IAGRDTT+SAL+WF WL+S +P+V   IR E+    L+   +G+
Sbjct  296   NTSDDKFLRDNILTFIIAGRDTTASALSWFFWLLSENPKVVAKIRQEVINTDLSRTGNGQ  355

Query  777   DPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMF  598
                       E L  LVYL  ALCE+LRLYPPV F  KSP+++D+LPSGHKV  ++ ++ 
Sbjct  356   ----------ENLDKLVYLQGALCEALRLYPPVCFGRKSPIKSDVLPSGHKVDANSNIVI  405

Query  597   SLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQM  418
              LYA+GRM+ +WG+DA EFKPERWI  E G +KHEPS+KFL+FNAGPRTCLGK +A  QM
Sbjct  406   CLYALGRMRAVWGEDALEFKPERWIT-ESGGIKHEPSFKFLSFNAGPRTCLGKHIALNQM  464

Query  417   KAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             K VA  I+ NY ++ V+     P + IIL MKHGL++ V +R
Sbjct  465   KIVAVEILQNYDIKVVEGQKIEPVLGIILSMKHGLRITVTKR  506



>dbj|BAJ86572.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   480 bits (1236),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/487 (50%), Positives = 330/487 (68%), Gaps = 17/487 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             PL+ PL GMLP+L  ++ ++HD   ++L+     F   GP  + +D+ +T DPANV ++ 
Sbjct  34    PLEWPLVGMLPALLANLPRLHDWVTSLLTASPLNFRFVGPPRSGMDLFLTSDPANVRHVF  93

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             + NF N+PKG +F +I D+LG GIFN+D D W+ QR  A+ L+   RF  ++ R S  KV
Sbjct  94    TSNFSNYPKGPDFAEIMDILGGGIFNADGDSWRRQRAKAQLLMSGPRFRAFVTRCSRRKV  153

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E+ L+P+L   A    GV DLQDVF R TFDTT TLV G DPGCL++ FP+VPF++AMDD
Sbjct  154   ERDLLPLLAHVAAAGTGVCDLQDVFLRLTFDTTTTLVFGVDPGCLAIGFPEVPFARAMDD  213

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             A +VL +R++LP S WKL +WLG+G E+K++ A   +D+ IG  I  KR+E++       
Sbjct  214   AMDVLLVRNVLPPSWWKLVRWLGVGYERKMAVAWRDIDRFIGDTIA-KRREVV------K  266

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
                 I+D    DLL+SYI+++D +          FLRDT +NLM+AGRDTT S L+WF +
Sbjct  267   ARGGIDDSA--DLLSSYIHDDDDDVVDA------FLRDTTMNLMLAGRDTTGSGLSWFFY  318

Query  849   LVSTHPEVEKNIRDELLTAVNSG-EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPF  673
             L++ +P V   I  EL T  +S   D      +  EEL  LVYLHAALCESLRLYPPVP 
Sbjct  319   LLTRNPRVVSKILAELDTVSSSATRDADGMVTYDPEELGRLVYLHAALCESLRLYPPVPT  378

Query  672   QHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHE  493
             +HK  +  + LPSGH+V P  ++M SLYAMGRM+ +WGKD +EF+PERWI  E G  ++ 
Sbjct  379   EHKGVVAAEALPSGHEVRPGEKVMVSLYAMGRMEAVWGKDCREFRPERWIG-EDGKPRYV  437

Query  492   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGL  313
             PSYKFL+FN+GPRTCLGK++AF Q+KAVAAA++ N+ V AV  H   P +SIIL+MK+G 
Sbjct  438   PSYKFLSFNSGPRTCLGKDMAFVQLKAVAAAVLSNFQVEAVPGHVVEPKISIILHMKNGF  497

Query  312   KVRVQRR  292
             K R++RR
Sbjct  498   KARIKRR  504



>gb|KFK22570.1| hypothetical protein AALP_AAs72953U000100 [Arabis alpina]
Length=500

 Score =   480 bits (1235),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/514 (48%), Positives = 328/514 (64%), Gaps = 23/514 (4%)
 Frame = -2

Query  1824  IDYFEIFVAFFCLVIW--IILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             I   EI +AF   +++   +L    +RP     P+ GMLP+L   V +I+D    VL   
Sbjct  5     IGLLEISIAFIFFLVFQCFLLHKKTQRPFPTNWPVLGMLPALLHQVPRIYDCITEVLEAA  64

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
               TF  KGPW +  DILITVDPAN+HYI+S NF N+PKG EF+ IF  LGD IFN D +L
Sbjct  65    DMTFHFKGPWLSRTDILITVDPANIHYILSSNFVNYPKGMEFRNIFKELGDSIFNVDWEL  124

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W++ R  A A+  HQ F +  V TS +K+++GL+P+LE A  E   +VDLQD+FQRF +D
Sbjct  125   WEDLRNSAHAIFSHQEFQKISVSTSMSKLKQGLVPILENAV-EENILVDLQDLFQRFLYD  183

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             T+  L+TGYD  CLS++ P V FS A+D   + LF RH +P  LWKLQ+W+G+G EK++ 
Sbjct  184   TSSILMTGYDTECLSIEMPKVEFSDAVDGVVDGLFYRHFMPVFLWKLQKWIGVGVEKRMK  243

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             R     D++  K I+ KR+EL     ++            D+LT Y+  +  +       
Sbjct  244   RGLASFDKLFEKIISAKREELKTHIDSKG--------EAVDVLTYYLTMDTTKYKHLKLS  295

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
              DKF+RD I   +IAGRDTTS+ALTWF WL+S +PE +  IR E+          +K   
Sbjct  296   SDKFIRDIIFGFLIAGRDTTSTALTWFFWLLSKNPEAKTKIRQEI---------NEKMPK  346

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F + EL  LVYLH A+CE+LRLY PVPF HKSP + D+LPSGH+V  + +++ + YAMGR
Sbjct  347   FDSAELDKLVYLHGAVCETLRLYSPVPFNHKSPAKPDVLPSGHRVDENLKIIITPYAMGR  406

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ IWG DA++F+PERWI  + G +KH PSYKFLAFNAGPR CLGK++ F QMK VA  I
Sbjct  407   MRSIWGDDAEDFRPERWIT-DSGKLKHVPSYKFLAFNAGPRLCLGKKLTFLQMKTVAVEI  465

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             I NY ++ V+ H   P  SIIL M+ GLKV V +
Sbjct  466   IRNYDIKVVEGHQTKPVPSIILRMRDGLKVSVTK  499



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   480 bits (1235),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/519 (47%), Positives = 337/519 (65%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYR--RPLKVPLFGMLPSLFLHVRKIHDRCAAVLSL  1660
             M  + Y+ I +   CL  W +     +  +P+  P+ GMLP    +  +IH     +L  
Sbjct  1     MDVLGYYVIPLIILCLTYWYLKNKWTKTSKPIDWPIIGMLPGFVHNAHRIHSFFTDLLLE  60

Query  1659  HGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLD  1480
                 F  +GP F N+D+L T DPAN+H+I+S NF N+PKG EF++IFD+LG+GIFN D +
Sbjct  61    TSSNFEFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSE  120

Query  1479  LWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTF  1300
             LW+  RK    L+ H +F   L R  W+ ++KG++P L+  A ++   VDLQD+FQRF+F
Sbjct  121   LWEIHRKTTMYLMNHAKFQTLLQRNVWDTIDKGIVPTLDIFA-KQDTPVDLQDIFQRFSF  179

Query  1299  DTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKL  1120
             DT   L+  +DP  LSV+ P VP  KA +D  + L  RH+LPES WKLQ+WL IG EK L
Sbjct  180   DTISKLLLDHDPKSLSVNLPYVPCEKAFNDMVDALLYRHVLPESCWKLQKWLRIGKEKNL  239

Query  1119  SRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYI---NNNDGETTM  949
               A E LDQ I   I+ KRQE +++       N I D++ FDL + Y+   N    E   
Sbjct  240   MNAWEALDQFIYPAIS-KRQEKLMS-------NKIKDDD-FDLFSDYVKAYNQWTNEDDK  290

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
              L   +KFLRDT LNLM AGRDTTS+ LTW  W ++ +P V K IR+E+   ++  ED +
Sbjct  291   NLGSVEKFLRDTFLNLMFAGRDTTSTTLTWCFWHLAKNPLVVKKIREEIQQQLHLKED-E  349

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
               + F  EE + LVYLH ALCE+LRL+PPV  +HKSPL+ D+LPSGH+VSP+ +++ S Y
Sbjct  350   SLKFFNIEESRKLVYLHGALCEALRLFPPVSIEHKSPLKLDVLPSGHRVSPNMKILISFY  409

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
              MGRM+ +WGKD  EF+PERWI  ERG +KHEPSYKF AF AGPRTC+GKE+AF QMK V
Sbjct  410   TMGRMESLWGKDCLEFRPERWIT-ERGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMKMV  468

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AA +I+NY+++ ++    SP  ++++ M +GL  +V +R
Sbjct  469   AATMIYNYNIQLLEAQTISPTATVVIRMTNGLMAKVVKR  507



>ref|XP_007150924.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
 gb|ESW22918.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
Length=509

 Score =   480 bits (1235),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/505 (47%), Positives = 329/505 (65%), Gaps = 13/505 (3%)
 Frame = -2

Query  1800  AFFCLVIWIILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPW  1627
             A FC++ +   R   R P+    P+ GMLP L  ++ + HD    +L   GGT    GPW
Sbjct  14    ALFCIMYFFHRRACCRYPILTDHPILGMLPQLLFNLWRFHDFFTEILKQKGGTGEFTGPW  73

Query  1626  FTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARA  1447
             FTN++ L T DP NV ++M+ +F N+ KG  F+ IF+V G GI  +D + WK  R L   
Sbjct  74    FTNMNYLFTSDPLNVRHVMNTSFHNYGKGPVFRDIFEVFGKGIVGTDSEAWKYNRDLVHY  133

Query  1446  LIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYD  1267
             L+  ++F  +L +T   K++  L+PVL+    ++G VVDLQD+F RFTFD  C  V G+D
Sbjct  134   LLKQKKFEVFLEKTIHKKIQNSLLPVLDHVH-QQGSVVDLQDLFNRFTFDNLCYSVNGHD  192

Query  1266  PGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVI  1087
             P CLSVDFP+V   KA +DA E +F RH++P+ +WKLQ+WL IG EKK++ AC+ LD+ I
Sbjct  193   PNCLSVDFPEVEIEKAFNDAGETIFRRHVVPKCVWKLQKWLQIGQEKKMTEACKNLDEFI  252

Query  1086  GKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTIL  907
                I  KR+ L    +     N+  + +  DLLT+ +     +   G + DD FLRDT+ 
Sbjct  253   YACIASKRKNLSKCIEK----NETEETSDVDLLTTLMREGKEK---GEEHDDIFLRDTVF  305

Query  906   NLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLV  727
             N  +AGRD  +SALTWF WLV+T+P VE  I +E+      G + KK  +   EE+K LV
Sbjct  306   NFFVAGRDAVTSALTWFFWLVATNPLVEAKILEEIKETF--GRNEKKAEVLSVEEVKKLV  363

Query  726   YLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAK  547
             YLH A+CESLRL+PP+PF+ K  L++D+LPSGH V+P T ++F LY+MGR + IWG+D  
Sbjct  364   YLHGAICESLRLFPPIPFERKEALKSDVLPSGHGVNPSTVILFFLYSMGRSEEIWGEDCM  423

Query  546   EFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK  367
             EFKPERWI+ E+G + + PSYKF+AFN GPRTCLGK V+  QMK VA AI+H Y ++ V+
Sbjct  424   EFKPERWIS-EKGGIVYVPSYKFVAFNTGPRTCLGKGVSLIQMKMVATAILHKYRLQVVE  482

Query  366   NHDASPNVSIILYMKHGLKVRVQRR  292
              H A P +SI+L MK GLKV +++R
Sbjct  483   GHVAKPKLSIVLLMKDGLKVTIKKR  507



>ref|XP_010531420.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=514

 Score =   480 bits (1236),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/520 (45%), Positives = 341/520 (66%), Gaps = 16/520 (3%)
 Frame = -2

Query  1836  AMASIDYFEIFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVL  1666
             A  SI + EI +AF C +++ IL +       P   P  GMLP + +   +++D  A VL
Sbjct  2     ASPSIGFLEISIAFVCFLVFHILLNKKPHACFPRNWPFLGMLPGVLVVFHRVYDWAADVL  61

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   TF  KGPWF  +D+L+TVDP+N+H+IMS +F N+PKG EFK++FDVLGDGI N D
Sbjct  62    EISDLTFTFKGPWFAGIDMLVTVDPSNIHHIMSSHFSNYPKGPEFKEVFDVLGDGILNVD  121

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              DLW+N RK  +++  H+ F ++    +  K++ GL+P L+ AA E   VVD+QDV +R+
Sbjct  122   SDLWENLRKSTQSIFNHEGFKKFSFLANVKKLKTGLLPFLDQAAKE-NMVVDVQDVLERY  180

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
              FDTTC  + GYDPGCLS++ P+V F  A++DA E +  RH+ P  LWK+Q WLG+G E 
Sbjct  181   IFDTTCITIAGYDPGCLSIELPEVEFYNALNDAVECIVYRHVKPRFLWKIQNWLGVGAEG  240

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+ RA    D++  KY + KR+E+       + + ++      DLL  Y+N+++ +  + 
Sbjct  241   KMRRAHATFDRICAKYASTKREEI---RSGIHSNGEV-----MDLLAFYMNSDESKYKLF  292

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN--SGEDP  772
               +D+KF RDT+L  M+AG    S+ LT   WL+S +PE    IR E+ + +   +  D 
Sbjct  293   DPYDNKFQRDTLLTFMVAGMGVGST-LTRLFWLLSKNPESLAKIRQEIQSKLPRMANRDD  351

Query  771   KKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSL  592
                  F  ++LK LVYLH A+CE+LRLYPPVPF+ KSP + D+LPSGHKV  + +++  +
Sbjct  352   DGEISFDPKDLKKLVYLHGAICETLRLYPPVPFERKSPTKEDVLPSGHKVGANEKILIII  411

Query  591   YAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKA  412
             YAMGRM+ +WG+DA +FKPERWI+ E G +KHEPSYKFL+FNAGPR CLG+E+AFTQ+K 
Sbjct  412   YAMGRMKAVWGEDASDFKPERWIS-ESGGLKHEPSYKFLSFNAGPRACLGREMAFTQLKT  470

Query  411   VAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             V   II NY +  V+  +    VS+IL +++GL+V V +R
Sbjct  471   VFVEIIRNYDINVVEGQEVKSVVSVILRIQNGLRVTVSKR  510



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   480 bits (1235),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/514 (48%), Positives = 332/514 (65%), Gaps = 27/514 (5%)
 Frame = -2

Query  1818  YFEIFVAFFCLVIW---IILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGT  1648
             Y E+ V+  C ++    +  RDG   P   P+ G+LP++ ++  +IH+     L   G +
Sbjct  14    YPELMVSLACFLLLFHRLKRRDGL--PTNWPVVGVLPAITINAGRIHEWLTEFLRAAGLS  71

Query  1647  FLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKN  1468
             +++KGPW + +D+++T DPANV ++ + NF N+PKG+EF ++FDVLGDGIFN+D D W  
Sbjct  72    YVIKGPWGSPVDVIVTADPANVAHVFTANFGNYPKGEEFAELFDVLGDGIFNADGDSWAF  131

Query  1467  QRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLE-FAAGERGGVVDLQDVFQRFTFDTT  1291
             QR+ A AL+   RF   +  ++  K+  GL+P+L+  AA   G  VDLQDVF R TFD T
Sbjct  132   QRRKAHALLSDARFRAGVAASTARKLRDGLVPLLDGLAASGSGAAVDLQDVFVRLTFDLT  191

Query  1290  CTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRA  1111
                V G+DPGCL+ DFP VPF+ AMD  EEVLF RH+ P    +LQ++L IG  KK+  A
Sbjct  192   AMFVFGFDPGCLAADFPHVPFAAAMDTIEEVLFYRHVTPVPCLRLQKFLKIGHIKKMGNA  251

Query  1110  CEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDD  931
               +LD  I ++I+++R+                 E   DLLTSY+   D     G  F  
Sbjct  252   RRVLDASIAEFISLRRERAA--------------EGEVDLLTSYLACQDEVGKSGADF-H  296

Query  930   KFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLT-AVNSGEDPKKFRLF  754
             +FLRDT  NLM+AGRDTTSSALTWF WL++ HP+VE  I +EL     +SG D  +    
Sbjct  297   RFLRDTTFNLMVAGRDTTSSALTWFFWLLTKHPDVEAKILEELRAHPPSSGADGHR----  352

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
              A ELK LVYLHAAL ESLRLYPPVPF+HK+  + D LPSG +V P  R++ S Y+MGRM
Sbjct  353   TAAELKQLVYLHAALSESLRLYPPVPFEHKAAARPDTLPSGARVGPSRRVIVSFYSMGRM  412

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + +WGKD  EF+PERW+    G  +HEPSYKF+AFN GPRTCLG+++A++QMKAV AA++
Sbjct  413   EAVWGKDCSEFRPERWLT-AAGRFRHEPSYKFVAFNVGPRTCLGRDLAYSQMKAVVAAVL  471

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               + V         P +SIIL+MK GLKVRV +R
Sbjct  472   PRFRVEVDAGAVVRPKLSIILHMKDGLKVRVHKR  505



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   479 bits (1234),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/519 (47%), Positives = 336/519 (65%), Gaps = 17/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI--WIILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ VA  C  I  + + +  + R  +  P+  MLP+L   + +I+D    +L 
Sbjct  1     MASISLLQVSVAILCFFILHYFLFKKPHGRFRRNWPVLRMLPALLKALHRIYDYSVKILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGP F  +D+LITVDPAN+H+IMS +F N+ KG EF+ +FDVLGD    +D 
Sbjct  61    TSDLTFPFKGPRFAGIDMLITVDPANIHHIMSSSFSNYIKGPEFQDVFDVLGDSFITTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKN RK  +A++  Q F R+ + T  +K++ GL+P+L   A E G  +DLQ VF RFT
Sbjct  121   ELWKNMRKSYQAMLHTQEFQRFSMSTMTSKLKDGLVPLLNHFA-EEGTTLDLQGVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT C LVTG DP  LS++ P   F+KA+DD  E +  RH+ P  LWKLQ W+G G EKK
Sbjct  180   FDTICILVTGSDPRSLSIEMPGDEFAKALDDVGEAILYRHVKPRFLWKLQNWMGFGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L  A    D+V  KYI+ KR+E+  +    N +++       DLLTS I  +  +  +  
Sbjct  240   LIEANATFDRVCAKYISAKREEIKRSQGVSNGESE-------DLLTSIIKLDTTKYKLLN  292

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               DDKFLRD IL  ++AGRDTT++AL+WF WL+S +P+V   IR E    +N+  D  + 
Sbjct  293   PSDDKFLRDNILAFILAGRDTTATALSWFFWLLSENPQVVAKIRQE----INNNTDLSRT  348

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                  E +  LVYLH ALCE++RLYPPV F  KSP+++D+LPSGHKV  +++++  LYA+
Sbjct  349   G-NSQENVDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVDANSKIIICLYAL  407

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA +FKPERWI+ E G +KHEPSYKFLAFNAGPRTCLGK +A TQMK +A 
Sbjct  408   GRMRAVWGEDATQFKPERWIS-ENGGIKHEPSYKFLAFNAGPRTCLGKHLAMTQMKIMAV  466

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              I+ NY ++ ++     P +  IL MKHGLK+ V +R +
Sbjct  467   VILRNYDIKVLQGQKIVPALGFILSMKHGLKITVTKRCS  505



>ref|XP_006283573.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
 gb|EOA16471.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
Length=505

 Score =   479 bits (1233),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/521 (46%), Positives = 345/521 (66%), Gaps = 23/521 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKV-----PLFGMLPSLFLHVRKIHDRCAAV  1669
             MASI   +  +A  CLV +      +++P        P+ GM+P   L + +I++     
Sbjct  1     MASISLLDASIAIVCLVFFQCFF--FKKPKNEAFRNWPVLGMIPGFLLVLHRIYNFGVET  58

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L     TF  KGPWFT +D+L TVDPAN+HYI+S NF N+ KG +FK++FDV G+ IF+S
Sbjct  59    LEATDLTFFFKGPWFTGMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEMIFSS  118

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LWKNQRK A+ ++ HQ F +  +  + +K+  GL+P+ +    E G VVDLQ+VF+R
Sbjct  119   DSELWKNQRKAAQFMLNHQGFQKLSMSATRSKLYDGLVPLFD-QCCEEGKVVDLQEVFKR  177

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  LVTG DP  L+++ P V ++KA+DD  E +F RH+ P+ LWKLQ W+G+G E
Sbjct  178   FTFDTTFFLVTGCDPKSLTIEMPAVEYAKALDDLGEGIFYRHIKPKFLWKLQNWMGLGQE  237

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             K++++A    D+V  KYIT KR+E+    ++Q  D+  + E+  DLL+S+I  +  +  +
Sbjct  238   KRMAKADATFDRVSAKYITAKREEI----RSQGIDHHSDGESE-DLLSSHIKLDTTKYEL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELL--TAVNSGED  775
                 DDKFLRDTIL   +AGRDT +SAL+WF WL+S +P+V   IR E++      +G +
Sbjct  293   LKPSDDKFLRDTILAFNLAGRDTMASALSWFFWLLSENPQVVTKIRKEIIDKNISKTGRN  352

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +       E+L  LVYLHAAL ES+RLYPPV FQ KSP++ D+LPSGHKV  ++ ++  
Sbjct  353   AQ-------EKLDKLVYLHAALYESVRLYPPVVFQRKSPIKADMLPSGHKVEANSVIIIY  405

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LY +GRM+ +WG+DA EFKPERW+  E G ++H PS+KFL+FNAGPRTC GK++A T MK
Sbjct  406   LYGLGRMRAVWGEDAAEFKPERWVT-ETGGLRHAPSFKFLSFNAGPRTCPGKQLAMTLMK  464

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              V   I+ NY +  +K     P+  ++L+MKHGL+V + +R
Sbjct  465   TVVVEILQNYDIEVIKGQKIEPDPGLMLHMKHGLRVTITKR  505



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   480 bits (1236),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 246/497 (49%), Positives = 333/497 (67%), Gaps = 18/497 (4%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   PL GMLP L  +  ++H+    +L  + G F  KGP F+NL++L + DPAN+H+++
Sbjct  42    PTNWPLIGMLPGLLRNTHRLHEFVTEILIENEGIFEFKGPVFSNLNMLFSSDPANLHHML  101

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG E+KK+FD++GDGIFN D +LW+ QRK+  +++ H +F   L R  W+KV
Sbjct  102   SKNFNNYPKGSEYKKMFDIMGDGIFNVDNELWEVQRKITISIMSHPKFLSCLERNVWDKV  161

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFP-DVPFSKAMD  1213
              KGL PVL+  A ++G   DLQD+FQRFTFDT   L+  +DPG LS+D P D  F  A  
Sbjct  162   VKGLQPVLDNFA-KQGSCFDLQDIFQRFTFDTISKLLLDHDPGSLSIDLPTDSLFKNAFQ  220

Query  1212  DAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQ  1033
             DA + +  RH++PES WKLQ+WL +G EKKLS+A +  DQ+I   I+ K++E++     +
Sbjct  221   DAGDAILYRHIMPESCWKLQKWLRVGKEKKLSQAWKAFDQLIYSCISRKQEEML----RR  276

Query  1032  NPDNDINDENGFDLLT-------SYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTS  874
             +   +  DE+ FD LT       S    N  +T +      KFLRDT +NLM AG+DTTS
Sbjct  277   SGFIEEEDED-FDFLTACMKAYNSLFMKNIVDTDLENNNAKKFLRDTCMNLMFAGKDTTS  335

Query  873   SALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLR  694
             SALTWF WL++ +P V+  IRDE+   +   ED +  R F  +E + LVYLH ALCESLR
Sbjct  336   SALTWFFWLLAKNPSVQTTIRDEIQEILQLKED-ENLRFFNVQESRELVYLHGALCESLR  394

Query  693   LYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWE  514
             L+PP+P +HK   +TDILPSGH + P  R++ S Y MGRM+ +WG D  +FKPERWI+  
Sbjct  395   LFPPIPLEHKIATETDILPSGHHLCPGKRVILSFYTMGRMETLWGNDCLDFKPERWISGG  454

Query  513   RGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK-NHDASPNVSI  337
             RG +KHEPS+KF  FNAGPRTCLGK+++F QMK VAA II NY V+ V+  H   P+ SI
Sbjct  455   RGKIKHEPSFKFPVFNAGPRTCLGKDISFFQMKMVAATIIFNYQVQLVEGQHLDFPSASI  514

Query  336   ILY--MKHGLKVRVQRR  292
             +L   MKHGLKVR+ +R
Sbjct  515   LLQLKMKHGLKVRLIQR  531



>emb|CDX76962.1| BnaC08g35480D [Brassica napus]
Length=510

 Score =   479 bits (1233),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 228/486 (47%), Positives = 320/486 (66%), Gaps = 11/486 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP + + + KI+     VL +   TF+ KGPWF+ +++LIT DPANV ++ 
Sbjct  32    PRNWPILGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPANVQHVF  91

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+ KG EFK++FD LG+GIF +D  LW+  R+ +  ++ HQ F  + ++T  +K+
Sbjct  92    SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             + GL+PVL+  A E   V DLQDVFQR  FD T TLVTGYD   LS++ P   ++KAMDD
Sbjct  152   KNGLVPVLDHFAKE-NMVFDLQDVFQRLAFDVTLTLVTGYDSNSLSIEMPKNEYAKAMDD  210

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             AEEV+ +RH+ P  +WKLQ WLG+G EKK+++A    D+   KYI+ KR+E+        
Sbjct  211   AEEVVVVRHVKPMFVWKLQNWLGLGEEKKMTQAKAAFDRSCAKYISAKREEIHQHSIIGE  270

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
               +D+      DLL  Y+N +  +  +    DD FL+D I + M+AGRD  ++ LTWF W
Sbjct  271   KAHDV------DLLKFYMNLDTSKYELLNPKDDSFLKDIIKSFMLAGRDAIATTLTWFFW  324

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L+S +PE    IR E+ T +    D         ++L  +VYLH ALCE+LRLY P+PF+
Sbjct  325   LLSKNPEALTKIRQEINTYLTRSSDKN----LDQDKLSKMVYLHGALCEALRLYAPIPFE  380

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              KSP++ D+LPSGHKV    +++FS+YA+GRM+ +WG+DA EFKPERWI+   G +KHEP
Sbjct  381   RKSPIKQDVLPSGHKVDAKWKILFSVYALGRMRAVWGEDASEFKPERWISERNGGLKHEP  440

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KF  FN+GPR CLGK+++F QMK VA  II NY +  ++ H   P  SI+L+MKHGLK
Sbjct  441   SFKFFVFNSGPRNCLGKKLSFLQMKIVATEIIQNYDINVLEGHKIEPASSIVLHMKHGLK  500

Query  309   VRVQRR  292
             V V +R
Sbjct  501   VTVAKR  506



>ref|XP_010431923.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   479 bits (1233),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/517 (46%), Positives = 338/517 (65%), Gaps = 14/517 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKV---PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ +A  CLV++  L    R+       P+ GM+P   L + +I+D    +  
Sbjct  1     MASISLLDVSIAIICLVLFRCLFFKKRKDHAFRSWPVLGMIPGFLLELHRIYDFGVEIFE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TFL  GPWFT +D+L TVDPAN+HYI+S NF N+ KG +FK++FDV G+ IF+SD 
Sbjct  61    TADLTFLFTGPWFTGMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEMIFSSDA  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKNQRK A+ ++ HQ F +  + T+  K+  GL+P+ +    E   VVDLQ+VF+RFT
Sbjct  121   ELWKNQRKAAQYMLNHQGFQKLSMSTTRRKLYDGLVPLFD-QCCEEEKVVDLQEVFKRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDTT  LVTG DP  LS++ P+V ++KA+DD  E +F RH+ P+ LWKLQ   G+G EK+
Sbjct  180   FDTTFFLVTGCDPKSLSIEMPEVEYAKALDDLGEGIFYRHIKPKFLWKLQNLFGLGQEKR  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++ A    D+V  KYI+ KR+E+    +++  D+  +D    DLL+S+I  +  +  +  
Sbjct  240   MTEADATFDRVSAKYISAKREEI----RSKGIDHHQSDGESEDLLSSHIKLDTTKYELLK  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               +DKFLRDTIL   +AGRDT +SAL+WF+WL+S +P+V   IR E++    S       
Sbjct  296   PSEDKFLRDTILAFNLAGRDTMASALSWFLWLLSQNPQVVTKIRKEIIDKSISKTGSNVL  355

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                  E L  LVYLHAAL ES+RLYPPV FQ KSP++ D+LPSGHKV  ++ ++  LY +
Sbjct  356   -----ENLDKLVYLHAALYESMRLYPPVVFQRKSPIKADLLPSGHKVDANSVIIIYLYGL  410

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM  +WG+DA EFKPERWI+   G ++H PS+KFL+FNAGPRTC GK++A T MK V  
Sbjct  411   GRMTAVWGEDATEFKPERWIS-GTGGLRHSPSFKFLSFNAGPRTCPGKQLAMTLMKTVVV  469

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              I+ NY ++ +K     P   ++L+MKHGL+V + +R
Sbjct  470   EILQNYDIKVIKGQKIEPESGLMLHMKHGLRVTITKR  506



>ref|XP_006411750.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
 gb|ESQ53203.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
Length=509

 Score =   479 bits (1233),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 243/518 (47%), Positives = 338/518 (65%), Gaps = 16/518 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKV---PLFGMLPSLFLHVR-KIHDRCAAVL  1666
             MASI   E  V   C +I   LR    R   +   P+  MLP L + ++ +I+D    +L
Sbjct  1     MASISLLEASVTILCFLILFYLRFKKHRGRFLRNWPVLRMLPGLLVALQYRIYDYSVKIL  60

Query  1665  SLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSD  1486
              +   TFL KGP F  +D+L+TVDPAN+H+IMS NF N+ KG +F+ +FDV GDGI  +D
Sbjct  61    EIFDLTFLFKGPPFAGMDMLVTVDPANIHHIMSSNFSNYIKGSDFQDVFDVFGDGIITTD  120

Query  1485  LDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRF  1306
              +LWKN RK  +A++ HQ F R+ + T  +K++ GL+P+L   A E G +VDLQDVF R 
Sbjct  121   SELWKNLRKSYQAMLHHQDFQRFSMSTMTSKLKDGLLPLLNHFA-EEGTIVDLQDVFGRL  179

Query  1305  TFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             TFDT   L+TG DP  LS++  +   +KA++D  E +F RH+ P+ LWKLQ W+G+G EK
Sbjct  180   TFDTILILITGSDPKSLSIEMHEDELAKALNDVGEGVFYRHVKPKFLWKLQNWMGLGQEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K+  A    D+V  KYI+ KR+E+     +     D +D    DLLTS++  +  +  + 
Sbjct  240   KMIEASATFDRVCAKYISAKREEI----NSSQGILDTSDGVTEDLLTSFMKLDTTKYKLL  295

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                DDKFLRDTIL  ++AGRDTT+SAL+WF WL+S +P V   IR E++    S + P+ 
Sbjct  296   NPSDDKFLRDTILAFILAGRDTTASALSWFFWLLSENPHVVAKIRQEII----STDLPRT  351

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
                   E L  +VYLH ALCE++RLYPPV F+ KS ++ D+LPSGHKV  +++++  LYA
Sbjct  352   GN--GQENLDKMVYLHGALCEAMRLYPPVAFERKSSIEPDVLPSGHKVDANSKIIICLYA  409

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             +GRM+ +WG+DA +FKPERWI  E G +KHEPS+KFLAFNAGPRTCLGK++A TQMK V 
Sbjct  410   LGRMRAVWGEDALQFKPERWIT-ENGGLKHEPSFKFLAFNAGPRTCLGKQLAMTQMKIVV  468

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
               I+ NY ++ +K     P +  IL MKHGL+V + +R
Sbjct  469   VEILQNYDIKVIKGQKIEPVLGFILSMKHGLRVTITQR  506



>gb|KGN48429.1| hypothetical protein Csa_6G487010 [Cucumis sativus]
Length=458

 Score =   477 bits (1228),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 233/452 (52%), Positives = 313/452 (69%), Gaps = 18/452 (4%)
 Frame = -2

Query  1635  GPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKL  1456
             G WFTN  +LITVDP+N+H+IM+ NF+N+PKG +FK IFDVLGDGIFNSD D WKNQRK+
Sbjct  19    GIWFTNTSLLITVDPSNIHHIMTSNFQNYPKGPDFKYIFDVLGDGIFNSDSDSWKNQRKI  78

Query  1455  ARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVT  1276
             A++LI+H++F  ++   +  KVEKGL+P+LE    E   VVDL+D+F R  FDTTCT+V 
Sbjct  79    AQSLIVHEKFFEFMCGVAKEKVEKGLVPILEHFC-ESKKVVDLKDLFLRLMFDTTCTMVA  137

Query  1275  GYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILD  1096
             G+D   LS+DFPD+PF+KAMDD +EV+F RHL P+  W+L + LG+G  KK+    + ++
Sbjct  138   GFDFNSLSIDFPDIPFTKAMDDIQEVIFFRHLYPKFYWELLKKLGLGDAKKMKNGTDTIN  197

Query  1095  QVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRD  916
             QVI   I +K+Q L L  ++   D         DL+T Y+ N       G+ ++DKF RD
Sbjct  198   QVIAHLIALKKQRLKLQQEDDGGDP--------DLITRYMMNEHD----GIDYNDKFFRD  245

Query  915   TILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFR--LFKAEE  742
              IL  +IAGRD  S AL+W    +S +P +  NIR+EL        + +K +  +F +EE
Sbjct  246   LILTYLIAGRDGLSIALSWLFLTLSKNPTIIANIREELKNIPQKESESRKGKPQIFGSEE  305

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
             L NL YLH A+CE LRLYPPV F+HKS ++ D LPSGH V   TR++ S YA+GR++ +W
Sbjct  306   LSNLAYLHGAICEILRLYPPVAFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKSVW  365

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             G+D +EFKPERWI+ E+G +K EPSYKF  FN GPR+CLGKEV   Q+K ++AAIIHNY 
Sbjct  366   GEDCEEFKPERWIS-EKGRIKREPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNYD  424

Query  381   VRAV--KNHDASPNVSIILYMKHGLKVRVQRR  292
             + AV   N+  +P  SIIL+MK G KVRV +R
Sbjct  425   IEAVVEDNNGIAPVASIILHMKTGFKVRVSKR  456



>ref|NP_195661.1| cytochrome P450, family 96, subfamily A, polypeptide 12 [Arabidopsis 
thaliana]
 emb|CAB44686.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80614.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAL24225.1| AT4g39510/F23K16_140 [Arabidopsis thaliana]
 gb|AAO23590.1| At4g39510/F23K16_140 [Arabidopsis thaliana]
 gb|AEE87080.1| cytochrome P450, family 96, subfamily A, polypeptide 12 [Arabidopsis 
thaliana]
Length=508

 Score =   478 bits (1231),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 240/519 (46%), Positives = 342/519 (66%), Gaps = 19/519 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRP-----LKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MAS+   ++ +A  CL  +  +   +++P        P+ GMLP   + + +I++     
Sbjct  1     MASVSLLDVAIAIICLFFFYYMY--FKKPHGQVFRNWPVIGMLPGFLMVLHRIYNFGVEA  58

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L +   TFL KGPWF  +D+L TVDPAN+HYI+S NF N+ KG +FK++FDV G+ IF+S
Sbjct  59    LEMSHLTFLFKGPWFAEMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEMIFSS  118

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D +LWKNQRK A+ ++ HQ F +  +  + +K+  GL+P+      E   VVDLQ VFQR
Sbjct  119   DSELWKNQRKAAQFMLNHQGFQKLSLSATRSKLYDGLVPLFN-QCCEEEKVVDLQQVFQR  177

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
             FTFDTT  +VTG+DP  LS++ P+V ++KA+DD  E +F RH+ P+  WKLQ   G+G E
Sbjct  178   FTFDTTFFIVTGFDPKSLSIEMPEVEYAKALDDLGEGIFYRHIKPKFFWKLQNRFGLGQE  237

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             K+++ A    D+V  KYI  KR+E+    ++Q  D+  N E+  DLLTS+I  +  +  +
Sbjct  238   KRMTEADATFDRVSAKYILAKREEI----RSQGIDHHANGESE-DLLTSHIKLDTTKYEL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DDKFLRDTIL   +AGRDTTSSAL+WF WL+S +P+V   IR E++   N  +D +
Sbjct  293   LNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKIRKEIIDK-NISKDGR  351

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                    E L  LVYLHAAL ES+RLYPPV FQ KSP++ D+LPSGHKV  ++ ++  L+
Sbjct  352   N----GQENLDKLVYLHAALYESMRLYPPVAFQRKSPIKPDVLPSGHKVEANSVIIIFLF  407

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             A+GRM+ +WG+DA EFKPERW++ E G ++H PS+KFL+FNAGPRTC GK++A T MK V
Sbjct  408   ALGRMRAVWGEDATEFKPERWVS-ESGGLRHAPSFKFLSFNAGPRTCPGKQLAMTLMKTV  466

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
                I+ NY +  +K     P   ++L+MKHGL+V + +R
Sbjct  467   VVEILQNYDIDVIKGQKIEPEPGLMLHMKHGLRVTITKR  505



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score =   478 bits (1230),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 239/523 (46%), Positives = 341/523 (65%), Gaps = 26/523 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI--WIILRDGYRR-PLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   E  +A  C +I  +++ +  + R P   P+ GMLP L + + +++D    +L 
Sbjct  1     MASISLLEASMAILCFLILFYLLFKKPHDRFPRNWPVLGMLPGLLVSLHRLYDYSVEILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
             +   TFLLKGP F  +D+L+TVDPAN+H+IMS NF N+ KG EF  +FDV GDGI  +D 
Sbjct  61    ISDLTFLLKGPRFFGMDMLVTVDPANIHHIMSSNFSNYIKGPEFHDVFDVFGDGILTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW+N R+  +A++ HQ F ++ V T  +K++ GL+P+L   A E G  VDLQD+F RFT
Sbjct  121   ELWRNLRRSYQAMVHHQGFQKFSVSTMTSKLKDGLVPLLNHFA-EEGTTVDLQDLFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT   L+TG DP  LS++  +   +KA++D  E +F RH+ P  +WKLQ W+G+G EKK
Sbjct  180   FDTILILITGSDPKSLSIEMHEDELAKALEDVGEGVFYRHIKPRFMWKLQNWMGLGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +S+A    D+V  +YI+ KR+E+I +    N +       G DLLTS++  +  +  +  
Sbjct  240   MSQANATFDRVCSRYISAKREEIIRSQGVLNGE-------GEDLLTSFMKLDTAKYKLLK  292

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL----LTAVNSGED  775
               DDKFLRDTIL  ++AGRDTT+SAL+WF WL+S +P V   IR E+    L    +G+ 
Sbjct  293   PSDDKFLRDTILAFILAGRDTTASALSWFFWLLSENPIVVAKIRQEIIDNDLPRTGNGQ-  351

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
                      E L  LVYL AAL E++RLYPPV F+ KS +++D+LPSGHKV  +++++  
Sbjct  352   ---------ENLDKLVYLQAALFEAMRLYPPVSFERKSSVESDVLPSGHKVDANSKIIIC  402

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LYA+GRM+ +WG+DA +FKPERWI  E G  KHEPS KFLAFN+GPRTCLGK +A TQMK
Sbjct  403   LYALGRMKAVWGEDALQFKPERWIT-ENGGPKHEPSSKFLAFNSGPRTCLGKHLAITQMK  461

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              V   I+  Y ++ ++     P +  IL MKHGL+V + +R++
Sbjct  462   TVVVEILQKYDIKVIQGQKIEPGLGFILSMKHGLRVTITKRYS  504



>emb|CBH32607.1| cytochrome P450, putative, expressed [Triticum aestivum]
 emb|CDM86333.1| unnamed protein product [Triticum aestivum]
Length=514

 Score =   478 bits (1231),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 246/519 (47%), Positives = 337/519 (65%), Gaps = 16/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRR-----PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             MAS+ + E+ +A  C V++       +R     PL  PL GMLP+L  ++ ++HD   +V
Sbjct  1     MASVSFLELSLALLCFVVFYYFHIRSKRQNPALPLDWPLVGMLPALLANLPRLHDWVTSV  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L+    +F L GP  + L + IT DPANV ++ + NF N+PKG EF +I D+LG GIFN+
Sbjct  61    LTASPLSFRLAGPPRSGLQLFITADPANVRHVFTSNFPNYPKGPEFAQIMDILGGGIFNA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D D W+ QR  A+ L+   RF  ++ R S  KVE+ L+P+L   AG   G  DLQDVF R
Sbjct  121   DGDSWRRQRAKAQLLMSGPRFRAFVSRCSRRKVERDLLPLLARVAGVGAGECDLQDVFLR  180

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
              TFD T TLV G DPGCL+V FP+VPF++A+DDA +VL +R LLP S WKL + LG+G E
Sbjct  181   LTFDVTTTLVLGVDPGCLAVGFPEVPFARAIDDAMDVLLVRSLLPLSWWKLVRRLGVGYE  240

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             +K++ A   +D+ IG  I  +R+ +  T            E+  DLL+SYI+++D     
Sbjct  241   RKMAVAGRDIDRFIGDTIAKRREAVKATG---------GIEDSADLLSSYIDDDD-GDAG  290

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                  D FLRDT LNL+IAGRDTT SALTWF +L++ +P V   I  EL T   +     
Sbjct  291   SGTVVDVFLRDTTLNLVIAGRDTTGSALTWFFYLLTRNPGVVSKILAELDTIKTTTTTLD  350

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                 +  +EL  LVYLHAALCESLRLYPP+P +HK     + LPSGH+V P  +++ SLY
Sbjct  351   GMVTYDPDELGRLVYLHAALCESLRLYPPLPMEHKGVAAAEALPSGHEVRPGDKILVSLY  410

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             AMGRM+ +WGKD +EF+PERWI  E G +++ PSYKF++FN+GPRTCLGK++A  Q+KAV
Sbjct  411   AMGRMEAVWGKDCREFRPERWIG-EDGKLRYVPSYKFISFNSGPRTCLGKDMAVVQLKAV  469

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AAA++ N+ V  V  H   P +S+IL+MK+G K R++RR
Sbjct  470   AAAVVRNFEVDFVAGHVIEPKISVILHMKNGFKARIKRR  508



>ref|XP_010520636.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=511

 Score =   478 bits (1230),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 240/482 (50%), Positives = 316/482 (66%), Gaps = 11/482 (2%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P  GMLP   + + + +D    VL +   TFL KGP F  +D+L TVDPAN+H+I+  NF
Sbjct  36    PFLGMLPGFTVEIPRFYDWIIQVLEVSNLTFLFKGPIFAGMDLLFTVDPANIHHILCSNF  95

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKG +F +IFD LGDGIFN+D +LWKN RK A AL+ H  F R+    + +  ++GL
Sbjct  96    VNYPKGPDFGEIFDALGDGIFNADFELWKNLRKSAHALLSHHDFQRFTKSATVSVAKRGL  155

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L+ AA ++  +VDLQDVFQRFTFDTT TL+TGY+P  LS+D P V  + A++DAEE 
Sbjct  156   VPLLDHAA-KKNTLVDLQDVFQRFTFDTTLTLITGYNPKSLSIDMPRVELADAVEDAEEA  214

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RH+ P  LWKLQ W+  G EKKL     I D+   KYI+MKR++L    +   P  D
Sbjct  215   IFHRHVKPRILWKLQNWIDFGLEKKLKNTVAIADRECAKYISMKREDL---RRGTQPKGD  271

Query  1017  INDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVST  838
                    DLLT Y+N ++ +       DDKFLRDT+++ ++AGRDTTS+ LT F WL+S 
Sbjct  272   -----AMDLLTYYMNLDENKYNFLNPSDDKFLRDTMVSFILAGRDTTSAGLTGFFWLLSK  326

Query  837   HPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSP  658
             +PE    IR E+   +    +          +L  LVYLH AL E+LRLYPPVPF HKSP
Sbjct  327   NPEAVAKIRGEISAEMPRSINRDDETQLDQVDLNKLVYLHGALYEALRLYPPVPFNHKSP  386

Query  657   LQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKF  478
              + D LPSGHKV  +T+++F  YAMGRM+ +WG DA EFKPERWI+ E+G +KHEPS+KF
Sbjct  387   AKADTLPSGHKVEANTKIIFPFYAMGRMRSVWGDDASEFKPERWIS-EKGRLKHEPSFKF  445

Query  477   LAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHV-RAVKNHDASPNVSIILYMKHGLKVRV  301
              +FNAGPRTC+GK+VA TQM  VA  I+ NY V  A +        SIIL  KHG KV +
Sbjct  446   ASFNAGPRTCIGKQVALTQMAIVAVEILQNYDVITATEGQQLELVPSIILRTKHGYKVSI  505

Query  300   QR  295
              +
Sbjct  506   TK  507



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score =   477 bits (1228),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 234/507 (46%), Positives = 331/507 (65%), Gaps = 26/507 (5%)
 Frame = -2

Query  1806  FVAFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKG  1633
             F++FF    + + +     PL    P+ GMLP L + + +I D  A VL     TF +KG
Sbjct  14    FLSFFVFQCFFLHKKSRESPLLKNWPILGMLPGLLVRIPRIFDCTAEVLEASNLTFAIKG  73

Query  1632  PWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLA  1453
              W +  D+L+T DP N+++I+S NF N+PKG EF+KIFD+LGDGI  +D +LW++ RK  
Sbjct  74    AWLSGTDLLLTADPRNINHILSSNFRNYPKGPEFRKIFDILGDGILAADSELWEDLRKSG  133

Query  1452  RALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTG  1273
               +  HQ      + ++ +K++KGLIP L+ AA ++  ++DLQDV QRF FDT   L+TG
Sbjct  134   HTIFHHQDILEISLSSNVSKLKKGLIPFLDNAA-DKNIIIDLQDVLQRFMFDTASILMTG  192

Query  1272  YDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQ  1093
             YDP  LSV+ P+V F +A++D EE LF R++ P+ LWKLQ W+GIG E+K+      L+Q
Sbjct  193   YDPMSLSVEMPEVEFGEAVEDGEEALFYRNIKPKILWKLQYWIGIGIERKMRATTATLNQ  252

Query  1092  VIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDT  913
             ++ K I+ +R+E+    +          E   D+LT Y+N +  +  +     DKF+RD 
Sbjct  253   MLAKIISSRREEISRGKR----------ETSMDVLTYYMNADTTKYKLLKPKSDKFIRDV  302

Query  912   ILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKN  733
             +L+LM+AGRDTTSSALTWF WL+ THP+V   IR E+ T             F    L+ 
Sbjct  303   VLSLMVAGRDTTSSALTWFFWLIFTHPQVMAKIRHEIDTK------------FDPANLEK  350

Query  732   LVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKD  553
             LVYL AAL ES+RLYPP+P  HKSPL++D+LPSGH V  +++++ S+YA+GRM+ +WG+D
Sbjct  351   LVYLQAALSESMRLYPPIPLNHKSPLKSDVLPSGHNVEANSKIIISMYALGRMRSVWGED  410

Query  552   AKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRA  373
             A E+KPERWI+ E G ++HEPSYKF+AF+AGPR CLGK +A  QMK V   II NY ++ 
Sbjct  411   ASEYKPERWIS-EDGGIRHEPSYKFVAFSAGPRACLGKHLALLQMKMVVVDIIQNYDLKI  469

Query  372   VKNHDASPNVSIILYMKHGLKVRVQRR  292
             V+ H      SIIL MKHGL+V V ++
Sbjct  470   VEGHTIDSVPSIILRMKHGLRVTVSKK  496



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   478 bits (1229),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 243/523 (46%), Positives = 334/523 (64%), Gaps = 29/523 (6%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI---WIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ VA  C +I   ++  +   R P   P+  MLP++   + +I+D    +L 
Sbjct  1     MASISLLQVSVAILCFLILHYFLFKKPHGRYPRNWPVLRMLPAMLKALHRIYDYSVEILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGP FT +D+L+TVDPAN+H+IMS NF N+ KG EF+ +FDVLGD    +D 
Sbjct  61    TSDLTFPFKGPRFTGMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKN RK  +A++  Q F R+ + T  +K++ GL+P+L   A E G  +DLQ VF RFT
Sbjct  121   ELWKNMRKSYQAMLHSQEFQRFSMSTMTSKLKYGLVPLLNHFA-EEGTTLDLQSVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT   LVTG DP  LS++ P+  F+KA+DD  E +  RH  P  LWKLQ W+G G EKK
Sbjct  180   FDTIFILVTGSDPRSLSIEMPEDEFAKALDDVGEGILYRHFKPRFLWKLQNWIGFGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L+ A    D+V  KYI+ KR+E+  +    N  +        DLLTS+I  +  +  +  
Sbjct  240   LTEANATFDRVCAKYISAKREEIKRSQGTSNGGSQ-------DLLTSFIKLDTTKYKLLN  292

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV------EKNIRDELLTAVNSG  781
               DDKFLRD IL  ++AGRDTT++AL+WF WL+S +P V      E NI  +L    NS 
Sbjct  293   PSDDKFLRDNILAFILAGRDTTATALSWFFWLLSENPHVVAKIHQEININTDLSRTGNSQ  352

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
             E+  K           LVYLH ALCE++RLYPPV F  KSP+++D+LPSGHKV  +++++
Sbjct  353   ENVDK-----------LVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVDANSKII  401

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
               LYA+GRM+ +WG+DA +FKPERWI+ E G +KHEPS+KFL+FNAGPRTCLGK +A TQ
Sbjct  402   ICLYALGRMRAVWGEDASQFKPERWIS-ENGGIKHEPSFKFLSFNAGPRTCLGKHLAMTQ  460

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             MK VA  I+ NY ++ ++     P +  IL MKHGL++ V +R
Sbjct  461   MKIVAVEILRNYDIKVLQGQKIVPALGFILSMKHGLQITVTKR  503



>gb|KFK30509.1| hypothetical protein AALP_AA7G271200 [Arabis alpina]
Length=447

 Score =   475 bits (1223),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/484 (49%), Positives = 321/484 (66%), Gaps = 46/484 (10%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP L + + +++D    +L      F  KGP+   LD+LITVDPAN+H+IMS NF N+P
Sbjct  1     MLPGLLVEIPRVYDFATEILEDANLNFPFKGPFLGGLDMLITVDPANIHHIMSSNFANYP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFKK+FDVLGDGIFN+D +LWK+ RK A++++++  F  + + TS +K+EKGL+P+L
Sbjct  61    KGTEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQNFSLATSLSKLEKGLLPLL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +  A E+  VVDLQDVFQRFTFDTTC L T YDPGCLSV+ P++                
Sbjct  121   DHVAKEK-LVVDLQDVFQRFTFDTTCVLATEYDPGCLSVEMPEI----------------  163

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
                        + +G G E KL+RA   +D+V  KYI  KR  +     + +P       
Sbjct  164   -----------ELVGFGDELKLNRARATVDRVCSKYIASKRDMVSREIDSSSPTQ-----  207

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
                DLLTSY++ +  +  +    DD+FLRDTIL  ++AGRDTTSSALTWF+WL+  + + 
Sbjct  208   ---DLLTSYMSLDTTKYKLLNPSDDRFLRDTILTFLLAGRDTTSSALTWFLWLLCKNQDS  264

Query  825   EKNIRDEL------LTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHK  664
                IR E+      +T  +  +D + F     +ELK LVYLH A+CE+LRLYPPVPF HK
Sbjct  265   IAKIRQEINTNLFQITKTDISDDSESFN---PQELKKLVYLHGAICEALRLYPPVPFNHK  321

Query  663   SPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSY  484
             SP ++++LPSGHKV  +++++F LY++GRM+ +WG+DA EFKPERWI+ E G   HEPSY
Sbjct  322   SPTKSEVLPSGHKVDANSKILFCLYSLGRMKSVWGEDAFEFKPERWIS-ESGKSIHEPSY  380

Query  483   KFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVR  304
             KFL+FNAGPRTCLGKEVA  QMK VA  II NY ++ V+ H   P  S+IL+MKHGLKV 
Sbjct  381   KFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEIKVVEGHKIEPAPSVILHMKHGLKVT  440

Query  303   VQRR  292
             V +R
Sbjct  441   VSKR  444



>gb|KFK40984.1| hypothetical protein AALP_AA2G070000 [Arabis alpina]
Length=493

 Score =   477 bits (1227),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/509 (47%), Positives = 326/509 (64%), Gaps = 21/509 (4%)
 Frame = -2

Query  1815  FEIFVAFFCLVIWIILRDGYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFL  1642
             F  F+ F C     +L     +PL    P+ GMLP L L V +I+D    VL     TF 
Sbjct  3     FVFFIVFQCF----LLHKKTHKPLVTNWPVLGMLPGLILQVPRIYDWITEVLEATDMTFC  58

Query  1641  LKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQR  1462
              KGPW +  DIL TVDPAN+ YI+S NF N+PKG E KKIF+VLGD IFN D +LW++ R
Sbjct  59    FKGPWLSGTDILATVDPANIQYILSSNFVNYPKGIESKKIFEVLGDSIFNVDSELWEDMR  118

Query  1461  KLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTL  1282
               + A+  HQ F +  V T+ +K+++GL+P+LE A  ++  +VDLQD+F+RF FDT+  L
Sbjct  119   SSSHAIFSHQEFQKISVSTTISKLKQGLVPILENAI-KKNILVDLQDLFRRFMFDTSSIL  177

Query  1281  VTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEI  1102
             +TGYDP CLS++ P V F  A+D A + +F R++ P  LWKLQ WLG+G EK++     +
Sbjct  178   MTGYDPKCLSIEMPKVEFGDAVDGAADGIFYRYVKPVFLWKLQYWLGVGVEKRMKSGLAV  237

Query  1101  LDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFL  922
              DQ+  K I+ KR+EL    K     +  +      +LT Y+  +  +       +DKF+
Sbjct  238   FDQLFEKIISAKREEL----KTHGTHDHDSKREAMGVLTYYMTVDTTKYKHLKPRNDKFI  293

Query  921   RDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEE  742
             RD IL  +IAGRDT SS+LTWF WL+S +PE    ++ E+          KK   F   +
Sbjct  294   RDAILGFLIAGRDTISSSLTWFFWLLSKNPEAMTKVQQEI---------NKKMPKFDPTD  344

Query  741   LKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIW  562
             L  LVYLH A+CE+LRLY P+PF  KSP + D+LPSGH+V  D +++ S YA+GRM+ +W
Sbjct  345   LDKLVYLHGAVCETLRLYSPLPFNQKSPAKPDVLPSGHRVDEDMKIVISTYALGRMRSVW  404

Query  561   GKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYH  382
             G DA++F+PERWI+ + G  KHEPSYKFLAFNAGPRTCLGK++ F QMK VA  II NY 
Sbjct  405   GDDAEDFRPERWIS-DSGKSKHEPSYKFLAFNAGPRTCLGKKLTFLQMKIVAVEIIQNYD  463

Query  381   VRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             ++ V+ H   P  S++L M+HGLKV V +
Sbjct  464   IKVVEGHKTQPVPSVLLRMQHGLKVTVTK  492



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   477 bits (1228),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 243/523 (46%), Positives = 334/523 (64%), Gaps = 29/523 (6%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI---WIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ VA  C +I   ++  +   R P   P+  MLP++   + +I+D    +L 
Sbjct  1     MASISLLQVSVAILCFLILHYFLFKKPHGRYPRNWPVLRMLPAMLKALHRIYDYSVKILE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGP FT +D+L+TVDPAN+H+IMS NF N+ KG EF+ +FDVLGD    +D 
Sbjct  61    TSDLTFPFKGPRFTGMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKN RK  +A++  Q F R+ + T  +K++ GL+P+L   A E G  +DLQ VF RFT
Sbjct  121   ELWKNMRKSYQAMLHSQEFQRFSMSTMTSKLKYGLVPLLNHFA-EEGTTLDLQSVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT   LVTG DP  LS++ P+  F+KA+DD  E +  RH  P  LWKLQ W+G G EKK
Sbjct  180   FDTIFILVTGSDPRSLSIEMPEDEFAKALDDVGEGILYRHFKPRFLWKLQNWIGFGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L+ A    D+V  KYI+ KR+E+  +    N  +        DLLTS+I  +  +  +  
Sbjct  240   LTEANATFDRVCAKYISAKREEIKRSQGTSNGGSQ-------DLLTSFIKLDTTKYKLLN  292

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV------EKNIRDELLTAVNSG  781
               DDKFLRD IL  ++AGRDTT++AL+WF WL+S +P V      E NI  +L    NS 
Sbjct  293   PSDDKFLRDNILAFILAGRDTTATALSWFFWLLSENPHVVAKIHQEININTDLSRTGNSQ  352

Query  780   EDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLM  601
             E+  K           LVYLH ALCE++RLYPPV F  KSP+++D+LPSGHKV  +++++
Sbjct  353   ENVDK-----------LVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVDANSKII  401

Query  600   FSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQ  421
               LYA+GRM+ +WG+DA +FKPERWI+ E G +KHEPS+KFL+FNAGPRTCLGK +A TQ
Sbjct  402   ICLYALGRMRAVWGEDASQFKPERWIS-ENGGIKHEPSFKFLSFNAGPRTCLGKHLAMTQ  460

Query  420   MKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             MK VA  I+ NY ++ ++     P +  IL MKHGL++ V +R
Sbjct  461   MKIVAVEILRNYDIKVLQGQKIVPALGFILSMKHGLQITVTKR  503



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   478 bits (1230),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 254/521 (49%), Positives = 335/521 (64%), Gaps = 18/521 (3%)
 Frame = -2

Query  1833  MASIDYFE---IFVAFFCLVIWIILRDGYRR----PLKVPLFGMLPSLFLHVRKIHDRCA  1675
             M  ++YF    I +  F    W  L + + +    P   PL GMLP L  +  ++H+   
Sbjct  1     MDVLEYFLPLLIIIMCFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIQNAHRVHEFAT  60

Query  1674  AVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIF  1495
              +L    GTF   GP   NL++LIT DPAN+HYI+S NF N+PKG EF+KIFD+LG+G+F
Sbjct  61    DILVETKGTFKFHGPVLANLNMLITSDPANIHYILSKNFSNYPKGVEFRKIFDILGNGMF  120

Query  1494  NSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVF  1315
             N D +LW+  RK   +L+ H +F   L R  WN +E  L P+L+ A  E+  + D+QD+F
Sbjct  121   NVDYELWEMHRKTTMSLMNHAKFQTLLERNMWNIIENRLRPILD-AFAEQDILFDMQDIF  179

Query  1314  QRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             QRFTFD    L+  +DP  LS+  P VP  KA +D  + L  RHLLPES WKLQ+WL IG
Sbjct  180   QRFTFDAISKLLLDHDPKSLSIGLPHVPCEKAFNDTVDALLYRHLLPESCWKLQKWLRIG  239

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
              EKKL +A E  DQ +   I+ K++EL+         + I DE  F  L  YI   +   
Sbjct  240   REKKLIQAWEAFDQFLYPCISRKQEELL-------HQSTIKDEE-FTFLNEYIKMYNQWK  291

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGED  775
                L     FLRDT L+LM+AGRDTTS+ALTWF WL++ +P  EK IR+E+   +N  ED
Sbjct  292   DGDLGTLQTFLRDTFLSLMLAGRDTTSAALTWFFWLLAKNPLAEKRIREEIQQQLNLKED  351

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
              +    F  +E + LVYLH ALCE+LR +P V  +HK P   DILPSGH VSP+ R++ S
Sbjct  352   -ENLNFFSIQETRKLVYLHGALCETLRFFPSVAIEHKLPHDFDILPSGHHVSPNMRIVLS  410

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LY MGRM+ IWG+D  EFKPERWI+ +RG +KHEPS+KF AFNAGPRTC+GKE+AF QMK
Sbjct  411   LYTMGRMESIWGEDCLEFKPERWIS-KRGGIKHEPSFKFSAFNAGPRTCIGKEMAFIQMK  469

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              VAA II+NYH++  ++   SP+ SII+ MKHGLKVR+ +R
Sbjct  470   IVAATIIYNYHIQLGEDQIISPSASIIIQMKHGLKVRLVKR  510



>gb|KDP46411.1| hypothetical protein JCGZ_10251 [Jatropha curcas]
Length=468

 Score =   475 bits (1223),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 322/480 (67%), Gaps = 15/480 (3%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M+P +  H  K+HD   ++L   GGTFL KG WF+  D L+  DP N+HYI+S NF N+ 
Sbjct  1     MIPDILWHASKLHDFTTSILEQSGGTFLFKGIWFSGSDFLLLSDPINLHYILSRNFPNYH  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KGKEFK+IF+ LG+GIFNSD D W+ QR++  + +  +RF   +  +   K+ KGL  VL
Sbjct  61    KGKEFKEIFEPLGNGIFNSDNDSWRIQRRIVHSFLKDKRFELAVKNSMEQKILKGLFLVL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +  A +    VD+QDV QRFTFD  C LV G+DP  L  +  +V F KA D+ EE++  R
Sbjct  121   D-NASKLESEVDMQDVIQRFTFDNICHLVLGFDPTSLCAESHEVAFEKAFDEIEEIILYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             HLLP  +WKLQ+WL IG EKK ++A  + D  + + IT K+++L      Q   ND    
Sbjct  180   HLLPGCVWKLQRWLQIGEEKKFTKAWRLFDGFLQQCITRKQKQLA-----QQKSND----  230

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
               FDLLT ++  +D +    +   DKFL D  LNL+ AGRDT  +AL W  WLV  HP V
Sbjct  231   --FDLLTFFLMKDDHQDQEEITKSDKFLADLALNLLSAGRDTIGAALVWLFWLVGKHPLV  288

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
             EK I +E+    N   +   +RLF  EELK LVYLHA +CE LRLYPPVPF+HK+ ++ D
Sbjct  289   EKKILEEI--KENLQGESNNWRLFNFEELKKLVYLHATICEVLRLYPPVPFEHKTSIKPD  346

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGH V  + R+++SLY+MGRM+ IWG+D  EF+PERWI+ E+G +KH PSYKF+AFN
Sbjct  347   VLPSGHHVPENMRILYSLYSMGRMKDIWGEDCLEFRPERWIS-EKGRIKHFPSYKFIAFN  405

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
             +GPRTCLGK++AF ++K VA+A++ NY +R V++H  SP +S+ILYM  GLKV+V +R+ 
Sbjct  406   SGPRTCLGKDLAFIKLKTVASAVLWNYSLRIVEDHHISPKISVILYMDKGLKVKVSKRFA  465



>ref|XP_009389287.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   477 bits (1228),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 249/505 (49%), Positives = 341/505 (68%), Gaps = 31/505 (6%)
 Frame = -2

Query  1773  ILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVD  1594
             I R   R P+  P+ GMLP+L +++ ++HD    VL   G +F  +GPWF  ++ L+T D
Sbjct  40    ICRSRSRIPVNWPVVGMLPALLVNLHRLHDWGTDVLREAGCSFWFRGPWFLGMNHLLTCD  99

Query  1593  PANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYL  1414
             PANVH++   NF N+PKG+ F +IFD+LGDGIFNSD   WK QR  A +++  +RF  ++
Sbjct  100   PANVHHVFGANFSNYPKGEAFLEIFDILGDGIFNSDEQSWKEQRTKAHSIMSGRRFRTFV  159

Query  1413  VRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDV  1234
               ++ +KVEKGL+P++   A +RG  VDLQDVF R TFDTTC LV G DP CLSV+FP +
Sbjct  160   ADSARSKVEKGLLPLIHHIA-QRGVAVDLQDVFLRLTFDTTCNLVFGVDPRCLSVEFPTI  218

Query  1233  PFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQEL  1054
             PF++AMDDA   L  R  +P + WKL +WL +G EKKL+ A + +D  I ++I  K++  
Sbjct  219   PFARAMDDAMAALLTRQTVPPAWWKLMRWLRVGEEKKLAMAWKEVDHFIAEHIAEKKR--  276

Query  1053  ILTYKNQNPDNDINDENGFDLLTSYINNN--------DGETTMGLKFDDKFLRDTILNLM  898
                        + ND    D+L++YIN+N        DG+ +      DKFLRDT +N M
Sbjct  277   ---------SGEAND----DMLSAYINDNDDDNDRAMDGKRSTEF---DKFLRDTAVNFM  320

Query  897   IAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVN-SGEDPKKFRL--FKAEELKNLV  727
             +AGRDTT +ALTWF WL+S +P VE  I  EL  A +   E P    L  F  +EL  +V
Sbjct  321   LAGRDTTGAALTWFFWLLSQNPMVEAKILKELEEATSLRKERPSSDELIVFGTDELGKMV  380

Query  726   YLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAK  547
             YLHAALCESLR +PPVPF+HKS LQ+++LPSGH+V   T+++ S YAMGRM+ +WG D  
Sbjct  381   YLHAALCESLRFFPPVPFEHKSVLQSEVLPSGHRVGQGTKILVSAYAMGRMEGVWGGDWA  440

Query  546   EFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVK  367
             E +PERWI+ E+G +++EPSYKFLAFN+GPR CLGK+VAF QMK V AA+++N+HV  ++
Sbjct  441   EVRPERWIS-EKGRMRYEPSYKFLAFNSGPRACLGKDVAFAQMKTVVAAMVYNFHVEVLR  499

Query  366   NHDASPNVSIILYMKHGLKVRVQRR  292
                A+P +SIIL MK+GL  R++RR
Sbjct  500   GPVAAPKLSIILQMKNGLMARIERR  524



>ref|XP_009402197.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=521

 Score =   476 bits (1226),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 233/491 (47%), Positives = 326/491 (66%), Gaps = 6/491 (1%)
 Frame = -2

Query  1758  YRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVH  1579
             ++ PL +P+ GM+P LF H+ ++HD  A  L+    TF+ KGPW + +D+ IT DP NV+
Sbjct  28    HKLPLNLPVVGMVPDLFSHISRVHDYAAEFLAAANWTFVFKGPWLSGMDMTITCDPDNVN  87

Query  1578  YIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSW  1399
             Y+      N+PKG+EF ++FD+ GD + NSD + W++QRK+  +L+ ++RF  Y ++ + 
Sbjct  88    YVFVTRSSNYPKGEEFAEMFDIFGDSLLNSDGEAWRSQRKMIHSLMSNRRFRSYELKANR  147

Query  1398  NKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKA  1219
             +KVEK LIP+L+  A E+  VVDLQDVF R TFDT C+L+ G DPGCL+ DF DVPF+KA
Sbjct  148   DKVEKRLIPLLQGVA-EQNKVVDLQDVFLRLTFDTACSLILGVDPGCLADDFSDVPFAKA  206

Query  1218  MDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYK  1039
             + DAEEV+F+RH++P+  WK  +WLG+G EKKL+ A  ++D      IT +R+E I    
Sbjct  207   LGDAEEVIFLRHIVPKFWWKALRWLGVGEEKKLAMAHRVMDDFATSTIT-RRKESISKEI  265

Query  1038  NQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTW  859
                 D + ++E   DLLT Y++         L+F DKF+++  LNL++AGRDTT++ LTW
Sbjct  266   RSREDGEDDEEAAADLLTVYMHQPTVREKNALEF-DKFIKNNALNLLLAGRDTTAATLTW  324

Query  858   FIWLVSTHPEVEKNIRDELLT--AVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYP  685
             F WL+S HP  E  I +EL         E P     F  + L  LVYLHAALCE LRLYP
Sbjct  325   FFWLLSMHPHAEHEILEELRRHWPAAPDETPNPNTPFDRDGLGKLVYLHAALCECLRLYP  384

Query  684   PVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGA  505
             P+  Q +   + D+LPSG KV P T L+F  Y+MGRM+ +WGKD  EFKPERWI  E G 
Sbjct  385   PIHAQSREVAKPDVLPSGEKVRPGTLLVFHAYSMGRMEGLWGKDCMEFKPERWIT-ESGD  443

Query  504   VKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYM  325
             ++HEP++KF AF+ G R C GK++AF  MK VAAA++ N+    V+ H   P +SIIL+M
Sbjct  444   LRHEPAHKFFAFSCGSRICQGKDMAFIHMKTVAAAMLRNFRFEVVEGHVVEPKLSIILHM  503

Query  324   KHGLKVRVQRR  292
             K+GL V+V +R
Sbjct  504   KNGLMVKVCKR  514



>emb|CDM81753.1| unnamed protein product [Triticum aestivum]
Length=516

 Score =   476 bits (1225),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 246/515 (48%), Positives = 341/515 (66%), Gaps = 24/515 (5%)
 Frame = -2

Query  1818  YFEIFVAFFCLVIWIILR----DGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGG  1651
             Y EI V+F C +  +  R    DG   P   P+ G +P++ ++  ++H+     L +  G
Sbjct  15    YPEIMVSFACFLFLLFFRYRRRDGL--PTNWPVVGSVPAISVNAGRVHEWLTEFLRVAPG  72

Query  1650  -TFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              + + +GPW + +D+LIT +PA+V ++ + NF N+PKG++F  +FDVLG+GIFN+D D W
Sbjct  73    MSHVARGPWGSPVDVLITANPADVAHVFTTNFGNYPKGEDFAAVFDVLGNGIFNADGDSW  132

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLE-FAAGERGGVVDLQDVFQRFTFD  1297
               QR+ A AL+   RF   +  ++  K+++GL+P+L+  AAG  G VVDLQDVF R TFD
Sbjct  133   AFQRRKAHALLSDARFRAAVAASTARKLDEGLVPLLDGVAAG--GAVVDLQDVFMRLTFD  190

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
              T   + G DPGCL+ DFP VPF+ AMD+AE VLF RH+ P +  +LQ +L IG  KK++
Sbjct  191   LTAMFIFGTDPGCLAADFPRVPFAAAMDEAEAVLFYRHVTPIAWLRLQTYLNIGHHKKMT  250

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             +A ++LD  I +Y++++R+      +  N D + +  +  DLL+ Y+   D     G + 
Sbjct  251   KAQQVLDASIAEYVSLRRE------RAANADTNADGSDAADLLSLYMACQDELGKDGNEL  304

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
              D+FLRDT LNLMIAGRDTTSSALTWF WL++ HP+VE  I  EL   ++SG  P     
Sbjct  305   -DRFLRDTTLNLMIAGRDTTSSALTWFFWLLTNHPDVEAKILAELRETLSSGGHP-----  358

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
               A +LK LVYLHAAL ESLRLYPPVPF+HK+  + D LPSG  V P  R++ S Y+MGR
Sbjct  359   -SAADLKRLVYLHAALSESLRLYPPVPFEHKAGARPDTLPSGPAVWPTRRVIVSFYSMGR  417

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ +WGKD  EF+PERW+    G ++HEPSYKF+AFN GPRTCLGK++AFTQMKAV AA+
Sbjct  418   MESVWGKDCLEFRPERWLT-AAGRLRHEPSYKFVAFNVGPRTCLGKDLAFTQMKAVVAAV  476

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +  + V         P +SIIL+MK GLKVRV +R
Sbjct  477   LPRFRVEVAPGAVVKPKLSIILHMKDGLKVRVYKR  511



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   475 bits (1222),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 318/486 (65%), Gaps = 18/486 (4%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+  M+P+L  ++ ++H     +L   GGT++ KGPWF+N D+L T DPAN+H++ 
Sbjct  23    PTNWPILDMIPALLKNIDRLHQFKTELLEQSGGTYMFKGPWFSNTDMLFTCDPANIHHVF  82

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG EF+KIF++LGDGIFN+D +LW+  R+   +L+ H +FH  L  T W KV
Sbjct  83    SKNFSNYPKGPEFRKIFEILGDGIFNADFELWEIHRRTTISLLTHSKFHSSLESTVWGKV  142

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GL+PVL  +  ++G  VDLQD+FQRFTFD  C +V  +DP  L V+ P +P  KA   
Sbjct  143   ETGLLPVLA-SFCKQGAEVDLQDIFQRFTFDNICKVVLDFDPSSLCVELPHIPCEKAFSH  201

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             + E L +RH++PES+WKLQ+ L IG EK+L  A +  D  I   I++K  E         
Sbjct  202   SVEPLLLRHIVPESIWKLQKRLKIGSEKQLMEASQNFDDFIYPLISLKNGE---------  252

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
                  ND N   +            + GL+    FL+DT L+L+ AGRDTTS+ LTW  W
Sbjct  253   ---QENDTNLLTVFRKVYEEKHVGPSSGLR---DFLKDTSLSLIFAGRDTTSTCLTWLFW  306

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L++ +P  E  I +E+ T ++  ED KK+R F  EE   L+YLH ALCESLRL+PPV  +
Sbjct  307   LIARNPLTETKILEEIHTVLHLKED-KKWRRFNVEESHKLIYLHGALCESLRLFPPVALE  365

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK+P + DILPSGH +  + +L+FS Y++GRM+ +WGKD  EF+P+RWI    G +KHEP
Sbjct  366   HKAPTKPDILPSGHYLPANAKLIFSFYSVGRMETVWGKDCLEFRPDRWIA-PGGRIKHEP  424

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             SYKF AFN GPRTCLGKE+AF QMK VAAAII++Y +  V+ +  SP VSIIL  K GLK
Sbjct  425   SYKFPAFNVGPRTCLGKEMAFIQMKMVAAAIIYHYRIELVEGNQVSPRVSIILQAKPGLK  484

Query  309   VRVQRR  292
             VR+ +R
Sbjct  485   VRLTKR  490



>emb|CDY44658.1| BnaA08g06820D [Brassica napus]
Length=502

 Score =   475 bits (1223),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 231/487 (47%), Positives = 324/487 (67%), Gaps = 21/487 (4%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP L +H+ +I+D    +L     TF  KGPW +  DILITVDPAN+ YI+
Sbjct  34    PTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYIL  93

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF+N+PKG EFK+IF+VLGD IFN D +LW++ R  + A+  HQ F R+ V TS +K+
Sbjct  94    SSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSKL  153

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
              +GL+P+LE A  E+  +VDLQD+F RF FDT+  L+TGYDPGCLS++ P V FS A+D 
Sbjct  154   NQGLVPILENAV-EKNIIVDLQDLFHRFLFDTSSILITGYDPGCLSIEMPKVNFSYAVDG  212

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
               + LF RH  P   WKLQ W+G+G EK + R   + D+++ K I+ KR+E+ +      
Sbjct  213   VADGLFYRHAKPVLFWKLQYWIGVGVEKSMRRGIAVFDEMLQKIISAKREEIKI------  266

Query  1029  PDNDINDENG--FDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWF  856
               + I D  G   D+LT Y+  +  +       +DKF+RDTIL ++IA +DTTSSAL+WF
Sbjct  267   --HGIRDSEGEAMDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGVLIAAKDTTSSALSWF  324

Query  855   IWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVP  676
              WL+S +PE    IR E+     + + PK    F   +L  LVYL  A+CE+LRLYP VP
Sbjct  325   FWLLSKNPEAMIKIRQEI-----NNKMPK----FNPADLDKLVYLDGAVCETLRLYPSVP  375

Query  675   FQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKH  496
             F HKSP + D+LP+GH+V  + +++ S+YA+GRM+  WG DA++F+PERWI+ + G ++H
Sbjct  376   FNHKSPAKPDVLPTGHRVDDNWKIVISIYALGRMKSFWGDDAEDFRPERWIS-DSGMLRH  434

Query  495   EPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHG  316
             EPS+KFL F+AGPR+CLGK++ F Q+K VA  II  Y +  V+   + P  S++L M+HG
Sbjct  435   EPSHKFLPFSAGPRSCLGKKLTFLQIKTVAVKIIQKYEIEVVEGQKSEPVPSVLLRMQHG  494

Query  315   LKVRVQR  295
             L V V R
Sbjct  495   LNVSVTR  501



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   475 bits (1223),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 240/523 (46%), Positives = 346/523 (66%), Gaps = 23/523 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI--WIILRDGYRRPL-KVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   E+ +A  C +I  ++  +  +   L K P+ GMLPSL + + ++++    ++ 
Sbjct  1     MASIYLLEVSIAILCFLITDYLFFKKPHGPSLRKWPVLGMLPSLLMVLHRMYEYGIEIME  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  KGPWF  +D+L TVDPAN+H+IMS NF N+ KG +F+ +FDV GDGI  +D 
Sbjct  61    FSDLTFQFKGPWFVGMDMLFTVDPANIHHIMSSNFPNYIKGPDFQDVFDVFGDGIITTDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWK+ RK  +A++ HQ F R+ + T  +K++ GL+P+L+  A E G  V+LQDVF RFT
Sbjct  121   ELWKDLRKSYQAMVHHQGFQRFSMSTMTSKLKDGLVPLLDHFA-EEGTTVNLQDVFGRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDT   L+TG DP  LS++  +   ++A+DD  E +  RH+ P+ LWKLQ W+ IG EKK
Sbjct  180   FDTILILITGSDPRSLSIEMHEDELARALDDVGEGILYRHIKPKFLWKLQNWMRIGQEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +  A    D+V  KYI+ KR+E+I   ++Q    DI++    DLL+S+I  +  +  +  
Sbjct  240   MVEADATFDRVCSKYISAKREEII---RSQGI-LDISNGESEDLLSSFIKLDTTKYKLLN  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL----LTAVNSGED  775
               +DKFLRDTIL  ++AGRDTT+SAL+WF+WL+S +P+V   IR E+    L+   +G+ 
Sbjct  296   PSNDKFLRDTILAFILAGRDTTASALSWFLWLLSENPQVVAKIRQEIIDTDLSRTGNGQ-  354

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
                      E L  LVYLH AL E++RLYPPV F  KS +++D+LPSGH+V  ++ ++ S
Sbjct  355   ---------ENLDKLVYLHGALNEAMRLYPPVSFGRKSSVESDVLPSGHRVDANSMIIIS  405

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             LYA+GRM+ +WG+DA +FKPERWI+ E G +K EPS+KFLAFN+GPR CLGK +A TQMK
Sbjct  406   LYALGRMKAVWGEDALKFKPERWIS-ENGGLKQEPSFKFLAFNSGPRICLGKNLAMTQMK  464

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              VA  I+HNY ++  K     P +  IL MKHGLKV + +R++
Sbjct  465   TVAVEILHNYDIKVTKGQKIEPVLGFILSMKHGLKVTITKRYS  507



>ref|XP_009132532.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=498

 Score =   474 bits (1221),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 241/514 (47%), Positives = 336/514 (65%), Gaps = 25/514 (5%)
 Frame = -2

Query  1824  IDYFEIFVAF-FCLVIWIILRD-GYRRPLKV--PLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             I   +I +AF F LV++ + R    + P     P+ GMLP L L + +IHD    VL   
Sbjct  5     IGLLDIIIAFIFFLVLYCLFRHMRTQTPFLTNWPVLGMLPGLLLQIHRIHDWLTQVLEAA  64

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
               TF  KGPW +  DIL+TVDP NVHYI+S +F N+PKG+EF+KIF+ LGDGIFN D  L
Sbjct  65    NMTFRFKGPWRSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGL  124

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W++ R  + A+  ++ F  + V TS +K+ +GL+PVLE  A E+  +VDLQD+FQRF FD
Sbjct  125   WEDMRNSSHAIFSNKDFQSFSVSTSVSKLRQGLVPVLE-NAYEKNILVDLQDLFQRFLFD  183

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             T+  L+TGYDP  LS++ P V F  A++   + +F RH+ P  LWKLQ W+G+G EKK+ 
Sbjct  184   TSSILMTGYDPRSLSIEMPKVEFCAAVEGVVDGIFYRHIKPVFLWKLQNWIGVGIEKKMR  243

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             +  E+ D+++GK I++KR+E+    KN          +  D+LT Y+  N  +  +    
Sbjct  244   KGIEVFDRLLGKIISVKREEI----KNHGKG------DAMDILTYYMTINREKYKLLKPS  293

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKF+RD +L  ++AGRDT SSALTWF WL+S +PE    IRDE+          KK  +
Sbjct  294   DDKFMRDILLGFLLAGRDTVSSALTWFFWLLSKNPEATAKIRDEI---------NKKMPV  344

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F   EL  LVYL  A+CE+LRLYPPV F HKS  + D+LPSGH+V    +++ S+YA+GR
Sbjct  345   FDPTELHKLVYLEGAVCEALRLYPPVLFNHKSLAKPDVLPSGHRVDESWKIVISIYALGR  404

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ +WG DA+EF+PERWI+ + G ++HEPSYKFLAF++GPRTCLGK++ F Q+K VA  I
Sbjct  405   MKSVWGDDAEEFRPERWIS-DSGTLRHEPSYKFLAFSSGPRTCLGKKLTFLQIKTVAVEI  463

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             I  Y  + ++ H   P  S++L M+ GLKV V +
Sbjct  464   IRKYDFKVIEGHKPKPVSSVLLRMQDGLKVSVTK  497



>ref|XP_006306153.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
 gb|EOA39051.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
Length=518

 Score =   475 bits (1222),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/529 (47%), Positives = 332/529 (63%), Gaps = 29/529 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRR----------PLKVPLFGMLPSLFLHVRKI  1690
             MASI   E F+A  C +I+   +++  +            P   P+ GMLP + L + +I
Sbjct  1     MASIGLCEAFIALICFLIFYHFLVKKPFSYLLTKKTLGSYPWNWPVLGMLPGILLRLHRI  60

Query  1689  HDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVL  1510
             +D    VL     TF  KGPWF  +D L TVDPANVH+IMS NF N+ KG  F +IF+  
Sbjct  61    YDFSVEVLENSNLTFQFKGPWFVAMDALATVDPANVHHIMSSNFSNYIKGPIFHEIFEAY  120

Query  1509  GDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVD  1330
             GDGI NSD +LW+N R  A+ +  HQR+  +   T+ +K++ GL+P+L   A E   VVD
Sbjct  121   GDGIINSDSELWRNWRNSAQIIFNHQRYQNFSTSTTRSKLKDGLVPLLNHFADEE-MVVD  179

Query  1329  LQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQ  1150
             LQDVFQRF FD T   VTG DP  LS++ P+V F+KA+DD  + +  RH+ P  +WKLQ+
Sbjct  180   LQDVFQRFMFDITFIFVTGSDPRSLSIEMPEVEFAKALDDVGDAIVHRHITPRFVWKLQK  239

Query  1149  WLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN  970
             W+GIG EKKL  A   LD+V  K+I  KR+EL    + Q   ++ N E+  DLLTS+I  
Sbjct  240   WIGIGTEKKLLEAHATLDRVCAKFIAAKREEL----RTQGTTHNTNGESE-DLLTSHIML  294

Query  969   NDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL---L  799
             +  +  +    DDKFLRD  +  M AGRD+T+SALTWF W +S +P V   I  E+   L
Sbjct  295   DATKYELLNPGDDKFLRDFTVGFMAAGRDSTASALTWFFWNLSENPNVLNKILQEINTNL  354

Query  798   TAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVS  619
                 SG+D   +       +  LVYLH+ L ESLRLYPP+PF+ KSP++ D+LPSGHKV 
Sbjct  355   PRTGSGQDMSSY-------MNKLVYLHSVLSESLRLYPPIPFERKSPIKEDVLPSGHKVK  407

Query  618   PDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGK  439
             P+  +M  +YAMGRM+ +WG+DA EFKPERWI  E G ++HEPSYKFL+FNAGPRTCLGK
Sbjct  408   PNINIMIFIYAMGRMKTVWGEDAMEFKPERWIT-ETGGLRHEPSYKFLSFNAGPRTCLGK  466

Query  438   EVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              +A   MK V   I+ NY ++ V      P   +IL+MK+GLKV + ++
Sbjct  467   NLAMNLMKTVIVEILQNYEIKVVGGQKIEPKPGLILHMKYGLKVTMTKK  515



>gb|KDP35251.1| hypothetical protein JCGZ_09410 [Jatropha curcas]
Length=493

 Score =   474 bits (1219),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 256/521 (49%), Positives = 332/521 (64%), Gaps = 33/521 (6%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPL--KVPLFGMLPSLFLHVRKIHDRCAAVLSL  1660
             MA +  F I +A  CLV+        RR +    PL GMLPSL  ++ ++ D    V   
Sbjct  1     MALVGIFGIILATLCLVVARRRLSRNRRKVIRSWPLIGMLPSLLSNMNRLADWMIEVAGR  60

Query  1659  HGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIF-DVLGDGIFNSDL  1483
              GGT + KGPWFT L  + T DP N+ +IMS NF N+PKG EFK+++ D+LGDGIFNSD 
Sbjct  61    RGGTLVFKGPWFTGLYAICTTDPENIKHIMSTNFCNYPKGSEFKEMYSDILGDGIFNSDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             DLWKNQRK A +LI H+RF R+L  T+  KVEKGL PVLE    E   + DLQD+  RFT
Sbjct  121   DLWKNQRKSAVSLINHERFQRFLFHTAHVKVEKGLFPVLEHICTENKEI-DLQDLVHRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
              D T  LVTG D   LS+   D     A+D  EE LF RH   + LWK Q WLGIG E+K
Sbjct  180   ADVTFILVTGLDRETLSIGSLDDKLGFALDCMEEALFYRHFQSKMLWKFQNWLGIGTERK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +  A + +D++  KYI+M+RQ              + +  G DLL+ YI+ +D       
Sbjct  240   VKAALKTVDEITTKYISMRRQ------------GRVGEGVGVDLLSWYIDRSD-------  280

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAV-NSGEDPKK  766
                 KFLRDTILN M+AGR+   ++LTW  WLVS  P VE  IR+EL + V  +  + KK
Sbjct  281   ----KFLRDTILNFMLAGRE---NSLTWLFWLVSKTPGVEAKIREELRSIVPENKREEKK  333

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
              +L   E++  LVYLHAA+CE+LR YPPV +++K PLQ DILPSGH V P  +++ S Y 
Sbjct  334   VQLLDIEKVNKLVYLHAAICETLRFYPPVTYEYKVPLQNDILPSGHHVDPRMKIILSSYL  393

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGR++ IWG+D  EFKPERWI+ E   ++  P Y+FLAFNAGPR CLGKE+AF +MKA+A
Sbjct  394   MGRLKCIWGEDCFEFKPERWISEEGRFIQRSP-YQFLAFNAGPRICLGKEIAFVEMKAMA  452

Query  405   AAIIHNYHVRAVKNHDASPN-VSIILYMKHGLKVRVQRRWT  286
             A +IHNY++  V+ H   P   SI+L+MK+GLKVR+ RRW 
Sbjct  453   AFLIHNYNIEVVEKHPVLPKYASIMLHMKYGLKVRISRRWA  493



>ref|NP_200045.1| cytochrome P450, family 96, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
 dbj|BAB10529.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AED96200.1| cytochrome P450, family 96, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
Length=502

 Score =   474 bits (1220),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/483 (49%), Positives = 317/483 (66%), Gaps = 21/483 (4%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P+ GMLP +   + +I+D     L     T    GPW +  DIL+TVDP N+ YI+S NF
Sbjct  38    PVLGMLPGVLFQIPRIYDFVTEALEAENMTGCFIGPWLSGTDILLTVDPVNIQYILSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKGK+F KIF+ LGDGIFN D  LW++ R  + A+  HQ F  + V TS +K+ +GL
Sbjct  98    VNYPKGKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L+ A  E+  +VDLQD+FQRF FDT+ TL+ GYDP  LSV+ P V F+ AMD   + 
Sbjct  158   VPILDNAV-EKHILVDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEFADAMDGVADA  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RHL P  LW +Q W+G+G EKK+ R  ++ DQ++GK I+ KR+E+    KN      
Sbjct  217   MFYRHLKPAFLWSIQSWIGVGIEKKMRRGLDVFDQMLGKIISAKREEI----KNHG----  268

Query  1017  INDENG--FDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLV  844
             I+D  G   D+LT Y+  +  +       +DKF+RDTIL L+IA RDTTSSALTWF WL+
Sbjct  269   IHDSKGEAMDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGLVIAARDTTSSALTWFFWLL  328

Query  843   STHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHK  664
             S +PE    IR E+          KK   F   +L  LVYL  A+CE+LRLYP VPF HK
Sbjct  329   SKNPEAMTKIRQEI---------NKKMPKFDPADLDKLVYLDGAVCETLRLYPSVPFNHK  379

Query  663   SPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSY  484
             SP + D+LPSGHKV  + R++  +Y++GRM+ +WG DA++F+PERWI+ + G ++ E SY
Sbjct  380   SPAKPDVLPSGHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWIS-DSGMLRQESSY  438

Query  483   KFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVR  304
             KFLAFNAGPRTCLGK + F QMK VA  II NY ++ V+ H   P  S++L M+HGLKV 
Sbjct  439   KFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRNYDIKVVEGHKPKPVPSVLLRMQHGLKVS  498

Query  303   VQR  295
             V +
Sbjct  499   VTK  501



>ref|XP_009101867.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Brassica rapa]
Length=517

 Score =   474 bits (1220),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 232/486 (48%), Positives = 317/486 (65%), Gaps = 14/486 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP + + + +I+D    VL     TF  KGPWF  +DIL+TV PAN+HYI+
Sbjct  41    PWNWPVLGMLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYIL  100

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+ KG EF++IF+  GDGI NSDL+LW+N RK ++ +  HQ++  +   T+ +K+
Sbjct  101   SSNFSNYIKGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQNFSKSTTRSKL  160

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             + GL+P+L   A E   VVDLQDVFQRF FDTT   +TG DP  LSV+ P+V F+KA+DD
Sbjct  161   KDGLLPILSHFAFEE-MVVDLQDVFQRFMFDTTFIFITGSDPRSLSVEMPEVEFAKALDD  219

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
               E +  RH+ P  LWKLQ+W GIG EKK+ +A  +LD+V  KYI+ KR+++        
Sbjct  220   VGEAIVYRHITPRFLWKLQKWFGIGTEKKMVKANAVLDRVCAKYISAKREDI--------  271

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
                +I DE   DLLTS+I  +  +  +    DDKFLRD  +  M AGRD+T+  LTWF W
Sbjct  272   RSQEIADEESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFMAAGRDSTACTLTWFFW  331

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             ++S +     N+  ++L  +N      +    K+  L  LVYLHAAL ES+RLYPP+PF+
Sbjct  332   ILSEN----SNVLSKILQEINENVPITRSDQDKSSYLNKLVYLHAALSESMRLYPPIPFE  387

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
              KSP++ D+LPSGHKV  +  +M  +YAMGRM+ +WG+DA EFKPERWI+ E G ++HEP
Sbjct  388   RKSPIKPDVLPSGHKVKSNINIMIFIYAMGRMKDMWGEDAAEFKPERWIS-ETGGLRHEP  446

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             SYKFL+FNAGPRTCLGK +A   MK V   I+  Y +  V          +IL+MKHGLK
Sbjct  447   SYKFLSFNAGPRTCLGKNLAMDLMKTVIVEILQAYEINVVSGQKIEAKPGLILHMKHGLK  506

Query  309   VRVQRR  292
             V + ++
Sbjct  507   VTIAKK  512



>ref|XP_006280314.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
 gb|EOA13212.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
Length=515

 Score =   474 bits (1219),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 241/526 (46%), Positives = 339/526 (64%), Gaps = 22/526 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPL------KVPLFGMLPSLFLHVRKIHDRCAA  1672
             MASI    + +   CL+I  + R  +++PL        P+ GM+P LFL + +I+D    
Sbjct  1     MASISLIGVSITIICLLI--LHRFLFKKPLYRFFRISWPVLGMVPDLFLMLHRIYDSIVE  58

Query  1671  VLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFN  1492
              L     TFL KGPWF  +D+LIT DPAN+HYI++ NF NF KG EF ++FD     +  
Sbjct  59    RLESTELTFLFKGPWFAGMDMLITADPANIHYILNSNFSNFVKGSEFIEVFDAFECALLT  118

Query  1491  SDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQ  1312
              D   WK QRK  + +I HQ F R  + T  +KV+ GL+PVL   A E G  VDLQDVF+
Sbjct  119   KDSVAWKTQRKATQVMINHQGFQRLSMSTIRSKVKDGLVPVLNHIA-EEGTTVDLQDVFR  177

Query  1311  RFTFDTTCTLVTGY-DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIG  1135
             RFTFDT+   +TG  DP  LS++ P+V  +KA DD  E +F RH+ P  LWKLQ+ +G+G
Sbjct  178   RFTFDTSLVTITGCDDPRSLSIEMPEVESAKAFDDIVEGVFYRHVKPRLLWKLQKLIGVG  237

Query  1134  PEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGET  955
              EKK++ A  + D+V  KY++ +++E+    ++Q  ++ +  E   DLLTS+I  +  + 
Sbjct  238   IEKKMTEAGAVFDRVCAKYVSARKEEI---KRSQGINSSVESE---DLLTSHIKLDTTKY  291

Query  954   TMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIR---DELLTAVNS  784
              +    +DKFLRD +L L++AGRDTT+SALTWF WL+S +P V   IR   D++L   +S
Sbjct  292   QLLDPINDKFLRDNVLALLLAGRDTTASALTWFFWLLSENPNVMTKIRQEIDKILPRSSS  351

Query  783   GEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRL  604
             G++   +     E L  LVYLHAALCE++RLYPPVP +  SPL++D+LPSGHKV  ++++
Sbjct  352   GQEKPSYD--PMEHLNKLVYLHAALCETMRLYPPVPLERVSPLESDVLPSGHKVEANSKI  409

Query  603   MFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFT  424
             +  +YA+G+M+ IWG+DA EFKPERW N E G ++H P++KFLAFNAGPR CLGK +A  
Sbjct  410   LIFIYAVGKMRTIWGEDALEFKPERW-NSETGELRHVPAFKFLAFNAGPRVCLGKHIAMM  468

Query  423   QMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              MK VA  I+ NY ++  K     PN S+ L MKHG KV + +R +
Sbjct  469   LMKIVAVEILQNYDIKVAKGQKFEPNTSLFLRMKHGFKVTINKRCS  514



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   473 bits (1217),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 230/517 (44%), Positives = 327/517 (63%), Gaps = 24/517 (5%)
 Frame = -2

Query  1830  ASIDYFEIFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGG  1651
             A++    +++   C    +  ++    P   P+ GM+P+L  ++ ++H     VL   GG
Sbjct  8     ATVISIVLYLMLLCYRYAVGRKEKSSLPTNWPILGMIPALLKNIGRLHQVTTEVLEQSGG  67

Query  1650  TFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWK  1471
             T   KGPWF N+D+++T D ANVHYI++ NF NF KG EFKKIFD+ GDGIF ++ + W+
Sbjct  68    TIWFKGPWFANMDMMVTSDRANVHYILTKNFPNFSKGPEFKKIFDIFGDGIFAAEHESWE  127

Query  1470  NQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTT  1291
             +QR+  +AL++   F   +  TSWNKVE  LIP++E  + E G  VD+Q++FQRF FD +
Sbjct  128   SQRRSTKALMMQPGFQELVATTSWNKVETSLIPIMELVS-ETGTEVDVQELFQRFAFDCS  186

Query  1290  CTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRA  1111
             C LV G+DP  LS + P +P  K   D  E +  RH+LP+ +WKLQ+WL +G E+KL   
Sbjct  187   CILVLGHDPTSLSKELPHLPHEKVFADVGEAVLYRHILPQIVWKLQRWLQVGKERKLKEG  246

Query  1110  CEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSY-----INNNDGETTMG  946
              E  D+ +    ++K+Q      +    D        FD+L+S      +N +D      
Sbjct  247   MEHFDRFLCHCFSLKQQGDTAATEPGRQD--------FDILSSTMRAVEVNGDDAPNISQ  298

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
             + +     RD + NL+ AG+DT S+ LTWF WL++THP  E+ IR E+ T    G    K
Sbjct  299   VSW-----RDNMFNLIGAGKDTISATLTWFFWLLATHPAEEEKIRLEICTNFQVG----K  349

Query  765   FRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             ++    +EL+ L+YLH ALCE+LRL+PPV  QHK+P++ DILP+GH + P+T  + S Y+
Sbjct  350   WKFTNMKELRKLIYLHGALCEALRLFPPVAIQHKAPVEHDILPTGHHIKPNTITLLSFYS  409

Query  585   MGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVA  406
             MGRM+ IWGKD  +FKP RWI+ E G++K EPSYKF AFNAGPR+CLGKE++FTQMK VA
Sbjct  410   MGRMESIWGKDCLQFKPGRWIS-ETGSIKIEPSYKFTAFNAGPRSCLGKEMSFTQMKIVA  468

Query  405   AAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             AAII  + V+    H   PN SIIL+MK GLKV+V +
Sbjct  469   AAIISRFKVQVAAGHPVCPNASIILHMKRGLKVKVSK  505



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   473 bits (1218),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 323/484 (67%), Gaps = 16/484 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   PL GMLP+L  ++ +IH+    +      TFL  GPWFTN+ IL+T+DPAN+H++M
Sbjct  30    PTNWPLLGMLPALLKNIHRIHNFLIEIFEKSHLTFLFDGPWFTNMQILLTIDPANIHHVM  89

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG +F ++FDVLGDGIFN+D  +W+  RK+A+  + H +FH +LV+ +  K+
Sbjct  90    SKNFGNYPKGTKFNEMFDVLGDGIFNADFLVWQYHRKMAQYFLGHPKFHHFLVKKTREKL  149

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GLIPVL+  +   G  VDLQD+F RFTFD  CT++  +DP  L VD P    SKA+DD
Sbjct  150   ENGLIPVLDHVS-LHGIEVDLQDLFARFTFDVGCTIMMDHDPKSLVVDLPTNASSKALDD  208

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
              EE +F RH++P  +WKLQ+WL +G E K  +A E LD  I + I  KR+E  ++ K Q 
Sbjct  209   VEEAIFHRHVVPTFVWKLQRWLNVGKEYKYRKAWETLDSFIYQCIAEKRKE--VSSKVQQ  266

Query  1029  PDNDINDENGFDLLTSYINNNDGE---TTMGLKFDDKFLRDTILNLMIAGRDTTSSALTW  859
             P  +  +E   DLLT YI  ++ +   T +     +KF+RDT+L   IAGRD  S  L+W
Sbjct  267   PSKE--NEVCTDLLTLYIKEDESDKYPTILSTNQRNKFIRDTVLTNFIAGRDAISITLSW  324

Query  858   FIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPV  679
             F +L+S +P V   I+ EL + +        +R FK    K LVYLH ALCE+LRLY PV
Sbjct  325   FFYLLSVNPLVASRIKKELDSVMID------WRNFKEANSK-LVYLHGALCETLRLYAPV  377

Query  678   PFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVK  499
              F+ K+P++ DILPSGH+V+P+ +++F+LYAMGRM+ IWG D  EFKPERWI+  +G ++
Sbjct  378   AFEAKAPMEPDILPSGHRVNPNMQIIFNLYAMGRMKSIWGDDCNEFKPERWIS-AQGNIR  436

Query  498   HEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKH  319
             HEPSYKF  FNAGPRTCLGKE+AFTQMK VAA +I  Y +  V      PN+SI L MKH
Sbjct  437   HEPSYKFFVFNAGPRTCLGKEMAFTQMKVVAATMIQKYVIEVVDERQVIPNMSIFLRMKH  496

Query  318   GLKV  307
             G KV
Sbjct  497   GFKV  500



>ref|XP_006279822.1| hypothetical protein CARUB_v10028124mg [Capsella rubella]
 gb|EOA12720.1| hypothetical protein CARUB_v10028124mg [Capsella rubella]
Length=514

 Score =   473 bits (1216),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/519 (46%), Positives = 340/519 (66%), Gaps = 10/519 (2%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW--IILRDGYRRPLKV-PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             M SI   E+F+A  C +I   ++ +  + R L+  P+ GMLP +FL + +I D    +L 
Sbjct  1     MYSISVIEVFIAILCFLILHCLLFKKPHDRFLRNWPVLGMLPGIFLVIHRIQDFVVELLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF  +G  F  +D+L TVDPANVHY+++ NF NF +G +FK+IFD+ GD I  +D 
Sbjct  61    NTDLTFPFQGLCFAGMDMLFTVDPANVHYLLNSNFSNFTRGSDFKEIFDLFGDSILTADS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             + WKN RK  +A++ HQ + R  + T+ +K++  L+PVL+  A E G  VDLQDVF R  
Sbjct  121   EEWKNLRKATKAILHHQGYQRLSMSTTRSKIKDDLVPVLDHFA-EEGTTVDLQDVFWRLA  179

Query  1302  FDTTCTLVTGY-DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEK  1126
             +DTT    TG  DP  LS++ P++ F+KA+D+  E L  RH  P  LWKLQ WLG+G EK
Sbjct  180   YDTTIVTTTGCDDPRSLSIEMPEIEFAKALDNIGEGLIYRHAKPRFLWKLQNWLGVGIEK  239

Query  1125  KLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMG  946
             K++ A  I D+V  KYI+ KR+E+    ++Q  + D  +    D+LTS+I  +  +  + 
Sbjct  240   KMTEAGVIFDRVCAKYISTKREEI---KRSQGINQDHFEGESEDILTSFIKLDMTKHQLL  296

Query  945   LKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK  766
                +DKFLRDT++  MIAGRDTT++ALTWF WL+S +P V   IR E+ T +  G   ++
Sbjct  297   NPINDKFLRDTVVFFMIAGRDTTAAALTWFFWLLSENPRVVTKIRQEIDTILPRGSSGQE  356

Query  765   FRLFKAEELKN-LVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                + + E  N L+YLH ALCE+LRLYPPVP +  SPL++D+LPSGHKV  ++++   LY
Sbjct  357   RPSYDSMEFLNKLLYLHGALCETLRLYPPVPIELVSPLKSDLLPSGHKVEENSKIFIFLY  416

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             A+GRM+ IWG+DA EFKPERWI+ E G ++H P++KFLAFN GPR+CLGK++A  QMK V
Sbjct  417   ALGRMRAIWGEDALEFKPERWIS-ETGTLRHVPTFKFLAFNGGPRSCLGKQIAMIQMKTV  475

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
                I+ NY ++  K     P+ ++IL MKHGLKV + +R
Sbjct  476   VVEILQNYDIKVAKEQKTQPDTNVILRMKHGLKVSISKR  514



>ref|XP_010446498.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   472 bits (1215),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/519 (45%), Positives = 338/519 (65%), Gaps = 14/519 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKV---PLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MASI   ++ +A  CLV++  L    R+       P+ GM P   L + +I+D    +  
Sbjct  1     MASISLLDVSIAIICLVLFRCLFFKKRKDHAFRSWPVLGMFPGFLLELHRIYDFGVEIFE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TFL  GPWFT +D+L TVDPAN+HYI+S NF N+ KG +FK++FDV G+ IF+SD 
Sbjct  61    SADLTFLFTGPWFTGMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEMIFSSDG  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LWKNQRK A+ ++ HQ F +  + T+  K+  GL+P+L+    E   VVDLQ+VF+RFT
Sbjct  121   ELWKNQRKAAQYMLNHQGFQKLSMSTTRRKLYDGLVPLLD-QCCEEEKVVDLQEVFKRFT  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FDTT  LVTG DP  LS++ P+V ++KA+DD  E +F RH+ P+ LWKLQ   G+G EK+
Sbjct  180   FDTTFFLVTGCDPKSLSIEMPEVEYAKALDDLGEGIFYRHIKPKFLWKLQNLFGLGQEKR  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             +++A    D+V  KYI+ KR+E+    +++   +  +D    DLL+S+I  +  +  +  
Sbjct  240   MTKADATFDRVSAKYISAKREEI----RSKGIAHHHSDGESEDLLSSHIKLDTTKYELLK  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
               +DKFLRDTIL   +AGRDT +SAL+W  WL+S +P+V   IR E++    S       
Sbjct  296   PSEDKFLRDTILAFNLAGRDTMASALSWLFWLLSQNPQVVTKIRKEIIDKNLSKTGSNVL  355

Query  762   RLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAM  583
                  + L  LVYLHAAL ES+RLYPPV FQ KSP++ D+LPSGHKV  ++ ++  LY +
Sbjct  356   -----DNLDKLVYLHAALYESMRLYPPVVFQRKSPIKADLLPSGHKVDANSVIIIYLYGL  410

Query  582   GRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA  403
             GRM+ +WG+DA EFKPERWI+   G ++H PS+KFL+FNAGPRTC GK++A T MK +  
Sbjct  411   GRMRAVWGEDATEFKPERWIS-GTGGLRHSPSFKFLSFNAGPRTCPGKQIAMTLMKTLVV  469

Query  402   AIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
              I+ NY ++ +K     P   ++L+MKHGLKV + +R +
Sbjct  470   EILQNYDIKVIKGQKVEPESGLMLHMKHGLKVTITKRCS  508



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   472 bits (1215),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 245/528 (46%), Positives = 341/528 (65%), Gaps = 32/528 (6%)
 Frame = -2

Query  1827  SIDYFEIFVA-FFCLV--IWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             +I Y E+ VA  F L+  +W   R    R        ML +L L+  ++H+    VL   
Sbjct  4     TISYVEMIVASLFILIGCLWCFKRSSRTR--------MLSTLVLNTHQLHEFATRVLKKS  55

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
              GT   KGPWF  +D +IT DP NVHYI S NF N+PKG + + I +  GDG+F +D +L
Sbjct  56    RGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNL  115

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK QRK+  +++ H++F   L +T + K+E GLIPVL+ A+ E G  VDLQDVFQRFTFD
Sbjct  116   WKMQRKMIHSVMKHKKFESALEKTIYQKLENGLIPVLDHAS-EVGIKVDLQDVFQRFTFD  174

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
               C  V G +P  LS +FP V ++ A +  E+ +F RH++P+S WKLQ+WL IG EK+LS
Sbjct  175   NICMSVLGINPNYLSFEFPQVAYANAFNATEQAVFYRHIVPKSWWKLQKWLHIGKEKELS  234

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM----  949
             +A +  D+ + + I++KR+ L+ + K         +E  FD+LT+++   + E  M    
Sbjct  235   KAMKTFDRFLYECISLKRERLLTSRKAS------TEEEEFDVLTAFMVEGEEEEEMNEDR  288

Query  948   ---GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDEL-----LTA  793
                 LK +DKFLRDT  NL+ AG++T +S L WF WLV+THP VE  I +E+     +  
Sbjct  289   EIGALKRNDKFLRDTAFNLLAAGKETVNSGLVWFFWLVATHPSVENKILEEMKANMVMQK  348

Query  792   VNSGEDPKKFRL-FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSP  616
                 ED  + RL F A+++  +VYLHAAL E+LRLYPPVP+ HK   Q D+LPSGH+++ 
Sbjct  349   QEEEEDDGEKRLFFDAKQVNRMVYLHAALRETLRLYPPVPYNHKISAQADVLPSGHRINK  408

Query  615   DTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKE  436
             +  ++ S YAMGRM+ IWGKD  EFKPERWI+ ERG++ H PSYKF AF+AGPR CLGK+
Sbjct  409   NHSILISYYAMGRMEEIWGKDCLEFKPERWIS-ERGSIVHVPSYKFTAFHAGPRNCLGKD  467

Query  435   VAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              AF QMK VAA I+  Y V+ V+ H  SP  S++L+MK+GLKV++ +R
Sbjct  468   TAFIQMKMVAALILGKYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKR  515



>dbj|BAC42841.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=502

 Score =   472 bits (1214),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/483 (48%), Positives = 316/483 (65%), Gaps = 21/483 (4%)
 Frame = -2

Query  1737  PLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNF  1558
             P+ GMLP +   + +I+D     L     T    GPW +  DIL+TVDP N+ YI+S NF
Sbjct  38    PVLGMLPGVLFQIPRIYDFVTEALEAENMTGCFIGPWLSGTDILLTVDPVNIQYILSSNF  97

Query  1557  ENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGL  1378
              N+PKGK+F KIF+ LGDGIFN D  LW++ R  + A+  HQ F  + V TS +K+ +GL
Sbjct  98    VNYPKGKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQGL  157

Query  1377  IPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEV  1198
             +P+L+ A  E+  +VDLQD+FQRF FDT+ TL+ GYDP  LSV+ P V F+ AMD   + 
Sbjct  158   VPILDNAV-EKHILVDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEFADAMDGVADA  216

Query  1197  LFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDND  1018
             +F RHL P  LW +Q W+G+G EKK+ R  ++ DQ++GK I+ KR+E+    KN      
Sbjct  217   MFYRHLKPAFLWSIQSWIGVGIEKKMRRGLDVFDQMLGKIISAKREEI----KNHG----  268

Query  1017  INDENG--FDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLV  844
             I+D  G   D+LT Y+  +  +       +DKF+RDTIL L+IA RDTTSSALTWF WL+
Sbjct  269   IHDSKGEAMDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGLVIAARDTTSSALTWFFWLL  328

Query  843   STHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHK  664
             S +PE    IR E+          KK   F   +L  LVYL  A+CE+LRLYP VPF HK
Sbjct  329   SKNPEAMTKIRQEI---------NKKMPKFDPADLDKLVYLDGAVCETLRLYPSVPFNHK  379

Query  663   SPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSY  484
             SP + D+LPSGHKV  + R++  +Y++GRM+ +WG DA++F+PERWI+ + G ++ E  Y
Sbjct  380   SPAKPDVLPSGHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWIS-DSGMLRQESPY  438

Query  483   KFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVR  304
             KFLAFNAGPRTCLGK + F QMK VA  II NY ++ V+ H   P  S++L M+HGLKV 
Sbjct  439   KFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRNYDIKVVEGHKPKPVPSVLLRMQHGLKVS  498

Query  303   VQR  295
             V +
Sbjct  499   VTK  501



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   469 bits (1206),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 313/442 (71%), Gaps = 12/442 (3%)
 Frame = -2

Query  1617  LDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALII  1438
             + +++T DPAN+HYI+S NF N+PKG EF+KIFD+LGDGIFN+D  LW+  R++  +L+ 
Sbjct  1     MHMVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRRVTLSLMH  60

Query  1437  HQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGC  1258
             H  F + L  T W+KVEKGL+PVL+  A + G  +DLQD+FQRF FD+   LV  +DPG 
Sbjct  61    HPSFLKVLEVTVWDKVEKGLLPVLQNCA-KTGSQLDLQDIFQRFAFDSISKLVLDHDPGS  119

Query  1257  LSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKY  1078
             LS+D P++P  KA +D   VL  RH+LPE  WKLQ+WLGIG EKKLS+A +  DQ I   
Sbjct  120   LSLDLPNIPCEKAFNDLALVLLHRHILPERYWKLQKWLGIGKEKKLSKAWDAFDQFIYPR  179

Query  1077  ITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLM  898
             I++K+++    +         ++E  F  LT+ +   + ET   ++    F+RD ILNLM
Sbjct  180   ISLKQEKRSKMF---------DEERRFVGLTTLMEAYE-ETNNSIRDAKAFIRDNILNLM  229

Query  897   IAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLH  718
              AGRDTTS+ALTWF WL++T+   E+ I +E+   ++  +  +  RLF  ++   LVYLH
Sbjct  230   FAGRDTTSTALTWFFWLIATNHWAEEKILEEIANELDVVKQGQDSRLFNVQQSHKLVYLH  289

Query  717   AALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFK  538
             AALCE+LRLYPPV  +HK+P+Q  ILPSG +V P+T+L+   Y+MGRM+ +WG+D  EFK
Sbjct  290   AALCEALRLYPPVALEHKAPVQAVILPSGVRVEPNTKLILFFYSMGRMESLWGEDCLEFK  349

Query  537   PERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHD  358
             PERWI+ ERG V+HEPS+KF AFNAGPRTCLGKE+AF QMK VAA+II+NYHVR V  H 
Sbjct  350   PERWIS-ERGRVRHEPSFKFPAFNAGPRTCLGKEMAFVQMKMVAASIIYNYHVRVVDGHP  408

Query  357   ASPNVSIILYMKHGLKVRVQRR  292
              SP+ SII+ MK GL VR+ +R
Sbjct  409   ISPSDSIIIQMKQGLMVRLFQR  430



>ref|XP_010479164.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=522

 Score =   471 bits (1213),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 242/528 (46%), Positives = 330/528 (63%), Gaps = 25/528 (5%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVI-------------WIILRDGY-RRPLKVPLFGMLPSLFLHVR  1696
             MASI   E F+A  C +I             +++++    R P   P+ GMLP   L ++
Sbjct  1     MASIGLLEAFIALLCFLIIFYHFLVNKANFSYVLIKKTLGRYPWNWPVLGMLPGGLLRLQ  60

Query  1695  KIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFD  1516
              I+D    +L     TF  KGPWF  +D+L+TVDPANVH+IMS NF N+ KG  F +IF+
Sbjct  61    YIYDCSVEILENSNLTFQFKGPWFVGMDVLVTVDPANVHHIMSSNFSNYIKGPIFHEIFE  120

Query  1515  VLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGV  1336
               GDGI NSD +LW+N R  A+ +  HQR+  +   T+  K++ GL+P+    A E   V
Sbjct  121   AFGDGIINSDSELWRNWRNAAQTIFNHQRYQNFSASTTKTKLKDGLVPLFNHFADEE-MV  179

Query  1335  VDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKL  1156
             VDLQDVFQRF FD T   +TG+DP  LS+  P+  FSKA+DD  + +  RH+ P  +WKL
Sbjct  180   VDLQDVFQRFMFDITFNFITGFDPRSLSIGMPEAEFSKALDDVGDAIVHRHITPRFVWKL  239

Query  1155  QQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYI  976
             QQW+GIG EK L +A   LD+V  K+I  KR+EL    ++    ++ N E+  DLLTS+I
Sbjct  240   QQWIGIGTEKTLLKAHATLDRVCAKFIAAKREEL----RSHGVTHNTNGESE-DLLTSHI  294

Query  975   NNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLT  796
               +  +  +    DDKFLRD  +  M AGRD+T+SALTWF W +S +P V   I  E+ T
Sbjct  295   MLDATKYELLNPGDDKFLRDFTVGFMAAGRDSTASALTWFFWNMSENPNVLTKILQEINT  354

Query  795   AVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSP  616
              +    + +    +    L  LVYLH AL ES+RLYPP+PF+ KSP++ D LPSGHKV  
Sbjct  355   NLPRTRNNQDMSSY----LNKLVYLHCALSESMRLYPPIPFERKSPIKEDELPSGHKVKE  410

Query  615   DTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKE  436
             +  +M  +YAMGRM+ +WG+DA EFKPERWI+ E G ++HEPSYKFL+FNAGPRTCLGK 
Sbjct  411   NINIMIFIYAMGRMKTVWGEDAMEFKPERWIS-ETGGLRHEPSYKFLSFNAGPRTCLGKN  469

Query  435   VAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +A T MK V   I+ NY ++ V      P   +IL+MK+GLKV + ++
Sbjct  470   LAMTLMKTVIVKILQNYEIKVVSGQKIEPKPGLILHMKYGLKVTMTKK  517



>ref|XP_006427985.1| hypothetical protein CICLE_v10025385mg [Citrus clementina]
 gb|ESR41225.1| hypothetical protein CICLE_v10025385mg [Citrus clementina]
Length=513

 Score =   471 bits (1212),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/487 (49%), Positives = 321/487 (66%), Gaps = 13/487 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P  +PL GML S+ L++ ++HD+ A +L    G+F++KG W    D+ +T DPANV +IM
Sbjct  31    PWNLPLLGMLASVILNINQLHDKVAQILEKTKGSFMIKGSWVAQYDMFLTSDPANVQHIM  90

Query  1569  SGNFENFPKGKEFKKIFDVLGD-GIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNK  1393
             S NF  + KG E +K FD+ G+ G+FNSD D WK+QRKLARA I HQ+F + + +     
Sbjct  91    STNFSKYHKGSEGRKRFDIFGETGLFNSDFDEWKHQRKLARAFINHQKFQQLMAKIVPEM  150

Query  1392  VEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMD  1213
             +E+GLIPVL+  + E+  +VD QD+ +R TFD  C + TG++P  LSV FP++ F  A+D
Sbjct  151   IERGLIPVLDHVSEEKM-LVDFQDLLKRTTFDFACLIATGHNPNSLSVGFPEMGFPDAVD  209

Query  1212  DAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQ  1033
             DA E + IRHL+PESLWKLQ WLG G EKKL+     +DQ   K  +MK++E+    + +
Sbjct  210   DACEAILIRHLVPESLWKLQSWLGFGKEKKLANGWRTIDQFWEKQKSMKQEEIEKGMEAK  269

Query  1032  NPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFI  853
                    DE  + LL  Y++   G    G    +K +RD I  L+ A   TTS ALTWF 
Sbjct  270   E------DEGIYSLLNCYLS---GHEVTGPTPAEKVMRDNITALIFATEGTTSIALTWFF  320

Query  852   WLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPF  673
             WLVS +P  E  I++EL     S E   K  L +  EL  LVYLHAALCE+LRLYPPVPF
Sbjct  321   WLVSKNPFAETKIKEELKRNF-SQEGFNKPPLVRLNELNKLVYLHAALCETLRLYPPVPF  379

Query  672   QHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHE  493
             + + PLQ D+LPSGH+V+ +T ++ S Y+M RM  +WG+D +EFKP RWI  E G ++HE
Sbjct  380   EIRIPLQPDVLPSGHQVNQNTHVLISAYSMARMTSVWGEDCREFKPGRWIT-EDGRIRHE  438

Query  492   PSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGL  313
             P +KF +FNAGPR C+GK++AFT MKA AA+IIHNY V+ VKNH  + N+SI   MKHGL
Sbjct  439   PPHKFFSFNAGPRICIGKDIAFTMMKATAASIIHNYDVQVVKNHPVTYNLSIGFRMKHGL  498

Query  312   KVRVQRR  292
               RV +R
Sbjct  499   LARVSKR  505



>emb|CDY53177.1| BnaA06g40560D [Brassica napus]
Length=518

 Score =   471 bits (1212),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 236/516 (46%), Positives = 330/516 (64%), Gaps = 22/516 (4%)
 Frame = -2

Query  1830  ASIDYFEIFVAFFCLVIWIILRDGYRRPLK-VPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             AS   F IF   F ++ +++ +  Y R L+ +P+  MLP L + + +IHD    +L   G
Sbjct  23    ASKTPFTIFC--FLILYYLLFKKRYVRFLRNLPVLRMLPGLLMTLHRIHDFTVKILEFSG  80

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              TFL KGP F  +D+L+T DP N+H+IMS NF N+ KG   ++IFDV GDGIF +D ++W
Sbjct  81    MTFLFKGPPFAGMDMLLTADPDNIHHIMSSNFSNYIKGPGLQEIFDVFGDGIFTTDSEMW  140

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             KN RK  ++++ HQ F R+ + T  +K++ GL+P+L   A E G  VDLQDVF R TFDT
Sbjct  141   KNLRKSIQSMLHHQEFQRFSMSTMTSKLKSGLVPLLNHFA-EEGAAVDLQDVFGRLTFDT  199

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             T  L+TG DP  LS++  +   +KA+DD  + +  RH+ P  LWK+Q W+G+G EKK+S+
Sbjct  200   TLILITGSDPRSLSIELHEDELAKALDDTGKGILSRHVKPRFLWKMQNWMGLGQEKKMSQ  259

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A    D+V  KYI+ KR+E++ +         + +  G DLLTS++  +  +       D
Sbjct  260   ASATFDRVCSKYISAKREEILRS-------QGVLNGEGEDLLTSFMKLDTTKYKFLNPSD  312

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             DK LRDTIL  +IAGRDT +  L+WF WL+S +P V  NIR E++    +G+        
Sbjct  313   DKLLRDTILAFIIAGRDTVAFTLSWFFWLLSVNPHVVANIRQEIIDTTGNGQ--------  364

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
               E L  LVYL  AL E++RLYPPV F  KSP+++D+LPSGHKV  +++++  LYA+GRM
Sbjct  365   --ENLDKLVYLQGALFEAMRLYPPVSFGRKSPVKSDVLPSGHKVDANSKIIICLYALGRM  422

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + +WGKDA  FKPERWI  E G +KHEPS KFLAFN GPRTCLGK +A TQMK V   I+
Sbjct  423   RAVWGKDAFRFKPERWIA-ENGGLKHEPSSKFLAFNTGPRTCLGKHLAITQMKMVVVEIL  481

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
               Y V  +K     P +  +L MKHGL+V+V +R +
Sbjct  482   QKYDVEVIKGQKIEPVLGFMLSMKHGLRVKVAKRCS  517



>gb|KEH22136.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   470 bits (1209),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 236/509 (46%), Positives = 334/509 (66%), Gaps = 24/509 (5%)
 Frame = -2

Query  1812  EIFVAFFCLVIWIILRDGYRRPL-KVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLK  1636
             E+F A    V     R     P+ K P+ GMLP L  +V  IH      L  +GGTF+ +
Sbjct  8     ELFWAVLVFVAIHYWRLNRNTPMTKWPVLGMLPGLLHNVSNIHGYVDLTLKQNGGTFIFE  67

Query  1635  GPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKL  1456
             GPW TN++IL T DP NV +I S  FEN+ KG +F++IF+VLG+GIF SD  +WK  RKL
Sbjct  68    GPWLTNMNILCTSDPMNVQHITSTKFENYGKGNDFREIFEVLGEGIFRSDSHIWKYNRKL  127

Query  1455  ARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVT  1276
               ++     F  ++ +T   K+   L+  L+ A+ + G  VDLQD+FQR TFD  C++V 
Sbjct  128   LHSIFKQGNFQVFIQKTVEKKICNYLLVFLDHAS-KNGVQVDLQDIFQRLTFDNICSVVL  186

Query  1275  GYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILD  1096
             G+DP CLS+D P++P  +A   AE+ LFIRH+ P+ LWKLQ W  +G EK+  +  + +D
Sbjct  187   GFDPKCLSIDLPEIPCERAFTQAEDTLFIRHVKPKLLWKLQNWFQVGEEKQFIKNNKFID  246

Query  1095  QVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINN-NDGETTMGLKFDDKFLR  919
             +++   I  KR+              +  E   DLL   IN   DGE     K DDKFLR
Sbjct  247   EMLYSEIKSKRE--------------MRGEQKVDLLDIIINEVGDGEN----KIDDKFLR  288

Query  918   DTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEEL  739
             DT +NL+ AGRDT SS LTWF WLV+THP +E  I +E+   + S E    ++   A+ L
Sbjct  289   DTSINLLAAGRDTISSGLTWFFWLVATHPLIEAKILEEIKENLPSRE--HSWKDLGAKGL  346

Query  738   KNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWG  559
               LVYLH ALCE+LRLYPP+PF+HKS  ++D+LPSGH+V  +T +++SLY++GR++ IWG
Sbjct  347   SKLVYLHGALCEALRLYPPIPFEHKSAQKSDVLPSGHRVESNTMIVYSLYSVGRVEEIWG  406

Query  558   KDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHV  379
             +D  EFKPERWI+ ++G + + PSYKF+AFNAGPR+CLGK+++F +MK VA AI+ NYH+
Sbjct  407   EDCLEFKPERWIS-QKGGIVYVPSYKFIAFNAGPRSCLGKDISFIEMKMVAIAILLNYHI  465

Query  378   RAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             + V++H   P++S++L+MKHGLKV +++R
Sbjct  466   QVVEDHPIIPSLSVVLHMKHGLKVNLKKR  494



>ref|XP_002865907.1| CYP96A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42166.1| CYP96A4 [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   470 bits (1209),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 233/514 (45%), Positives = 328/514 (64%), Gaps = 20/514 (4%)
 Frame = -2

Query  1824  IDYFEIFVAFFCLVIWIILRDGYRRPLKV----PLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             I   EIF+ F   + +       + P  +    P+ GMLP + LH+ +++D     L   
Sbjct  5     IGLLEIFITFIFFLAYQCFSLHKKTPKHMVTNWPVLGMLPGVVLHISRVYDLVTEALEGE  64

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
               T    GPW +  +IL+T DP N+ YI+S NF N+PKGK+F KIF+ LGDGIFN D  L
Sbjct  65    NMTGCFIGPWLSGTNILLTADPVNIQYILSSNFVNYPKGKKFNKIFEFLGDGIFNVDSGL  124

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W++ R  + A+  HQ F  + V TS +K+ +GL+P+L+ A  E+  +VDLQD+F RF FD
Sbjct  125   WEDMRNSSHAIFSHQDFQSFSVSTSVSKLRQGLVPILDNAV-EKHILVDLQDLFHRFLFD  183

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             T+ TL+TGYDP  LS++ P V F+ AMD   + +F RHL P  LW+LQ W+G+G EKK+ 
Sbjct  184   TSSTLMTGYDPKSLSIEMPKVEFADAMDGVADAMFYRHLKPAFLWELQSWIGVGVEKKMR  243

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
             R   + DQ++GK I+ KR+E+       +  +D   E   D+LT Y+  +  +       
Sbjct  244   RGLAVFDQMLGKIISAKREEI-----KSHGIHDSKGEEAMDVLTYYMTIDTTKYKHLKPS  298

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             +DKF+RDTIL  +IA RDTTSSALTW  WL+S +PE    IR E+     + + PK    
Sbjct  299   NDKFIRDTILGFLIAARDTTSSALTWLFWLLSKNPEAMTKIRQEI-----NNKMPK----  349

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F   +L  LVYL  A+CE+LRLYP VPF HKSP + D+LPSGH+V  + R++  ++A+GR
Sbjct  350   FNPADLDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDVLPSGHRVDENWRVVIPIFAVGR  409

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ +WG DA++F+PERWI+ + G ++ E SYKFLAFNAGPRTCLGK + F Q+K VA  I
Sbjct  410   MKSVWGDDAEDFRPERWIS-DSGMLRQESSYKFLAFNAGPRTCLGKRLTFLQVKTVAVEI  468

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             I NY ++ V+ H+  P  S++L M+HGLKV V +
Sbjct  469   IRNYDIKVVEGHNPKPVPSVLLRMQHGLKVSVTK  502



>gb|KFK32856.1| hypothetical protein AALP_AA6G295800 [Arabis alpina]
Length=509

 Score =   469 bits (1208),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 231/519 (45%), Positives = 333/519 (64%), Gaps = 19/519 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPLKV-----PLFGMLPSLFLHVRKIHDRCAAV  1669
             MA I   E+F+AF   + +  L   +++P ++     P+ GMLP + +   +I+D  A  
Sbjct  1     MACIGLLEVFIAFLVSIFFHFLI--HKKPHQILPRNWPILGMLPGVLVVFHRINDYVAEA  58

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L +   TF  KGPWF+ +++L+T DPAN+ ++ S NF ++ KG EFK+IFD LG+GIF +
Sbjct  59    LEVSNMTFAFKGPWFSGMNMLVTADPANIQHVFSSNFSSYDKGSEFKEIFDFLGEGIFTA  118

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D  LW+  RK A  ++ HQ F  +  RT  +K++  LIPVL+  A E   V DLQ VFQR
Sbjct  119   DSKLWEELRKSALVMLSHQGFQSFSFRTFTSKIKNRLIPVLDHFA-EANTVFDLQGVFQR  177

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
               FD T TLVTGY+   LS++ P+  ++KAMDDAEEV+  RH  P   WKLQ W+G+G E
Sbjct  178   LAFDVTLTLVTGYNSNSLSIEMPENDYAKAMDDAEEVIVYRHAKPMIFWKLQNWIGLGEE  237

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             KK+ +A  + +++  +YI  KR+E  +  +  + + +  DE   D+L+ Y+  +  +  +
Sbjct  238   KKMKKANAVFNRLCAEYIFSKREE--IQRRQDSNEEEAQDE---DILSFYMKLDTSKYKL  292

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                 DD FL+  I + M+AGRD  +S LTWF WL+S +PE    IR E+   +     P+
Sbjct  293   MNPNDDNFLKGIIKSFMLAGRDAIASTLTWFFWLLSKNPEAVTKIRQEINENL-----PR  347

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
               +    E L  +VYLH ALCESLRLY P+PF+ KSP++ D+LPSGHKV  + +++F++Y
Sbjct  348   SGKSLNPEMLNKMVYLHGALCESLRLYAPIPFERKSPIKQDVLPSGHKVDTNWKIVFAVY  407

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             A+GRM+ +WG+DA EFKPERWI+ E G +KHEPS+KF  FN+GPR CLGK ++F QMK V
Sbjct  408   ALGRMRAVWGEDASEFKPERWIS-ENGGLKHEPSFKFFVFNSGPRNCLGKNLSFLQMKTV  466

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             A  II NY +R V+ H      S++L+MKHGLK  V +R
Sbjct  467   AIEIIQNYDIRVVEGHKIEQVPSMVLHMKHGLKATVAKR  505



>emb|CDY53178.1| BnaA06g40570D [Brassica napus]
Length=469

 Score =   468 bits (1204),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 229/478 (48%), Positives = 313/478 (65%), Gaps = 14/478 (3%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP + + + +I+D    VL     TF  KGPWF  +DIL+TV PAN+HYI+S NF N+ 
Sbjct  1     MLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYILSSNFSNYI  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EF++IF+  GDGI NSDL+LW+N RK ++ +  HQ++  +   T+ +K++ GL+P+L
Sbjct  61    KGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQNFSKSTTRSKLKDGLLPLL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
                A E   VVDLQDVFQRF FDTT   +TG DP  LSV+ P+V F+KA+DD  E +  R
Sbjct  121   SHFADEE-IVVDLQDVFQRFMFDTTFIFITGSDPRSLSVEMPEVEFAKALDDVGEAIVYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H+ P  LWKLQ+W GIG EKK+ +A  +LD+V  KYI+ KR+E+           +I DE
Sbjct  180   HITPRFLWKLQKWFGIGTEKKMVKANAVLDRVCAKYISAKREEI--------RSQEIADE  231

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
                DLLTS+I  +  +  +    DDKFLRD  +  M AGRD+T+  LTWF W++S +   
Sbjct  232   ESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFMAAGRDSTACTLTWFFWILSEN---  288

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
               N+  ++L  +N      +    K+  L  LVYLHAAL ES+RLYPP+PF+ KSP++ D
Sbjct  289   -SNVLSKILQEINENVPITRSDQDKSSYLNKLVYLHAALSESMRLYPPIPFERKSPIKPD  347

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV  +  +M  +YAMGRM+ +WG+DA EFKPERWI+ E G ++HEPSYKFL+FN
Sbjct  348   VLPSGHKVKSNINIMIFIYAMGRMKDVWGEDAAEFKPERWIS-ETGGLRHEPSYKFLSFN  406

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AGPRTCLGK +A   +K V   I+  Y +  V          +IL+MKHGLKV + ++
Sbjct  407   AGPRTCLGKNLAMDLIKTVIVEILQAYEINVVSGQKIEAKPGLILHMKHGLKVTIAKK  464



>ref|XP_006301880.1| hypothetical protein CARUB_v10022359mg [Capsella rubella]
 gb|EOA34778.1| hypothetical protein CARUB_v10022359mg [Capsella rubella]
Length=456

 Score =   467 bits (1202),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/478 (48%), Positives = 321/478 (67%), Gaps = 23/478 (5%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M+PSL +   +++D    +L      F  KG WF+  D L+T DP N+H+I+S NF+N+P
Sbjct  1     MVPSLVVQFPRVYDWMVEILEASDLNFAFKGAWFSGTDFLLTADPRNIHHILSSNFKNYP  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFKKIFDVLGDGI  +D  LW++ RK   ++  H+ F  + V ++ +KV+KGL+P+L
Sbjct  61    KGPEFKKIFDVLGDGIVAADSMLWEDLRKSNHSIFHHKGFLEHAVSSNISKVKKGLLPIL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             + A  E   ++DLQD+FQRFTFD +  L+TGYDP  LS++ P+V F++A+D +EE +F R
Sbjct  121   DKAV-EENIILDLQDMFQRFTFDISSILMTGYDPMSLSIEMPEVEFAEAVDISEEAIFYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             HL P  LWKLQ+W+G+G EKKL  +   +D+++ K I+ +R+EL               E
Sbjct  180   HLKPVILWKLQKWIGVGLEKKLRDSMVAVDEMLAKIISSRREEL----------GRGKRE  229

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
                ++LT YIN +  +  +     DKF+RD + +L+IA RDTTSSALTWF WL+S HP V
Sbjct  230   TSMNVLTYYINVDTTKYKLLKPRSDKFIRDVVFSLLIAARDTTSSALTWFFWLLSMHPNV  289

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
                I+ E+ T  ++  D           L+ LVYLHAAL E++RLYPP+PF HKSP +++
Sbjct  290   MAKIQHEINTKYDNPAD-----------LEKLVYLHAALSETMRLYPPLPFNHKSPSESE  338

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV   ++++ S+YA+GRM+ +WG+DA +FKPERWI  E G ++HEPSYKFLAFN
Sbjct  339   VLPSGHKVEAHSKIVISIYALGRMRSVWGEDASDFKPERWI-LEDGGIRHEPSYKFLAFN  397

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +GPRTCLGK +A  Q+K VA  II NY  + V+     P  S+IL MKHGLKV V ++
Sbjct  398   SGPRTCLGKNLALLQLKIVAVDIIRNYDFKIVEGQKIEPVTSVILTMKHGLKVTVSKK  455



>ref|XP_010555337.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=501

 Score =   469 bits (1206),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/515 (47%), Positives = 326/515 (63%), Gaps = 18/515 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIW-IILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA   + EI +AF    I+  +LR   +     P  GMLP L +   + +D    +L   
Sbjct  1     MALKGFLEISIAFVIFFIFSFLLRK--KTLTNWPFLGMLPGLIVETPRFYDWIVEILEAT  58

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             G TF  KGPWFT  D+L TVDPAN+++I+S NF N+PKG +F+ IF+ LGDGIFN+D DL
Sbjct  59    GLTFHFKGPWFTRSDLLFTVDPANINHILSSNFVNYPKGPDFRDIFEPLGDGIFNADFDL  118

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             WK+ RK A AL+  Q F  +   T+   V+  L+PVL+  A +   VVDLQDVFQRFTFD
Sbjct  119   WKDLRKSAHALLSRQDFQGFTKSTTVGVVKNRLLPVLD-HADKTDTVVDLQDVFQRFTFD  177

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
             TT TLVTGYDP  LS+D P V  + A++DAEE +F RH  P   WKLQ WLG G EKKL 
Sbjct  178   TTLTLVTGYDPKSLSMDMPHVELAIAVEDAEEAIFHRHFRPRIFWKLQSWLGFGFEKKLR  237

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
              A  + D+    YI+ KR+E+           D ++    DLLT Y+N +  +  +    
Sbjct  238   DAVAVGDRACANYISAKREEI--------RRGDRSEGEAMDLLTYYMNIDKNKYELLNPN  289

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DDKFLRD++L  ++AGRDTTS+ LTWF +L+S +P+    IR E+          +    
Sbjct  290   DDKFLRDSMLTFILAGRDTTSAGLTWFFFLLSKNPKAVTKIRGEIEATFE-----RSVNW  344

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
             F   +L  LVYL+ A+ ESLRLYPPVPF HKSP + D+LPSGH+V  + +++ + YA+ R
Sbjct  345   FDQVDLNKLVYLYGAIYESLRLYPPVPFNHKSPAREDVLPSGHRVDANAKIVLAFYALAR  404

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
             M+ +WG+DA EFKPERWI+ + G ++HEPS+KF +FNAGPRTC+GK+VA T M  VA  I
Sbjct  405   MKSVWGEDASEFKPERWIS-DSGVLRHEPSFKFASFNAGPRTCIGKQVALTHMAIVAVEI  463

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             + NY + AV         S+IL MKHG KV V++R
Sbjct  464   LQNYDITAVDGQRVELVPSVILRMKHGFKVFVRKR  498



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   469 bits (1206),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 241/511 (47%), Positives = 331/511 (65%), Gaps = 22/511 (4%)
 Frame = -2

Query  1809  IFVAFFCLVIWIILRDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGP  1630
             IF   FC     + R+    P   PL GMLP+L  +  +IH+    ++     TF  KGP
Sbjct  8     IFFVLFCY----LFRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHFKGP  63

Query  1629  WFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLAR  1450
             WF+N+++L+T+DP N+H+++S  FEN+ KG +  +I + LGDGI  +D  LW   R +A 
Sbjct  64    WFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRNVAH  123

Query  1449  ALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGY  1270
             +   H +FH+ LV  +W KV+ GLIPVLE  + +   V+DLQD+F RF++DT CT++  +
Sbjct  124   SFFNHPKFHQSLVDVTWKKVKNGLIPVLEHVS-KHNIVIDLQDLFLRFSYDTMCTIMMDH  182

Query  1269  DPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQV  1090
             DP  LSVD PD P  KA+ D     FIRH +P  +WKLQ+WL +G EKK  +  +ILD  
Sbjct  183   DPTSLSVDSPDFPLLKAVADMAHGAFIRHAVPTWIWKLQRWLNVGEEKKFRQGWKILDNF  242

Query  1089  IGKYITMKRQE----LILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFL  922
             I K I  KR+       +  K  N D D   E  +DLLT +++N D  T      +DKFL
Sbjct  243   IYKCIDRKREAKAKGASIPSKTNNKDQDF--EVSYDLLTFFMDNEDKNT------NDKFL  294

Query  921   RDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKK--FRLFKA  748
             RDTI N  +AG +TTS+AL+WF +L+S HP+V   I+ EL + +   +D  +  FR FK 
Sbjct  295   RDTITNFFLAGGETTSTALSWFFYLISNHPKVSHKIKQELNSIMIQNDDNYEMIFRNFK-  353

Query  747   EELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQF  568
             E    LVYLHAALCE+LRLYP + F  K+P++  ILPSGH+V+ +T ++F+ YAMGRM+ 
Sbjct  354   EISSKLVYLHAALCETLRLYPSIVFNPKTPVEPQILPSGHRVNSNTEIIFNTYAMGRMKS  413

Query  567   IWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  388
             IWG D  EFKPERWI  E   +KHEPSYKF  F+AGPR+C+GK++AFTQMK VAA II N
Sbjct  414   IWGDDCNEFKPERWI-LEGRMIKHEPSYKFSVFSAGPRSCIGKQMAFTQMKIVAAIIIQN  472

Query  387   YHVRAVKNHDASPNVSIILYMKHGLKVRVQR  295
             YH+ AV+ +   P +S++L+MKHG KVR+ R
Sbjct  473   YHIEAVEKYHV-PTMSMVLHMKHGFKVRIFR  502



>ref|XP_009101865.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=518

 Score =   469 bits (1207),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 236/516 (46%), Positives = 330/516 (64%), Gaps = 22/516 (4%)
 Frame = -2

Query  1830  ASIDYFEIFVAFFCLVIWIILRDGYRRPLK-VPLFGMLPSLFLHVRKIHDRCAAVLSLHG  1654
             AS   F I    F ++ +++ +  Y R L+ +P+  MLP L + + +IHD    +L   G
Sbjct  23    ASKTLFTILC--FLILHYLLFKKRYVRFLRNLPVLRMLPGLLMTLHRIHDFTVKILEFSG  80

Query  1653  GTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDLW  1474
              TFL KGP F  +D+L+T DP N+H+IMS NF N+ KG   ++IFDV GDGIF +D ++W
Sbjct  81    MTFLFKGPPFAGMDMLLTADPDNIHHIMSSNFSNYIKGPGLQEIFDVFGDGIFTTDSEMW  140

Query  1473  KNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFDT  1294
             KN RK  ++++ HQ F R+ + T  +K++ GL+P+L   A E G  VDLQDVF R TFDT
Sbjct  141   KNLRKSIQSMLHHQEFQRFSMSTMTSKLKSGLVPLLNHFA-EEGTAVDLQDVFGRLTFDT  199

Query  1293  TCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLSR  1114
             T  L+TG DP  LS++  +   +KA+DD  + +  RH+ P  LWK+Q W+G+G EKK+S+
Sbjct  200   TLILITGSDPRSLSIELHEDELAKALDDTGKGILSRHVKPRFLWKMQNWMGLGQEKKMSQ  259

Query  1113  ACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKFD  934
             A    D+V  KYI+ KR+E++ +    N +       G DLLTS++  +  +       D
Sbjct  260   ASATFDRVCSKYISAKREEILRSQGVLNGE-------GEDLLTSFMKLDTTKYKFLNPSD  312

Query  933   DKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRLF  754
             DK LRDTIL  +IAGRDT +  L+WF WL+S +P V  NIR E++    +G+        
Sbjct  313   DKLLRDTILAFIIAGRDTVAFTLSWFFWLLSVNPHVVANIRQEIIDTTGNGQ--------  364

Query  753   KAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGRM  574
               E L  LVYL  AL E++RLYPPV F  KSP+++D+LPSGHKV  +++++  LYA+GRM
Sbjct  365   --ENLDKLVYLQGALFEAMRLYPPVSFGRKSPVKSDVLPSGHKVDANSKIIICLYALGRM  422

Query  573   QFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAII  394
             + +WGKDA +FKPERWI  E G +KHEPS KFLAFN GPRTCLGK +A TQMK V   I+
Sbjct  423   RAVWGKDAFKFKPERWIT-ENGGLKHEPSSKFLAFNTGPRTCLGKHLAITQMKMVVVEIL  481

Query  393   HNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRRWT  286
               Y V  +K     P +  +L MKHGL+V+V +R +
Sbjct  482   QKYDVEVIKGQKIEPVLGFMLSMKHGLRVKVAKRCS  517



>gb|KCW62188.1| hypothetical protein EUGRSUZ_H04845 [Eucalyptus grandis]
Length=415

 Score =   465 bits (1196),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 231/427 (54%), Positives = 307/427 (72%), Gaps = 16/427 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIIL---RDGYRRPLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I + EIF+A  C V+  +L    DG   P   PL GMLP+L L++  +HD    +L 
Sbjct  1     MAWIGFLEIFLAVICFVVLCLLGKSDDGL--PNNWPLVGMLPALCLNLSHVHDWATGILE  58

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                  FL +  WF+ +D+L+T DPANVHYIMS NFENFP G EFK++FDVLGDGIFNSD 
Sbjct  59    RSRCNFLFRFHWFSGMDMLVTADPANVHYIMSTNFENFPNGPEFKRVFDVLGDGIFNSDS  118

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             D+W+ QR++A+  +  QRFHR+L +T+ +KVE GL+ VL+    +RG  VDLQD+FQRFT
Sbjct  119   DMWRMQRRVAQVFMNDQRFHRFLAKTTRDKVENGLLRVLD-ELSQRGVAVDLQDLFQRFT  177

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD+ C  +TG+DPG LSV+FP+VPFS+A+DDAEEV+F RHL P     LQ+WLG+G E+K
Sbjct  178   FDSACRFITGFDPGSLSVEFPEVPFSRALDDAEEVIFYRHLYPAWFGTLQRWLGLGVEEK  237

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             L RA E++DQ++G+YI MK+ EL      +       DE+G DLLTSY+  N  ET   L
Sbjct  238   LRRAWEVMDQIVGRYIEMKKAEL-----REGTSKVKGDEDGADLLTSYMVEN--ETLGAL  290

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKF  763
             + +DKFLRDTILNLMIAG+DTTS  LTWF W +ST+P VE  IR+E+ + +   E+ +  
Sbjct  291   ECNDKFLRDTILNLMIAGKDTTSLELTWFFWALSTNPSVEMKIREEIKSVIL--EEEQNL  348

Query  762   RLFK-AEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYA  586
             ++FK  E + N+VYLH ALCESLRLYPP+PF+HK P++ D+LPSGHKV+P T+++  LYA
Sbjct  349   KVFKIGEHVHNMVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPSTKILILLYA  408

Query  585   MGRMQFI  565
             MGRM+ +
Sbjct  409   MGRMKSV  415



>ref|XP_010555325.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=516

 Score =   468 bits (1205),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 241/521 (46%), Positives = 336/521 (64%), Gaps = 15/521 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRR---PLKVPLFGMLPSLFLHVRKIHDRCAAVLS  1663
             MA I   EI +AF C +I+  L +       P   P  GMLP L   V +I+D  A +L 
Sbjct  1     MAFIGLPEISIAFICFLIFHFLTNKKPHESFPRNWPFLGMLPGLIAAVPRIYDWNAELLE  60

Query  1662  LHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDL  1483
                 TF+ KG WF  +D+L+T DP N+ +IMS NF N+PKG EFK++FD LGDGIFN D 
Sbjct  61    YSNMTFISKGIWFAGMDVLVTADPDNIRHIMSSNFRNYPKGPEFKEMFDALGDGIFNVDS  120

Query  1482  DLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFT  1303
             +LW++ RK  +A++ HQ F R+  RTS ++++KGL+P L+ AA  +  VVD+QDV +R++
Sbjct  121   ELWEDLRKSFQAVLHHQGFQRFTFRTSMDRIKKGLVPFLDHAARAK-MVVDIQDVLERYS  179

Query  1302  FDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKK  1123
             FD      TGYDPG LS++ P+V F +A DD EE +  RH  P  LWKLQ WLG+G EKK
Sbjct  180   FDAMLISCTGYDPGTLSIEMPEVEFYRAFDDFEEAIIYRHFKPRILWKLQNWLGLGIEKK  239

Query  1122  LSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGL  943
             ++RA    D++  ++I+ KR+E++ + ++ +       E   D+LT ++N +  +  +  
Sbjct  240   MTRARATFDRICAEHISAKRKEMVSSGQHHS----FGPETCADVLTCFMNMDRTKYKLLN  295

Query  942   KFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDE----LLTAVNSGED  775
               DD+FLRDT+L  M AGR  T S +  F+W +S HP V   IR E    L     SG+D
Sbjct  296   PNDDEFLRDTMLTFMTAGRG-TGSIIARFLWFLSKHPRVLTKIRQEMKEKLPPRTRSGDD  354

Query  774   PKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFS  595
                   F   ELK LVYLHAAL ESLRLYPPVPF+ KSP++ D+LPSGH+V+ +++++F 
Sbjct  355   DDGLP-FDPMELKKLVYLHAALSESLRLYPPVPFERKSPVEPDVLPSGHRVAANSKIVFP  413

Query  594   LYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMK  415
             +YA+GRM+ +WG+DA EFKPERWI+ E G +K EP  KF  FNAGPRTCLGK++A+TQ K
Sbjct  414   IYALGRMKRVWGEDALEFKPERWIS-ETGRLKQEPPSKFFVFNAGPRTCLGKDMAYTQFK  472

Query  414   AVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
              +   I+ NY +  V+   A   +S +L +K GLKV V +R
Sbjct  473   TLLVEILQNYDIHVVEGQRADCIISTVLRVKDGLKVTVTKR  513



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   468 bits (1204),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 243/488 (50%), Positives = 325/488 (67%), Gaps = 12/488 (2%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             P   P+ GMLP L  ++ ++H++   VL    GTF   GP F N ++L T DP N+HYI+
Sbjct  22    PTNWPIVGMLPELIRNLHRVHEKTTEVLIESNGTFEFHGPVFANFNMLGTSDPENIHYIL  81

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             S NF N+PKG EF+K FD+ G+GIF+ D +LW+  RK    L+ H +FH  L R  W  +
Sbjct  82    SKNFSNYPKGVEFRKYFDIFGNGIFSVDYELWEIHRKTTMYLMGHAKFHTLLERNIWEII  141

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             E GL P+L+  A E   + DLQD+F RFTFD  C L+  +DP  LS+  P VP  KA +D
Sbjct  142   ENGLRPILDDFA-ELDTLFDLQDIFHRFTFDVICKLLLDHDPKSLSIGLPHVPCEKAFND  200

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
               + L  R++LPE  WKLQ+WL IG EKKL +A E  DQ +   I+ K++EL+  +K+  
Sbjct  201   TVDALLYRYILPECCWKLQKWLRIGREKKLIQAWEAFDQFLYPCISRKQEELM--HKSTM  258

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
              D +      F  L ++I   D      L     FLRDT L+LM+ GRDTTS+ALTWF  
Sbjct  259   KDEE------FSFLNAFIKMYDQWKDGDLGTLQTFLRDTFLSLMLGGRDTTSAALTWFFA  312

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L++ +P VEK IR+E+   ++  ED +    F  +E + LVYLHAA CE+LRL+P V  +
Sbjct  313   LMAKNPLVEKKIREEIQQQLHLKED-ENLNFFNIQETRKLVYLHAAFCETLRLFPSVAIE  371

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK PL+ DILPSGH+VSP+TR+M S Y MGRM+ +WGKD  EFKPERWI+ +RG +KHEP
Sbjct  372   HKLPLEFDILPSGHRVSPNTRVMLSFYTMGRMESLWGKDCLEFKPERWIS-KRGEIKHEP  430

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             S+KF AFNAGPR C+GKE+AFTQMK VAA IIHNYH++ V++   SP+ S+I+ +KHGLK
Sbjct  431   SFKFTAFNAGPRACIGKEMAFTQMKIVAATIIHNYHIQ-VEDQIISPSSSVIIQVKHGLK  489

Query  309   VRVQRRWT  286
             VR+ +R T
Sbjct  490   VRLIKRVT  497



>ref|XP_006604019.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Glycine max]
Length=530

 Score =   469 bits (1207),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 238/515 (46%), Positives = 335/515 (65%), Gaps = 14/515 (3%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRRPL-KVPLFGMLPSLFLHVRKIHDRCAAVLSLH  1657
             MA +   E   AF   V+    R     P+ K P+ GMLP +FL++  I D   +VL   
Sbjct  1     MAVLSSGEFLGAFLVFVVIHYWRLNRHTPIAKWPILGMLPGVFLNMPTIFDYITSVLKRE  60

Query  1656  GGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNSDLDL  1477
             GGTF+ +GP  +N++I+ T DP NV +I S  F+N+ KG +F++IF++LGDGIF SD  L
Sbjct  61    GGTFMFEGPCLSNMNIMFTSDPMNVQHITSTKFQNYGKGNDFREIFEILGDGIFRSDSQL  120

Query  1476  WKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQRFTFD  1297
             W   R +  ++     F  ++ +T  NK+E  L+P L+    E G  VDLQDVFQR TFD
Sbjct  121   WNYNRTILHSVFRKASFQLFVHQTIMNKIESCLLPFLDRGWKE-GMEVDLQDVFQRLTFD  179

Query  1296  TTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPEKKLS  1117
               C++V G+DP CLS++FP+V   KA  +AE+ L  RH  P+ LWKL +WL +G EKKL 
Sbjct  180   NICSIVLGFDPNCLSMEFPEVACEKAFTEAEDALLYRHFRPKCLWKLMKWLHVGKEKKLE  239

Query  1116  RACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTMGLKF  937
              + +I+DQ++   I   R +  +  ++ N    + DE+ F LL   IN    E   G K 
Sbjct  240   ESQKIVDQMLYTEI---RSKCKVQGESNNSSTPV-DESQFSLLNVLIN----EVGKG-KA  290

Query  936   DDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPKKFRL  757
             DD FLRDT +NL+ AGRDT SS L+WF WLV+THP VE  I +E+   + + E    ++ 
Sbjct  291   DDNFLRDTAINLLAAGRDTISSGLSWFFWLVATHPSVESKILEEIRKNLPAREG--NWKN  348

Query  756   FKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLYAMGR  577
                E +  L YLHAA+ E+LRLYPP+P +HK  L++D+LPSGH ++ +T +++SLY MGR
Sbjct  349   LGVESISRLTYLHAAISEALRLYPPIPIEHKCALKSDMLPSGHWINSNTMILYSLYTMGR  408

Query  576   MQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAI  397
              + IWG+D  +F PERWI+ ++G + H PSYKF+AFNAGPR+CLGK++++T+MK VA +I
Sbjct  409   AEEIWGEDCLKFIPERWIS-KQGGIIHIPSYKFIAFNAGPRSCLGKDISYTEMKMVAVSI  467

Query  396   IHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             + NYHV  V+ H  SP VSI+L+MKHGLKVRV +R
Sbjct  468   LSNYHVHLVEGHTISPGVSIVLHMKHGLKVRVTKR  502



>ref|NP_195660.1| cytochrome P450, family 96, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
 emb|CAB44685.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80613.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87079.1| cytochrome P450, family 96, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
Length=469

 Score =   466 bits (1200),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 226/478 (47%), Positives = 322/478 (67%), Gaps = 12/478 (3%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP L + + +I+D    +L +   TF  KGPWF  +D L+TVDPAN+H++M+ NF N+ 
Sbjct  1     MLPCLLVVLHRIYDYIVEILEISDLTFSFKGPWFAGMDTLLTVDPANIHHMMNSNFSNYI  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG +FK++FDV GDGI  +D +LWKN RK  + ++ HQ F  + + T+ +K++ GL+P+L
Sbjct  61    KGSDFKEVFDVFGDGIITTDSELWKNLRKSYQEMLHHQAFQSFSLSTTRSKLKDGLVPLL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
                A E G  VDLQDV  RFTFDT   L+TG DP  LS++  +   +KA+D   E +F R
Sbjct  121   NHFA-EEGTTVDLQDVLGRFTFDTILILITGSDPRSLSIEMHEDELAKALDVVGEGIFFR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H+ P+ LWKLQ W+G G EKK+  A    D+V  KYI+ KR E+I + +     +DI+  
Sbjct  180   HVKPKFLWKLQNWMGFGHEKKMIEANATFDRVCAKYISDKRGEIIRSQRF----SDISYG  235

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
                DLL+S++  +  +  +    DDKFLRDTIL  ++AGRDTT+SALTWF WL+S + +V
Sbjct  236   EPEDLLSSFMKLDTTKYNLLNPSDDKFLRDTILAFILAGRDTTASALTWFFWLLSENAQV  295

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
                IR E++    S     +      E L  LVYLH ALCE++RLYPPV F  KSP+++D
Sbjct  296   VSKIRQEIINTNPSKNGNGQ------ENLDKLVYLHGALCEAMRLYPPVSFGRKSPIKSD  349

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV  +++++  LYA+GRM+ +WG DA EFKPERW++ ++G+++HEPS+KFL+FN
Sbjct  350   VLPSGHKVQANSKIIICLYALGRMRAVWGDDALEFKPERWVS-DKGSLRHEPSFKFLSFN  408

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +GPRTCLGK +A TQMK VA  I+HNY ++ +K     P +  IL MKHGL++ + +R
Sbjct  409   SGPRTCLGKHLAMTQMKMVAVEILHNYEIKVIKGQKIKPVLGFILSMKHGLRITITKR  466



>emb|CDX72693.1| BnaC07g47150D [Brassica napus]
Length=466

 Score =   466 bits (1199),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 232/478 (49%), Positives = 314/478 (66%), Gaps = 17/478 (4%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP + + + +I+D    VL     TF  KGPWF+ +DIL+TV PAN+HYI+S NF N+ 
Sbjct  1     MLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFSGMDILVTVVPANIHYILSSNFSNYI  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EF++IF+  GDGI NSD +LW+N RK ++ +  HQ F +   R+   K++ GL+P+L
Sbjct  61    KGPEFQEIFEAYGDGIINSDSELWRNLRKSSQVIFSHQNFSKSTTRS---KLKDGLLPLL  117

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
                A E   VVDLQDVFQRF FDTT   +TG DP  LS++ P+V F+KA+DD  E +  R
Sbjct  118   SHFADEEM-VVDLQDVFQRFMFDTTFIFITGSDPRSLSIEMPEVEFAKALDDVGEAIVYR  176

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H+ P  LWKLQ+W+GIG EKK+ +A  +LD+V  KYI+ KR+E I + +N        DE
Sbjct  177   HITPRFLWKLQKWIGIGTEKKMMKANAVLDRVCAKYISAKREE-IRSQENA-------DE  228

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
                DLLTS+I  +  +  +    DDKFLRD  +  M AGRD+T+  LTWF W++S +P  
Sbjct  229   ESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFMAAGRDSTACTLTWFFWILSENP--  286

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
               N+  ++L  +N      +    K+  L  LVYLHAAL ES+RLYPP+PF+ KSP++ D
Sbjct  287   --NVLSKILQEINENAPKTRSDQDKSSYLNKLVYLHAALSESMRLYPPIPFERKSPIKPD  344

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV  +  +M  LYAMGRM+ +WG+DA+EFKPERWI+ E G ++HEPSYKFL+FN
Sbjct  345   VLPSGHKVKSNINIMIFLYAMGRMKDVWGEDAREFKPERWIS-ETGGLRHEPSYKFLSFN  403

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AGPRTCLGK +A   MK V   I+  Y +  V          +IL+MKHGLKV   ++
Sbjct  404   AGPRTCLGKNLAMDLMKTVIVEILQAYEINVVSGQKIEAKPGLILHMKHGLKVTTAKK  461



>ref|NP_001048917.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|ABF93893.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10831.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|EAZ25523.1| hypothetical protein OsJ_09347 [Oryza sativa Japonica Group]
Length=508

 Score =   467 bits (1202),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 327/486 (67%), Gaps = 17/486 (3%)
 Frame = -2

Query  1749  PLKVPLFGMLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIM  1570
             PL+ PL GMLP+L  +   +H+   +VL++    F   GP  +++ + IT DPAN+ ++ 
Sbjct  36    PLQWPLVGMLPALLANCNHLHEWITSVLTVTPLNFRFIGPPSSDMRLFITSDPANIRHVF  95

Query  1569  SGNFENFPKGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKV  1390
             + NF N+PKG+EF++IFD+LGDGIF++D + W+ QR  A+ L+   RF  ++ R S +KV
Sbjct  96    NTNFSNYPKGREFQEIFDILGDGIFSADGESWRRQRTKAQLLMSSPRFRAFVARYSRDKV  155

Query  1389  EKGLIPVLEFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDD  1210
             EK L+P+L   AG  G   +LQDVF R TFDTT TLV G DPG +++D P+VPF++AMDD
Sbjct  156   EKALLPLLAHVAGT-GDACNLQDVFLRLTFDTTTTLVFGVDPGSVAIDLPEVPFARAMDD  214

Query  1209  AEEVLFIRHLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQN  1030
             A  +L +RH++P S W+L + LGIG E+K+  A   +D+ +   I  +R E   T     
Sbjct  215   AMTMLLLRHIVPLSWWRLARRLGIGYERKMPVAWRTMDRFVADTIAKRRAEKART-----  269

Query  1029  PDNDINDENGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIW  850
                 I+D    DLL+SYIN+++ +        D FLRDT +NLM+AGRDTT SAL+WF +
Sbjct  270   ---GIDDSA--DLLSSYINDDEEDAGTV----DAFLRDTTINLMLAGRDTTGSALSWFFY  320

Query  849   LVSTHPEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQ  670
             L++ +P V   +  E L +V S        +F  +E   LVYLHAALCESLRLYPPVP +
Sbjct  321   LLTKNPRVLHKLLQE-LDSVKSTTAADGMVIFDPDETGRLVYLHAALCESLRLYPPVPME  379

Query  669   HKSPLQTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEP  490
             HK P   D+LPSGH+V P  +++ SLYAMGRM+ +WG D  EF+PERWI+ + G +++ P
Sbjct  380   HKGPAAADVLPSGHEVRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWIS-DDGKLRYVP  438

Query  489   SYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLK  310
             SYKF++FN+GPRTCLGK++AF Q+K  AAA++ N+ + AV  H   P +SIIL+MK+G  
Sbjct  439   SYKFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNFEIEAVAGHVVEPKLSIILHMKNGFM  498

Query  309   VRVQRR  292
             VRV+RR
Sbjct  499   VRVKRR  504



>emb|CDP04331.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   466 bits (1198),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/478 (48%), Positives = 314/478 (66%), Gaps = 11/478 (2%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             M+P LFL+V +  D    +L   GGTF  KGPWF N+D+L+T DPANV++I+S +F NF 
Sbjct  1     MMPDLFLNVHRAQDYITEILQESGGTFEFKGPWFANMDMLVTSDPANVNHILSKSFSNFQ  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EF+K+FD+LG GIFN++ + W++ RK    LI HQ F +++  TSWNK+EKGLIPVL
Sbjct  61    KGPEFEKMFDILGKGIFNAECESWESPRKTIMPLINHQGFQKFVGITSWNKLEKGLIPVL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             E AA + G  VDLQ +F +FTFDTTC LV G+DP    +D P+ P   A  DAEE +F R
Sbjct  121   ELAA-KSGMEVDLQQLFAKFTFDTTCILVLGHDPASPGIDLPESPLGNAFADAEEAVFYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H++P + WK+Q+WL IG EKKL++A E L Q +   I+ K + L    +  N      D 
Sbjct  180   HVVPRTCWKIQRWLQIGAEKKLTKARENLHQFLATNISSKSENL----EGINQTAISQDG  235

Query  1005  NGFDLLTSYINNN---DGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTH  835
              G DLL  Y+        E         K  RD +LNL+ AG+D   + LTWF WL++++
Sbjct  236   GGLDLLARYMKAVGVLKEENRTSDIVSQKIWRDALLNLIFAGKDIKGAGLTWFFWLLASN  295

Query  834   PEVEKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPL  655
             P  E  +R E+L+ +   E   +++    EE+K  VYL  ALCESLRL+PPV  QHK+P+
Sbjct  296   PIEESMVRKEILSNLQVKEG--RWQFSNLEEMKKQVYLRGALCESLRLFPPVATQHKAPV  353

Query  654   QTDILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFL  475
               DILPSGH ++P+T+ +   +AMGRM+ IWGK   EFKP+RWI+ E+  + HEPS+KF 
Sbjct  354   NPDILPSGHSINPNTKTLLPFHAMGRMETIWGKVCWEFKPQRWIS-EQVGITHEPSFKFT  412

Query  474   AFNAGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRV  301
             AFNAGPR+C GKE+ F QMK VA A++  +H   ++ H   P+ S+IL+M+HGLK++V
Sbjct  413   AFNAGPRSCKGKEICFIQMKIVAVALLCRFHFHILEGHQTVPDNSVILHMRHGLKLKV  470



>ref|XP_006649380.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=507

 Score =   467 bits (1201),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 233/519 (45%), Positives = 338/519 (65%), Gaps = 21/519 (4%)
 Frame = -2

Query  1833  MASIDYFEIFVAFFCLVIWIILRDGYRR-----PLKVPLFGMLPSLFLHVRKIHDRCAAV  1669
             M+S  + E+ ++F C   +       ++     PL+ PL GMLP+L  +   +H+   ++
Sbjct  1     MSSFSFLELLLSFVCFGFFYYYHAKSKQKNPVIPLQWPLVGMLPALLANCNHLHEWITSL  60

Query  1668  LSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFPKGKEFKKIFDVLGDGIFNS  1489
             L+     F   GP  +++ + +T DPAN+ ++ + NF N+PKG+EF++IFDVLGDGIF++
Sbjct  61    LTASPLNFRFIGPPRSDMRLFVTSDPANIRHVFNTNFSNYPKGREFQEIFDVLGDGIFSA  120

Query  1488  DLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVLEFAAGERGGVVDLQDVFQR  1309
             D + W+ QR  A+ L+   RF  ++ R S  KVE+ L+P+L   AG  G   +LQDVF R
Sbjct  121   DGESWRRQRTKAQLLMSSPRFREFVSRYSRAKVERALLPLLAHFAGT-GEACNLQDVFLR  179

Query  1308  FTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIRHLLPESLWKLQQWLGIGPE  1129
              TFDTT TLV G DPG ++V  P+VPF++AMDDA  VL +RH++P S WKL + LGIG E
Sbjct  180   LTFDTTTTLVFGVDPGSVAVGLPEVPFARAMDDAMSVLLLRHIIPLSWWKLARRLGIGYE  239

Query  1128  KKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDENGFDLLTSYINNNDGETTM  949
             +K+  A   +D+ +   I  +R E   T  + + D          LL+SYI+++D +   
Sbjct  240   RKMPVAWRTMDRFVADTIAKRRAEKAKTGIDASAD----------LLSSYIDDDDEDAGT  289

Query  948   GLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEVEKNIRDELLTAVNSGEDPK  769
                  D FLRDT +NLM+AGRDTT SAL+WF +L++ +P V + +  EL  ++ S   P 
Sbjct  290   V----DAFLRDTTVNLMLAGRDTTGSALSWFFYLLTKNPLVLRKLLQEL-DSIKSSTTPD  344

Query  768   KFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTDILPSGHKVSPDTRLMFSLY  589
                +F  +E+  LVYLHAALC+SLRLYPPVP +HK P+  D+LPSG +V P  +++ SLY
Sbjct  345   GMVVFDPDEVGRLVYLHAALCDSLRLYPPVPMEHKGPVAADVLPSGDEVLPGDKIVVSLY  404

Query  588   AMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAV  409
             AMGRM+ +WG D  EFKPERWI+ +   +++ PSYKF++FN+GPRTCLGK++AF Q+K  
Sbjct  405   AMGRMESVWGSDCSEFKPERWISDDGKKLRYVPSYKFMSFNSGPRTCLGKDMAFVQLKTA  464

Query  408   AAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             AAA++ N+ V AV  H   P +SIIL+MK+G  VRV+RR
Sbjct  465   AAAVMKNFEVEAVPGHVVEPKLSIILHMKNGFMVRVKRR  503



>gb|KFK33109.1| hypothetical protein AALP_AA6G332200 [Arabis alpina]
Length=471

 Score =   466 bits (1198),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 228/478 (48%), Positives = 320/478 (67%), Gaps = 11/478 (2%)
 Frame = -2

Query  1725  MLPSLFLHVRKIHDRCAAVLSLHGGTFLLKGPWFTNLDILITVDPANVHYIMSGNFENFP  1546
             MLP + +   +I+D  A  L +   TF LKGPWF  +++LIT DPAN+ ++ + NF  + 
Sbjct  1     MLPGVLVVFHRINDYIAEALEVSNLTFALKGPWFFGMNMLITSDPANIQHVYNSNFSGYD  60

Query  1545  KGKEFKKIFDVLGDGIFNSDLDLWKNQRKLARALIIHQRFHRYLVRTSWNKVEKGLIPVL  1366
             KG EFK+IF+ LGDGIF++D  LW+  R  A  +I HQ F  + +RT  +K++ GL+PVL
Sbjct  61    KGPEFKEIFNYLGDGIFSADSKLWEELRHSALVMISHQGFQSFSLRTFVSKIKYGLVPVL  120

Query  1365  EFAAGERGGVVDLQDVFQRFTFDTTCTLVTGYDPGCLSVDFPDVPFSKAMDDAEEVLFIR  1186
             +   GE   V DLQ VFQR  FD T TLVTGYD   LS++ P+  ++KAMDDA EV+  R
Sbjct  121   DH-FGETNKVFDLQGVFQRLAFDVTLTLVTGYDSNSLSIEMPENDYAKAMDDANEVIVYR  179

Query  1185  HLLPESLWKLQQWLGIGPEKKLSRACEILDQVIGKYITMKRQELILTYKNQNPDNDINDE  1006
             H+ P  LWKLQ W+G+G EKK+ +A    +++  KYI+ KR E+I + ++ N   + +DE
Sbjct  180   HVKPMILWKLQNWIGVGVEKKMIKANATFNRLCAKYISSKR-EVIQSCQHSNIGEEAHDE  238

Query  1005  NGFDLLTSYINNNDGETTMGLKFDDKFLRDTILNLMIAGRDTTSSALTWFIWLVSTHPEV  826
                D+L+ Y+  +  +  +    DDKFL+DTI   MIAGRD  ++ LTWF WL+S +P+V
Sbjct  239   ---DILSFYMKLDTSKYELMNPKDDKFLKDTIKTFMIAGRDALATTLTWFFWLLSKNPKV  295

Query  825   EKNIRDELLTAVNSGEDPKKFRLFKAEELKNLVYLHAALCESLRLYPPVPFQHKSPLQTD  646
                IR E+ T +     P+  +    + L  +VYLH ALCESLRLY PVPF+ KSP++ D
Sbjct  296   VTKIRQEINTIL-----PRSNKSLDPDMLNKMVYLHGALCESLRLYAPVPFERKSPIKKD  350

Query  645   ILPSGHKVSPDTRLMFSLYAMGRMQFIWGKDAKEFKPERWINWERGAVKHEPSYKFLAFN  466
             +LPSGHKV  + +++F+ YA+GRM+ +WG+DA EFKPERWI  E G +KHEPS+KF  FN
Sbjct  351   VLPSGHKVDANWKILFAAYALGRMRAVWGEDASEFKPERWIT-ENGGLKHEPSFKFFVFN  409

Query  465   AGPRTCLGKEVAFTQMKAVAAAIIHNYHVRAVKNHDASPNVSIILYMKHGLKVRVQRR  292
             +GPR CLGK+++F QMK +A  II NY ++ V+ H      S++L+MKHGLKV V +R
Sbjct  410   SGPRNCLGKKLSFLQMKTIAIEIIQNYDIKVVEGHKIEQTPSMVLHMKHGLKVTVAKR  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6326231589360