BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78365_g1_i1 len=1160 path=[1:0-1159]

Length=1160
                                                                      Score     E

ref|XP_011092282.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    407   9e-138   
ref|XP_002526428.1|  conserved hypothetical protein                     395   2e-133   Ricinus communis
gb|AHK60924.1|  glucuronoxylan methyltransferase 1                      394   1e-132   
ref|XP_006385062.1|  hypothetical protein POPTR_0004s23540g             396   1e-132   
ref|XP_006389489.1|  hypothetical protein POPTR_0022s00320g             392   4e-132   
ref|XP_007226453.1|  hypothetical protein PRUPE_ppa024506mg             390   8e-132   
ref|XP_009110815.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    391   9e-132   
ref|XP_006470960.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    392   9e-132   
ref|XP_006303671.1|  hypothetical protein CARUB_v10011736mg             391   1e-131   
gb|AHK60925.1|  glucuronoxylan methyltransferase 2                      391   1e-131   
ref|XP_009353798.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    391   1e-131   
emb|CDO97633.1|  unnamed protein product                                391   1e-131   
ref|NP_172432.1|  uncharacterized protein                               391   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028374.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    392   4e-131   
ref|XP_004230438.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    389   4e-131   
emb|CDY20685.1|  BnaC08g13730D                                          389   7e-131   
ref|XP_011047866.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    389   1e-130   
gb|KDO42443.1|  hypothetical protein CISIN_1g043166mg                   389   1e-130   
ref|XP_008339417.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    390   2e-130   
ref|XP_008218691.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    389   2e-130   
ref|XP_009774625.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    388   2e-130   
ref|XP_009611196.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    391   3e-130   
ref|XP_006431520.1|  hypothetical protein CICLE_v10002026mg             387   4e-130   
ref|XP_007041172.1|  S-adenosyl-L-methionine-dependent methyltran...    392   6e-130   
ref|XP_009355344.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    386   1e-129   
emb|CDY31075.1|  BnaA08g26250D                                          385   2e-129   
ref|XP_010475802.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    385   3e-129   
emb|CAN78768.1|  hypothetical protein VITISV_006251                     382   5e-129   Vitis vinifera
ref|XP_008365324.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    384   9e-129   
ref|XP_002889761.1|  hypothetical protein ARALYDRAFT_888205             383   2e-128   
ref|XP_010544116.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    383   2e-128   
ref|XP_010458256.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    383   2e-128   
ref|XP_006349307.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    380   1e-127   
ref|XP_002266046.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    380   3e-127   Vitis vinifera
ref|XP_006417555.1|  hypothetical protein EUTSA_v10009538mg             380   4e-127   
ref|XP_003547881.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    379   5e-127   
ref|XP_009611193.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    379   5e-127   
gb|ACU23359.1|  unknown                                                 377   4e-126   Glycine max [soybeans]
ref|XP_010490173.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    374   6e-125   
ref|XP_010490169.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    374   7e-125   
ref|XP_010030205.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    374   7e-125   
gb|AAC33218.1|  Similar to cdc2 protein kinases                         395   1e-124   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33284.1|  hypothetical protein MIMGU_mgv1a010969mg                372   4e-124   
ref|XP_007148579.1|  hypothetical protein PHAVU_006G220400g             372   7e-124   
ref|XP_010676715.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    370   1e-123   
ref|XP_009774624.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    370   2e-123   
gb|KFK43257.1|  hypothetical protein AALP_AA1G100400                    390   5e-123   
ref|XP_010099766.1|  hypothetical protein L484_010953                   369   1e-122   
ref|XP_004152531.1|  PREDICTED: uncharacterized protein LOC101217402    366   6e-122   
ref|XP_008437427.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    366   8e-122   
ref|XP_010657964.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    367   6e-121   
emb|CDY50891.1|  BnaCnng19830D                                          383   2e-120   
ref|XP_004300005.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    362   6e-120   
ref|XP_010261020.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    358   8e-119   
ref|XP_007019817.1|  UvrABC system protein C isoform 1                  358   1e-118   
emb|CAN66688.1|  hypothetical protein VITISV_037863                     358   2e-118   Vitis vinifera
ref|XP_011005441.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    356   1e-117   
ref|XP_002526403.1|  conserved hypothetical protein                     355   2e-117   Ricinus communis
ref|XP_006376148.1|  hypothetical protein POPTR_0013s10240g             353   1e-116   
ref|XP_007019818.1|  UvrABC system protein C isoform 2                  353   3e-116   
ref|XP_008441152.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    350   2e-115   
ref|XP_011031554.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    350   3e-115   
ref|XP_002325525.2|  hypothetical protein POPTR_0019s10490g             350   3e-115   Populus trichocarpa [western balsam poplar]
emb|CDP00853.1|  unnamed protein product                                346   1e-113   
ref|XP_004138670.1|  PREDICTED: uncharacterized protein LOC101202991    345   1e-113   
ref|XP_004158529.1|  PREDICTED: uncharacterized LOC101202991            345   1e-113   
ref|XP_009357185.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    345   3e-113   
ref|XP_010062382.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    345   4e-113   
ref|XP_006478265.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    343   1e-112   
ref|XP_008368121.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    343   2e-112   
ref|XP_008219085.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    343   2e-112   
ref|XP_002279765.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    342   3e-112   Vitis vinifera
ref|XP_004250648.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    342   3e-112   
gb|EYU22748.1|  hypothetical protein MIMGU_mgv1a011269mg                340   8e-112   
ref|XP_010912696.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    340   2e-111   
ref|XP_010930428.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    339   3e-111   
ref|XP_010100099.1|  hypothetical protein L484_014289                   340   3e-111   
ref|XP_007223179.1|  hypothetical protein PRUPE_ppa009168mg             339   4e-111   
ref|XP_006339353.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    339   5e-111   
ref|NP_192737.1|  uncharacterized protein                               338   8e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48797.1|  BnaA05g20730D                                          337   2e-110   
ref|XP_006441614.1|  hypothetical protein CICLE_v10021249mg             338   2e-110   
ref|XP_009145172.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    337   2e-110   
ref|XP_008786409.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    336   3e-110   
ref|XP_011095869.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    337   4e-110   
ref|XP_008378726.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    336   5e-110   
ref|XP_009773426.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    336   6e-110   
ref|XP_010667408.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    335   7e-110   
gb|KFK45099.1|  hypothetical protein AALP_AA1G343500                    336   9e-110   
ref|XP_002891062.1|  predicted protein                                  335   1e-109   
ref|XP_009588800.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    334   4e-109   
ref|XP_003598051.1|  hypothetical protein MTR_3g005710                  334   4e-109   
ref|XP_010252121.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    335   4e-109   
ref|XP_006415059.1|  hypothetical protein EUTSA_v10008341mg             334   4e-109   
ref|XP_006397117.1|  hypothetical protein EUTSA_v10028858mg             333   5e-109   
ref|NP_564428.1|  glucuronoxylan 4-O-methyltransferase                  334   5e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148617.1|  hypothetical protein PHAVU_005G001400g             334   5e-109   
emb|CDY15292.1|  BnaC06g07780D                                          333   7e-109   
ref|XP_009114783.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    333   7e-109   
ref|XP_002874599.1|  hypothetical protein ARALYDRAFT_489845             333   8e-109   
ref|XP_003523475.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    333   9e-109   
ref|XP_009379025.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    333   1e-108   
ref|XP_010542789.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    332   3e-108   
ref|XP_010461205.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    331   5e-108   
ref|XP_004499575.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    331   6e-108   
ref|XP_010437731.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    331   6e-108   
ref|XP_006288379.1|  hypothetical protein CARUB_v10001630mg             330   6e-108   
ref|XP_006305458.1|  hypothetical protein CARUB_v10009876mg             331   6e-108   
ref|XP_009417000.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    330   7e-108   
ref|XP_010499922.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    331   7e-108   
ref|XP_008778155.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    330   1e-107   
ref|XP_004299873.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    329   4e-107   
emb|CAN73177.1|  hypothetical protein VITISV_009984                     329   5e-107   Vitis vinifera
ref|XP_010927860.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    327   2e-106   
ref|XP_010646548.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    327   2e-106   
ref|XP_010539231.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    328   2e-106   
ref|XP_010421910.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    326   3e-106   
ref|XP_009415016.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    322   2e-104   
ref|XP_006302624.1|  hypothetical protein CARUB_v10020731mg             321   4e-104   
ref|XP_010427991.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    318   5e-103   
ref|XP_010471166.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    318   6e-103   
gb|AAF43218.1|AC012654_2  EST gb|AI999169 comes from this gene          317   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397116.1|  hypothetical protein EUTSA_v10028858mg             317   2e-102   
ref|NP_565020.1|  uncharacterized protein                               317   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420161.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    315   4e-102   
gb|KFK41585.1|  hypothetical protein AALP_AA2G148100                    313   5e-101   
ref|XP_010421911.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    309   2e-99    
ref|XP_002887380.1|  hypothetical protein ARALYDRAFT_316133             308   3e-99    
ref|XP_006836793.1|  hypothetical protein AMTR_s00099p00012720          309   4e-99    
gb|KCW57152.1|  hypothetical protein EUGRSUZ_I02785                     306   5e-99    
ref|XP_006390759.1|  hypothetical protein EUTSA_v10018938mg             307   9e-99    
emb|CDP00854.1|  unnamed protein product                                306   2e-98    
ref|XP_009405263.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    300   2e-96    
emb|CDX72815.1|  BnaC06g32630D                                          300   6e-96    
ref|XP_010415866.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    298   3e-95    
ref|XP_009105824.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    298   3e-95    
dbj|BAJ88693.1|  predicted protein                                      298   4e-95    
emb|CDX96332.1|  BnaA07g29430D                                          298   5e-95    
gb|ACE97109.1|  expressed protein                                       293   9e-95    Populus tremula [European aspen]
gb|ACE97121.1|  expressed protein                                       292   1e-94    Populus tremula [European aspen]
gb|ACE97115.1|  expressed protein                                       291   2e-94    Populus tremula [European aspen]
gb|ACE97116.1|  expressed protein                                       291   3e-94    Populus tremula [European aspen]
ref|XP_010480867.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    295   4e-94    
gb|ACE97107.1|  expressed protein                                       290   6e-94    Populus tremula [European aspen]
dbj|BAK02602.1|  predicted protein                                      295   7e-94    
gb|ACE97113.1|  expressed protein                                       290   1e-93    Populus tremula [European aspen]
gb|ACE97135.1|  expressed protein                                       288   3e-93    Populus tremula [European aspen]
gb|ACE97136.1|  expressed protein                                       288   3e-93    Populus tremula [European aspen]
gb|EPS67958.1|  hypothetical protein M569_06817                         291   2e-92    
gb|ACE97140.1|  expressed protein                                       286   2e-92    Populus tremula [European aspen]
ref|XP_004977142.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    291   3e-92    
ref|XP_002443019.1|  hypothetical protein SORBIDRAFT_08g006410          288   6e-91    Sorghum bicolor [broomcorn]
gb|EAY89414.1|  hypothetical protein OsI_10920                          285   4e-90    Oryza sativa Indica Group [Indian rice]
gb|EYU22746.1|  hypothetical protein MIMGU_mgv1a023936mg                283   7e-90    
ref|NP_001066378.1|  Os12g0204500                                       284   1e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009785261.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    282   5e-89    
ref|XP_003576967.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    282   9e-89    
gb|KDP45647.1|  hypothetical protein JCGZ_17254                         277   1e-88    
ref|XP_010322783.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    278   2e-87    
ref|XP_008662640.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    278   6e-87    
tpg|DAA55455.1|  TPA: plant-specific domain TIGR01627 family protein    276   2e-86    
ref|NP_001147380.1|  plant-specific domain TIGR01627 family protein     272   4e-85    Zea mays [maize]
ref|XP_006356560.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    276   1e-84    
ref|XP_008662641.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    268   2e-83    
gb|KFK32037.1|  hypothetical protein AALP_AA6G191900                    259   2e-81    
ref|XP_008662639.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    249   1e-75    
gb|EMS51769.1|  hypothetical protein TRIUR3_12679                       247   5e-75    
dbj|BAK07602.1|  predicted protein                                      244   9e-74    
gb|AAO22808.1|  unknown protein                                         235   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848337.1|  hypothetical protein AMTR_s00013p00174150          236   2e-71    
ref|XP_009629764.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    234   1e-70    
gb|EAZ27036.1|  hypothetical protein OsJ_10966                          231   3e-69    Oryza sativa Japonica Group [Japonica rice]
ref|NP_176901.1|  uncharacterized protein                               231   4e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDY28894.1|  BnaC06g26820D                                          228   6e-68    
ref|XP_010415308.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    227   1e-67    
ref|XP_010470638.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    227   1e-67    
ref|XP_010511661.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    227   1e-67    
ref|XP_009105125.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    227   2e-67    
ref|XP_004310084.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    225   6e-67    
ref|XP_006301418.1|  hypothetical protein CARUB_v10021834mg             225   9e-67    
ref|XP_002887113.1|  hypothetical protein ARALYDRAFT_475830             224   1e-66    
ref|XP_009127546.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    225   1e-66    
emb|CDY12639.1|  BnaA02g13070D                                          224   1e-66    
emb|CDY51186.1|  BnaC02g45640D                                          224   1e-66    
gb|KFK41138.1|  hypothetical protein AALP_AA2G090800                    224   2e-66    
ref|XP_006391291.1|  hypothetical protein EUTSA_v10018905mg             224   2e-66    
ref|XP_010530547.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    223   3e-66    
ref|XP_004310083.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    222   6e-66    
ref|XP_008801843.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    220   8e-66    
ref|XP_011086800.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    221   2e-65    
emb|CDP13345.1|  unnamed protein product                                219   1e-64    
ref|XP_002978695.1|  hypothetical protein SELMODRAFT_57632              216   1e-64    
ref|XP_002983636.1|  hypothetical protein SELMODRAFT_47473              217   2e-64    
ref|XP_002990576.1|  hypothetical protein SELMODRAFT_47472              216   3e-64    
ref|XP_011002126.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    218   4e-64    
ref|XP_002984622.1|  hypothetical protein SELMODRAFT_47575              214   1e-63    
ref|XP_010499283.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    216   1e-63    
ref|XP_010460560.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    216   1e-63    
ref|XP_011036083.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    216   2e-63    
ref|XP_010460559.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    216   2e-63    
ref|XP_006304065.1|  hypothetical protein CARUB_v10009914mg             215   3e-63    
ref|NP_564297.1|  uncharacterized protein                               215   4e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61740.1|  unknown                                                 215   5e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002297842.1|  hypothetical protein POPTR_0001s13850g             215   5e-63    Populus trichocarpa [western balsam poplar]
ref|XP_010549289.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    215   6e-63    
ref|XP_008446029.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    214   8e-63    
ref|XP_007044007.1|  Cell wall integrity and stress response comp...    214   8e-63    
ref|XP_002893494.1|  hypothetical protein ARALYDRAFT_890326             214   9e-63    
gb|KFK44666.1|  hypothetical protein AALP_AA1G288200                    214   9e-63    
ref|XP_009113726.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    214   1e-62    
ref|XP_010099365.1|  hypothetical protein L484_000866                   214   1e-62    
ref|XP_009102942.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    214   1e-62    
gb|KGN51667.1|  hypothetical protein Csa_5G589350                       213   2e-62    
ref|XP_006415716.1|  hypothetical protein EUTSA_v10010026mg             213   5e-62    
ref|XP_011071227.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    212   7e-62    
ref|XP_008361849.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    212   8e-62    
ref|XP_008389872.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    211   1e-61    
ref|XP_002304685.1|  hypothetical protein POPTR_0003s17080g             211   1e-61    Populus trichocarpa [western balsam poplar]
ref|XP_006484106.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    211   1e-61    
ref|XP_010905171.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    211   1e-61    
ref|XP_007223739.1|  hypothetical protein PRUPE_ppa010492mg             209   2e-61    
ref|XP_007158681.1|  hypothetical protein PHAVU_002G173400g             211   2e-61    
ref|XP_009775021.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    211   2e-61    
ref|XP_011020742.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    210   3e-61    
ref|XP_002514909.1|  conserved hypothetical protein                     210   3e-61    Ricinus communis
ref|XP_006438023.1|  hypothetical protein CICLE_v10032331mg             210   4e-61    
ref|XP_009394065.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    209   4e-61    
ref|XP_009372279.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    209   5e-61    
gb|KDP26809.1|  hypothetical protein JCGZ_17967                         209   7e-61    
ref|XP_008389874.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    209   9e-61    
ref|XP_002274054.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    209   1e-60    Vitis vinifera
emb|CDY37946.1|  BnaC02g20650D                                          208   1e-60    
gb|ABF72010.1|  hypothetical protein MA4_111B14.64                      208   1e-60    Musa acuminata [banana]
ref|XP_006352193.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    208   2e-60    
ref|XP_009620086.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    208   2e-60    
ref|XP_008353046.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    211   3e-60    
gb|AFK44106.1|  unknown                                                 207   5e-60    
ref|XP_008222167.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    207   6e-60    
ref|XP_003577659.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    207   8e-60    
ref|XP_009787024.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    206   8e-60    
gb|KEH20602.1|  polysaccharide biosynthesis protein                     207   9e-60    
ref|XP_006352194.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    204   1e-59    
ref|XP_003552780.2|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    207   2e-59    
ref|XP_009628062.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    204   2e-59    
ref|XP_004293059.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    205   2e-59    
ref|XP_003537534.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    205   2e-59    
ref|XP_006855212.1|  hypothetical protein AMTR_s00051p00191940          206   2e-59    
ref|XP_010028995.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    206   3e-59    
ref|XP_003531197.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    205   3e-59    
ref|XP_010249031.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    205   3e-59    
ref|XP_007163768.1|  hypothetical protein PHAVU_001G262300g             204   5e-59    
ref|XP_004502290.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    204   7e-59    
ref|XP_003601776.1|  hypothetical protein MTR_3g085270                  203   2e-58    
ref|XP_004504411.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    203   3e-58    
ref|XP_006580120.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    200   2e-57    
gb|KDP46273.1|  hypothetical protein JCGZ_10113                         201   2e-57    
ref|XP_010682759.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    200   2e-57    
ref|XP_002509508.1|  conserved hypothetical protein                     199   5e-57    Ricinus communis
ref|XP_002277620.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    198   1e-56    Vitis vinifera
ref|XP_009415897.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    197   3e-56    
emb|CBI27661.3|  unnamed protein product                                198   4e-56    
ref|XP_010682760.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    197   4e-56    
emb|CDP16775.1|  unnamed protein product                                197   6e-56    
gb|EPS63199.1|  hypothetical protein M569_11587                         191   7e-55    
gb|KDP24994.1|  hypothetical protein JCGZ_23977                         194   1e-54    
ref|XP_003548518.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    193   1e-54    
ref|XP_006359734.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    192   1e-54    
ref|XP_010263448.1|  PREDICTED: protein IRX15-LIKE-like                 191   1e-53    
ref|XP_004243057.2|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    188   1e-53    
ref|XP_010270730.1|  PREDICTED: protein IRX15-LIKE-like                 191   2e-53    
ref|XP_003553258.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    188   1e-52    
ref|XP_010932030.1|  PREDICTED: protein IRX15-LIKE-like                 189   1e-52    
ref|XP_010680469.1|  PREDICTED: uncharacterized protein LOC104895606    192   8e-52    
ref|XP_006346387.1|  PREDICTED: protein IRX15-like                      186   8e-52    
ref|XP_010682758.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    186   9e-52    
ref|XP_007161723.1|  hypothetical protein PHAVU_001G093100g             186   1e-51    
ref|XP_008776524.1|  PREDICTED: protein IRX15-LIKE-like                 186   1e-51    
ref|XP_004230754.1|  PREDICTED: protein IRX15-LIKE-like                 186   2e-51    
ref|XP_002285113.1|  PREDICTED: protein IRX15-LIKE-like                 185   2e-51    Vitis vinifera
ref|XP_010909183.1|  PREDICTED: protein IRX15-LIKE-like                 185   3e-51    
ref|XP_002313132.2|  hypothetical protein POPTR_0009s10160g             184   3e-51    
ref|XP_007042486.1|  Uncharacterized protein TCM_007104                 185   4e-51    
ref|XP_004513320.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    184   4e-51    
emb|CAN63149.1|  hypothetical protein VITISV_040802                     183   4e-51    
ref|NP_001058408.1|  Os06g0687600                                       185   5e-51    
ref|XP_009784046.1|  PREDICTED: protein IRX15-LIKE-like                 184   6e-51    
ref|XP_010065988.1|  PREDICTED: protein IRX15-LIKE-like                 184   6e-51    
ref|XP_011000888.1|  PREDICTED: protein IRX15-LIKE-like                 184   7e-51    
gb|EPS63094.1|  hypothetical protein M569_11690                         184   8e-51    
emb|CAN74915.1|  hypothetical protein VITISV_041669                     184   1e-50    
ref|XP_002518716.1|  conserved hypothetical protein                     183   2e-50    
ref|XP_011000138.1|  PREDICTED: protein IRX15-LIKE-like                 183   2e-50    
ref|XP_001754981.1|  predicted protein                                  180   3e-50    
gb|EEC81210.1|  hypothetical protein OsI_24242                          183   3e-50    
gb|EYU42089.1|  hypothetical protein MIMGU_mgv1a011091mg                182   3e-50    
emb|CDP02521.1|  unnamed protein product                                182   4e-50    
gb|KCW63892.1|  hypothetical protein EUGRSUZ_G01567                     182   4e-50    
ref|XP_009588942.1|  PREDICTED: protein IRX15-LIKE-like                 182   4e-50    
ref|XP_011088226.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         182   5e-50    
ref|XP_009793224.1|  PREDICTED: protein IRX15-LIKE-like                 181   6e-50    
ref|XP_002298736.2|  hypothetical protein POPTR_0001s31000g             183   7e-50    
ref|XP_006447054.1|  hypothetical protein CICLE_v10018349mg             180   9e-50    
ref|XP_009592679.1|  PREDICTED: protein IRX15-LIKE-like                 181   1e-49    
ref|XP_008812532.1|  PREDICTED: LOW QUALITY PROTEIN: protein IRX1...    180   1e-49    
gb|EAY80483.1|  hypothetical protein OsI_35661                          181   2e-49    
ref|XP_006470075.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    179   2e-49    
ref|XP_002449278.1|  hypothetical protein SORBIDRAFT_05g007090          180   4e-49    
ref|XP_004136972.1|  PREDICTED: uncharacterized protein LOC101203456    179   4e-49    
ref|NP_001067591.1|  Os11g0242600                                       179   5e-49    
ref|XP_003576046.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    177   2e-48    
ref|XP_011097393.1|  PREDICTED: protein IRX15-LIKE                      177   2e-48    
ref|XP_008454974.1|  PREDICTED: protein IRX15-LIKE-like                 177   3e-48    
ref|XP_007157717.1|  hypothetical protein PHAVU_002G092400g             177   4e-48    
gb|EEE66247.1|  hypothetical protein OsJ_22425                          176   5e-48    
gb|KEH30898.1|  polysaccharide biosynthesis protein                     176   6e-48    
emb|CDO97204.1|  unnamed protein product                                176   6e-48    
gb|EYU37651.1|  hypothetical protein MIMGU_mgv1a010254mg                176   7e-48    
ref|XP_006360212.1|  PREDICTED: protein IRX15-like                      175   9e-48    
emb|CDY13145.1|  BnaA09g16720D                                          176   1e-47    
ref|XP_006409555.1|  hypothetical protein EUTSA_v10022776mg             176   2e-47    
dbj|BAJ84875.1|  predicted protein                                      174   3e-47    
ref|XP_004233444.1|  PREDICTED: protein IRX15-LIKE-like                 174   3e-47    
ref|XP_009136270.1|  PREDICTED: protein IRX15-LIKE-like                 174   4e-47    
gb|EMT29657.1|  hypothetical protein F775_16343                         173   4e-47    
ref|XP_008236563.1|  PREDICTED: protein IRX15-LIKE-like                 174   6e-47    
ref|XP_010068514.1|  PREDICTED: protein IRX15-LIKE-like                 170   1e-46    
ref|XP_003528522.1|  PREDICTED: protein IRX15-like                      172   1e-46    
ref|XP_008373171.1|  PREDICTED: protein IRX15-LIKE-like                 173   1e-46    
ref|XP_010530753.1|  PREDICTED: protein IRX15-LIKE-like                 173   1e-46    
gb|EMS49082.1|  hypothetical protein TRIUR3_01798                       174   2e-46    
ref|XP_009599933.1|  PREDICTED: protein IRX15-LIKE-like                 172   2e-46    
ref|XP_006339865.1|  PREDICTED: protein IRX15-like                      172   2e-46    
ref|XP_004231869.1|  PREDICTED: protein IRX15-LIKE-like                 172   3e-46    
ref|NP_001067923.1|  Os11g0490100                                       171   3e-46    
ref|XP_009775230.1|  PREDICTED: protein IRX15-LIKE-like                 171   4e-46    
ref|XP_009418802.1|  PREDICTED: protein IRX15-LIKE-like                 172   4e-46    
ref|XP_002283187.1|  PREDICTED: protein IRX15-LIKE                      171   4e-46    
ref|XP_008644968.1|  PREDICTED: protein IRREGULAR XYLEM 15              172   4e-46    
ref|XP_004505254.1|  PREDICTED: protein IRX15-like                      171   5e-46    
gb|KEH30897.1|  polysaccharide biosynthesis protein                     169   6e-46    
gb|EAZ18392.1|  hypothetical protein OsJ_33924                          171   7e-46    
ref|XP_009345137.1|  PREDICTED: protein IRX15-LIKE-like                 171   8e-46    
gb|KEH22018.1|  polysaccharide biosynthesis protein                     169   9e-46    
ref|XP_004305944.1|  PREDICTED: protein IRX15-like                      171   1e-45    
ref|XP_010030639.1|  PREDICTED: protein IRX15-LIKE-like                 169   2e-45    
ref|XP_009123237.1|  PREDICTED: protein IRX15-LIKE-like                 170   2e-45    
emb|CDY37228.1|  BnaA09g08490D                                          169   2e-45    
ref|XP_010028217.1|  PREDICTED: protein IRX15-LIKE-like                 169   2e-45    
ref|XP_009407075.1|  PREDICTED: protein IRX15-LIKE-like                 169   3e-45    
ref|NP_001148409.1|  plant-specific domain TIGR01627 family protein     169   3e-45    
ref|XP_010107856.1|  hypothetical protein L484_027443                   170   3e-45    
gb|KGN43907.1|  hypothetical protein Csa_7G073430                       166   3e-45    
ref|XP_002885962.1|  hypothetical protein ARALYDRAFT_899758             169   6e-45    
ref|XP_010518178.1|  PREDICTED: protein IRX15-LIKE-like                 169   7e-45    
tpg|DAA41884.1|  TPA: plant-specific domain TIGR01627 family protein    168   7e-45    
ref|XP_010911544.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    164   8e-45    
ref|XP_002447223.1|  hypothetical protein SORBIDRAFT_06g030790          167   2e-44    
ref|XP_004288008.1|  PREDICTED: protein IRX15-like                      167   3e-44    
ref|XP_003580688.1|  PREDICTED: protein IRX15-LIKE-like                 166   3e-44    
ref|XP_007200416.1|  hypothetical protein PRUPE_ppa008725mg             167   3e-44    
ref|XP_010467300.1|  PREDICTED: protein IRX15-LIKE-like                 166   5e-44    
ref|NP_565374.1|  uncharacterized protein                               166   7e-44    
gb|KDP31981.1|  hypothetical protein JCGZ_12442                         165   7e-44    
ref|XP_010691720.1|  PREDICTED: protein IRX15-LIKE-like                 165   8e-44    
ref|XP_006487028.1|  PREDICTED: protein IRX15-like                      166   8e-44    
ref|XP_004979287.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    165   8e-44    
ref|XP_003517315.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         165   8e-44    
ref|XP_010488960.1|  PREDICTED: protein IRX15-LIKE-like                 166   1e-43    
ref|NP_001151168.1|  plant-specific domain TIGR01627 family protein     164   1e-43    
ref|XP_010070598.1|  PREDICTED: protein IRX15-LIKE-like                 164   1e-43    
ref|XP_003520070.1|  PREDICTED: protein IRX15-like                      164   2e-43    
gb|KDO59785.1|  hypothetical protein CISIN_1g019623mg                   165   2e-43    
ref|XP_004951837.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         164   2e-43    
gb|ACF86974.1|  unknown                                                 164   2e-43    
ref|XP_009420642.1|  PREDICTED: protein IRX15-LIKE-like                 164   3e-43    
emb|CDY62313.1|  BnaCnng39920D                                          164   3e-43    
ref|NP_001152696.1|  LOC100286337                                       164   3e-43    
ref|XP_002533263.1|  conserved hypothetical protein                     164   5e-43    
emb|CAH68262.1|  H0212B02.6                                             163   6e-43    
ref|NP_001054086.1|  Os04g0649900                                       163   7e-43    
emb|CDX89660.1|  BnaC03g45740D                                          163   7e-43    
ref|XP_006292985.1|  hypothetical protein CARUB_v10019263mg             162   9e-43    
ref|XP_002310711.2|  hypothetical protein POPTR_0007s10710g             162   1e-42    
ref|XP_007156771.1|  hypothetical protein PHAVU_002G016200g             164   1e-42    
gb|KCW55159.1|  hypothetical protein EUGRSUZ_I01114                     160   1e-42    
ref|XP_002449507.1|  hypothetical protein SORBIDRAFT_05g016880          162   1e-42    
ref|XP_010672415.1|  PREDICTED: protein IRX15-LIKE-like                 162   1e-42    
ref|XP_004977048.1|  PREDICTED: protein IRX15-like                      162   2e-42    
gb|EPS67946.1|  hypothetical protein M569_06823                         161   2e-42    
ref|XP_002437483.1|  hypothetical protein SORBIDRAFT_10g027930          162   2e-42    
ref|XP_009412469.1|  PREDICTED: protein IRX15-LIKE-like                 162   2e-42    
ref|XP_006422963.1|  hypothetical protein CICLE_v10028798mg             159   3e-42    
ref|XP_011005802.1|  PREDICTED: protein IRX15-LIKE-like                 161   3e-42    
ref|NP_001241343.1|  uncharacterized protein LOC100817866               161   3e-42    
ref|NP_190591.1|  protein IRREGULAR XYLEM 15                            161   4e-42    
dbj|BAD94344.1|  hypothetical protein                                   161   4e-42    
gb|ABK28594.1|  unknown                                                 161   4e-42    
ref|XP_010547998.1|  PREDICTED: protein IRX15-LIKE                      161   5e-42    
ref|XP_010503691.1|  PREDICTED: protein IRREGULAR XYLEM 15              160   5e-42    
gb|AAM64983.1|  unknown                                                 160   5e-42    
ref|XP_010515380.1|  PREDICTED: protein IRREGULAR XYLEM 15-like         160   5e-42    
gb|KFK40017.1|  hypothetical protein AALP_AA3G319200                    160   6e-42    
ref|XP_004509113.1|  PREDICTED: protein IRX15-like                      160   7e-42    
gb|KHN42103.1|  hypothetical protein glysoja_003843                     161   7e-42    
ref|XP_008440308.1|  PREDICTED: protein IRX15-LIKE                      160   9e-42    
ref|XP_010928364.1|  PREDICTED: protein IRX15-LIKE-like                 160   9e-42    
emb|CDY17753.1|  BnaC08g21610D                                          160   1e-41    
dbj|BAJ87047.1|  predicted protein                                      159   2e-41    
gb|EAY80965.1|  hypothetical protein OsI_36146                          158   2e-41    
ref|XP_010426565.1|  PREDICTED: protein IRREGULAR XYLEM 15              159   2e-41    
ref|XP_003560476.1|  PREDICTED: protein IRX15-LIKE-like                 159   2e-41    
ref|XP_002877736.1|  hypothetical protein ARALYDRAFT_906343             159   3e-41    
ref|XP_007047358.1|  Bromodomain-containing protein DDB_G0271118        158   3e-41    
gb|ACU21250.1|  unknown                                                 155   4e-41    
gb|EYU42690.1|  hypothetical protein MIMGU_mgv1a011105mg                157   4e-41    
gb|KEH31471.1|  polysaccharide biosynthesis protein                     157   4e-41    
dbj|BAD28033.1|  unknown protein                                        159   4e-41    
ref|XP_006404049.1|  hypothetical protein EUTSA_v10010543mg             158   5e-41    
ref|XP_003524627.1|  PREDICTED: protein IRX15-like                      157   6e-41    
gb|EAY84554.1|  hypothetical protein OsI_05925                          158   7e-41    
ref|XP_006664425.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    152   8e-41    
ref|XP_003550048.1|  PREDICTED: protein IRX15-like                      157   8e-41    
dbj|BAJ95150.1|  predicted protein                                      158   8e-41    
ref|XP_007209010.1|  hypothetical protein PRUPE_ppa023358mg             157   1e-40    
ref|NP_001132394.1|  uncharacterized protein LOC100193840               157   1e-40    
ref|XP_009148770.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    150   2e-40    
ref|XP_004142003.1|  PREDICTED: uncharacterized protein LOC101217122    156   2e-40    
ref|XP_003570954.2|  PREDICTED: protein IRREGULAR XYLEM 15-like         155   4e-40    
emb|CBI40959.3|  unnamed protein product                                149   4e-40    
ref|XP_008239480.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    155   5e-40    
ref|XP_002453337.1|  hypothetical protein SORBIDRAFT_04g004070          155   6e-40    
ref|XP_011008784.1|  PREDICTED: protein IRX15-LIKE-like                 155   6e-40    
ref|XP_002306483.1|  hypothetical protein POPTR_0005s18480g             155   7e-40    
ref|XP_008799899.1|  PREDICTED: protein IRX15-LIKE-like                 155   7e-40    
ref|XP_003525535.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    154   9e-40    
gb|AFK42978.1|  unknown                                                 150   9e-40    
gb|KEH31718.1|  polysaccharide biosynthesis protein                     154   1e-39    
emb|CBI29685.3|  unnamed protein product                                147   1e-39    
ref|XP_006280826.1|  hypothetical protein CARUB_v10026796mg             154   1e-39    
ref|XP_009115695.1|  PREDICTED: protein IRREGULAR XYLEM 15              154   2e-39    
emb|CDY30600.1|  BnaAnng03750D                                          154   2e-39    
ref|XP_010558800.1|  PREDICTED: protein IRX15-LIKE                      153   2e-39    
ref|NP_201522.1|  uncharacterized protein                               153   3e-39    
ref|XP_002866713.1|  nucleic acid binding protein                       153   4e-39    
ref|XP_007205581.1|  hypothetical protein PRUPE_ppa008835mg             152   4e-39    
ref|XP_010444678.1|  PREDICTED: protein IRX15-LIKE-like                 152   6e-39    
ref|XP_010550356.1|  PREDICTED: protein IRX15-LIKE-like                 152   6e-39    
ref|XP_010464334.1|  PREDICTED: protein IRX15-LIKE-like                 152   7e-39    
ref|XP_010484528.1|  PREDICTED: protein IRX15-LIKE                      152   7e-39    
ref|XP_010093517.1|  hypothetical protein L484_007232                   152   8e-39    
ref|XP_008238947.1|  PREDICTED: protein IRX15-LIKE                      151   1e-38    
ref|XP_008340351.1|  PREDICTED: protein IRX15-LIKE-like                 152   1e-38    
ref|XP_010104047.1|  hypothetical protein L484_005520                   152   1e-38    
ref|XP_008345507.1|  PREDICTED: protein IRX15-LIKE-like                 151   2e-38    
emb|CDP16776.1|  unnamed protein product                                146   2e-38    
ref|XP_009103444.1|  PREDICTED: protein IRX15-LIKE                      150   3e-38    
ref|XP_006494477.1|  PREDICTED: protein IRX15-like                      150   3e-38    
gb|ADR31629.1|  DUF579 protein                                          149   3e-38    
ref|XP_009367443.1|  PREDICTED: protein IRX15-LIKE-like                 150   3e-38    
gb|ADR31620.1|  DUF579 protein                                          149   3e-38    
gb|ADR31612.1|  DUF579 protein                                          149   3e-38    
gb|KDO79100.1|  hypothetical protein CISIN_1g021017mg                   150   3e-38    
gb|ADR31613.1|  DUF579 protein                                          149   4e-38    
ref|XP_009351143.1|  PREDICTED: protein IRX15-LIKE-like                 150   4e-38    
gb|ADR31610.1|  DUF579 protein                                          149   4e-38    
emb|CDX81329.1|  BnaC09g07400D                                          150   4e-38    
ref|XP_006393919.1|  hypothetical protein EUTSA_v10004623mg             150   5e-38    
ref|XP_006298050.1|  hypothetical protein CARUB_v10014094mg             150   5e-38    
emb|CDY12819.1|  BnaC07g16140D                                          149   7e-38    
ref|XP_007155898.1|  hypothetical protein PHAVU_003G241300g             149   7e-38    
ref|XP_006425964.1|  hypothetical protein CICLE_v10025796mg             150   1e-37    
gb|ABK93235.1|  unknown                                                 141   1e-37    
emb|CDM86548.1|  unnamed protein product                                147   2e-37    
ref|XP_002511179.1|  conserved hypothetical protein                     147   6e-37    
ref|XP_002322260.2|  hypothetical protein POPTR_0015s10890g             146   8e-37    
ref|XP_009372433.1|  PREDICTED: protein IRX15-LIKE-like                 147   9e-37    
ref|XP_006648329.1|  PREDICTED: protein IRX15-like                      144   1e-36    
gb|KFK28414.1|  hypothetical protein AALP_AA8G511700                    146   1e-36    
emb|CDY01429.1|  BnaA07g12020D                                          146   1e-36    
gb|ADR31621.1|  DUF579 protein                                          144   1e-36    
ref|XP_007037988.1|  Uncharacterized protein TCM_014647                 145   2e-36    
ref|XP_009368533.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    145   2e-36    
ref|XP_009375208.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    145   2e-36    
ref|XP_008392805.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    145   3e-36    
gb|ADR31616.1|  DUF579 protein                                          144   3e-36    
gb|ADR31611.1|  DUF579 protein                                          143   3e-36    
ref|XP_010663748.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    144   4e-36    
gb|ADR31614.1|  DUF579 protein                                          143   4e-36    
ref|XP_011024394.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    144   6e-36    
ref|WP_006623492.1|  hypothetical protein                               147   8e-36    
ref|XP_010249029.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    143   9e-36    
ref|XP_008374234.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    142   2e-35    
ref|XP_004963505.1|  PREDICTED: glucuronoxylan 4-O-methyltransfer...    137   4e-35    
gb|KHN14112.1|  hypothetical protein glysoja_033339                     140   1e-34    
ref|XP_007155553.1|  hypothetical protein PHAVU_003G211500g             140   1e-34    
tpg|DAA44836.1|  TPA: hypothetical protein ZEAMMB73_823783              135   2e-34    
ref|WP_008055017.1|  hypothetical protein                               142   3e-34    
ref|WP_006618676.1|  hypothetical protein                               142   4e-34    
gb|KDP22615.1|  hypothetical protein JCGZ_26446                         139   4e-34    
ref|XP_007508077.1|  predicted protein                                  139   4e-34    



>ref|XP_011092282.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Sesamum indicum]
Length=297

 Score =   407 bits (1046),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 221/248 (89%), Gaps = 8/248 (3%)
 Frame = +1

Query  271  FLPR-KEARLSSKN------CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQK  429
            F+PR K    ++KN      CNK IP+S+A+A+IHYSTS ITPQQT KEISVTSRIL++K
Sbjct  45   FIPRSKSFPRTAKNSTCPPTCNK-IPSSLAQALIHYSTSTITPQQTLKEISVTSRILDKK  103

Query  430  SPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQA  609
            SP NFL+FGLGHDSLMWH+LN+GGRT+FLEEDEAWI QI R+FPMLESYHVTYD+KV+QA
Sbjct  104  SPCNFLIFGLGHDSLMWHSLNHGGRTIFLEEDEAWIEQIKRRFPMLESYHVTYDSKVNQA  163

Query  610  GDLMEIGKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAA  789
             DLM++GKGPECTAI+DP+YSMCQLALK LPS VY++ WDLIMVDAPTGY++EAPGRM+A
Sbjct  164  SDLMQVGKGPECTAISDPQYSMCQLALKGLPSEVYDMEWDLIMVDAPTGYYEEAPGRMSA  223

Query  790  IYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            IYTAGMMARNR+EGGG+T VFVHDVNR VEDKFS+ FLCEGYMKKQEGRLRHF IPS+R+
Sbjct  224  IYTAGMMARNRQEGGGKTHVFVHDVNREVEDKFSREFLCEGYMKKQEGRLRHFVIPSHRD  283

Query  970  HLDMPFCP  993
             L+ PFCP
Sbjct  284  DLNKPFCP  291



>ref|XP_002526428.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35923.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 212/235 (90%), Gaps = 5/235 (2%)
 Frame = +1

Query  298  SSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHD  468
            S++NC+    KIP S+A+A+IHY+TS ITPQQT KEISVT+RILE+KSP NFLVFGLGHD
Sbjct  58   SARNCSSTCSKIPRSLAQALIHYTTSTITPQQTLKEISVTARILEKKSPCNFLVFGLGHD  117

Query  469  SLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECT  648
            SLMW+TLNYGGRT+FLEEDE+WI QI R+FPMLESYHVTYD+KV+QA +LM++GKGPECT
Sbjct  118  SLMWNTLNYGGRTIFLEEDESWISQIRRRFPMLESYHVTYDSKVNQADNLMDVGKGPECT  177

Query  649  AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRRE  828
            A++DP+ SMCQLALK LP+ VYE+ WDLIMVDAPTGY++EAPGRM AIYTAGMMARNR E
Sbjct  178  ALSDPKVSMCQLALKGLPNEVYEIKWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARNRPE  237

Query  829  GGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
              G+TEVFVHDVNR VED+FSKAFLCEGYMKKQEGRLRHFTIPS+ + LD PFCP
Sbjct  238  --GKTEVFVHDVNREVEDRFSKAFLCEGYMKKQEGRLRHFTIPSHMDALDRPFCP  290



>gb|AHK60924.1| glucuronoxylan methyltransferase 1 [Populus trichocarpa]
Length=288

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 7/242 (3%)
 Frame = +1

Query  277  PRKEARLSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFL  447
            P KEAR    NC++   +IP S+ +A++HY+TS ITPQQT KEISV++++LE+KSP NFL
Sbjct  50   PMKEAR--ETNCSQACTQIPRSLTQALVHYTTSTITPQQTRKEISVSAKVLEKKSPCNFL  107

Query  448  VFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEI  627
            VFGLGHDSLMW  LNYGGRTVFLEEDEAWI QI R+FPMLES+HVTYD+KV++A +LME+
Sbjct  108  VFGLGHDSLMWSALNYGGRTVFLEEDEAWIAQIKRRFPMLESHHVTYDSKVNEAANLMEV  167

Query  628  GKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGM  807
            GKGPECTA+ DP++SMCQLA+K LPS VYE+ WDLIMVDAPTGYHDEAPGRM AI+TAGM
Sbjct  168  GKGPECTAVGDPKFSMCQLAMKGLPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIFTAGM  227

Query  808  MARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPF  987
            MARNR+E  GET+VFVHDVNR VEDKFSK+FLCEGYMKKQ GRLRHFTIPS+R+ LD PF
Sbjct  228  MARNRKE--GETDVFVHDVNREVEDKFSKSFLCEGYMKKQVGRLRHFTIPSHRDDLDRPF  285

Query  988  CP  993
            CP
Sbjct  286  CP  287



>ref|XP_006385062.1| hypothetical protein POPTR_0004s23540g, partial [Populus trichocarpa]
 gb|ERP62859.1| hypothetical protein POPTR_0004s23540g, partial [Populus trichocarpa]
Length=352

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 7/242 (3%)
 Frame = +1

Query  277  PRKEARLSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFL  447
            P KEAR    NC++   +IP S+ +A++HY+TS ITPQQT KEISV++++LE+KSP NFL
Sbjct  114  PMKEAR--ETNCSQACTQIPRSLTQALVHYTTSTITPQQTRKEISVSAKVLEKKSPCNFL  171

Query  448  VFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEI  627
            VFGLGHDSLMW  LNYGGRTVFLEEDEAWI QI R+FPMLES+HVTYD+KV++A +LME+
Sbjct  172  VFGLGHDSLMWSALNYGGRTVFLEEDEAWIAQIKRRFPMLESHHVTYDSKVNEAANLMEV  231

Query  628  GKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGM  807
            GKGPECTA+ DP++SMCQLA+K LPS VYE+ WDLIMVDAPTGYHDEAPGRM AI+TAGM
Sbjct  232  GKGPECTAVGDPKFSMCQLAMKGLPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIFTAGM  291

Query  808  MARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPF  987
            MARNR+E  GET+VFVHDVNR VEDKFSK+FLCEGYMKKQ GRLRHFTIPS+R+ LD PF
Sbjct  292  MARNRKE--GETDVFVHDVNREVEDKFSKSFLCEGYMKKQVGRLRHFTIPSHRDDLDRPF  349

Query  988  CP  993
            CP
Sbjct  350  CP  351



>ref|XP_006389489.1| hypothetical protein POPTR_0022s00320g [Populus trichocarpa]
 gb|ERP48403.1| hypothetical protein POPTR_0022s00320g [Populus trichocarpa]
Length=288

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 211/240 (88%), Gaps = 7/240 (3%)
 Frame = +1

Query  283  KEARLSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVF  453
            KEAR +  NC++   K+P  + +A+IHY+TS ITPQQT KEISV+++ILE+KSP NFLVF
Sbjct  52   KEARAT--NCSQGCSKVPRFLTQALIHYTTSTITPQQTQKEISVSAKILEKKSPCNFLVF  109

Query  454  GLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGK  633
            GLGHDSLMW  LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +LME+GK
Sbjct  110  GLGHDSLMWSALNYGGRTVFLEEDEAWIAQIKRRFPMLESYHVTYDSKVNQANNLMEVGK  169

Query  634  GPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMA  813
            GPECTAI+DP++SMCQLALK LPS VYE+ WDLIMVDAPTGY++EAPGRM AIYTAGMMA
Sbjct  170  GPECTAISDPKFSMCQLALKGLPSEVYEIEWDLIMVDAPTGYYEEAPGRMTAIYTAGMMA  229

Query  814  RNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            RNR+E  GET+VFVHDVNR VEDKFSKA LCEGYMKKQ GRLRHF IPS+R+ LD PFCP
Sbjct  230  RNRKE--GETDVFVHDVNREVEDKFSKALLCEGYMKKQVGRLRHFIIPSHRDALDRPFCP  287



>ref|XP_007226453.1| hypothetical protein PRUPE_ppa024506mg, partial [Prunus persica]
 gb|EMJ27652.1| hypothetical protein PRUPE_ppa024506mg, partial [Prunus persica]
Length=247

 Score =   390 bits (1002),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 206/228 (90%), Gaps = 3/228 (1%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK IP S+AKA+IHY+TS ITPQQT KEISVTS++L++KSP NFLVFGLGHDSLMW +L
Sbjct  22   CNK-IPPSLAKALIHYTTSTITPQQTLKEISVTSKVLDKKSPCNFLVFGLGHDSLMWSSL  80

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            N+GGRT+F+EEDE+WI QI R+FPMLESYHVTYD+KV+QA +LM++GKGPECTA+ DPRY
Sbjct  81   NHGGRTIFVEEDESWIEQIQRRFPMLESYHVTYDSKVNQADNLMDVGKGPECTAVGDPRY  140

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LPS VY++ WDLIMVDAPTGYHDEAPGRM+AIYTAGMMARN+ E  GET+V
Sbjct  141  SMCQLALKGLPSEVYDIKWDLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKEE--GETDV  198

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDVNRVVED FSKAFLCEGYMKKQ+GRLRHF IPS+R+    PFCP
Sbjct  199  FVHDVNRVVEDNFSKAFLCEGYMKKQQGRLRHFNIPSHRDGSHRPFCP  246



>ref|XP_009110815.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Brassica rapa]
Length=281

 Score =   391 bits (1005),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 205/230 (89%), Gaps = 4/230 (2%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK +P S+A+A+IHYSTS ITPQQT KEI+V+SR+LE+KSP NFLVFGLGHDSLMW +L
Sbjct  54   CNK-LPRSLAQALIHYSTSVITPQQTLKEIAVSSRVLEKKSPCNFLVFGLGHDSLMWSSL  112

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGPECTA+ DPRY
Sbjct  113  NYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQAENLIEVGKGPECTAVGDPRY  172

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN RE  GET+V
Sbjct  173  SMCQLALKGLPAEIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARN-RERVGETDV  231

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFCP  993
            FVHDVNR VEDKFSKAFLCEGYMKKQEGRLRHF IPSYR+    + PFCP
Sbjct  232  FVHDVNREVEDKFSKAFLCEGYMKKQEGRLRHFVIPSYRDGSESNRPFCP  281



>ref|XP_006470960.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Citrus 
sinensis]
Length=295

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 208/232 (90%), Gaps = 5/232 (2%)
 Frame = +1

Query  307  NCN---KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            NC+    KIP S+A+A+IHYSTS ITPQQT KEISV++R+LE+K+P NFLVFGLGHDSLM
Sbjct  65   NCSPTCTKIPRSLAQALIHYSTSTITPQQTLKEISVSARVLEKKAPCNFLVFGLGHDSLM  124

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W TLNYGGRT+FLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +LM++GKGPECTAI 
Sbjct  125  WSTLNYGGRTIFLEEDEAWIEQIRRRFPMLESYHVTYDSKVNQAENLMDVGKGPECTAIG  184

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DP+YSMCQLALK LP+ VY++ WDLIMVDAPTGY++EAPGRM AIYTAGMMARNR +  G
Sbjct  185  DPKYSMCQLALKGLPAEVYDIKWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARNRED--G  242

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +T+VFVHDVNR VED FSKAFLCEGYMKKQEGR+RHF IPS+R+ L+MPFCP
Sbjct  243  DTDVFVHDVNREVEDNFSKAFLCEGYMKKQEGRIRHFNIPSHRDGLEMPFCP  294



>ref|XP_006303671.1| hypothetical protein CARUB_v10011736mg [Capsella rubella]
 gb|EOA36569.1| hypothetical protein CARUB_v10011736mg [Capsella rubella]
Length=282

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/243 (76%), Positives = 212/243 (87%), Gaps = 8/243 (3%)
 Frame = +1

Query  283  KEARLS--SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFG  456
            +EAR +  S  CNK +P S+A+A+IHYSTS ITPQQT KEI+V+SR+L +KSP NFLVFG
Sbjct  42   EEARSARCSGACNK-LPRSLAQALIHYSTSVITPQQTLKEIAVSSRVLNKKSPCNFLVFG  100

Query  457  LGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG  636
            LGHDSLMW +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTY++KV+QA +L+E+GKG
Sbjct  101  LGHDSLMWSSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYNSKVNQADNLIEVGKG  160

Query  637  PECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMAR  816
            PECTAI DPRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMAR
Sbjct  161  PECTAIGDPRYSMCQLALKGLPADIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMAR  220

Query  817  NRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR----NHLDMP  984
            NR++ GGET+VFVHDVNR +EDKFSKAFLCEGYMKKQEGRLRHF IPSYR    +  + P
Sbjct  221  NRKQ-GGETDVFVHDVNREIEDKFSKAFLCEGYMKKQEGRLRHFVIPSYRVGSNSESNRP  279

Query  985  FCP  993
            FCP
Sbjct  280  FCP  282



>gb|AHK60925.1| glucuronoxylan methyltransferase 2 [Populus trichocarpa]
Length=288

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 211/240 (88%), Gaps = 7/240 (3%)
 Frame = +1

Query  283  KEARLSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVF  453
            KEAR  + NC++   K+P  + +A+IHY+TS ITPQQT KEISV+++ILE+KSP NFLVF
Sbjct  52   KEAR--ATNCSQGCSKVPRFLTQALIHYTTSTITPQQTHKEISVSAKILEKKSPCNFLVF  109

Query  454  GLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGK  633
            GLGHDSLMW  LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +LME+GK
Sbjct  110  GLGHDSLMWSALNYGGRTVFLEEDEAWIAQIKRRFPMLESYHVTYDSKVNQANNLMEVGK  169

Query  634  GPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMA  813
            GPECTAI+DP++SMCQLALK LPS VYE+ WDLIMVDAPTGY++EAPGRM AIYTAGMMA
Sbjct  170  GPECTAISDPKFSMCQLALKGLPSEVYEIEWDLIMVDAPTGYYEEAPGRMTAIYTAGMMA  229

Query  814  RNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            RNR+E  GET+VFVHDVNR VEDKFSKA LCEGYMKKQ GRLRHF IPS+R+ LD PFCP
Sbjct  230  RNRKE--GETDVFVHDVNREVEDKFSKALLCEGYMKKQVGRLRHFIIPSHRDALDRPFCP  287



>ref|XP_009353798.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=291

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 207/232 (89%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+  CNK IP S+AKA+IHY+TS ITPQQT KEISVTS++L++KSP NFLVFGLGHDSLM
Sbjct  62   STMTCNK-IPTSLAKALIHYTTSTITPQQTLKEISVTSKVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+FLEEDE+WI QI R+FP LESYHVTYD+KV++A  LM++GKGPECTA+ 
Sbjct  121  WTSLNHGGRTIFLEEDESWIEQIRRRFPTLESYHVTYDSKVNEANSLMDVGKGPECTAVV  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPRYS+CQLALK LPS VYE+ WDLIMVDAPTGYHDEAPGRM+AIYTAGMMARN+   GG
Sbjct  181  DPRYSVCQLALKGLPSEVYEIKWDLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKE--GG  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VEDKFSKAFLCEGYMKKQEGRLRHF IPS+++  + PFCP
Sbjct  239  ETDVFVHDVNRDVEDKFSKAFLCEGYMKKQEGRLRHFNIPSHKDSSNRPFCP  290



>emb|CDO97633.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 213/241 (88%), Gaps = 5/241 (2%)
 Frame = +1

Query  277  PRKEARLS--SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLV  450
            P K+ ++S  S +CNK IP+++A+A+IHYSTS+I PQQT KEISVTS+ILE+KSP NFLV
Sbjct  50   PLKDEKVSNCSPSCNK-IPSTLAQAIIHYSTSSIIPQQTLKEISVTSKILEKKSPCNFLV  108

Query  451  FGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG  630
            FGLGHDSLMW  LNYGGRT+FLEEDE+WI QI R+FPMLESYHV+YD+KV+QA +L+E+G
Sbjct  109  FGLGHDSLMWSALNYGGRTIFLEEDESWIEQIKRRFPMLESYHVSYDSKVNQADELLEVG  168

Query  631  KGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMM  810
            KGPECT + DPRYSMCQLALK LPS VYE+ WDLIMVDAPTGY+DEAPGRM AIYTAGMM
Sbjct  169  KGPECTPVADPRYSMCQLALKGLPSEVYEIKWDLIMVDAPTGYYDEAPGRMTAIYTAGMM  228

Query  811  ARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            ARNR +  G TEVFVHDVNR VEDKFS+AFLC+ Y+KKQEGR+RHF IPSYR++L+ PFC
Sbjct  229  ARNRED--GVTEVFVHDVNRDVEDKFSRAFLCDAYVKKQEGRIRHFRIPSYRSNLNQPFC  286

Query  991  P  993
            P
Sbjct  287  P  287



>ref|NP_172432.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q6NMK1.1|GXM1_ARATH RecName: Full=Glucuronoxylan 4-O-methyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAR20784.1| At1g09610 [Arabidopsis thaliana]
 gb|AAS47664.1| At1g09610 [Arabidopsis thaliana]
 gb|AEE28468.1| uncharacterized protein AT1G09610 [Arabidopsis thaliana]
 gb|AFU91592.1| glucuronoxylan methyltransferase 1 [Arabidopsis thaliana]
Length=282

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  CNK +P S+A+A+IHYSTS ITPQQT KEI+V+SR+L +KSP NFLVFGLGHDSLMW
Sbjct  50   SGACNK-LPRSLAQALIHYSTSVITPQQTLKEIAVSSRVLGKKSPCNFLVFGLGHDSLMW  108

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
             +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGPECTAI D
Sbjct  109  SSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGPECTAIGD  168

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            PRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR++ GGE
Sbjct  169  PRYSMCQLALKGLPAEIYETGWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKQ-GGE  227

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN----HLDMPFCP  993
            T+VFVHDVNR +EDKFSKAFLCEGYMKKQEGRLRHF IPSYR+      + PFCP
Sbjct  228  TDVFVHDVNREIEDKFSKAFLCEGYMKKQEGRLRHFIIPSYRDGSESESNRPFCP  282



>ref|XP_011028374.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=360

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 212/242 (88%), Gaps = 7/242 (3%)
 Frame = +1

Query  277  PRKEARLSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFL  447
            P KEAR   KNC++   +IP S+ +A++HY+TS ITPQQT  EISV++++LE+KSP NFL
Sbjct  122  PVKEAR--EKNCSQACTQIPRSLTQALVHYTTSTITPQQTRNEISVSAKVLEKKSPCNFL  179

Query  448  VFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEI  627
            VFGLGHDS+MW  LNYGGRTVFLEEDEAWI QI R+FP+LESYHVTYD+KV +A +LME+
Sbjct  180  VFGLGHDSIMWSALNYGGRTVFLEEDEAWIAQIKRRFPILESYHVTYDSKVKEAANLMEV  239

Query  628  GKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGM  807
            GKGPECTA+ DP++SMCQLA+K +PS VYE+ WDLIMVDAPTGYHDEAPGRM AI+TAGM
Sbjct  240  GKGPECTAVGDPKFSMCQLAMKGMPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIFTAGM  299

Query  808  MARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPF  987
            MARNR+E  GET+VFVHDVNR VEDKFSK+FLCEGYMKKQ GRLRHFTIPS+R+ LD PF
Sbjct  300  MARNRKE--GETDVFVHDVNREVEDKFSKSFLCEGYMKKQVGRLRHFTIPSHRDDLDRPF  357

Query  988  CP  993
            CP
Sbjct  358  CP  359



>ref|XP_004230438.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Solanum lycopersicum]
Length=275

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 206/228 (90%), Gaps = 3/228 (1%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK IP+SVAK++IHY+TSAITPQQT KEI VTS+IL++KSPSNFLVFGLGHDSLMWHTL
Sbjct  51   CNK-IPSSVAKSLIHYATSAITPQQTQKEILVTSKILDKKSPSNFLVFGLGHDSLMWHTL  109

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRT+FLEEDEAWI QI ++FPMLESYHVTYD+KV+QA  L+E GKG ECT I DPRY
Sbjct  110  NYGGRTIFLEEDEAWIQQIKKRFPMLESYHVTYDSKVNQANVLIEAGKGTECTTIADPRY  169

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LPS +Y++ WDLIMVDAPTGY+++APGRM AIYTAGMMARNR +  GET V
Sbjct  170  SMCQLALKGLPSEIYDIKWDLIMVDAPTGYYEDAPGRMTAIYTAGMMARNRED--GETHV  227

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDVNR VEDKFS+ FLCEGYMKKQ GRLRHFTIPS++++L+MPFCP
Sbjct  228  FVHDVNRDVEDKFSREFLCEGYMKKQVGRLRHFTIPSHKSNLNMPFCP  275



>emb|CDY20685.1| BnaC08g13730D [Brassica napus]
Length=281

 Score =   389 bits (999),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 204/230 (89%), Gaps = 4/230 (2%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK +P S+A+A+IHYSTS ITPQQT KEI V+SR+LE+KSP NFLVFGLGHDSLMW +L
Sbjct  54   CNK-LPRSLAQALIHYSTSVITPQQTLKEIVVSSRVLEKKSPCNFLVFGLGHDSLMWSSL  112

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGPECTAI DPRY
Sbjct  113  NYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQAENLIEVGKGPECTAIGDPRY  172

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR+   GET+V
Sbjct  173  SMCQLALKGLPAEIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKR-VGETDV  231

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFCP  993
            FVHDVNR VEDKFSKAFLCEGY+KKQEGRLRHF IPSYR+    + PFCP
Sbjct  232  FVHDVNREVEDKFSKAFLCEGYIKKQEGRLRHFVIPSYRDGSESNRPFCP  281



>ref|XP_011047866.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=288

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 209/240 (87%), Gaps = 7/240 (3%)
 Frame = +1

Query  283  KEARLSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVF  453
            KEAR  + NC++   K P  + +A+IHY+TS ITPQQT KEISVT++ILE+KSP NFLVF
Sbjct  52   KEAR--ATNCSQGCSKAPRFLTQALIHYTTSTITPQQTQKEISVTAKILEKKSPCNFLVF  109

Query  454  GLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGK  633
            GLGH SLMW  LNYGGRTVFLEEDEAWI QI R+FPMLE YHVTYD+KV+QA +LME+GK
Sbjct  110  GLGHASLMWSALNYGGRTVFLEEDEAWIAQIKRRFPMLELYHVTYDSKVNQAKNLMEVGK  169

Query  634  GPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMA  813
            GPECTAI+DP++SMCQLALK LPS VYE+ WDLIMVDAPTGY++EAPGRM AIYTAGMMA
Sbjct  170  GPECTAISDPKFSMCQLALKGLPSEVYEIEWDLIMVDAPTGYYEEAPGRMTAIYTAGMMA  229

Query  814  RNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            RNR+E  GET+VFVHDVNR VEDKFSKA LCEGYMKKQ GRLRHFTIPS+R+ LD PFCP
Sbjct  230  RNRKE--GETDVFVHDVNREVEDKFSKALLCEGYMKKQVGRLRHFTIPSHRDALDRPFCP  287



>gb|KDO42443.1| hypothetical protein CISIN_1g043166mg [Citrus sinensis]
Length=295

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 207/232 (89%), Gaps = 5/232 (2%)
 Frame = +1

Query  307  NCN---KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            NC+    KIP S+A+A+IHYSTS ITPQQT KEISV++R+LE+K+P NFLVFGLGHDSLM
Sbjct  65   NCSPTCTKIPRSLAQALIHYSTSTITPQQTLKEISVSARVLEKKAPCNFLVFGLGHDSLM  124

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W TLNYGGRT+FLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +LM++GKGPECTAI 
Sbjct  125  WSTLNYGGRTIFLEEDEAWIEQIRRRFPMLESYHVTYDSKVNQAENLMDVGKGPECTAIG  184

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DP+YSMCQLALK LP+ VY++ WDLIMVDAPTGY++EAPGRM AIYTAGMMARNR +  G
Sbjct  185  DPKYSMCQLALKGLPAEVYDIKWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARNRED--G  242

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +T+VFVHDVNR VED FSKAFLCEGYMKKQEGR+RHF IPS+R+ L+ PFCP
Sbjct  243  DTDVFVHDVNREVEDNFSKAFLCEGYMKKQEGRIRHFNIPSHRDGLERPFCP  294



>ref|XP_008339417.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Malus domestica]
Length=329

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 207/232 (89%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+  CNK IP S+AKA+IHY+TS ITPQQT KEISVTS++L++KSP NFLVFGLGHDSLM
Sbjct  100  STGTCNK-IPTSLAKALIHYTTSTITPQQTLKEISVTSKVLDKKSPCNFLVFGLGHDSLM  158

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+FLEEDE+WI QI R+FP LESYHVTYD+KV++A  LM++GKGPECTA+ 
Sbjct  159  WTSLNHGGRTIFLEEDESWIEQIRRRFPTLESYHVTYDSKVNEANSLMDVGKGPECTAVG  218

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPRYS+CQLALK LPS VYE+ W+LIMVDAPTGYHDEAPGRM+AIYTAGMMARN+   GG
Sbjct  219  DPRYSVCQLALKGLPSEVYEIKWBLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKE--GG  276

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VEDKFSKAFLCEGYMKKQEGRLRHF IPS+++  + PFCP
Sbjct  277  ETDVFVHDVNRDVEDKFSKAFLCEGYMKKQEGRLRHFNIPSHKDSSNRPFCP  328



>ref|XP_008218691.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Prunus mume]
Length=306

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 205/228 (90%), Gaps = 3/228 (1%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK IP S+AKA+IHY+TS ITPQQT KEISVTS++L++KSP NFLVFGLGHDSLMW +L
Sbjct  81   CNK-IPPSLAKALIHYTTSTITPQQTLKEISVTSKVLDKKSPCNFLVFGLGHDSLMWSSL  139

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            N+GGRT+FLEEDE+WI QI R+FPMLESYHVTYD+KV+QA +LM++GKGPECTA+ DPRY
Sbjct  140  NHGGRTIFLEEDESWIEQIQRRFPMLESYHVTYDSKVNQADNLMDVGKGPECTAVGDPRY  199

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LPS VY++ WDLIMVDAPTGYHDEAPGRM+AIYTAGMMARN+ E  GET+V
Sbjct  200  SMCQLALKGLPSEVYDIKWDLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKEE--GETDV  257

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDVNRVVED FSKAFLC GYMKKQ+GRLRHF IPS+R+    PFCP
Sbjct  258  FVHDVNRVVEDNFSKAFLCVGYMKKQQGRLRHFNIPSHRDGSHRPFCP  305



>ref|XP_009774625.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Nicotiana 
sylvestris]
Length=295

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 208/238 (87%), Gaps = 3/238 (1%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            +K    SS  CNK IP+SVA ++IHY+TS ITPQQT KEISVTS+IL++KSP NFLVFGL
Sbjct  61   KKTRTCSSPQCNK-IPSSVANSLIHYTTSTITPQQTLKEISVTSKILDKKSPCNFLVFGL  119

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMWHTLN+GGRT+FLEEDE WI QI ++FPMLESYHVTYD+KV++A  L+E GKGP
Sbjct  120  GHDSLMWHTLNFGGRTIFLEEDETWIEQIKKRFPMLESYHVTYDSKVNEANVLIEAGKGP  179

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTAI DPRYSMCQLALK LPS +Y++ WDLIMVDAPTGY+++APGRM AIYTAGMMARN
Sbjct  180  ECTAIADPRYSMCQLALKGLPSEIYDIKWDLIMVDAPTGYYEDAPGRMTAIYTAGMMARN  239

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +    GET VFVHDVNR +EDKFS+ FLC+GYMKKQ GRLRHFTIPS++++LDMPFCP
Sbjct  240  KE--NGETHVFVHDVNRNIEDKFSREFLCDGYMKKQVGRLRHFTIPSHKSNLDMPFCP  295



>ref|XP_009611196.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=377

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 209/238 (88%), Gaps = 3/238 (1%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            +K    SS  CNK IP+SVAK++IHY+TS ITPQQT KEISVTS+IL++KSP NFLVFGL
Sbjct  143  KKTRTCSSPQCNK-IPSSVAKSLIHYTTSTITPQQTLKEISVTSKILDKKSPCNFLVFGL  201

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMWHTLN+GGRT+FLEEDE WI QI ++FPMLESYHVTYD+KV++A  L+E GKGP
Sbjct  202  GHDSLMWHTLNFGGRTIFLEEDETWIEQIKKRFPMLESYHVTYDSKVNEANVLIEAGKGP  261

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTAI DPRYSMCQLALK LPS +Y++ WDLIMVDAPTGY+++APGRM AIYTAGMMARN
Sbjct  262  ECTAIADPRYSMCQLALKGLPSEIYDMKWDLIMVDAPTGYYEDAPGRMTAIYTAGMMARN  321

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R    GET VFVHDVNR +EDKFS+ FLC+GYMKKQ GRLRHFTIPS++++LDMPFCP
Sbjct  322  RE--NGETHVFVHDVNRNIEDKFSREFLCDGYMKKQVGRLRHFTIPSHKSNLDMPFCP  377



>ref|XP_006431520.1| hypothetical protein CICLE_v10002026mg [Citrus clementina]
 gb|ESR44760.1| hypothetical protein CICLE_v10002026mg [Citrus clementina]
Length=295

 Score =   387 bits (995),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 206/232 (89%), Gaps = 5/232 (2%)
 Frame = +1

Query  307  NCN---KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            NC+    KIP S+A+A+IHYSTS ITPQQT KEISV++R+LE+K+P NFLVFGLGHDSLM
Sbjct  65   NCSPTCTKIPRSLAQALIHYSTSTITPQQTLKEISVSARVLEKKAPCNFLVFGLGHDSLM  124

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W TLNYGGRT+FLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +LM++GKGPECTAI 
Sbjct  125  WSTLNYGGRTIFLEEDEAWIEQIRRRFPMLESYHVTYDSKVNQAENLMDVGKGPECTAIG  184

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DP+YSMCQLALK LP+ VY++ WDLIMVDAPTGY++EAPGRM AIYTAGMMARNR +  G
Sbjct  185  DPKYSMCQLALKGLPAEVYDIKWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARNRED--G  242

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +T+VFVHDVNR VED FS AFLCEGYMKKQEGR+RHF IPS+R+ L+ PFCP
Sbjct  243  DTDVFVHDVNREVEDNFSNAFLCEGYMKKQEGRIRHFNIPSHRDGLERPFCP  294



>ref|XP_007041172.1| S-adenosyl-L-methionine-dependent methyltransferase mraW [Theobroma 
cacao]
 gb|EOX97003.1| S-adenosyl-L-methionine-dependent methyltransferase mraW [Theobroma 
cacao]
Length=424

 Score =   392 bits (1007),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 210/237 (89%), Gaps = 3/237 (1%)
 Frame = +1

Query  283  KEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLG  462
            K A   S +C+K IP S+A+A+IHYSTSAITPQQT KEISVT+R+LE+KSP NFLVFGLG
Sbjct  190  KTAANCSPSCDK-IPRSLAQALIHYSTSAITPQQTLKEISVTARVLEKKSPCNFLVFGLG  248

Query  463  HDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE  642
            HDSLMW +LN+GGRTVFLEEDEAWI QI R+FPMLESYHV YD+KV+QA +LM++GKGPE
Sbjct  249  HDSLMWSSLNHGGRTVFLEEDEAWIEQIRRRFPMLESYHVAYDSKVNQAENLMDVGKGPE  308

Query  643  CTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            CTA+ DP+YSMCQLALK LPS VYE+ WDLIMVDAPTGY++EAPGRM AIYTAGMMARNR
Sbjct  309  CTAVGDPKYSMCQLALKGLPSEVYEMKWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARNR  368

Query  823  REGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
             E  G+T+VFVHDVNRVVEDKFS AFLC+GYMKKQEGRLRHF IPS+++  D PFCP
Sbjct  369  EE--GDTDVFVHDVNRVVEDKFSMAFLCQGYMKKQEGRLRHFRIPSHKDGPDRPFCP  423



>ref|XP_009355344.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=291

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 205/232 (88%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+  CNK IP S+AKA+IHY+TS ITPQQT KEISVTS++L++KSP NFLVFGLGHDSLM
Sbjct  62   STMTCNK-IPTSLAKALIHYTTSTITPQQTLKEISVTSKVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+FLEEDE+WI QI R+FP LESYHVTYD+KV++A DL+ +GKGPEC+A+ 
Sbjct  121  WTSLNHGGRTIFLEEDESWIKQIQRRFPTLESYHVTYDSKVNEANDLLGVGKGPECSAVG  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPRYSMCQLALK LPS VYE+ WDLIMVDAPTGYHD APGRM+AIYTAGMMARN+ E  G
Sbjct  181  DPRYSMCQLALKGLPSEVYEIKWDLIMVDAPTGYHDGAPGRMSAIYTAGMMARNKVE--G  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VEDKFSKAFLCEGYMKKQ GRLRHF IPS+R+  D PFCP
Sbjct  239  ETDVFVHDVNRDVEDKFSKAFLCEGYMKKQVGRLRHFNIPSHRDASDRPFCP  290



>emb|CDY31075.1| BnaA08g26250D [Brassica napus]
Length=281

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 204/230 (89%), Gaps = 4/230 (2%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK +P S+A+A+IHYSTS ITPQQT KEI+V+SR+L++KSP NFLVFGLGHDSLMW +L
Sbjct  54   CNK-LPRSLAQALIHYSTSVITPQQTPKEIAVSSRVLDKKSPCNFLVFGLGHDSLMWSSL  112

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRTVFLEEDEAWI QI R+FPMLESYHVTY +KV+QA +L+E+GKGPECTA+ DPRY
Sbjct  113  NYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYHSKVNQADNLIEVGKGPECTAVGDPRY  172

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LP+ +YE  WD+IMVDAPTGY+DEAPGRM AIYTAGMMARN RE  GET+V
Sbjct  173  SMCQLALKGLPAEIYETSWDIIMVDAPTGYYDEAPGRMTAIYTAGMMARN-RERVGETDV  231

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFCP  993
            FVHDVNR VEDKFSKAFLCEGYMKKQEGRLRHF IPSYR+    + PFCP
Sbjct  232  FVHDVNREVEDKFSKAFLCEGYMKKQEGRLRHFVIPSYRDGSESNRPFCP  281



>ref|XP_010475802.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Camelina 
sativa]
Length=282

 Score =   385 bits (988),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 207/242 (86%), Gaps = 7/242 (3%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            R+  R S   CNK +P S+A+A+IHYSTS I PQQT KEI+V+S IL +KSP NFLVFGL
Sbjct  44   RRSERCSGA-CNK-LPRSLAQALIHYSTSVIIPQQTLKEIAVSSSILSKKSPCNFLVFGL  101

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGP
Sbjct  102  GHDSLMWSSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGP  161

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTAI DPRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN
Sbjct  162  ECTAIGDPRYSMCQLALKGLPADIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARN  221

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR----NHLDMPF  987
            R++ GGET+VFVHDVNR +E+KFSKAFLCEGYMKKQEGRLRHF IPSYR    +  D  F
Sbjct  222  RKQ-GGETDVFVHDVNREIENKFSKAFLCEGYMKKQEGRLRHFVIPSYRVGSQSESDRLF  280

Query  988  CP  993
            CP
Sbjct  281  CP  282



>emb|CAN78768.1| hypothetical protein VITISV_006251 [Vitis vinifera]
Length=237

 Score =   382 bits (982),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 204/236 (86%), Gaps = 5/236 (2%)
 Frame = +1

Query  295  LSSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGH  465
            L ++NC++   KIP S+A+A+IHY+TS ITPQQT KEI VTSR+L++KSP NFLVFGLGH
Sbjct  3    LRAENCSRTCGKIPPSLAQALIHYTTSTITPQQTLKEIKVTSRVLQKKSPCNFLVFGLGH  62

Query  466  DSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPEC  645
            DSLMW  LN+GGRT+FL+ED  WI QI R+FPMLESYHVTYD+KV+QA +LME GKGPEC
Sbjct  63   DSLMWAALNHGGRTIFLDEDAVWIEQIRRRFPMLESYHVTYDSKVNQADELMEAGKGPEC  122

Query  646  TAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRR  825
            TAI D RYSMCQL LK LP  VY++ WDLIMVDAPTGYHDEAPGRM AIYTAGMMARNR 
Sbjct  123  TAIVDARYSMCQLGLKGLPGEVYDIKWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNRA  182

Query  826  EGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +  GET+VFVHDVNRVVEDKFSK FLC+GYMKKQEGR RHFTIPS+R+ ++ PFCP
Sbjct  183  D--GETDVFVHDVNRVVEDKFSKEFLCDGYMKKQEGRXRHFTIPSHRDGMERPFCP  236



>ref|XP_008365324.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Malus 
domestica]
Length=291

 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 204/232 (88%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+  CNK IP S+AKA+IHY+TS ITPQQT KEISVTS++L++KSP NFLVFGLGHDSLM
Sbjct  62   STMTCNK-IPTSLAKALIHYTTSTITPQQTLKEISVTSKVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+FLEEDE+WI QI R+FP LESYHVTYD+KV++A +L+ +GKGPEC+A+ 
Sbjct  121  WTSLNHGGRTIFLEEDESWIEQIRRRFPTLESYHVTYDSKVNEANNLLGVGKGPECSAVG  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPRYSMCQLALK LPS VYE+ WDLIMVDAPTGYHDEAPGRM+AIYTAGMMARN+ E  G
Sbjct  181  DPRYSMCQLALKGLPSEVYEIKWDLIMVDAPTGYHDEAPGRMSAIYTAGMMARNKVE--G  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
             T+VFVHDVNR VEDKFSKAFLCEGYMKKQ GRLRHF IPS+R   D PFCP
Sbjct  239  XTDVFVHDVNRGVEDKFSKAFLCEGYMKKQVGRLRHFNIPSHRXASDRPFCP  290



>ref|XP_002889761.1| hypothetical protein ARALYDRAFT_888205 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66020.1| hypothetical protein ARALYDRAFT_888205 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 204/235 (87%), Gaps = 6/235 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  CNK +P S+A+A+IHYSTS ITPQQT KEI+V+S +L +KSP NFLVFGLGHDSLMW
Sbjct  50   SGACNK-LPRSLAQALIHYSTSVITPQQTLKEIAVSSTVLGKKSPCNFLVFGLGHDSLMW  108

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
             +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGPECTAI D
Sbjct  109  SSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGPECTAIGD  168

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            PRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR++ GGE
Sbjct  169  PRYSMCQLALKGLPAEIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKQ-GGE  227

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN----HLDMPFCP  993
            T+VFVHDVNR +E+KFSK FLCEGYM KQEGRLRHF IPSYR+      + PFCP
Sbjct  228  TDVFVHDVNREIENKFSKTFLCEGYMTKQEGRLRHFVIPSYRDGSESESNRPFCP  282



>ref|XP_010544116.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Tarenaya hassleriana]
Length=288

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 201/229 (88%), Gaps = 2/229 (1%)
 Frame = +1

Query  307  NCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHT  486
            +   KIP S+A+A+IHYST+ ITPQQT KEISVT+++LE+KSP NFLVFGLGHDSLMW +
Sbjct  55   DATNKIPRSIAQALIHYSTTTITPQQTLKEISVTAKVLEKKSPCNFLVFGLGHDSLMWSS  114

Query  487  LNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPR  666
            LNYGGRTVFLEEDEAWI QI ++FPMLESYHVTYD+KV+QA +LME+GKG ECTA+ DPR
Sbjct  115  LNYGGRTVFLEEDEAWIGQIKKRFPMLESYHVTYDSKVNQADNLMEVGKGTECTAVDDPR  174

Query  667  YSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
            YSMCQLALK LP  +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN+ E  GET+
Sbjct  175  YSMCQLALKGLPKEIYETKWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNKDE--GETD  232

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VFVHDVNR VEDKFS AFLC+ YMKKQEGRLRHFTIPS+++  D PFCP
Sbjct  233  VFVHDVNREVEDKFSMAFLCDRYMKKQEGRLRHFTIPSHKDGSDRPFCP  281



>ref|XP_010458256.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Camelina 
sativa]
Length=282

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 206/242 (85%), Gaps = 7/242 (3%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            R+  R S   CNK +P S+A+A+IHYSTS ITPQQT KEI+V+S +L +KSP NFLVFGL
Sbjct  44   RRSERCSGA-CNK-LPRSLAQALIHYSTSVITPQQTLKEIAVSSEVLSKKSPCNFLVFGL  101

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LNYGGRTVFLEEDEAWI QI R+FPMLESYHV YD+KV+QA +L+E+GKGP
Sbjct  102  GHDSLMWSSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVIYDSKVNQADNLIEVGKGP  161

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTAI DPRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN
Sbjct  162  ECTAIGDPRYSMCQLALKGLPADIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARN  221

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR----NHLDMPF  987
            R++  GET+VFVHDVNR +EDKFSKAFLCEGYMKKQEGRLRHF IPSYR    +  D  F
Sbjct  222  RKQ-RGETDVFVHDVNREIEDKFSKAFLCEGYMKKQEGRLRHFVIPSYRVGSQSESDRLF  280

Query  988  CP  993
            CP
Sbjct  281  CP  282



>ref|XP_006349307.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Solanum 
tuberosum]
Length=276

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 204/228 (89%), Gaps = 3/228 (1%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK IP+SVAK++IHY+TSAITPQQT KEI VTS+IL++KSP NFLVFGLGHDSLMWHTL
Sbjct  52   CNK-IPSSVAKSLIHYTTSAITPQQTHKEILVTSKILDKKSPCNFLVFGLGHDSLMWHTL  110

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRT+FLEEDEAWI QI ++FPMLESYHVTYD+KV+QA  L+E GKG ECT I DPRY
Sbjct  111  NYGGRTIFLEEDEAWIQQIKKRFPMLESYHVTYDSKVNQANVLIEAGKGTECTTIADPRY  170

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK +PS +Y++ WD+IMVDAPTGY+++APGRM AIYTAGMMARNR +   ET +
Sbjct  171  SMCQLALKGMPSEIYDIKWDIIMVDAPTGYYEDAPGRMTAIYTAGMMARNRED--RETHL  228

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDVNR +EDKFS+ FLCEGYMKKQ GRLRHFTIPS++++L+MPFCP
Sbjct  229  FVHDVNRYIEDKFSREFLCEGYMKKQVGRLRHFTIPSHKSNLNMPFCP  276



>ref|XP_002266046.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Vitis vinifera]
Length=284

 Score =   380 bits (975),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 211/247 (85%), Gaps = 9/247 (4%)
 Frame = +1

Query  271  FLPRKEARL---SSKNCNK---KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKS  432
            FLP K++++    ++NC++   KIP S+A+A+IHY+TS ITPQQT KEI VTSR+L++KS
Sbjct  40   FLP-KDSKIVIGRAENCSRTCGKIPPSLAQALIHYTTSTITPQQTLKEIKVTSRVLQKKS  98

Query  433  PSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAG  612
            P NFLVFGLGHDSLMW  LN+GGRT+FL+ED  WI +I R+FPMLESYHVTYD+KV+QA 
Sbjct  99   PCNFLVFGLGHDSLMWAALNHGGRTIFLDEDAVWIERIRRRFPMLESYHVTYDSKVNQAD  158

Query  613  DLMEIGKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAI  792
            +LME GK PECTAI D RYSMCQL LK LP  VY++ WDLIMVDAPTGYHDEAPGRM AI
Sbjct  159  ELMEAGKRPECTAIVDARYSMCQLGLKGLPGEVYDIKWDLIMVDAPTGYHDEAPGRMTAI  218

Query  793  YTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
            YTAGMMARNR +  GET+VFVHDVNRVVEDKFSK FLC+GYMKKQEGRLRHFTIPS+R+ 
Sbjct  219  YTAGMMARNRAD--GETDVFVHDVNRVVEDKFSKEFLCDGYMKKQEGRLRHFTIPSHRDG  276

Query  973  LDMPFCP  993
            ++ PFCP
Sbjct  277  MERPFCP  283



>ref|XP_006417555.1| hypothetical protein EUTSA_v10009538mg [Eutrema salsugineum]
 gb|ESQ35908.1| hypothetical protein EUTSA_v10009538mg [Eutrema salsugineum]
Length=283

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 200/232 (86%), Gaps = 6/232 (3%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK +P S+A+A+IHYSTS ITPQQT KEI V+SR+L+ KSP NFLVFGLGHDSLMW +L
Sbjct  54   CNK-LPRSLAQALIHYSTSVITPQQTLKEIVVSSRVLDNKSPCNFLVFGLGHDSLMWSSL  112

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV QA +L+++GKGPECTAI D RY
Sbjct  113  NYGGRTVFLEEDEAWIRQIKRRFPMLESYHVTYDSKVHQADNLIQVGKGPECTAIGDLRY  172

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR++ GGET V
Sbjct  173  SMCQLALKGLPAQIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKQ-GGETHV  231

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN----HLDMPFCP  993
            FVHDVNR VED FS AFLC+GYMKKQEGRLRHF IPSYR+      + PFCP
Sbjct  232  FVHDVNREVEDNFSMAFLCQGYMKKQEGRLRHFVIPSYRDGSESESNRPFCP  283



>ref|XP_003547881.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Glycine 
max]
 gb|KHN39683.1| hypothetical protein glysoja_020761 [Glycine soja]
Length=280

 Score =   379 bits (973),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 210/242 (87%), Gaps = 6/242 (2%)
 Frame = +1

Query  280  RKEARL--SSKNCNK-KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLV  450
            ++EA L  S  +CNK KIP SV++A+IHYSTS+ITPQQT KEISVT+R+LE+KSP NFLV
Sbjct  40   QQEALLVKSDGSCNKMKIPGSVSEALIHYSTSSITPQQTVKEISVTARVLEKKSPCNFLV  99

Query  451  FGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG  630
            FGLGHDSLMW+ LN+GGRT+FLEEDE+WI Q+ R+FPMLE+Y V Y++KV++A  +ME+G
Sbjct  100  FGLGHDSLMWNALNHGGRTIFLEEDESWIQQMRRRFPMLEAYQVNYESKVNEAESMMEVG  159

Query  631  KGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMM  810
            +G EC A+ DPRYS+C LALK LPS+VYE  WDLIMVDAPTGY++ APGRM AIYTAGMM
Sbjct  160  RGGECRAVGDPRYSICPLALKGLPSVVYETKWDLIMVDAPTGYYENAPGRMTAIYTAGMM  219

Query  811  ARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN-HLDMPF  987
            ARNR    GETEVFVHDVNRVVED+FS+AFLC+ YMKKQEGRLRHFTIPSYR+ H DMPF
Sbjct  220  ARNRE--SGETEVFVHDVNRVVEDQFSRAFLCQKYMKKQEGRLRHFTIPSYRDHHQDMPF  277

Query  988  CP  993
            CP
Sbjct  278  CP  279



>ref|XP_009611193.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=287

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 202/241 (84%), Gaps = 5/241 (2%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLV  450
            FLP      SS  CN KIP+SVAK++IHY+TS  TPQQ   EIS+TS IL++KSP NFLV
Sbjct  52   FLP---TSCSSTKCNNKIPSSVAKSLIHYATSNTTPQQKLDEISITSNILDKKSPCNFLV  108

Query  451  FGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG  630
            FGLGHDSLMWHTLN+GGRT+FL+ED  WI +I +KFPMLESYHVTYD+KV +A  LME G
Sbjct  109  FGLGHDSLMWHTLNFGGRTIFLDEDVIWIEKIKKKFPMLESYHVTYDSKVKEANVLMEAG  168

Query  631  KGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMM  810
            K P+CTAI DPRYS CQLALK LP+ +Y++ WDLIMVDAPTG+H+ APGRM AIYTAGMM
Sbjct  169  KKPDCTAIADPRYSKCQLALKGLPNEIYDIKWDLIMVDAPTGFHENAPGRMTAIYTAGMM  228

Query  811  ARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            ARN+    GET VFVHDV+R +EDKFSKAFLC+GYMKKQ G+LRHFTIPS++N+LDMPFC
Sbjct  229  ARNKE--NGETHVFVHDVHRNIEDKFSKAFLCDGYMKKQVGKLRHFTIPSHKNNLDMPFC  286

Query  991  P  993
            P
Sbjct  287  P  287



>gb|ACU23359.1| unknown [Glycine max]
Length=280

 Score =   377 bits (967),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 210/242 (87%), Gaps = 6/242 (2%)
 Frame = +1

Query  280  RKEARL--SSKNCNK-KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLV  450
            ++EA L  S  +CNK KIP SV++A+IHYSTS+ITPQQT KEISVT+R+LE+KSP NFLV
Sbjct  40   QQEALLVKSDGSCNKMKIPGSVSEALIHYSTSSITPQQTVKEISVTARVLEKKSPCNFLV  99

Query  451  FGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG  630
            FGLGHDSLMW+ LN+GGRT+FLEEDE+WI Q+ R+FPMLE+Y V Y++KV++A  +ME+G
Sbjct  100  FGLGHDSLMWNALNHGGRTIFLEEDESWIQQMRRRFPMLEAYQVNYESKVNEAESMMEVG  159

Query  631  KGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMM  810
            +G EC A+ DPRYS+C LALK LPS+V+E  WDLIMVDAPTGY++ APGRM AIYTAGMM
Sbjct  160  RGGECRAVGDPRYSICPLALKGLPSVVHETKWDLIMVDAPTGYYENAPGRMTAIYTAGMM  219

Query  811  ARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN-HLDMPF  987
            ARNR    GETEVFVHDVNRVVED+FS+AFLC+ YMKKQEGRLRHFTIPSYR+ H DMPF
Sbjct  220  ARNRE--SGETEVFVHDVNRVVEDQFSRAFLCQKYMKKQEGRLRHFTIPSYRDHHQDMPF  277

Query  988  CP  993
            CP
Sbjct  278  CP  279



>ref|XP_010490173.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 isoform X2 
[Camelina sativa]
Length=283

 Score =   374 bits (960),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 208/242 (86%), Gaps = 7/242 (3%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            R+  R S   CNK IP S+A+A+IHYSTS ITPQQT KEI+V+S +L +KSP NFLVFGL
Sbjct  44   RRSERCSGA-CNK-IPRSLAQALIHYSTSVITPQQTLKEIAVSSSVLSKKSPCNFLVFGL  101

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGP
Sbjct  102  GHDSLMWSSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGP  161

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTAI DPRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN
Sbjct  162  ECTAIGDPRYSMCQLALKGLPADIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARN  221

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHL----DMPF  987
            R++ GGET+VFVHDVNR +EDKFSKAFLCEGYMKKQEGRLRHF IPSYR  L    +  F
Sbjct  222  RKQ-GGETDVFVHDVNREIEDKFSKAFLCEGYMKKQEGRLRHFVIPSYRVGLQSESNRLF  280

Query  988  CP  993
            CP
Sbjct  281  CP  282



>ref|XP_010490169.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 isoform X1 
[Camelina sativa]
Length=283

 Score =   374 bits (959),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 208/242 (86%), Gaps = 7/242 (3%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            R+  R S   CNK IP S+A+A+IHYSTS ITPQQT KEI+V+S +L +KSP NFLVFGL
Sbjct  44   RRSERCSGA-CNK-IPRSLAQALIHYSTSVITPQQTLKEIAVSSSVLSKKSPCNFLVFGL  101

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGP
Sbjct  102  GHDSLMWSSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGP  161

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTAI DPRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN
Sbjct  162  ECTAIGDPRYSMCQLALKGLPADIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARN  221

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHL----DMPF  987
            R++ GGET+VFVHDVNR +EDKFSKAFLCEGYMKKQEGRLRHF IPSYR  L    +  F
Sbjct  222  RKQ-GGETDVFVHDVNREIEDKFSKAFLCEGYMKKQEGRLRHFVIPSYRVGLQSESNRLF  280

Query  988  CP  993
            CP
Sbjct  281  CP  282



>ref|XP_010030205.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Eucalyptus 
grandis]
Length=288

 Score =   374 bits (960),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 202/238 (85%), Gaps = 5/238 (2%)
 Frame = +1

Query  286  EARLS--SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            EA+ S  S  C+K IP  +A+A+IHY+TS ITPQQT KEISVT+R+L++KSP NFLVFGL
Sbjct  53   EAKASDCSPTCSK-IPNPLAQALIHYTTSTITPQQTLKEISVTARVLKKKSPCNFLVFGL  111

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LNYGGRT+FLEEDEAWI QI ++FPMLESYHV+YD+KV+QA +LME GK P
Sbjct  112  GHDSLMWSSLNYGGRTIFLEEDEAWIEQIKKRFPMLESYHVSYDSKVNQADNLMEAGKVP  171

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            EC  ++DPRYSMCQLALK LP  VYE  WDLIMVDAPTGY++EAPGRM AIYTAGMMARN
Sbjct  172  ECMVVSDPRYSMCQLALKGLPDEVYERQWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARN  231

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R+E  GET+VFVHDVNR VEDKFSK FLCEGYMKKQE RLRHF IPS+     MPFCP
Sbjct  232  RKE--GETDVFVHDVNRSVEDKFSKEFLCEGYMKKQENRLRHFIIPSHTGESSMPFCP  287



>gb|AAC33218.1| Similar to cdc2 protein kinases [Arabidopsis thaliana]
Length=967

 Score =   395 bits (1014),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  CNK +P S+A+A+IHYSTS ITPQQT KEI+V+SR+L +KSP NFLVFGLGHDSLMW
Sbjct  735  SGACNK-LPRSLAQALIHYSTSVITPQQTLKEIAVSSRVLGKKSPCNFLVFGLGHDSLMW  793

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
             +LNYGGRTVFLEEDEAWI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGPECTAI D
Sbjct  794  SSLNYGGRTVFLEEDEAWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGPECTAIGD  853

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            PRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR++ GGE
Sbjct  854  PRYSMCQLALKGLPAEIYETGWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKQ-GGE  912

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN----HLDMPFCP  993
            T+VFVHDVNR +EDKFSKAFLCEGYMKKQEGRLRHF IPSYR+      + PFCP
Sbjct  913  TDVFVHDVNREIEDKFSKAFLCEGYMKKQEGRLRHFIIPSYRDGSESESNRPFCP  967



>gb|EYU33284.1| hypothetical protein MIMGU_mgv1a010969mg [Erythranthe guttata]
Length=296

 Score =   372 bits (955),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/245 (73%), Positives = 206/245 (84%), Gaps = 5/245 (2%)
 Frame = +1

Query  274  LPRKEARLSS-KNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLV  450
            LP+ +A +   KN   KIP S+++A+IHYSTS ITPQQT +EIS+TSRILE+ SP NFLV
Sbjct  52   LPKTKAEMKCPKNYCGKIPQSISEALIHYSTSTITPQQTLEEISITSRILEEYSPCNFLV  111

Query  451  FGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG  630
            FGLGHDSLMWH+LN+GGRTVFLEEDE+WI QI R+FPMLESY  +Y TKVSQA DLM +G
Sbjct  112  FGLGHDSLMWHSLNHGGRTVFLEEDESWIEQIKRRFPMLESYRASYGTKVSQANDLMHVG  171

Query  631  KGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMM  810
            KG ECTA++DPRYS+CQLALK LPS VYEV WDLIMVDAPTGY++EAPGRMAAIYTAGMM
Sbjct  172  KGIECTAVSDPRYSVCQLALKGLPSEVYEVEWDLIMVDAPTGYYEEAPGRMAAIYTAGMM  231

Query  811  ARN----RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLD  978
            ARN       GGG T VFVHDVNR VEDKFS  FLCEGY+KKQEGRLRHF +PS+R+ L+
Sbjct  232  ARNRRRRGGGGGGGTHVFVHDVNREVEDKFSMEFLCEGYLKKQEGRLRHFVVPSHRDDLE  291

Query  979  MPFCP  993
             PFCP
Sbjct  292  RPFCP  296



>ref|XP_007148579.1| hypothetical protein PHAVU_006G220400g [Phaseolus vulgaris]
 gb|ESW20573.1| hypothetical protein PHAVU_006G220400g [Phaseolus vulgaris]
Length=291

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 205/234 (88%), Gaps = 6/234 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +CNK IP S+++A+IHYSTS ITPQQT KEISV++R+LE+KSP NFLVFGLGHDSLMW
Sbjct  59   SPSCNK-IPVSLSQALIHYSTSTITPQQTLKEISVSARVLEKKSPCNFLVFGLGHDSLMW  117

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
              LNYGGRTVFLEEDEAW+ QI R+FP +ESYHV YD+KV++A +LME+G+G ECTA+ D
Sbjct  118  SALNYGGRTVFLEEDEAWMEQIRRRFPTVESYHVRYDSKVNEAENLMEVGRGEECTAVGD  177

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            PRYS+CQLALK LPS+VYE  WD+IMVDAPTGY+++APGRM+AIYTAGMMARNR    GE
Sbjct  178  PRYSVCQLALKGLPSVVYETEWDVIMVDAPTGYYEDAPGRMSAIYTAGMMARNRE--SGE  235

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH---LDMPFCP  993
            T+VFVHDVNRVVED FS AFLC+ ++KKQEGRLRHFTIPS+R++   LD PFCP
Sbjct  236  TDVFVHDVNRVVEDNFSMAFLCKSFIKKQEGRLRHFTIPSFRDNPHLLDGPFCP  289



>ref|XP_010676715.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Beta 
vulgaris subsp. vulgaris]
Length=277

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 197/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP+S++ A+IHYSTS+ITPQQT++EI+VTS+IL++KSP NFLVFGLGHDSLMW  LNYG
Sbjct  55   KIPSSLSHALIHYSTSSITPQQTSREIAVTSKILQKKSPCNFLVFGLGHDSLMWSALNYG  114

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEEDE+WI QI  +FPML SYHV YDTKV+QA  L+++ KG ECT+I+DP++SMC
Sbjct  115  GRTIFLEEDESWIKQIKSRFPMLHSYHVVYDTKVNQADILIDLAKGEECTSISDPKHSMC  174

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALKSLP  VYE  WDLIMVDAPTGYHDEAPGRM AIYTAGM+ARN+    GET+VFVH
Sbjct  175  QLALKSLPKEVYETKWDLIMVDAPTGYHDEAPGRMTAIYTAGMIARNQE--NGETDVFVH  232

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNR VEDKFSKAFLCEGYM+KQEGRLRHFTIPS+R     PFCP
Sbjct  233  DVNREVEDKFSKAFLCEGYMQKQEGRLRHFTIPSHREGSQRPFCP  277



>ref|XP_009774624.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=298

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 199/249 (80%), Gaps = 10/249 (4%)
 Frame = +1

Query  271  FLPRKEAR--------LSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQ  426
            FLPR  A          SS  CN KIP+SVAK++IHY+TS  TPQQ   EIS+TS IL++
Sbjct  52   FLPRSSASSGDKETISCSSPKCNNKIPSSVAKSLIHYATSNTTPQQKLDEISITSNILDK  111

Query  427  KSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQ  606
            KSP  FLVFGLGHDSLMWHTLN+GGRT+FL+ED  WI +I  KFPMLESYHVTYD+KV +
Sbjct  112  KSPCTFLVFGLGHDSLMWHTLNFGGRTIFLDEDIIWIEKIKNKFPMLESYHVTYDSKVKE  171

Query  607  AGDLMEIGKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMA  786
            A  LME GK P+CTAI DPRY+ CQLALK LP+ +Y++ WDLIMVDAPTG+H  APGRM 
Sbjct  172  ANVLMEAGKKPDCTAIVDPRYTKCQLALKGLPNEIYDIKWDLIMVDAPTGFHKNAPGRMT  231

Query  787  AIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR  966
            AIYTAGMMARNR    GET VFVHDV+R +EDKFS+ FLC+GYMK+Q G+LRHFTIPS++
Sbjct  232  AIYTAGMMARNRE--NGETHVFVHDVHRNIEDKFSRQFLCDGYMKEQVGKLRHFTIPSHK  289

Query  967  NHLDMPFCP  993
             +LDMPFCP
Sbjct  290  TNLDMPFCP  298



>gb|KFK43257.1| hypothetical protein AALP_AA1G100400 [Arabis alpina]
Length=972

 Score =   390 bits (1003),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 206/233 (88%), Gaps = 4/233 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  CNK +P S+A+A+IHYSTS ITPQQT +EI+V+SR+L++KSP NFLVFGLGHDSLMW
Sbjct  742  SGACNK-LPRSLAQALIHYSTSVITPQQTFREIAVSSRVLDKKSPCNFLVFGLGHDSLMW  800

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
             +LNYGGRTVFLEEDE WI QI R+FPMLESYHVTYD+KV+QA +L+E+GKGPECTAI D
Sbjct  801  SSLNYGGRTVFLEEDEGWIKQIKRRFPMLESYHVTYDSKVNQADNLIEVGKGPECTAIGD  860

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            PRYSMCQLALK LP+ +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR++ GGE
Sbjct  861  PRYSMCQLALKGLPAEMYETRWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNRKQ-GGE  919

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFCP  993
            T+VFVHDVNR VEDKFSKAFLCEGYMK+QEGRLRHF IPSYR+    +  FCP
Sbjct  920  TDVFVHDVNREVEDKFSKAFLCEGYMKRQEGRLRHFVIPSYRDGSESERSFCP  972



>ref|XP_010099766.1| hypothetical protein L484_010953 [Morus notabilis]
 gb|EXB80384.1| hypothetical protein L484_010953 [Morus notabilis]
Length=303

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A+ +IHY+TS ITPQQT KEISVT+ +LE++SP NFLVFGLGHDSLMW  LN+G
Sbjct  77   KIPPSLAQTLIHYTTSTITPQQTLKEISVTAGVLEKRSPCNFLVFGLGHDSLMWAALNHG  136

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEEDEAWI QI R+FP L+++HV Y++KV++A  LM++GKGPECTA+ DPRYSMC
Sbjct  137  GRTVFLEEDEAWIEQIRRRFPTLDTHHVRYESKVNEAEGLMDVGKGPECTAVGDPRYSMC  196

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LALK LPS VYE  WDLIMVDAPTGY++EAPGRM AI+TAGMMARNR E G ET+VFVH
Sbjct  197  LLALKGLPSEVYETKWDLIMVDAPTGYYEEAPGRMTAIFTAGMMARNREE-GSETDVFVH  255

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNRVVEDKFSKAFLCEGYM++QEGRLRHF IPS+R+    PFCP
Sbjct  256  DVNRVVEDKFSKAFLCEGYMREQEGRLRHFRIPSHRDDTQRPFCP  300



>ref|XP_004152531.1| PREDICTED: uncharacterized protein LOC101217402 [Cucumis sativus]
 ref|XP_004169013.1| PREDICTED: uncharacterized protein LOC101226845 [Cucumis sativus]
 gb|KGN64244.1| hypothetical protein Csa_1G044930 [Cucumis sativus]
Length=289

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 198/238 (83%), Gaps = 1/238 (0%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            +K    SS +   KIP S + A+IHYSTS+ITPQQT KEISV + +L  +SP NFLVFGL
Sbjct  52   QKLTHCSSPSFCNKIPPSFSHALIHYSTSSITPQQTFKEISVAAAVLLNRSPCNFLVFGL  111

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW TLN+GGRT+FLEED++WI QI+R+FPMLES HV YD+KV QA  LM++GKGP
Sbjct  112  GHDSLMWATLNHGGRTLFLEEDKSWIQQISRRFPMLESRHVIYDSKVHQADGLMDVGKGP  171

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTA+ DP+YS+C LA+K LP  VYEV WDLIMVDAPTG+HDEAPGRM AIYTAGMMARN
Sbjct  172  ECTAVGDPKYSVCPLAIKGLPEEVYEVKWDLIMVDAPTGFHDEAPGRMTAIYTAGMMARN  231

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R EGG  T+VFVHDVNR VEDKFS  FLCEGYM KQEGRLRHFTIPS+++ LD PFCP
Sbjct  232  REEGGS-TDVFVHDVNREVEDKFSMEFLCEGYMVKQEGRLRHFTIPSHKDDLDKPFCP  288



>ref|XP_008437427.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Cucumis melo]
Length=288

 Score =   366 bits (940),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 197/238 (83%), Gaps = 2/238 (1%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            +K    S   CNK IP S +  +IHYSTS+ITPQQT KEISV + +L  +SP NFLVFGL
Sbjct  52   QKLTHCSPSFCNK-IPPSFSHTLIHYSTSSITPQQTFKEISVAAAVLLDRSPCNFLVFGL  110

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW TLN+GGRT+FLEED++WI QI+R+FPMLES HV YD+KV QA  LM++GKGP
Sbjct  111  GHDSLMWATLNHGGRTLFLEEDKSWIQQISRRFPMLESRHVIYDSKVHQADGLMDVGKGP  170

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            ECTA+ DP+YS+C LA+K LP  VYEV WDLIMVDAPTG+HDEAPGRM AIYTAGMMARN
Sbjct  171  ECTAVGDPKYSVCPLAIKGLPEEVYEVKWDLIMVDAPTGFHDEAPGRMTAIYTAGMMARN  230

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R EGG  T+VFVHDVNR VEDKFS  FLCEGYM KQEGRLRHFTIPS+R+ LD PFCP
Sbjct  231  REEGGS-TDVFVHDVNREVEDKFSMEFLCEGYMVKQEGRLRHFTIPSHRDDLDKPFCP  287



>ref|XP_010657964.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Vitis vinifera]
Length=362

 Score =   367 bits (941),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 200/234 (85%), Gaps = 5/234 (2%)
 Frame = +1

Query  301  SKNCN---KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDS  471
            + NC+    KIP S+A+A+IHY+TS ITPQQT KEISVTS+IL  KSP NFLVFGLGHDS
Sbjct  130  AANCSPTCTKIPTSLAQALIHYTTSTITPQQTLKEISVTSKILVNKSPCNFLVFGLGHDS  189

Query  472  LMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTA  651
            LMW  LN+GGRT+FLEEDEAWI QI ++FP LESYHV YD+KV+QA +LME+GKGPEC  
Sbjct  190  LMWRELNHGGRTIFLEEDEAWIEQIRQRFPKLESYHVMYDSKVNQADNLMEVGKGPECIG  249

Query  652  ITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
            + D R+S CQLALK LP+ VY++ WDLIMVDAPTGY++EAPGRMAAIYTAGMMARNR++ 
Sbjct  250  VGDIRHSTCQLALKGLPNEVYDIKWDLIMVDAPTGYYEEAPGRMAAIYTAGMMARNRKD-  308

Query  832  GGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
             GET+VFVHDVNRVVEDKFS+AFLC+GYM+KQ GRLRHF IPS+R+    PFCP
Sbjct  309  -GETDVFVHDVNRVVEDKFSRAFLCDGYMRKQTGRLRHFRIPSHRDGSAKPFCP  361



>emb|CDY50891.1| BnaCnng19830D [Brassica napus]
Length=957

 Score =   383 bits (984),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 200/232 (86%), Gaps = 6/232 (3%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK +P S+A+A+IHYSTS ITPQQT KEI V+SR+L++KSP NFLVFGLGHDSLMW +L
Sbjct  728  CNK-LPRSLAQALIHYSTSVITPQQTLKEIVVSSRVLDKKSPCNFLVFGLGHDSLMWSSL  786

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRTVFLEEDE WI QI R+FPMLE+YHV+YD+KV+QA +L+E+GKGPECTAI DPRY
Sbjct  787  NYGGRTVFLEEDEVWIKQIKRRFPMLETYHVSYDSKVNQAENLIEVGKGPECTAIGDPRY  846

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            SMCQLALK LP  +YE  WDLIMVDAPTGY+DEAPGRM AIYTAGMMARN RE  GET+V
Sbjct  847  SMCQLALKGLPDDIYETSWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARN-RERTGETDV  905

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP----FCP  993
            FVHDVNR VEDKFS AFLCEGYMKKQEGRLRHF IPSYRN  +      FCP
Sbjct  906  FVHDVNREVEDKFSMAFLCEGYMKKQEGRLRHFIIPSYRNGSESDSYRLFCP  957



>ref|XP_004300005.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=303

 Score =   362 bits (928),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 200/226 (88%), Gaps = 2/226 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP+S+A+ +IHY+TS ITPQQT KEISVT++IL++KSP NFLVFGLGHDSLMW  LN+G
Sbjct  78   KIPSSLAQTIIHYTTSTITPQQTLKEISVTAKILDKKSPCNFLVFGLGHDSLMWSALNHG  137

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI-TDPRYSM  675
            GRT+FLEEDE+WI QI R+FP LESYHVTY++KV++A +LM++G+GPECTA+ +D +YSM
Sbjct  138  GRTIFLEEDESWIEQIRRRFPTLESYHVTYNSKVNEADNLMDVGQGPECTAVGSDIKYSM  197

Query  676  CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFV  855
            CQLALK LPS VY++ WDLIMVDAPTGYHD+APGRM+AIYTAGM+ARN+ E G  T VFV
Sbjct  198  CQLALKGLPSQVYDMKWDLIMVDAPTGYHDQAPGRMSAIYTAGMIARNKEE-GETTHVFV  256

Query  856  HDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            HDVNRVVEDKFS +FLC+GYM+KQEGRLRHFTIPS+ +    PFCP
Sbjct  257  HDVNRVVEDKFSMSFLCKGYMQKQEGRLRHFTIPSHMDGSSRPFCP  302



>ref|XP_010261020.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Nelumbo nucifera]
Length=293

 Score =   358 bits (920),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 194/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
             IPAS+A+A+IHYSTS ITPQQT +EISVTSRILE+KSP  FLVFGLGHDSLMW  LN+G
Sbjct  70   NIPASLAQALIHYSTSNITPQQTLREISVTSRILEKKSPCKFLVFGLGHDSLMWSALNHG  129

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI ++F  LESYHV YDTKV +A +LME+G+G +CTA+ DPR+S C
Sbjct  130  GRTVFLEEDKAWIEQIKQRFSGLESYHVVYDTKVREADELMEVGQGEDCTAVGDPRFSKC  189

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK +P  ++E  WDLIMVDAPTGY D+APGRM AIYTAG+MARNR E  GET+VFVH
Sbjct  190  RLALKGIPDEIFETEWDLIMVDAPTGYIDDAPGRMNAIYTAGLMARNREE--GETDVFVH  247

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGYM++QEGRLRHFTIPS+R +   PFCP
Sbjct  248  DVDRVVEDKFSKAFLCEGYMREQEGRLRHFTIPSHRANPGRPFCP  292



>ref|XP_007019817.1| UvrABC system protein C isoform 1 [Theobroma cacao]
 gb|EOY17042.1| UvrABC system protein C isoform 1 [Theobroma cacao]
Length=304

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY+T+ ITPQQT KEISV++R+LE+KSP NFLVFGLGHDSLMW  LNYG
Sbjct  82   KAPPSLANALVHYATTNITPQQTFKEISVSARVLEKKSPCNFLVFGLGHDSLMWTALNYG  141

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI +K P LESYHV YDTKV QA DLME G   EC  ++DPR+S C
Sbjct  142  GRTVFLEEDKAWIEQIKQKLPTLESYHVEYDTKVHQADDLMETGMKEECKVVSDPRFSKC  201

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALK  PS +Y++ WDLIMVDAPTG+HDEAPGRM AIYTAG+MARNR E  GET+VFVH
Sbjct  202  QLALKGFPSDIYDIEWDLIMVDAPTGFHDEAPGRMNAIYTAGLMARNREE--GETDVFVH  259

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGY+++Q+GRLRHFTIPS+R     PFCP
Sbjct  260  DVDRVVEDKFSKAFLCEGYLREQQGRLRHFTIPSHRARSGRPFCP  304



>emb|CAN66688.1| hypothetical protein VITISV_037863 [Vitis vinifera]
Length=293

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 195/225 (87%), Gaps = 5/225 (2%)
 Frame = +1

Query  301  SKNCN---KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDS  471
            + NC+    KIP S+A+A+IHY+TS ITPQQT KEISVTS+IL  KSP NFLVFGLGHDS
Sbjct  58   AANCSPTCTKIPTSLAQALIHYTTSTITPQQTLKEISVTSKILVNKSPCNFLVFGLGHDS  117

Query  472  LMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTA  651
            LMW  LN+GGRT+FLEEDEAWI QI ++FP LESYHV YD+KV+QA +LME+GKGPEC  
Sbjct  118  LMWRELNHGGRTIFLEEDEAWIEQIRQRFPKLESYHVMYDSKVNQADNLMEVGKGPECIG  177

Query  652  ITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
            + D R+S CQLALK LP+ VY++ WDLIMVDAPTGY++EAPGRMAAIYTAGMMARNR++ 
Sbjct  178  VGDIRHSTCQLALKGLPNEVYDIKWDLIMVDAPTGYYEEAPGRMAAIYTAGMMARNRKD-  236

Query  832  GGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR  966
             GET+VFVHDVNRVVEDKFS+AFLC+GYM+KQ GRLRHFTIP+ +
Sbjct  237  -GETDVFVHDVNRVVEDKFSRAFLCDGYMRKQTGRLRHFTIPTAK  280



>ref|XP_011005441.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Populus 
euphratica]
Length=304

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY T+ ITPQQT KEISVT R+LE+KSP NFLVFGLGHDSLMW +LN+G
Sbjct  82   KTPPSLANALVHYVTTNITPQQTLKEISVTLRVLEKKSPCNFLVFGLGHDSLMWTSLNHG  141

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QIT K P LESYHVTYDT+V QA  LME G G EC  ++DPR+S C
Sbjct  142  GRTVFLEEDKAWIEQITEKLPSLESYHVTYDTRVHQADGLMETGMGDECKIVSDPRFSKC  201

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALK  PS +Y++ WDLIMVDAPTGYHDEAPGRM AIYTAG+MARNR    GET+VFVH
Sbjct  202  QLALKGFPSDIYDMEWDLIMVDAPTGYHDEAPGRMTAIYTAGLMARNRE--NGETDVFVH  259

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGYM +QEGRLRHF IPS+R     PFCP
Sbjct  260  DVDRVVEDKFSKAFLCEGYMTEQEGRLRHFIIPSHRTRSGRPFCP  304



>ref|XP_002526403.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35979.1| conserved hypothetical protein [Ricinus communis]
Length=301

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 188/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY T+ ITPQQT KEISVT R+LE+KSP NFLVFGLGHDSLMW +LN+G
Sbjct  79   KTPPSLANALVHYVTTNITPQQTLKEISVTLRVLEKKSPCNFLVFGLGHDSLMWTSLNHG  138

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI  K P LESYHVTY+TKV QA  LME G G EC A++DPR S C
Sbjct  139  GRTVFLEEDKSWIEQIKAKQPSLESYHVTYETKVHQADGLMETGMGEECKAVSDPRLSSC  198

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALKS PS VY+  WDLIMVDAPTGYHDEAPGRM AIYTAG+MARNR    GET+VFVH
Sbjct  199  QLALKSFPSDVYDTEWDLIMVDAPTGYHDEAPGRMTAIYTAGLMARNRE--NGETDVFVH  256

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGY+ +QEGRLRHFTIPS+R  L  PFCP
Sbjct  257  DVDRVVEDKFSKAFLCEGYLVEQEGRLRHFTIPSHRARLGRPFCP  301



>ref|XP_006376148.1| hypothetical protein POPTR_0013s10240g [Populus trichocarpa]
 gb|ABK93991.1| unknown [Populus trichocarpa]
 gb|ERP53945.1| hypothetical protein POPTR_0013s10240g [Populus trichocarpa]
 gb|AHK60926.1| glucuronoxylan methyltransferase 3 [Populus trichocarpa]
Length=304

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY T+ ITPQQT KEISVT R+LE+KSP NFLVFGLGHDSLMW +LN+G
Sbjct  82   KTPPSLANALVHYVTTNITPQQTLKEISVTLRVLEKKSPCNFLVFGLGHDSLMWTSLNHG  141

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QIT K P LE+YHVTYDT+V QA  LME G G EC  ++DPR+S C
Sbjct  142  GRTVFLEEDKAWIEQITEKLPSLEAYHVTYDTRVHQADGLMETGMGDECKVVSDPRFSKC  201

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QL+LK  PS +Y++ WDLIMVDAPTGYHDEAPGRM AIYTAG+MARNR    GET+VFVH
Sbjct  202  QLSLKGFPSDIYDMEWDLIMVDAPTGYHDEAPGRMTAIYTAGLMARNRE--NGETDVFVH  259

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGY+ +QEGRLRHF IPS+R     PFCP
Sbjct  260  DVDRVVEDKFSKAFLCEGYLTEQEGRLRHFIIPSHRTRSGRPFCP  304



>ref|XP_007019818.1| UvrABC system protein C isoform 2, partial [Theobroma cacao]
 gb|EOY17043.1| UvrABC system protein C isoform 2, partial [Theobroma cacao]
Length=310

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 188/221 (85%), Gaps = 2/221 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY+T+ ITPQQT KEISV++R+LE+KSP NFLVFGLGHDSLMW  LNYG
Sbjct  82   KAPPSLANALVHYATTNITPQQTFKEISVSARVLEKKSPCNFLVFGLGHDSLMWTALNYG  141

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI +K P LESYHV YDTKV QA DLME G   EC  ++DPR+S C
Sbjct  142  GRTVFLEEDKAWIEQIKQKLPTLESYHVEYDTKVHQADDLMETGMKEECKVVSDPRFSKC  201

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALK  PS +Y++ WDLIMVDAPTG+HDEAPGRM AIYTAG+MARNR E  GET+VFVH
Sbjct  202  QLALKGFPSDIYDIEWDLIMVDAPTGFHDEAPGRMNAIYTAGLMARNREE--GETDVFVH  259

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDM  981
            DV+RVVEDKFSKAFLCEGY+++Q+GRLRHFTIPS+R   D+
Sbjct  260  DVDRVVEDKFSKAFLCEGYLREQQGRLRHFTIPSHRARSDV  300



>ref|XP_008441152.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Cucumis 
melo]
Length=287

 Score =   350 bits (897),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P SVA A+IHY+TS ITPQQT KEISV++RILE KSP NFLVFGLGHDSLMW  LN+G
Sbjct  65   KTPPSVANALIHYATSNITPQQTLKEISVSARILETKSPCNFLVFGLGHDSLMWTALNHG  124

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI  + P LE+YHV YDTKV QA +LM+IG G EC ++ DPR+  C
Sbjct  125  GRTVFLEEDKAWIDQIQERLPNLEAYHVQYDTKVHQADELMKIGMGEECKSVGDPRFCKC  184

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK LPS +YE+ WDLIMVDAPTGY +EAPGRM+AIYTAG+MARNR+E  GET+VFVH
Sbjct  185  ELALKGLPSEIYEMEWDLIMVDAPTGYFNEAPGRMSAIYTAGLMARNRQE--GETDVFVH  242

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVED FS AFLC+GY++KQEGR+RHF+IPS+R   D PFCP
Sbjct  243  DVDRVVEDNFSMAFLCKGYLRKQEGRIRHFSIPSHRTRPDTPFCP  287



>ref|XP_011031554.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Populus 
euphratica]
Length=301

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A A++HY T+ ITPQQT KEISV+ R+LE+KSP NFLVFGLGHDSLMW +LN+G
Sbjct  79   KIPPSLANALVHYVTTNITPQQTLKEISVSLRVLEKKSPCNFLVFGLGHDSLMWTSLNHG  138

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI  K P LESYHVTYDT+V QA  LME GKG EC  + DPR+S C
Sbjct  139  GRTVFLEEDKAWIEQIREKLPTLESYHVTYDTRVHQADGLMETGKGDECKVVGDPRFSKC  198

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALK  P  +Y++ WDLIMVDAPTGYHDEAPGRM AIYTAG+MARNR    G T+VFVH
Sbjct  199  QLALKGFPGDIYDIEWDLIMVDAPTGYHDEAPGRMNAIYTAGLMARNRE--NGVTDVFVH  256

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFS+AFLCEGY+ +QEGRLRHF IPS+R     PFCP
Sbjct  257  DVDRVVEDKFSRAFLCEGYLTEQEGRLRHFIIPSHRTSSGKPFCP  301



>ref|XP_002325525.2| hypothetical protein POPTR_0019s10490g [Populus trichocarpa]
 gb|EEE99906.2| hypothetical protein POPTR_0019s10490g [Populus trichocarpa]
 gb|AHK60927.1| glucuronoxylan methyltransferase 4 [Populus trichocarpa]
Length=301

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A A++HY T+ ITPQQT KEISV+ R+LE+KSP NFLVFGLGHDSLMW +LN+G
Sbjct  79   KIPPSLANALVHYVTTNITPQQTLKEISVSLRVLEKKSPCNFLVFGLGHDSLMWTSLNHG  138

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI  K P LESYHVTYDT+V QA  LME G G EC  + DPR+S C
Sbjct  139  GRTVFLEEDKAWIEQIREKLPTLESYHVTYDTRVHQADGLMETGMGDECKVVGDPRFSKC  198

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALK  P  +Y+V WDLIMVDAPTGYHDEAPGRM AIYTAG+MARNR    G T+VFVH
Sbjct  199  QLALKGFPGDIYDVEWDLIMVDAPTGYHDEAPGRMNAIYTAGLMARNRE--NGVTDVFVH  256

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGYM +QEGRLRHF IP++R     PFCP
Sbjct  257  DVDRVVEDKFSKAFLCEGYMTEQEGRLRHFIIPTHRTSSGKPFCP  301



>emb|CDP00853.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KI  S+A A++HY+T  ITPQQT KEISV+ R+LE+KSP NFLVFGLGHDSLMW  LN+G
Sbjct  88   KISPSLANAIVHYATLNITPQQTFKEISVSLRVLEKKSPCNFLVFGLGHDSLMWTALNHG  147

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI Q+ R+ P LESYHVTYDTKV+QA ++ME+G   +C  + DPR+S C
Sbjct  148  GRTVFLEEDKSWIEQVQRQLPNLESYHVTYDTKVTQADEMMEVGMREDCKVVGDPRFSKC  207

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LALK  PS VY++ WDLIMVDAPTG+HDEAPGRM AIYTAG+MARNR    GET+VFVH
Sbjct  208  GLALKGFPSEVYDIEWDLIMVDAPTGWHDEAPGRMTAIYTAGLMARNRE--SGETDVFVH  265

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VEDKFSK FLCEGY+++QEGR+RHFTIPS+R  L  PFCP
Sbjct  266  DVDRAVEDKFSKTFLCEGYLREQEGRIRHFTIPSHRARLGRPFCP  310



>ref|XP_004138670.1| PREDICTED: uncharacterized protein LOC101202991 [Cucumis sativus]
 gb|KGN63058.1| hypothetical protein Csa_2G396200 [Cucumis sativus]
Length=287

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P SVA A+IHY+T+ ITPQQT KEISV++RILE KSP NFLVFGLGHDSLMW  LN+G
Sbjct  65   KTPPSVANALIHYATTNITPQQTLKEISVSARILETKSPCNFLVFGLGHDSLMWTALNHG  124

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI  + P LE+YHV YDTKV QA +LM+IG G EC  + DPR+  C
Sbjct  125  GRTVFLEEDKAWIDQIQERLPNLEAYHVQYDTKVHQADELMKIGMGEECKIVGDPRFCKC  184

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK  PS +YE+ WDLIMVDAPTGY +EAPGRM+AIYTAG+MARNR+E  GET+VFVH
Sbjct  185  ELALKGFPSEIYEMEWDLIMVDAPTGYFNEAPGRMSAIYTAGLMARNRQE--GETDVFVH  242

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVED FS AFLC+GY+ KQEGR+RHF+IPS+R   D PFCP
Sbjct  243  DVDRVVEDNFSMAFLCKGYLTKQEGRIRHFSIPSHRTRPDTPFCP  287



>ref|XP_004158529.1| PREDICTED: uncharacterized LOC101202991 [Cucumis sativus]
Length=287

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P SVA A+IHY+T+ ITPQQT KEISV++RILE KSP NFLVFGLGHDSLMW  LN+G
Sbjct  65   KTPPSVANALIHYATTNITPQQTLKEISVSARILETKSPCNFLVFGLGHDSLMWTALNHG  124

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+AWI QI  + P LE+YHV YDTKV QA +LM+IG G EC  + DPR+  C
Sbjct  125  GRTVFLEEDKAWIDQIQERLPNLEAYHVQYDTKVHQADELMKIGMGEECKIVGDPRFCKC  184

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK  PS +YE+ WDLIMVDAPTGY +EAPGRM+AIYTAG+MARNR+E  GET+VFVH
Sbjct  185  ELALKGFPSEIYEMEWDLIMVDAPTGYFNEAPGRMSAIYTAGLMARNRQE--GETDVFVH  242

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVED FS AFLC+GY+ KQEGR+RHF+IPS+R   D PFCP
Sbjct  243  DVDRVVEDNFSMAFLCKGYLTKQEGRIRHFSIPSHRTRPDTPFCP  287



>ref|XP_009357185.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Pyrus 
x bretschneideri]
 ref|XP_009362363.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Pyrus 
x bretschneideri]
Length=297

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A A+IHY+T+ +TPQQT KE+SV++ IL +KSP NFLVFGLG DSLMW  LN+G
Sbjct  75   KIPPSLAHAIIHYATTNVTPQQTIKEVSVSAAILSKKSPCNFLVFGLGRDSLMWTALNHG  134

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED +WI QI +K P LE+YHVTYDTKV QA  LMEIG+  EC A+ DPR+S C
Sbjct  135  GRTVFLEEDNSWIDQIKQKLPGLEAYHVTYDTKVHQADKLMEIGRKEECKAVGDPRFSKC  194

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK+LPS VY++ WDLIMVDAPTGY D APGRM AIYTAG+M RNR E  GET VFVH
Sbjct  195  ELALKNLPSDVYDIEWDLIMVDAPTGYFDGAPGRMGAIYTAGLMGRNREE--GETHVFVH  252

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNRVVED FSKAFLCEGY+ +QEG LRHFTIPS+R  L  PFCP
Sbjct  253  DVNRVVEDSFSKAFLCEGYLTEQEGLLRHFTIPSHRARLGRPFCP  297



>ref|XP_010062382.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Eucalyptus 
grandis]
 gb|KCW69522.1| hypothetical protein EUGRSUZ_F02961 [Eucalyptus grandis]
Length=307

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = +1

Query  325  PASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGR  504
            P S+A+A++HY+T+ ITPQQT  EISV+ R+L +KSP NFLVFGLGHDSLMW +LN+GGR
Sbjct  87   PPSLAQALVHYATTNITPQQTYDEISVSLRVLAKKSPCNFLVFGLGHDSLMWTSLNHGGR  146

Query  505  TVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQL  684
            TVFLEED+AWIHQIT+K P LE++HVTYDTKV+QA +LM++ +  EC A+TDPR S C+L
Sbjct  147  TVFLEEDKAWIHQITQKLPTLEAFHVTYDTKVTQADNLMKLREEEECKAVTDPRSSKCEL  206

Query  685  ALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDV  864
            A K  PS VYEV WDLIMVDAPTG+HDEAPGRM+AIYTAG+MARNR    GET+VFVHDV
Sbjct  207  AHKGFPSEVYEVEWDLIMVDAPTGWHDEAPGRMSAIYTAGLMARNRE--SGETDVFVHDV  264

Query  865  NRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +RV+ED+FSKAFLCEGY+ +Q GRLRHFT+PS+R     PFCP
Sbjct  265  DRVIEDRFSKAFLCEGYLTEQVGRLRHFTVPSHRARSGRPFCP  307



>ref|XP_006478265.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Citrus 
sinensis]
 gb|KDO38549.1| hypothetical protein CISIN_1g021206mg [Citrus sinensis]
Length=316

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 187/226 (83%), Gaps = 3/226 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY+T+ ITPQQT KEISV+ R+L QKSP NFLVFGLG+DSLMW  LN+G
Sbjct  92   KTPPSLANALVHYATTNITPQQTVKEISVSLRVLAQKSPCNFLVFGLGYDSLMWSALNHG  151

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYSM  675
            GRT+FLEED++WI+QI  KFP LESYHV YDTKV++A +LM  +G   EC  +TDPR+S 
Sbjct  152  GRTLFLEEDKSWINQIKEKFPTLESYHVEYDTKVNEADELMNAVGSDEECRVVTDPRFSK  211

Query  676  CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFV  855
            C+LALK  PS VY+V WDLIMVDAPTGYH+ APGRM AIYTAG+MARNR    GET+VFV
Sbjct  212  CRLALKGFPSEVYDVEWDLIMVDAPTGYHEAAPGRMTAIYTAGLMARNRE--SGETDVFV  269

Query  856  HDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            HDV+RVVEDKFSKAFLCEGY+K+QEGR+RHF +PS+R     PFCP
Sbjct  270  HDVDRVVEDKFSKAFLCEGYLKEQEGRIRHFVVPSHRTRSARPFCP  315



>ref|XP_008368121.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Malus 
domestica]
Length=296

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A A+IHY+T+ +TPQQT KE+SV++ IL +KSP NFLVFGLG DSLMW  LN+G
Sbjct  74   KIPPSLAHAIIHYATTNVTPQQTIKEVSVSAAILSKKSPCNFLVFGLGLDSLMWTALNHG  133

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED +WI QI +K P LE+YHVTYDTKV QA  LMEIG+  EC A+ DPR+S C
Sbjct  134  GRTVFLEEDNSWIDQIKQKLPGLEAYHVTYDTKVHQADKLMEIGRKEECKAVGDPRFSKC  193

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK+LPS VY++ WDLIMVDAPTGY D APGRM AIYTAG+M RNR E  GET VFVH
Sbjct  194  ELALKNLPSDVYDIEWDLIMVDAPTGYFDGAPGRMGAIYTAGLMGRNREE--GETHVFVH  251

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNRVVED FSKAFLCEGY+ +QEG +RHFTIPS+R  L  PFCP
Sbjct  252  DVNRVVEDSFSKAFLCEGYLTEQEGLIRHFTIPSHRARLGRPFCP  296



>ref|XP_008219085.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Prunus 
mume]
Length=304

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 188/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A+IHY+T+ ITPQQT KEISV+SRIL++KSP NFLVFGLG DSLMW  LN+G
Sbjct  82   KTPPSLANAIIHYATTNITPQQTIKEISVSSRILQKKSPCNFLVFGLGLDSLMWTALNHG  141

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI +K P LE+YHV+YDTKV QA  LMEIG   +C  + DPR+S C
Sbjct  142  GRTVFLEEDKSWIEQIQQKLPNLEAYHVSYDTKVHQADKLMEIGMKEQCKVVGDPRFSKC  201

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK+ PS VY++ WDLIMVDAPTGY D APGRM+AIYTAG++ RNR E  GET+VFVH
Sbjct  202  ELALKNWPSEVYDIEWDLIMVDAPTGYFDGAPGRMSAIYTAGLLGRNREE--GETDVFVH  259

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VEDKFSKAFLCEGY+++QEGR+RHFTIPS+R  L  PFCP
Sbjct  260  DVDRNVEDKFSKAFLCEGYLREQEGRIRHFTIPSHRARLGRPFCP  304



>ref|XP_002279765.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Vitis vinifera]
 emb|CBI40958.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 195/247 (79%), Gaps = 10/247 (4%)
 Frame = +1

Query  277  PRKEARLSSKNCNK--------KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKS  432
            P  E +  S++C          K P S+A+A++HY+T  ITPQQT  EISV+ R+L++K+
Sbjct  56   PAAEEQPPSRDCPSLPLTPTCTKTPPSLAQALVHYATLNITPQQTFNEISVSLRVLQKKA  115

Query  433  PSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAG  612
            P NFLVFGLGHDSLMW  LN+GGRT+FLEED++WI QI +K P LESYHV YD+KV QA 
Sbjct  116  PCNFLVFGLGHDSLMWTALNHGGRTIFLEEDKSWIEQIKQKLPSLESYHVVYDSKVHQAD  175

Query  613  DLMEIGKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAI  792
            +LME+G G +C  + DPR+S C+L+LK  P+ VY+V WDLIMVDAPTGYHDEAPGRM+AI
Sbjct  176  ELMEVGMGEDCKVVVDPRFSKCKLSLKGFPNEVYDVEWDLIMVDAPTGYHDEAPGRMSAI  235

Query  793  YTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
            YTAG+MARNR +  GET+VFVHDV+RVVEDKFSKAFLCEGY ++QEGR+RHFTIPS+R  
Sbjct  236  YTAGLMARNRED--GETDVFVHDVDRVVEDKFSKAFLCEGYFREQEGRIRHFTIPSHRTR  293

Query  973  LDMPFCP  993
                FCP
Sbjct  294  SGRSFCP  300



>ref|XP_004250648.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Solanum 
lycopersicum]
Length=294

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  CNK I  S+A A++HY+TS +TPQQT KEISV+ ++LE+KSPSNFLVFGLGHDSLMW
Sbjct  66   SNTCNK-ISPSLANALVHYATSNVTPQQTLKEISVSLKVLEKKSPSNFLVFGLGHDSLMW  124

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAIT  657
              LN+GGRTVFLEED++WI QI  + P LESYHV YDT+++QA +LMEIG   E C  +T
Sbjct  125  TALNHGGRTVFLEEDKSWIEQIQSQLPNLESYHVIYDTRITQADELMEIGMSNEDCKKVT  184

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S CQLALK LP  V E+ WDLIMVDAPTG+HD APGRM+AIYTAG++ARN++E  G
Sbjct  185  DPRLSKCQLALKGLPQQVLEIDWDLIMVDAPTGWHDGAPGRMSAIYTAGLIARNKQE--G  242

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET VFVHDV+RVVED+FSKAFLCEGY+ +QEGR+RHF IPS++  L  PFCP
Sbjct  243  ETHVFVHDVDRVVEDQFSKAFLCEGYLLQQEGRIRHFNIPSHKARLGRPFCP  294



>gb|EYU22748.1| hypothetical protein MIMGU_mgv1a011269mg [Erythranthe guttata]
Length=287

 Score =   340 bits (873),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 188/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KI  S+A A++HY+T  ITPQQT KEISV+ +ILE+KSP NFLVFGLGHDSLMW +LN+G
Sbjct  65   KIAPSLAHALVHYATLNITPQQTFKEISVSLKILEKKSPCNFLVFGLGHDSLMWTSLNHG  124

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI  + P LESYHV YDTKV+QA +L+EI +  EC  ++DPR+S C
Sbjct  125  GRTVFLEEDKSWIQQINARIPSLESYHVNYDTKVTQADELLEISEREECRTVSDPRFSKC  184

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            QLALK LPS +Y++ WDLIMVDAPTGY D APGRM+AIYTAG+MARNR    GET+VFVH
Sbjct  185  QLALKGLPSEIYDIDWDLIMVDAPTGYFDGAPGRMSAIYTAGLMARNRE--NGETDVFVH  242

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKA LC+GY+++QEGR+RHFTIPS+R     PFCP
Sbjct  243  DVDRVVEDKFSKALLCQGYLREQEGRIRHFTIPSHRTRSARPFCP  287



>ref|XP_010912696.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Elaeis 
guineensis]
Length=282

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 191/233 (82%), Gaps = 3/233 (1%)
 Frame = +1

Query  295  LSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSL  474
            L + +C K IP S+A  +IH++ S +TPQQT  EISVT+R+LE+KSP NFLVFGLGHDS 
Sbjct  53   LPTPSCTK-IPHSLANTIIHHAASNMTPQQTFNEISVTARVLEKKSPCNFLVFGLGHDSP  111

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI  654
            MW  LN+GGRTVFLEED+AW+  + +KFP LESYH TYDTKVSQA  L+++ + P+CTA+
Sbjct  112  MWSALNHGGRTVFLEEDKAWMETVRQKFPTLESYHATYDTKVSQADHLLKLRRQPDCTAV  171

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            +D R+S CQLALKSLP + YEV WDLIMVDAPTG+  EAPGRM AIYTAGM AR R +  
Sbjct  172  SDMRFSKCQLALKSLPIVFYEVEWDLIMVDAPTGWIPEAPGRMGAIYTAGMAARARSK--  229

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            GET+VFVHDV+RVVEDKFSK FLCEGY+K+QEGRLR FTIPS+R  L MPFCP
Sbjct  230  GETDVFVHDVDRVVEDKFSKTFLCEGYLKEQEGRLRRFTIPSHRTSLGMPFCP  282



>ref|XP_010930428.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Elaeis 
guineensis]
Length=284

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 190/233 (82%), Gaps = 3/233 (1%)
 Frame = +1

Query  295  LSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSL  474
            L + +C K IP S+A  +IHY+TS  TPQQT KEISVT+R+LE+K+P NFLVFGLG DS 
Sbjct  55   LPTTSCTK-IPQSLANTIIHYATSNTTPQQTFKEISVTARVLEKKAPCNFLVFGLGRDSP  113

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI  654
            MW  LN+GGRTVFLEED +W+  I  KFP LESYHVTYDTKV+QA DL+E+ + P CTA+
Sbjct  114  MWTALNHGGRTVFLEEDMSWMETIQEKFPTLESYHVTYDTKVTQANDLLELRREPACTAV  173

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
             + ++S CQLALK LPS+ +EV WDLIMVDAPTG+  EAPGRM AIYTAGM AR R E  
Sbjct  174  GEVKFSKCQLALKRLPSVFFEVEWDLIMVDAPTGWIPEAPGRMGAIYTAGMAARARTE--  231

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            GET+VFVHDV+RVVEDKFSK FLCEGY+++QEGRLRHFT+PS+R   D+PFCP
Sbjct  232  GETDVFVHDVDRVVEDKFSKIFLCEGYLREQEGRLRHFTVPSHRTGSDIPFCP  284



>ref|XP_010100099.1| hypothetical protein L484_014289 [Morus notabilis]
 gb|EXB81482.1| hypothetical protein L484_014289 [Morus notabilis]
Length=306

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 188/239 (79%), Gaps = 3/239 (1%)
 Frame = +1

Query  277  PRKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFG  456
            P  E  +    C K  P S+A A++HY+ + ITPQQT KEISV+  +LE+KSP NFLVFG
Sbjct  71   PTLEPSIPVTTCTK-TPPSLANALVHYAATNITPQQTQKEISVSMSVLEKKSPCNFLVFG  129

Query  457  LGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG  636
            LGHDSLMW  LN+GGRTVFLEED+AWI QI R+FP LESYHVTYDTKV QA +L+++G  
Sbjct  130  LGHDSLMWTALNHGGRTVFLEEDKAWIEQIKRRFPGLESYHVTYDTKVHQAEELLKLGDS  189

Query  637  PECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMAR  816
             EC A+ DPR+S CQLALK+ PS VY+  WDLIMVDAPTGY D APGRM+AIYTAG+MAR
Sbjct  190  EECKAVGDPRFSDCQLALKNFPSEVYDTEWDLIMVDAPTGYFDGAPGRMSAIYTAGIMAR  249

Query  817  NRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            NR    GET+VFVHDV+RVVEDKFSK FLCEGY+ +QEGRLRHF +PS+R      FCP
Sbjct  250  NRE--SGETDVFVHDVDRVVEDKFSKTFLCEGYLAQQEGRLRHFILPSHRARAGRLFCP  306



>ref|XP_007223179.1| hypothetical protein PRUPE_ppa009168mg [Prunus persica]
 gb|EMJ24378.1| hypothetical protein PRUPE_ppa009168mg [Prunus persica]
Length=304

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A+IHY+T+ ITPQQT KEISV+SRIL++KSP NFLVFGLG DSLMW  LN+G
Sbjct  82   KTPPSLANAIIHYATTNITPQQTIKEISVSSRILQKKSPCNFLVFGLGLDSLMWTALNHG  141

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI +K P LE+YHV+YDTKV QA  LMEIG   EC  + DPR+S C
Sbjct  142  GRTVFLEEDKSWIEQIQQKLPNLEAYHVSYDTKVHQADKLMEIGMKEECKVVGDPRFSKC  201

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK+ PS VY++ WDLIMVDAPTGY D APGRM+AIYTAG++ RNR E  GET+VFVH
Sbjct  202  ELALKNWPSEVYDIEWDLIMVDAPTGYFDGAPGRMSAIYTAGLLGRNREE--GETDVFVH  259

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VEDKFSKAFLCEGY++++EGR+R FTIPS+R  L  PFCP
Sbjct  260  DVDRNVEDKFSKAFLCEGYLREEEGRIRRFTIPSHRARLGRPFCP  304



>ref|XP_006339353.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Solanum 
tuberosum]
Length=308

 Score =   339 bits (870),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  CNK I  S+A A++HY+TS +TPQQT KEISV+ R+LE+KSP NFLVFGLGHDSLMW
Sbjct  80   SNTCNK-ISPSLANALVHYATSNVTPQQTLKEISVSLRVLEKKSPCNFLVFGLGHDSLMW  138

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAIT  657
              LN+GGRTVFLEED++WI QI  + P LESYHV YDT+++QA +LMEIG   E C  +T
Sbjct  139  TALNHGGRTVFLEEDKSWIEQIQSQLPNLESYHVIYDTRITQADELMEIGMSNEDCKKVT  198

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR+S CQLALK LP  V E+ WDLIMVDAPTG+HD APGRM+AIYTAG++ARN+ +  G
Sbjct  199  DPRFSKCQLALKGLPQQVLEIDWDLIMVDAPTGWHDGAPGRMSAIYTAGLIARNKLD--G  256

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDV+R+VED+FSKAFLCE Y+ +QEGR+RHF IPS+R+ L  PFCP
Sbjct  257  ETDVFVHDVDRIVEDQFSKAFLCESYLVEQEGRIRHFNIPSHRSRLGRPFCP  308



>ref|NP_192737.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9T0F7.1|GXM2_ARATH RecName: Full=Glucuronoxylan 4-O-methyltransferase 2 [Arabidopsis 
thaliana]
 emb|CAB39623.1| putative protein [Arabidopsis thaliana]
 emb|CAB78122.1| putative protein [Arabidopsis thaliana]
 gb|ABN04828.1| At4g09990 [Arabidopsis thaliana]
 gb|AEE82826.1| uncharacterized protein AT4G09990 [Arabidopsis thaliana]
 gb|AFU91593.1| glucuronoxylan methyltransferase 2 [Arabidopsis thaliana]
Length=290

 Score =   338 bits (867),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 185/225 (82%), Gaps = 1/225 (0%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P S++ A++HY TS ITPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLMW +LN+G
Sbjct  60   KLPTSLSDALVHYVTSEITPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLMWASLNHG  119

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEEDEAWI  +T+KFP LESYHV YDTKV  +  LME+ +  +C A++DPR S C
Sbjct  120  GRTLFLEEDEAWIETVTKKFPNLESYHVVYDTKVKDSNKLMELKRTEDCKAVSDPRDSKC  179

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             L+LK  P+ VYE  WD+IMVDAPTGYHDEAPGRM+AIYTAG++ARNR + GGET+VFVH
Sbjct  180  ALSLKGFPADVYETQWDVIMVDAPTGYHDEAPGRMSAIYTAGLLARNRYD-GGETDVFVH  238

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            D+NR VED+FS AFLC GYMK+Q+GRLRHF IPS+R     PFCP
Sbjct  239  DINRPVEDEFSVAFLCGGYMKEQQGRLRHFNIPSHRASFGTPFCP  283



>emb|CDY48797.1| BnaA05g20730D [Brassica napus]
Length=297

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY TS +TPQQT  EISV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  62   TTQQCTK-MPISLSDALVHYVTSNVTPQQTFDEISVSKRVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T KFP LESYHV YDTKV  +  LME+G+  ECT++T
Sbjct  121  WASLNHGGRTLFIEEDKAWIETVTNKFPNLESYHVVYDTKVKNSDKLMELGRSEECTSVT  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  181  DPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  239  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARTGRPFCP  290



>ref|XP_006441614.1| hypothetical protein CICLE_v10021249mg [Citrus clementina]
 gb|ESR54854.1| hypothetical protein CICLE_v10021249mg [Citrus clementina]
Length=314

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 185/226 (82%), Gaps = 3/226 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A++HY+T+ ITPQQT KEISV+ R+L QKSP NFLVFGLG+DSLMW  LN+G
Sbjct  90   KTPPSLANALVHYATTNITPQQTLKEISVSLRVLAQKSPCNFLVFGLGYDSLMWSALNHG  149

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYSM  675
            GRT+FLEED++WI+Q+  KFP LESYHV YDTKV++A +LM  +    EC  +TDPR+S 
Sbjct  150  GRTLFLEEDKSWINQMKEKFPTLESYHVEYDTKVNEADELMNTVASDEECRVVTDPRFSK  209

Query  676  CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFV  855
            C+LALK  PS VY+V WDLIMVDAPTGYH+ APGRM AIYTAG+M RNR    GET+VFV
Sbjct  210  CRLALKGFPSEVYDVEWDLIMVDAPTGYHEAAPGRMTAIYTAGLMGRNRE--SGETDVFV  267

Query  856  HDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            HDV+RVVEDKFSKAFLCEGY+K+QEGR+RHF +PS+R     PFCP
Sbjct  268  HDVDRVVEDKFSKAFLCEGYLKEQEGRIRHFVVPSHRTRSARPFCP  313



>ref|XP_009145172.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Brassica rapa]
Length=297

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  62   TTQQCTK-MPISLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T KFP LESYHV YDTKV  +  LME+G+  ECT++T
Sbjct  121  WASLNHGGRTLFIEEDKAWIETVTNKFPNLESYHVVYDTKVKNSDKLMELGRSEECTSVT  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  181  DPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  239  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARTGRPFCP  290



>ref|XP_008786409.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Phoenix dactylifera]
Length=284

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 191/233 (82%), Gaps = 3/233 (1%)
 Frame = +1

Query  295  LSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSL  474
            +++ +C K +P  +A  +IHY+TS  TPQQT +EISVT+R+LE+K+P N LVFGLGHDS 
Sbjct  55   VTASSCTK-LPQFLANTIIHYATSNTTPQQTFEEISVTARVLEKKAPCNLLVFGLGHDSA  113

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI  654
            MW  LN+GGRTVFLEEDE+W+  + +K PMLES+HVTYDTKV+QA DL+E+ + PECTA+
Sbjct  114  MWSALNHGGRTVFLEEDESWMEIVRQKSPMLESHHVTYDTKVTQADDLLELRRKPECTAV  173

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
             D ++S C LALK +PS+ +EV WDLIMVDAPTG+  EAPGRM AIYTAGM AR R E  
Sbjct  174  GDMKFSKCHLALKRMPSVFFEVEWDLIMVDAPTGWIPEAPGRMGAIYTAGMAARARSE--  231

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            GET+VFVHDV+RVVEDKFSK FLCEGY+K+Q+GRLRHF IPS+R   DMPFCP
Sbjct  232  GETDVFVHDVDRVVEDKFSKTFLCEGYLKEQQGRLRHFIIPSHRTGSDMPFCP  284



>ref|XP_011095869.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Sesamum 
indicum]
Length=296

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KI  S+A A++HY+T  ITPQQT KEISV+ ++LE KSP NFLVFGLGHDSLMW  LN+G
Sbjct  74   KISPSLAHALVHYATLNITPQQTLKEISVSLKVLENKSPCNFLVFGLGHDSLMWTALNHG  133

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI R+ P LESYHV YDTKV+QA +L+EI    EC  + DPR+S C
Sbjct  134  GRTVFLEEDKSWIQQIQRQIPSLESYHVVYDTKVTQADELLEISTKEECKTVGDPRFSKC  193

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LALK LP+ VY++ WDLIMVDAPTGY D APGRM+AIYTAG+MARNR    GET+VFVH
Sbjct  194  PLALKGLPNEVYDIEWDLIMVDAPTGYFDGAPGRMSAIYTAGLMARNRE--NGETDVFVH  251

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKA LCEGY+++QEGR+RHFTIPS+R     PFCP
Sbjct  252  DVDRVVEDKFSKALLCEGYLREQEGRIRHFTIPSHRTRSGRPFCP  296



>ref|XP_008378726.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Malus domestica]
Length=294

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A+IHY+T+ +TPQQT KE+SV++ +L QKSP NFLVFGLG DSLMW  LN+G
Sbjct  72   KTPPSLAHAIIHYATTNVTPQQTMKEVSVSAAVLSQKSPCNFLVFGLGFDSLMWTALNHG  131

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEED +WI QI +K P LE+YHV YDTKV QA  LME+G+  EC A+ DPR+S C
Sbjct  132  GRTIFLEEDNSWIDQIKQKLPGLEAYHVKYDTKVHQADKLMEMGRKEECRAVGDPRFSKC  191

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK+LPS VY++ WDLIMVDAPTGY D APGRM+AIYTAG++ RNR E  GE  VFVH
Sbjct  192  ELALKNLPSDVYDIEWDLIMVDAPTGYFDGAPGRMSAIYTAGLLGRNREE--GEAHVFVH  249

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVED FSKAFLCEGY+ +QEGR+RHFTIPS+R  L  PFCP
Sbjct  250  DVDRVVEDSFSKAFLCEGYLTEQEGRIRHFTIPSHRARLGRPFCP  294



>ref|XP_009773426.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Nicotiana 
sylvestris]
Length=300

 Score =   336 bits (862),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            ++ CNK I  S++ A++HY+TS +TPQQT KEI+V+ R+LE+KSP NFLVFGLGHDSLMW
Sbjct  72   TQTCNK-ISPSLSNALVHYATSNVTPQQTIKEIAVSLRVLEKKSPCNFLVFGLGHDSLMW  130

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAIT  657
              LN+GGRTVFLEED++WI QI  + P LES+HV YDT+++QA +LMEIG   E C  +T
Sbjct  131  TALNHGGRTVFLEEDKSWIEQIQSQLPNLESHHVVYDTRITQADELMEIGMSNEDCKKVT  190

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR+S CQLALK LP  V E+ WDLIMVDAPTG+HD APGRM+AIYTAG++ARN+    G
Sbjct  191  DPRFSKCQLALKGLPKEVLEIDWDLIMVDAPTGWHDGAPGRMSAIYTAGLIARNKE--NG  248

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDV+RVVED+FSKAFLCEGY+ +QEGR+RHF IPS++  L  PFCP
Sbjct  249  ETDVFVHDVDRVVEDQFSKAFLCEGYLVEQEGRIRHFNIPSHKARLGRPFCP  300



>ref|XP_010667408.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Beta 
vulgaris subsp. vulgaris]
Length=289

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 186/235 (79%), Gaps = 4/235 (2%)
 Frame = +1

Query  295  LSSKNC-NKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDS  471
            + ++NC   KIP S++  +IHY+TS ITPQQT KEISVT RIL +KSPSNFLVFGLG DS
Sbjct  50   VKTQNCPCNKIPPSLSDTIIHYATSNITPQQTAKEISVTERILRRKSPSNFLVFGLGRDS  109

Query  472  LMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG-KGPECT  648
            LMW +LN+GGRTVFLEE+E WI +I  +FP LESY  TYDTKV  + DLM    K  EC+
Sbjct  110  LMWASLNHGGRTVFLEENEGWISEIKAQFPTLESYLATYDTKVRHSDDLMTSAVKSEECS  169

Query  649  AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRRE  828
             + DPR S C LALKSLP+ +YE+ WDLIMVDAPTGYHDEAPGRM+AIYTAG+M RNR  
Sbjct  170  NVVDPRKSECNLALKSLPNEIYEIEWDLIMVDAPTGYHDEAPGRMSAIYTAGLMGRNREV  229

Query  829  GGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
              GET+VFVHDVNRVVEDKFS  FLCEGYM +QEGRLRHFTIPS++     PFCP
Sbjct  230  --GETDVFVHDVNRVVEDKFSMEFLCEGYMIQQEGRLRHFTIPSHKARRGRPFCP  282



>gb|KFK45099.1| hypothetical protein AALP_AA1G343500 [Arabis alpina]
Length=296

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S++ C K +P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  61   STQQCTK-MPISLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM  119

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  EC +++
Sbjct  120  WASLNHGGRTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGQSEECRSVS  179

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAGM+ARNR +  G
Sbjct  180  DPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGMLARNRED--G  237

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  238  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  289



>ref|XP_002891062.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67321.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=298

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  63   TTQQCTK-MPLSLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM  121

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EEDEAWI  +T+KFP LESYHV YDTKV  +  LME+G+  EC +++
Sbjct  122  WASLNHGGRTLFIEEDEAWISIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSEECRSVS  181

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  182  DPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  239

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  240  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  291



>ref|XP_009588800.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Nicotiana 
tomentosiformis]
 ref|XP_009588801.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Nicotiana 
tomentosiformis]
Length=300

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 189/232 (81%), Gaps = 4/232 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            ++ CNK I  S+A A++HY+TS +TPQQT+KEISV+ R+LE+KSP NFLVFGLGHDSLMW
Sbjct  72   TQTCNK-ISPSLANALVHYATSNVTPQQTSKEISVSLRVLEKKSPCNFLVFGLGHDSLMW  130

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAIT  657
              LN  GRTVFLEED++WI QI  + P LES+HV YDT+++QA +LMEIG   E C  +T
Sbjct  131  TALNQNGRTVFLEEDKSWIEQIQSQLPNLESHHVIYDTRITQADELMEIGMSNEDCKKVT  190

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR+S CQLALK LP  V E+ WDLIMVDAPTG+HD APGRM+AIYTAG++ARN+    G
Sbjct  191  DPRFSKCQLALKGLPKEVLEIDWDLIMVDAPTGWHDGAPGRMSAIYTAGLIARNKE--NG  248

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDV+RVVED+FSKAFLCEGY+ +QEGR+RHF IPS++  L   FCP
Sbjct  249  ETDVFVHDVDRVVEDQFSKAFLCEGYLVEQEGRIRHFNIPSHKARLGRTFCP  300



>ref|XP_003598051.1| hypothetical protein MTR_3g005710 [Medicago truncatula]
 gb|AES68302.1| glucuronoxylan 4-O-methyltransferase [Medicago truncatula]
 gb|AFK39995.1| unknown [Medicago truncatula]
Length=298

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 188/229 (82%), Gaps = 4/229 (2%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            C K  P S+A A+IHY+T+ ITPQQT +EISV++++L++KSP NFLVFGLGHDSLMW +L
Sbjct  73   CTKN-PPSLANALIHYATTKITPQQTIQEISVSAKVLQKKSPCNFLVFGLGHDSLMWTSL  131

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAITDPR  666
            NYGGRTVFLEED+ WI QI  KFP LESYHV YDTKV Q+ +LM+IG   E C  ++DPR
Sbjct  132  NYGGRTVFLEEDKTWIEQIQSKFPTLESYHVVYDTKVHQSDELMKIGMEQEDCKKVSDPR  191

Query  667  YSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
            +S C LALK  PS +Y+V WD+IMVDAPTGY D APGRM+AIYTAG++ARNR    G+T+
Sbjct  192  FSKCGLALKGFPSEIYDVEWDVIMVDAPTGYFDGAPGRMSAIYTAGLIARNRE--NGDTD  249

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VFVHDV+R VED+FSKAFLCEGY+++QEGR+RHF IPS+R  L  P+CP
Sbjct  250  VFVHDVDRKVEDQFSKAFLCEGYLREQEGRIRHFNIPSHRARLGRPYCP  298



>ref|XP_010252121.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nelumbo 
nucifera]
Length=321

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 190/228 (83%), Gaps = 5/228 (2%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A+A+IHYSTS +TPQQT KEISVT ++LE++SP NFLVFGLGHDSLMW  LN+G
Sbjct  96   KIPPSLAQALIHYSTSNVTPQQTLKEISVTWKVLEKRSPCNFLVFGLGHDSLMWSALNHG  155

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED AWI QI ++FP LES+HV YDTKV QA DL+++GK  EC  + DPR S C
Sbjct  156  GRTVFLEEDRAWIDQIKQRFPTLESHHVVYDTKVRQAEDLLKVGKREECAVVGDPRSSKC  215

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK +P  +YE+ WDLIMVDAPTGY ++APGRM A+YTAG+MARNR++  G+T+VFVH
Sbjct  216  RLALKGMPDEIYEIEWDLIMVDAPTGYFEDAPGRMTALYTAGLMARNRKD--GDTDVFVH  273

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR---NHLDMPFCP  993
            DV+R+VEDKFS+AFLC+GYM++Q+GRLRHFTIPS     +  D  FCP
Sbjct  274  DVDRLVEDKFSRAFLCDGYMREQQGRLRHFTIPSQTLGASPGDGLFCP  321



>ref|XP_006415059.1| hypothetical protein EUTSA_v10008341mg [Eutrema salsugineum]
 gb|ESQ33412.1| hypothetical protein EUTSA_v10008341mg [Eutrema salsugineum]
Length=295

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S++ C K +P S++ A++HY TS ITPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  60   STQQCTK-MPISLSDALVHYVTSNITPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM  118

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  EC +++
Sbjct  119  WASLNHGGRTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSEECRSVS  178

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  179  DPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  236

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  237  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  288



>ref|XP_006397117.1| hypothetical protein EUTSA_v10028858mg [Eutrema salsugineum]
 gb|ESQ38570.1| hypothetical protein EUTSA_v10028858mg [Eutrema salsugineum]
Length=289

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 186/225 (83%), Gaps = 1/225 (0%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P S++ A++HY T+ ITPQQT  E+SV+ RIL++KSP NFLVFGLGHDSLMW +LN+ 
Sbjct  59   KLPTSLSDALVHYVTTEITPQQTFNEVSVSKRILDKKSPCNFLVFGLGHDSLMWASLNHA  118

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEED+AWI  +T+KFP LESYHV YDTK+  +  L+E+ K  +C +++DPR S C
Sbjct  119  GRTLFLEEDKAWIETVTKKFPSLESYHVVYDTKLKDSNKLIELEKTEDCKSVSDPRDSKC  178

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             L+LK  P+ VYE  WDLIMVDAPTGYHDEAPGRM+AIYTAG++ARNR + GGET+VFVH
Sbjct  179  ALSLKGFPADVYETQWDLIMVDAPTGYHDEAPGRMSAIYTAGLLARNRFD-GGETDVFVH  237

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNR VED+FS AFLC GY+K+Q+GRLRHFTIPS+R+    PFCP
Sbjct  238  DVNRPVEDEFSAAFLCRGYLKEQQGRLRHFTIPSHRSRSGTPFCP  282



>ref|NP_564428.1| glucuronoxylan 4-O-methyltransferase [Arabidopsis thaliana]
 sp|Q9LQ32.1|GXM3_ARATH RecName: Full=Glucuronoxylan 4-O-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAF97282.1|AC010164_4 Hypothetical protein [Arabidopsis thaliana]
 gb|AAL50109.1| At1g33800/F14M2_23 [Arabidopsis thaliana]
 gb|AAM19911.1| At1g33800/F14M2_23 [Arabidopsis thaliana]
 gb|AAM61226.1| unknown [Arabidopsis thaliana]
 gb|AEE31626.1| glucuronoxylan 4-O-methyltransferase [Arabidopsis thaliana]
 gb|AFU91594.1| glucuronoxylan methyltransferase 3 [Arabidopsis thaliana]
Length=297

 Score =   334 bits (856),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 191/238 (80%), Gaps = 3/238 (1%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            ++E   +++ C K +P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGL
Sbjct  56   KQEGCPTTQQCTK-MPLSLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGL  114

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  
Sbjct  115  GHDSLMWASLNHGGRTLFIEEDQAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSE  174

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            EC +++DPR S C LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARN
Sbjct  175  ECRSVSDPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARN  234

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R +  GET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  235  RED--GETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  290



>ref|XP_007148617.1| hypothetical protein PHAVU_005G001400g [Phaseolus vulgaris]
 gb|ESW20611.1| hypothetical protein PHAVU_005G001400g [Phaseolus vulgaris]
Length=310

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 190/228 (83%), Gaps = 3/228 (1%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK  P S++ A+IHY T+ ITPQQT +EISV++R+L++KSP NFLVFGLGHDSLMW +L
Sbjct  85   CNKA-PPSLSNALIHYVTTNITPQQTLREISVSARVLQKKSPCNFLVFGLGHDSLMWTSL  143

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            NYGGRTVFLEED++WI QI +K P LESYHV YDT+V QA +L+++G   +C  ++DPR+
Sbjct  144  NYGGRTVFLEEDKSWIDQIQQKIPSLESYHVMYDTQVHQAEELLKVGMEADCKKVSDPRF  203

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            S CQLA K  PS VY++ WD+IMVDAPTGY + APGRM AIYTAG++ARN+  G GET+V
Sbjct  204  SQCQLAHKGFPSEVYDIDWDVIMVDAPTGYFEGAPGRMTAIYTAGLIARNK--GHGETDV  261

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDV+R VEDKFSKAFLCEGY+K+QEGR+RHF IPS+R+ L  PFCP
Sbjct  262  FVHDVDRDVEDKFSKAFLCEGYLKEQEGRIRHFNIPSHRSRLWRPFCP  309



>emb|CDY15292.1| BnaC06g07780D [Brassica napus]
Length=296

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 189/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY+TS +TPQQT  EISV+ R+L++KSP NFLVFGLGHDS M
Sbjct  61   TTQQCTK-MPISLSDALVHYATSNVTPQQTFDEISVSKRVLDKKSPCNFLVFGLGHDSPM  119

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LE+YHV YDTKV  +  LME+G+  EC ++T
Sbjct  120  WASLNHGGRTLFIEEDKAWIEIVTKKFPNLEAYHVVYDTKVKHSDKLMELGRSEECRSVT  179

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C+LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  180  DPRNSKCELALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  237

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  238  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  289



>ref|XP_009114783.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Brassica 
rapa]
 emb|CDX93751.1| BnaA09g23510D [Brassica napus]
Length=296

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 189/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY+TS +TPQQT  EISV+ R+L++KSP NFLVFGLGHDS M
Sbjct  61   TTQQCTK-MPISLSDALVHYATSNVTPQQTFDEISVSKRVLDKKSPCNFLVFGLGHDSPM  119

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LE+YHV YDTKV  +  LME+G+  EC ++T
Sbjct  120  WASLNHGGRTLFIEEDKAWIEIVTKKFPNLEAYHVVYDTKVKHSDKLMELGRSEECRSVT  179

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C+LALK  P+  YE  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  180  DPRNSKCELALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  237

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  238  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  289



>ref|XP_002874599.1| hypothetical protein ARALYDRAFT_489845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50858.1| hypothetical protein ARALYDRAFT_489845 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score =   333 bits (854),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 191/233 (82%), Gaps = 2/233 (1%)
 Frame = +1

Query  295  LSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSL  474
            L+S  C K IP S++ A++HY T+ ITPQQT  EISV+ R+L++KSP NFLVFGLGHDSL
Sbjct  53   LTSLQCTK-IPISLSDALVHYVTTEITPQQTFDEISVSKRVLDKKSPCNFLVFGLGHDSL  111

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI  654
            MW +LN+GGRT+FLEED+AWI  +T+KFP LESYHV YDTKV  +  L+E+ +  +C A+
Sbjct  112  MWASLNHGGRTLFLEEDKAWIKTVTKKFPNLESYHVEYDTKVKDSNKLIELERTEDCKAV  171

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            +DPR S C L+LK  P+ VYE  WD+IMVDAPTGY+D+APGRM+AIYTAG++ARNR + G
Sbjct  172  SDPRDSKCALSLKDFPADVYETQWDVIMVDAPTGYNDDAPGRMSAIYTAGLLARNRYD-G  230

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            GET+VFVHD+NR VED+FS AFLC GY+K+Q+GRLRHFTIPS+R  L  PFCP
Sbjct  231  GETDVFVHDINRPVEDEFSVAFLCRGYIKEQQGRLRHFTIPSHRASLGTPFCP  283



>ref|XP_003523475.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Glycine 
max]
 gb|KHN47081.1| hypothetical protein glysoja_018448 [Glycine soja]
Length=306

 Score =   333 bits (855),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A+IHY+T+ +TPQQT  EISV++R+LE+KSP NFLVFGLGHDSLMW +LNYG
Sbjct  83   KAPPSLANAIIHYATANVTPQQTLHEISVSARVLEKKSPCNFLVFGLGHDSLMWTSLNYG  142

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI  K P LESYHV YDT+V QA +LM+ G   +C  +TDPR+S C
Sbjct  143  GRTVFLEEDKSWIDQIQEKVPSLESYHVMYDTQVHQAEELMKTGMKEDCQKVTDPRFSRC  202

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LA K LPS VY++ WD+IMVDAPTGY DEAPGRM+AIYTAG++ARN+    G+T+VFVH
Sbjct  203  PLAHKGLPSEVYDIDWDVIMVDAPTGYFDEAPGRMSAIYTAGLIARNKER--GQTDVFVH  260

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VED FSKAFLCEGY K+QEGR+RHF IPS+R+ L  PFCP
Sbjct  261  DVDRKVEDMFSKAFLCEGYFKEQEGRIRHFNIPSHRSRLWRPFCP  305



>ref|XP_009379025.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Pyrus 
x bretschneideri]
Length=294

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A+IHY+T+ +TPQQT  E+SV++ +L QK+P +FLVFGLG DSLMW  LN+G
Sbjct  72   KTPPSLAHAIIHYATTNVTPQQTINEVSVSAAVLSQKAPCDFLVFGLGFDSLMWTALNHG  131

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED +WI QI +K P LE+YHVTYDTKV +A  LME+G+  EC A+ DPR S C
Sbjct  132  GRTVFLEEDSSWIDQIKQKLPGLEAYHVTYDTKVHEADKLMEMGRKEECRAVGDPRLSKC  191

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LALK+LPS VY++ WDLIMVDAPTGY D APGRM+AIYTAG+M RNR +  GET VFVH
Sbjct  192  ELALKNLPSDVYDIEWDLIMVDAPTGYFDGAPGRMSAIYTAGLMGRNRED--GETHVFVH  249

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVED FSKAFLCEGY+ +QEGR+RHFTIPS+R  L  PFCP
Sbjct  250  DVDRVVEDSFSKAFLCEGYLTEQEGRIRHFTIPSHRARLGRPFCP  294



>ref|XP_010542789.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Tarenaya 
hassleriana]
Length=306

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+PAS+A A++HY T+ ITPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLMW +LN+G
Sbjct  73   KLPASLADALVHYVTTNITPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLMWASLNHG  132

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEED++WI  +T KFP LESYHV YDTKV  +  LME+GK  +C A++DPR S C
Sbjct  133  GRTLFLEEDKSWIETVTHKFPKLESYHVVYDTKVKDSDKLMELGKTDDCKAVSDPRDSKC  192

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LALK LP  VYE  WDLIMVDAPTGYH+EAPGRM+AIYTAG+MARNR    GET+VFVH
Sbjct  193  GLALKGLPPDVYETEWDLIMVDAPTGYHNEAPGRMSAIYTAGLMARNRE--SGETDVFVH  250

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VED+FS  FLC GY+ +Q+GRLRHFT+PS+R     PFCP
Sbjct  251  DVDRPVEDEFSATFLCRGYLIEQQGRLRHFTVPSHRARAGRPFCP  295



>ref|XP_010461205.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Camelina sativa]
Length=297

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  62   TTQQCTK-MPLSLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  EC +++
Sbjct  121  WASLNHGGRTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSEECRSVS  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  Y+  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  181  DPRNSKCDLALKDFPADFYDTKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  239  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  290



>ref|XP_004499575.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Cicer 
arietinum]
Length=296

 Score =   331 bits (849),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 186/232 (80%), Gaps = 4/232 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            ++ C K  P S+  A+IHY+T+ ITPQQT +EI V+S+ILE+KSP NFLVFGLGHDSLMW
Sbjct  68   TQTCTKN-PPSLVNALIHYATTNITPQQTIQEILVSSKILEKKSPCNFLVFGLGHDSLMW  126

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIG-KGPECTAIT  657
             +LNYGGRTVFLEED++WI QI +KFP LESYHVTYDTKV Q  +LM I  +  EC  I+
Sbjct  127  TSLNYGGRTVFLEEDKSWIEQIQKKFPSLESYHVTYDTKVHQGDELMRIAMENEECKKIS  186

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C+L  K  P+ VYE+ WD+IMVDAPTGY D APGRM+AIYTAG++ARN+    G
Sbjct  187  DPRISKCELTHKGFPNEVYEIEWDVIMVDAPTGYFDGAPGRMSAIYTAGLIARNKE--NG  244

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +T+VFVHDVNR VED+FSKAFLCEGY ++QEGR+RHF IPS+R  L  PFCP
Sbjct  245  DTDVFVHDVNRKVEDEFSKAFLCEGYFREQEGRIRHFNIPSHRARLGRPFCP  296



>ref|XP_010437731.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2 isoform X1 
[Camelina sativa]
 ref|XP_010437739.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2 isoform X2 
[Camelina sativa]
Length=289

 Score =   331 bits (848),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 188/232 (81%), Gaps = 2/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+K C K +P S++ A++HY T+ ITPQQT  EISV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  53   STKQCTK-LPISLSDALVHYVTTEITPQQTFDEISVSKRVLDKKSPCNFLVFGLGHDSLM  111

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+FLEED+AWI  +T+K P LESYHV YDTKV  +  LME+ +   C A++
Sbjct  112  WASLNHGGRTLFLEEDKAWIETVTKKIPNLESYHVVYDTKVKDSNKLMELERTEGCKAVS  171

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C L+LK  P+ VYE  WD+IMVDAPTGYH+EAPGRM+AIYTAG++ARNR +   
Sbjct  172  DPRDSKCALSLKGFPADVYETQWDVIMVDAPTGYHEEAPGRMSAIYTAGLLARNRYD-SD  230

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR+VED+FS AFLC GYMK+Q+GRLRHFTIPS+R  +  PFCP
Sbjct  231  ETDVFVHDVNRLVEDEFSVAFLCRGYMKEQQGRLRHFTIPSHRARVGTPFCP  282



>ref|XP_006288379.1| hypothetical protein CARUB_v10001630mg [Capsella rubella]
 gb|EOA21277.1| hypothetical protein CARUB_v10001630mg [Capsella rubella]
Length=287

 Score =   330 bits (847),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 185/225 (82%), Gaps = 1/225 (0%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P S++ A++HY T+ ITPQQT  EISV+ R+L++K+P NFLVFGLGHDSLMW +LN+G
Sbjct  57   KLPVSLSDALVHYVTTEITPQQTFDEISVSKRVLDKKAPCNFLVFGLGHDSLMWASLNHG  116

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEED+AWI  +T+KFP LESYHV YDTKV  +  LME+ +   C A++DPR S C
Sbjct  117  GRTLFLEEDKAWIETVTKKFPNLESYHVVYDTKVKDSNKLMELERTKGCKAVSDPRDSKC  176

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             L+LK  P+ VY+  WD+IMVDAPTGYH+EAPGRM+AIYTAG++ARNR + G ET+VFVH
Sbjct  177  ALSLKGFPADVYDTQWDVIMVDAPTGYHEEAPGRMSAIYTAGLLARNRYD-GSETDVFVH  235

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNR VED+FS AFLC GYMK+Q+GRLRHFTIPS+R  +  PFCP
Sbjct  236  DVNRPVEDEFSMAFLCRGYMKEQQGRLRHFTIPSHRERIGTPFCP  280



>ref|XP_006305458.1| hypothetical protein CARUB_v10009876mg [Capsella rubella]
 gb|EOA38356.1| hypothetical protein CARUB_v10009876mg [Capsella rubella]
Length=299

 Score =   331 bits (848),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLM
Sbjct  64   TTQQCTK-MPLSLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM  122

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  EC +++
Sbjct  123  WASLNHGGRTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSEECRSVS  182

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  Y+  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  183  DPRNSKCDLALKDFPADFYDTKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  240

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  241  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  292



>ref|XP_009417000.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Musa 
acuminata subsp. malaccensis]
Length=280

 Score =   330 bits (846),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 184/225 (82%), Gaps = 1/225 (0%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+ + +IHY+TS ITPQQT +EISVT+++LE+KSP NFLVFGLGHDSLMW  LN+G
Sbjct  56   KIPPSLGETIIHYATSNITPQQTLREISVTAKVLERKSPCNFLVFGLGHDSLMWSALNHG  115

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED+ WI  +T+KFP LE+YHV+YDTKVSQA +L+E GK   C  + D ++S C
Sbjct  116  GRTVFLEEDKKWIESVTQKFPTLEAYHVSYDTKVSQADELLESGKSTGCMVLEDTKFSRC  175

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LAL  LP + YEV WDLIMVDAPTGY  +APGRM AIYTAGM AR RR   G+T+VFVH
Sbjct  176  PLALTKLPDVFYEVDWDLIMVDAPTGYFPQAPGRMGAIYTAGMAARGRRR-EGDTDVFVH  234

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VEDKFSK FLC+GY+K++EGR+RHFTIPS+R + ++ FCP
Sbjct  235  DVDRAVEDKFSKTFLCQGYLKEEEGRIRHFTIPSHRANPEISFCP  279



>ref|XP_010499922.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Camelina 
sativa]
Length=297

 Score =   331 bits (848),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 188/232 (81%), Gaps = 3/232 (1%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +++ C K +P S++ A++HY TS +TPQQT  E++V+ R+L++KSP NFLVFGLGHDSLM
Sbjct  62   TTQQCTK-MPLSLSDALVHYVTSNVTPQQTFDEVAVSKRVLDKKSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  EC +++
Sbjct  121  WASLNHGGRTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSEECRSVS  180

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C LALK  P+  Y+  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARNR +  G
Sbjct  181  DPRNSKCDLALKDFPADFYDTKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNRED--G  238

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  239  ETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  290



>ref|XP_008778155.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Phoenix dactylifera]
Length=292

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 191/240 (80%), Gaps = 4/240 (2%)
 Frame = +1

Query  274  LPRKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVF  453
            LP    R  +++C K IP S+A  +IHY+TS  TPQQT KEIS+T+++LE++SP NFLVF
Sbjct  56   LPSTTTR-PTQSCTK-IPPSLANTIIHYATSNTTPQQTIKEISITAQVLERRSPCNFLVF  113

Query  454  GLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGK  633
            GLG DSLMW  LN+GGRTVFLEED  WI  + ++ P LE+YHV YDTKVSQA +L+E+G+
Sbjct  114  GLGRDSLMWTALNHGGRTVFLEEDRQWIETVQQELPTLEAYHVRYDTKVSQAEELLELGQ  173

Query  634  GPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMA  813
             PECT + D R S C+LALK LP + +EV WDLIMVDAPTGY   APGRM AIYTAGM A
Sbjct  174  LPECTTVGDMRLSKCRLALKGLPEVFFEVEWDLIMVDAPTGYFPGAPGRMGAIYTAGMAA  233

Query  814  RNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R R+E  GET+VFVHDVNR+VED+FSK FLCEGYM++++G LRHFTIPS+R+ + MPFCP
Sbjct  234  RWRKE--GETDVFVHDVNRLVEDRFSKKFLCEGYMRQEKGFLRHFTIPSHRSGMAMPFCP  291



>ref|XP_004299873.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=300

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K P S+A A+IHY+T+ ITPQQT KEISV++RIL +K+P NFLVFGLG DSLMW  LN+G
Sbjct  78   KTPPSLANALIHYATTNITPQQTFKEISVSARILAKKAPCNFLVFGLGLDSLMWAALNHG  137

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRTVFLEED++WI QI  + P LESYHV YDTKV +A  L E G   EC  ++DPR+S C
Sbjct  138  GRTVFLEEDQSWIDQIKERLPNLESYHVVYDTKVHEAEKLFEHGSKEECKTVSDPRFSKC  197

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LALK+LP  VY++ WDLIMVDAPTGY D APGRM+AIYTAG+M RNR E  GET+VFVH
Sbjct  198  PLALKNLPGDVYDMEWDLIMVDAPTGYFDGAPGRMSAIYTAGLMGRNREE--GETDVFVH  255

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+RVVEDKFSKAFLCEGY+++QEGR+RHF IPS+R  L   FCP
Sbjct  256  DVDRVVEDKFSKAFLCEGYLREQEGRIRHFKIPSHRARLGRTFCP  300



>emb|CAN73177.1| hypothetical protein VITISV_009984 [Vitis vinifera]
Length=299

 Score =   329 bits (843),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 184/221 (83%), Gaps = 2/221 (1%)
 Frame = +1

Query  331  SVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTV  510
            S+A+A++HY+T  +TPQQT  EISVTSR+L++K+P NFLVFGLGHDSLMW  LN+GGRTV
Sbjct  81   SLAQALVHYATLNVTPQQTFDEISVTSRVLQKKAPCNFLVFGLGHDSLMWTALNHGGRTV  140

Query  511  FLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQLAL  690
            FLEED++W+ +I +KFP +ESY+V YDTKV QA +L+E+G G +C  + DPR+S C+L+L
Sbjct  141  FLEEDKSWMERIKQKFPSVESYYVVYDTKVHQADELLEVGMGEDCKVVVDPRFSKCKLSL  200

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
            K  P+ VY+V WDLIMVDAPTGYHDEAPGRM AIYTAG+M RNR +  GET+VFVH+VNR
Sbjct  201  KGFPNEVYDVEWDLIMVDAPTGYHDEAPGRMGAIYTAGLMGRNRED--GETDVFVHNVNR  258

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VVEDKFSKAFLCEGY ++QEGR+  FTIPS+R      FCP
Sbjct  259  VVEDKFSKAFLCEGYFREQEGRIGRFTIPSHRTRSGRSFCP  299



>ref|XP_010927860.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Elaeis 
guineensis]
Length=292

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 186/240 (78%), Gaps = 4/240 (2%)
 Frame = +1

Query  274  LPRKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVF  453
            LP    R  +++C K IP S+A  +IHY+ S  TPQQT KEIS+TS++LE++SP NFL+F
Sbjct  56   LPSTTTR-PTQSCTK-IPPSLANTIIHYAASNTTPQQTIKEISITSQVLERRSPCNFLIF  113

Query  454  GLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGK  633
            GLG DSLMW  LN+GGRTVFLEED  WI  I ++ P LE+YHV YDTKVSQA +L+E+G+
Sbjct  114  GLGRDSLMWTALNHGGRTVFLEEDRQWIETIQQELPNLEAYHVEYDTKVSQAEELLELGQ  173

Query  634  GPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMA  813
             PECT + D R S C+LALK LP   +EV WDLIMVDAPTGY   APGRM AIYTAGM A
Sbjct  174  LPECTTVGDVRLSKCRLALKGLPEAFFEVEWDLIMVDAPTGYFPGAPGRMGAIYTAGMAA  233

Query  814  RNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R R+E  GET+VFVHDVNR  ED+FS+ FLCEGYM+++EG LRHFTIPS+R  + MPFCP
Sbjct  234  RWRKE--GETDVFVHDVNRFAEDRFSRKFLCEGYMRQEEGFLRHFTIPSHRGDMAMPFCP  291



>ref|XP_010646548.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Vitis 
vinifera]
Length=299

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 191/247 (77%), Gaps = 10/247 (4%)
 Frame = +1

Query  277  PRKEARLSSKNCNK--------KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKS  432
            P  E +L S  C          K P S+A+A++HY+T  +TPQQT  EISVTSR+L++K+
Sbjct  55   PATEEQLLSPACPSLLFTPTCTKTPPSLAQALVHYATLNVTPQQTFNEISVTSRVLQKKA  114

Query  433  PSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAG  612
            P NFLVFGLGHDSLMW  LN+GGRTVFLEED++W+ +I +KFP +ESY+V YDTKV +A 
Sbjct  115  PCNFLVFGLGHDSLMWTALNHGGRTVFLEEDKSWMERIKQKFPSVESYYVVYDTKVHEAD  174

Query  613  DLMEIGKGPECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAI  792
            +L+E+G G +C  + DPR+S  +L+LK  P+ VY+V WDLIMVDAPTGYHDEAPGRM AI
Sbjct  175  ELLEVGMGEDCKVVADPRFSKYKLSLKGFPNEVYDVEWDLIMVDAPTGYHDEAPGRMGAI  234

Query  793  YTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
            YTAG+M RNR +  GET+VFVH+VNRVVEDKFSKAFLCEGY ++QEGR+  FTIPS+R  
Sbjct  235  YTAGLMGRNRED--GETDVFVHNVNRVVEDKFSKAFLCEGYFREQEGRIGRFTIPSHRTR  292

Query  973  LDMPFCP  993
                FCP
Sbjct  293  SRRSFCP  299



>ref|XP_010539231.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Tarenaya 
hassleriana]
Length=328

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+PAS+A A++HY T++ITPQQT  E+SV+ R+L++KSP NFLVFGLGHDSLMW +LN+G
Sbjct  75   KMPASLADALVHYVTTSITPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLMWASLNHG  134

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT+FLEED++WI  +T+KFP LESYHV YDTKV  +  LME+GK  +C  ++DPR S C
Sbjct  135  GRTLFLEEDKSWIETVTQKFPNLESYHVIYDTKVKDSDKLMELGKTEDCKTVSDPRDSKC  194

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LALK  P+ VYE  WDLIMVDAPTGYH+ APGRM+AIYTAG+MARNR    GET+VFVH
Sbjct  195  ALALKGFPADVYETEWDLIMVDAPTGYHEAAPGRMSAIYTAGLMARNRES--GETDVFVH  252

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DV+R VED+FS  FLC GY+++++GRLRHFTIPS+R     PFCP
Sbjct  253  DVDRPVEDEFSATFLCGGYLREEQGRLRHFTIPSHRARAGRPFCP  297



>ref|XP_010421910.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2 isoform X1 
[Camelina sativa]
Length=290

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 186/232 (80%), Gaps = 1/232 (0%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+K    K+P S++ A++HY T+ ITPQQT  EISV+ R+L++ SP NFLVF LGHDSLM
Sbjct  53   STKQQCTKLPISLSDALVHYVTTEITPQQTFDEISVSKRVLDKNSPCNFLVFRLGHDSLM  112

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT+FLEED+AWI  +T+KFP LESYHV YDTKV  +  LME+ +   C A++
Sbjct  113  WASLNHGGRTLFLEEDKAWIETVTKKFPNLESYHVVYDTKVKDSNKLMELERTEGCKAVS  172

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C L+LK  P+ VYE  WD+IMVDAPTGYH+EAPGRM+AIYTAG++ARNR +   
Sbjct  173  DPRDSKCALSLKGFPADVYETQWDVIMVDAPTGYHEEAPGRMSAIYTAGLLARNRYD-SD  231

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR+VED+FS AFLC GYMK+Q+GRLRHFTIP++R  +  PFCP
Sbjct  232  ETDVFVHDVNRLVEDEFSVAFLCRGYMKEQQGRLRHFTIPNHRARVGTPFCP  283



>ref|XP_009415016.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Musa 
acuminata subsp. malaccensis]
Length=279

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 181/227 (80%), Gaps = 4/227 (2%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P S+AK ++HY+TS ITPQQT +EISVT+++LE+KSP NFLVFGLG+DS MW  LN+G
Sbjct  55   KLPPSLAKTIVHYTTSNITPQQTLREISVTAKVLERKSPCNFLVFGLGYDSPMWSALNHG  114

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECT--AITDPRYS  672
            GRT+FLEEDE+WI  +TRKFP LE+YHV YDT+VSQA +L+E+ +   CT  A  D R S
Sbjct  115  GRTIFLEEDESWIKSMTRKFPELEAYHVKYDTRVSQADELLELRRSSSCTTAAAADTRSS  174

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL  LP   Y V WDLIMVDAPTGY  +APGRM+AIYTAGM AR R E  GET+VF
Sbjct  175  GCRLALTELPDEFYGVEWDLIMVDAPTGYVAKAPGRMSAIYTAGMAARGRSE--GETDVF  232

Query  853  VHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VHDV+R VED+FS  FLCEGYMK+QEGRLRHFTIPS+R +    FCP
Sbjct  233  VHDVDRAVEDRFSTTFLCEGYMKEQEGRLRHFTIPSHRANPSFSFCP  279



>ref|XP_006302624.1| hypothetical protein CARUB_v10020731mg [Capsella rubella]
 gb|EOA35522.1| hypothetical protein CARUB_v10020731mg [Capsella rubella]
Length=295

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 181/226 (80%), Gaps = 3/226 (1%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S  C+K IP S+A A+IHY++S +TPQQT  EISVT ++L +KSP NFLVFGLGHDS MW
Sbjct  62   SAKCSK-IPPSLADALIHYASSNVTPQQTHSEISVTKKVLVKKSPCNFLVFGLGHDSFMW  120

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAI-  654
             TLNYGGRT+FLEE+E+WI QI  KFP LESYHV Y+TKV  A  LM + K   EC ++ 
Sbjct  121  STLNYGGRTIFLEENESWIRQIAEKFPSLESYHVQYNTKVRDAAALMAVAKEREECRSVS  180

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            TD R S C+LALK LP +VYE  WDLIMVDAPTG+H+EAPGRM A+YTAGM+AR R++GG
Sbjct  181  TDLRVSACELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMTALYTAGMIARRRKDGG  240

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
              T+VFVHDV+R VED+FS AFLC  YM +QEGRLRHFT+PS+RN+
Sbjct  241  ETTDVFVHDVDRKVEDEFSMAFLCRDYMTEQEGRLRHFTVPSHRNY  286



>ref|XP_010427991.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Camelina 
sativa]
Length=297

 Score =   318 bits (816),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 185/235 (79%), Gaps = 5/235 (2%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +CNK IP S+A A+IHY+ S +TPQQT  EISVT ++LE+KSP NFLVFGLG+DSLMW
Sbjct  64   SASCNK-IPPSLADALIHYAASNVTPQQTHSEISVTKKVLEKKSPCNFLVFGLGYDSLMW  122

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAIT  657
             TLNYGGRT+FLEE+E+WI QI  KFP LESYHV Y+TKVS A  LM   +  E C +++
Sbjct  123  STLNYGGRTIFLEENESWIRQIAEKFPSLESYHVRYNTKVSDADALMAAARDKEECHSVS  182

Query  658  -DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
             DPR S C LALK LP +VYE  WDLIMVDAPTG+H+EAPGRM AIYTAG++AR R++ G
Sbjct  183  MDPRVSACDLALKGLPDVVYETEWDLIMVDAPTGFHEEAPGRMTAIYTAGLIARRRKDEG  242

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH--LDMPFCP  993
              T+VF+HDV+R VED+FS AFLC  Y+ +QEGRLRHFT+PS+R++      FCP
Sbjct  243  ETTDVFLHDVDRKVEDEFSMAFLCRDYLTEQEGRLRHFTVPSHRDYGVSGGTFCP  297



>ref|XP_010471166.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Camelina 
sativa]
Length=297

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 181/226 (80%), Gaps = 3/226 (1%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +CNK IP S+A A+IHY+ S +TPQQT  EISVT ++LE+KSP NFLVFGLG+DSLMW
Sbjct  64   SVSCNK-IPPSLADALIHYAASNVTPQQTHSEISVTKKVLEKKSPCNFLVFGLGYDSLMW  122

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAI-  654
             TLNYGGRT+FLEE+E+WI QI  KFP LESYHV Y+TKV  A  LM  +    EC  + 
Sbjct  123  STLNYGGRTIFLEENESWIRQIAEKFPSLESYHVRYNTKVRDADALMAAVRDKEECHNVS  182

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            TDPR S C+LALK LP +VYE  WDLIMVDAPTG+H+EAPGRM AIYTAGMMAR R++ G
Sbjct  183  TDPRVSACELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMTAIYTAGMMARRRKDEG  242

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
              T+VFVHDV+R VED+F+ AFLC  Y+ +QEGRLRHFT+PS+R++
Sbjct  243  ETTDVFVHDVDRKVEDEFTMAFLCRDYLTEQEGRLRHFTVPSHRSY  288



>gb|AAF43218.1|AC012654_2 EST gb|AI999169 comes from this gene [Arabidopsis thaliana]
Length=287

 Score =   317 bits (813),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 183/236 (78%), Gaps = 5/236 (2%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S ++CNK IP S+A A++HY++S +TPQQT  EISVT + LE+KSP NFLVFGLGHDSLM
Sbjct  53   SPRSCNK-IPPSLADALVHYASSNVTPQQTLSEISVTKKELEKKSPCNFLVFGLGHDSLM  111

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAI  654
            W TLN+GGRT+FL+EDE+WIHQI  KFP LESYHV Y TKV  A  LM   K   EC  +
Sbjct  112  WATLNHGGRTIFLDEDESWIHQIAEKFPSLESYHVRYKTKVRDAEALMAATKDREECRRV  171

Query  655  -TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
             TD R S C+LALK LP +VYE  WDLIMVDAPTG+H+EAPGRM+AIYTAGM+AR R++ 
Sbjct  172  STDLRVSTCELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMSAIYTAGMIARRRKDE  231

Query  832  GGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH--LDMPFCP  993
               T VFVHDV+R VED+FS  FLC  YM KQEGRLRHFT+PS+RN+    + FCP
Sbjct  232  EETTAVFVHDVDRKVEDEFSMEFLCRDYMTKQEGRLRHFTVPSHRNYGVSGVKFCP  287



>ref|XP_006397116.1| hypothetical protein EUTSA_v10028858mg [Eutrema salsugineum]
 gb|ESQ38569.1| hypothetical protein EUTSA_v10028858mg [Eutrema salsugineum]
Length=284

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 180/225 (80%), Gaps = 6/225 (3%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P S++ A++HY T+ ITPQQT  E+SV+ RIL++KSP NFLVFGLGHDSLMW +LN+ 
Sbjct  59   KLPTSLSDALVHYVTTEITPQQTFNEVSVSKRILDKKSPCNFLVFGLGHDSLMWASLNHA  118

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            GRT      +AWI  +T+KFP LESYHV YDTK+  +  L+E+ K  +C +++DPR S C
Sbjct  119  GRTY-----KAWIETVTKKFPSLESYHVVYDTKLKDSNKLIELEKTEDCKSVSDPRDSKC  173

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             L+LK  P+ VYE  WDLIMVDAPTGYHDEAPGRM+AIYTAG++ARNR + GGET+VFVH
Sbjct  174  ALSLKGFPADVYETQWDLIMVDAPTGYHDEAPGRMSAIYTAGLLARNRFD-GGETDVFVH  232

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            DVNR VED+FS AFLC GY+K+Q+GRLRHFTIPS+R+    PFCP
Sbjct  233  DVNRPVEDEFSAAFLCRGYLKEQQGRLRHFTIPSHRSRSGTPFCP  277



>ref|NP_565020.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51814.1|AC016163_3 hypothetical protein; 28267-27009 [Arabidopsis thaliana]
 gb|AAS76228.1| At1g71690 [Arabidopsis thaliana]
 gb|AAS92321.1| At1g71690 [Arabidopsis thaliana]
 dbj|BAF00524.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35213.1| uncharacterized protein AT1G71690 [Arabidopsis thaliana]
Length=295

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 183/236 (78%), Gaps = 5/236 (2%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S ++CNK IP S+A A++HY++S +TPQQT  EISVT + LE+KSP NFLVFGLGHDSLM
Sbjct  61   SPRSCNK-IPPSLADALVHYASSNVTPQQTLSEISVTKKELEKKSPCNFLVFGLGHDSLM  119

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAI  654
            W TLN+GGRT+FL+EDE+WIHQI  KFP LESYHV Y TKV  A  LM   K   EC  +
Sbjct  120  WATLNHGGRTIFLDEDESWIHQIAEKFPSLESYHVRYKTKVRDAEALMAATKDREECRRV  179

Query  655  -TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
             TD R S C+LALK LP +VYE  WDLIMVDAPTG+H+EAPGRM+AIYTAGM+AR R++ 
Sbjct  180  STDLRVSTCELALKGLPEVVYETEWDLIMVDAPTGFHEEAPGRMSAIYTAGMIARRRKDE  239

Query  832  GGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH--LDMPFCP  993
               T VFVHDV+R VED+FS  FLC  YM KQEGRLRHFT+PS+RN+    + FCP
Sbjct  240  EETTAVFVHDVDRKVEDEFSMEFLCRDYMTKQEGRLRHFTVPSHRNYGVSGVKFCP  295



>ref|XP_009420161.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 181/227 (80%), Gaps = 4/227 (2%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P S+A A++HY+T  ITPQQT  EISV +R+L +KSP NFLVFGLGHDSLMW  LN+G
Sbjct  51   KLPPSLADAILHYATLNITPQQTIDEISVAARVLREKSPCNFLVFGLGHDSLMWSALNHG  110

Query  499  GRTVFLEEDEAWIHQI-TRKFPML-ESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYS  672
            GRT+FLEEDE WI     R  P++ E+YHV YDT+VS+A  L+E+G   +C A+ D R S
Sbjct  111  GRTLFLEEDEGWIEAWRLRLLPVVAETYHVKYDTRVSEAEQLLELGARADCKAVGDLRRS  170

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LALK LP + YEV WDLIMVDAPTGYH  APGRMAAIYTAG+ AR R+E  G+TEVF
Sbjct  171  GCRLALKQLPPVFYEVEWDLIMVDAPTGYHAGAPGRMAAIYTAGVAARWRKE--GKTEVF  228

Query  853  VHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VHDV+R VED+FSKAFLCEGYMK +EGRLRHFTIPS+R + + PFCP
Sbjct  229  VHDVDRAVEDRFSKAFLCEGYMKHEEGRLRHFTIPSHRANTERPFCP  275



>gb|KFK41585.1| hypothetical protein AALP_AA2G148100 [Arabis alpina]
Length=295

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 179/224 (80%), Gaps = 4/224 (2%)
 Frame = +1

Query  307  NCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHT  486
            NC K IP S+A  +IHY+ S++TPQQT  EISVT ++L++KSP NFLVFGLGHDSLMW +
Sbjct  65   NCGK-IPPSLADTLIHYAASSVTPQQTLSEISVTKKVLDKKSPCNFLVFGLGHDSLMWAS  123

Query  487  LNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLM-EIGKGPECTAI-TD  660
            LN+GGRT+FLEEDE+WI QI++KFP LESYHV YDTKV  A  LM E     EC  + TD
Sbjct  124  LNHGGRTIFLEEDESWIRQISKKFPSLESYHVRYDTKVRDAAALMAEARDREECVRVTTD  183

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
             R S C LALK LP +VYEV WDLIMVDAPTGYH+EAPGRMAAIYTA M+AR RR+ G  
Sbjct  184  LRVSKCVLALKGLPEMVYEVEWDLIMVDAPTGYHEEAPGRMAAIYTAAMIAR-RRKKGET  242

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
            T VFVHDV+R VED+FS AFLC+ YM +Q+GRLR FT+PS+RN+
Sbjct  243  TAVFVHDVDRKVEDEFSMAFLCKDYMTEQQGRLRGFTVPSHRNY  286



>ref|XP_010421911.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2 isoform X2 
[Camelina sativa]
Length=285

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 180/232 (78%), Gaps = 6/232 (3%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+K    K+P S++ A++HY T+ ITPQQT  EISV+ R+L++ SP NFLVF LGHDSLM
Sbjct  53   STKQQCTKLPISLSDALVHYVTTEITPQQTFDEISVSKRVLDKNSPCNFLVFRLGHDSLM  112

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAIT  657
            W +LN+GGRT      +AWI  +T+KFP LESYHV YDTKV  +  LME+ +   C A++
Sbjct  113  WASLNHGGRTY-----KAWIETVTKKFPNLESYHVVYDTKVKDSNKLMELERTEGCKAVS  167

Query  658  DPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
            DPR S C L+LK  P+ VYE  WD+IMVDAPTGYH+EAPGRM+AIYTAG++ARNR +   
Sbjct  168  DPRDSKCALSLKGFPADVYETQWDVIMVDAPTGYHEEAPGRMSAIYTAGLLARNRYD-SD  226

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            ET+VFVHDVNR+VED+FS AFLC GYMK+Q+GRLRHFTIP++R  +  PFCP
Sbjct  227  ETDVFVHDVNRLVEDEFSVAFLCRGYMKEQQGRLRHFTIPNHRARVGTPFCP  278



>ref|XP_002887380.1| hypothetical protein ARALYDRAFT_316133 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63639.1| hypothetical protein ARALYDRAFT_316133 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 173/226 (77%), Gaps = 3/226 (1%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +C+K IP S+A A++HY+ S +TPQQT  EISVT ++LE+KSP NFLVFGLG DSLMW
Sbjct  64   STSCSK-IPPSLADALVHYAASNVTPQQTLSEISVTKKVLEKKSPCNFLVFGLGRDSLMW  122

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAI-  654
              LN+GGRT+FLEEDE WIH+I  KFP LESYHV Y+TKV  A  LM   +   EC  + 
Sbjct  123  AALNHGGRTIFLEEDELWIHKIAEKFPSLESYHVRYNTKVRDATALMAATRDREECRRVS  182

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            TD R S C+LALK LP +VYE  WDLIMVDAPTG+ DE PGRM AIYT GM+AR R++ G
Sbjct  183  TDLRVSACELALKGLPEVVYETEWDLIMVDAPTGFDDETPGRMTAIYTVGMIARRRKDDG  242

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
              T VFVHDV+R VED+FS  FLC  YM +QEGRLRHFT+PS+RNH
Sbjct  243  ETTAVFVHDVDRKVEDEFSMEFLCRDYMTEQEGRLRHFTVPSHRNH  288



>ref|XP_006836793.1| hypothetical protein AMTR_s00099p00012720 [Amborella trichopoda]
 gb|ERM99646.1| hypothetical protein AMTR_s00099p00012720 [Amborella trichopoda]
Length=310

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 183/233 (79%), Gaps = 7/233 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +C K +P ++ +++IHY+TS  TPQQT KEIS+TS +L QKSP NFL+FGLGHDSL+W
Sbjct  83   SSSCTK-LPEAIVQSLIHYATSNTTPQQTIKEISITSSVLLQKSPCNFLIFGLGHDSLLW  141

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
             +LNY GRTVFLEED+AWI QIT+K P LE+YH+ Y T+VS+A +L++ G+  EC  + +
Sbjct  142  SSLNYNGRTVFLEEDKAWIQQITQKIPNLEAYHLQYTTRVSEADELLKYGETEECRRVQN  201

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            PR S C+L++K +P  +YEV WDLIMVDAPTGY   APGRM AIYTAGM+AR+RR+ GGE
Sbjct  202  PRDSDCRLSIKGMPDELYEVNWDLIMVDAPTGYFSGAPGRMTAIYTAGMIARSRRD-GGE  260

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP--FCP  993
            T+VFVHD +R VEDK+S +FLCEGYMK  EGRLRHF IPS    L  P  FCP
Sbjct  261  TDVFVHDCDRPVEDKYSMSFLCEGYMKNAEGRLRHFLIPS---QLSNPGSFCP  310



>gb|KCW57152.1| hypothetical protein EUGRSUZ_I02785 [Eucalyptus grandis]
Length=256

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 175/238 (74%), Gaps = 37/238 (16%)
 Frame = +1

Query  286  EARLS--SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            EA+ S  S  C+K IP  +A+A+IHY+TS ITPQQT KEISVT+R+L++KSP NFLVFGL
Sbjct  53   EAKASDCSPTCSK-IPNPLAQALIHYTTSTITPQQTLKEISVTARVLKKKSPCNFLVFGL  111

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LNYGGRT+FLEEDEAWI QI ++FPMLESYHV+YD+K              
Sbjct  112  GHDSLMWSSLNYGGRTIFLEEDEAWIEQIKKRFPMLESYHVSYDSK--------------  157

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
                               LP  VYE  WDLIMVDAPTGY++EAPGRM AIYTAGMMARN
Sbjct  158  ------------------GLPDEVYERQWDLIMVDAPTGYYEEAPGRMTAIYTAGMMARN  199

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R+EG  ET+VFVHDVNR VEDKFSK FLCEGYMKKQE RLRHF IPS+     MPFCP
Sbjct  200  RKEG--ETDVFVHDVNRSVEDKFSKEFLCEGYMKKQENRLRHFIIPSHTGESSMPFCP  255



>ref|XP_006390759.1| hypothetical protein EUTSA_v10018938mg [Eutrema salsugineum]
 gb|ESQ28045.1| hypothetical protein EUTSA_v10018938mg [Eutrema salsugineum]
Length=297

 Score =   307 bits (787),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 177/236 (75%), Gaps = 6/236 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S NC  KIP S+A A++HY+ S ITPQQT  EISVT ++LE+KSP NFLVFGLGHDSLMW
Sbjct  63   SINC-VKIPPSLADALVHYAASNITPQQTLSEISVTKKVLEKKSPCNFLVFGLGHDSLMW  121

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT--A  651
             +LN+GGRT+FL+EDE+WI +I+ KFP LESYHV Y+TKV  A  LM   K   EC    
Sbjct  122  ASLNHGGRTIFLDEDESWIRRISEKFPSLESYHVKYETKVKDAAALMSSAKNREECRRGL  181

Query  652  ITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
             TD R S C+L L  LP +VYE  WDLIMVDAPTG+H+EAPGRM AIYTAGM+AR+R+  
Sbjct  182  STDLRVSACELTLTRLPEVVYETEWDLIMVDAPTGFHEEAPGRMTAIYTAGMIARSRKNE  241

Query  832  GGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH--LDMPFCP  993
            G  T VFVHDV+R VED+FS  FLC  Y+ +Q+GRLRHFT+PS+RN       FCP
Sbjct  242  GETTAVFVHDVDRTVEDEFSMTFLCRDYLTEQQGRLRHFTVPSHRNKNFSGGRFCP  297



>emb|CDP00854.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            KIP S+A+A++HY+++ ITPQQT +E+ +T R+LEQKSP+NFL+FGLG+DSLMW  LNYG
Sbjct  53   KIPPSLAEALVHYASTNITPQQTYQELQITLRVLEQKSPTNFLIFGLGYDSLMWSMLNYG  112

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMC  678
            G+T+FLEE +AW+  + ++ P +E++HVTY+TKV++A  L+ +GK   C  +TDPR S C
Sbjct  113  GKTIFLEESDAWMQDVKKQIPSIEAFHVTYNTKVTEAVQLLHLGKEENCKVVTDPRSSKC  172

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
             LA+K+ P  VY   WD+IM+DAPTGY  E PGRM AIYTAG++ARN+R   G+T++FVH
Sbjct  173  HLAIKTFPDEVYNTEWDVIMIDAPTGYKAELPGRMTAIYTAGLLARNKR--FGDTDIFVH  230

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            D++R VE+KFS  FLCEGY K++ GR+RHFTIPS+R  ++ PFCP
Sbjct  231  DIDRWVENKFSMDFLCEGYWKEEVGRIRHFTIPSHRGGVERPFCP  275



>ref|XP_009405263.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=264

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 174/231 (75%), Gaps = 6/231 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +C K IP S+A A++HY+TS  TPQQT +EISVT+R+L +KSP NFLVFGLGHDS MW
Sbjct  40   SDSCTK-IPPSLATAIVHYATSNTTPQQTLEEISVTARVLRKKSPCNFLVFGLGHDSPMW  98

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD  660
              LN+GGRTVFLEED +WI  +  +FP LE+YH+TY TKVSQA  L+  G      A+ +
Sbjct  99   SALNHGGRTVFLEEDGSWIRTVRGRFPALEAYHMTYRTKVSQAEGLLASGLNSTDCAVWN  158

Query  661  PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
               S C LAL  LP++ YEV WDLIMVDAPTGY  +APGRM AIYTAGM AR R    GE
Sbjct  159  ---SKCPLALTELPAVFYEVEWDLIMVDAPTGYQADAPGRMGAIYTAGMAARGR--SAGE  213

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            T+VFVHDV+RVVEDKFS AFLCEGY+++Q GRLRHFTIPS R    + FCP
Sbjct  214  TDVFVHDVDRVVEDKFSTAFLCEGYLREQVGRLRHFTIPSRRTTPAIAFCP  264



>emb|CDX72815.1| BnaC06g32630D [Brassica napus]
Length=301

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 178/231 (77%), Gaps = 7/231 (3%)
 Frame = +1

Query  283  KEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLG  462
            KE    S +C K IP S+A A+IHY+ S +TPQQT  EISVT ++L++ SP NFLVFGLG
Sbjct  57   KEQSPDSVSCGK-IPPSLADALIHYAASNVTPQQTLSEISVTKKVLDKTSPCNFLVFGLG  115

Query  463  HDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-P  639
            HDSLMW +LN+GGRT+FL+EDE+WI QI  KFP LESYHV Y+TK+  A  LM   +   
Sbjct  116  HDSLMWASLNHGGRTIFLDEDESWIRQIAEKFPSLESYHVRYETKLRDAAALMSAARNRE  175

Query  640  ECT--AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMA  813
            EC   A  D R S C+LALK LP +VYE+ W+LIMVDAPTG+H+EAPGRM+AIYTAGM+A
Sbjct  176  ECRLGASMDLRVSKCELALKGLPEVVYEMEWNLIMVDAPTGFHEEAPGRMSAIYTAGMIA  235

Query  814  RNRREGGGE-TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSY  963
            R+R  G GE T VFVHDV+R VED+FS AFLC  YM +QEGRLRHFT+PS+
Sbjct  236  RSR--GKGETTAVFVHDVDRTVEDEFSMAFLCRDYMTEQEGRLRHFTVPSH  284



>ref|XP_010415866.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Camelina sativa]
Length=293

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 175/226 (77%), Gaps = 7/226 (3%)
 Frame = +1

Query  301  SKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMW  480
            S +CNK IP S+A A+IHY+ S +TPQQT  EISVT ++LE+KSP NFLVFGLG+DSLMW
Sbjct  64   SVSCNK-IPPSLADALIHYAASNVTPQQTHSEISVTKKVLEKKSPCNFLVFGLGYDSLMW  122

Query  481  HTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP-ECTAI-  654
             TLNYGGRT+FLEE+E+WI QI  KFP LESYHV Y+TKV  A  LM   +   EC ++ 
Sbjct  123  STLNYGGRTIFLEENESWIRQIAEKFPSLESYHVRYNTKVRDAEALMAAARDKEECHSVS  182

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            TDPR S C LALK LP +VYE  WDLIMVDAPTG+H+EA GRM AIYTAGMMAR  ++ G
Sbjct  183  TDPRVSACDLALKGLPEVVYETEWDLIMVDAPTGFHEEALGRMTAIYTAGMMARRWKDEG  242

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
              T+VFVHDV+R VED+FS A     Y+ +QEGRLRHFT+PS+R +
Sbjct  243  ETTDVFVHDVDRKVEDEFSMA----DYLTEQEGRLRHFTVPSHRGY  284



>ref|XP_009105824.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3 [Brassica rapa]
Length=296

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 179/237 (76%), Gaps = 7/237 (3%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +S +C K IP S+A A+IHY+ S +TPQQT  EISVT ++L++ SP NFLVFGLGHDSLM
Sbjct  62   NSVSCGK-IPPSLADALIHYAASNVTPQQTLSEISVTKKVLDKTSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT--  648
            W +LN+GGRT+FL+EDE+WI +I  KFP LESYHV Y+TKV  A  LM   +   EC   
Sbjct  121  WASLNHGGRTIFLDEDESWIRRIAEKFPSLESYHVRYETKVRDAAALMSAARDREECRLG  180

Query  649  AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRRE  828
            A  D R S C+LALK LP +VYE  WDLIMVDAPTG+H++APGRM+AIYTAGM+AR+R+ 
Sbjct  181  ASMDLRVSKCELALKGLPEVVYEREWDLIMVDAPTGFHEDAPGRMSAIYTAGMLARSRK-  239

Query  829  GGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSY--RNHLDMPFCP  993
             G  T VFVHDV+R VED+FS AFLC  YM +QEGRLRHFT+PS+   N     +CP
Sbjct  240  NGENTAVFVHDVDRTVEDEFSMAFLCRDYMTEQEGRLRHFTVPSHWDSNIAGGKYCP  296



>dbj|BAJ88693.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 171/229 (75%), Gaps = 3/229 (1%)
 Frame = +1

Query  316  KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNY  495
             K+PA VA A++HY+ S +TPQQT  EI V+ R+L+++SP NFLVFGLG DS MW  LN+
Sbjct  70   SKLPAPVADALVHYAASNVTPQQTAAEIGVSLRVLQRRSPCNFLVFGLGLDSPMWAALNH  129

Query  496  GGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PR  666
            GGRTVFLEED +WI  +  K P LESYHV YDT+V++A DLM +   P CTA  D     
Sbjct  130  GGRTVFLEEDASWIASVRSKHPGLESYHVVYDTRVTEADDLMSLRDHPGCTAQPDLAAAA  189

Query  667  YSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
             + C+LAL+ LP+  +EV WDL+MVDAPTG+  EAPGRM AIYTAGM+AR RR G G T+
Sbjct  190  EASCRLALRGLPAAFHEVEWDLVMVDAPTGWTPEAPGRMGAIYTAGMVARARRPGDGATD  249

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VFVHDV+R VED+FSKAFLC+ Y+ +Q GR+RHF IPS+R     PFCP
Sbjct  250  VFVHDVDRTVEDRFSKAFLCDAYLAEQVGRIRHFVIPSHREKPGTPFCP  298



>emb|CDX96332.1| BnaA07g29430D [Brassica napus]
Length=296

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/237 (62%), Positives = 179/237 (76%), Gaps = 7/237 (3%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +S +C K IP S+A A+IHY+ S +TPQQT  EISVT ++L++ SP NFLVFGLGHDSLM
Sbjct  62   NSVSCGK-IPPSLADALIHYAASNVTPQQTLSEISVTKKVLDKTSPCNFLVFGLGHDSLM  120

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT--  648
            W +LN+GGRT+FL+EDE+WI +I  KFP LESYHV Y+TKV  A  LM   +   EC   
Sbjct  121  WASLNHGGRTIFLDEDESWIRRIAEKFPSLESYHVRYETKVRDAAALMSAARDREECRLG  180

Query  649  AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRRE  828
            A  D R S C+LALK LP +VYE  WDLIMVDAPTG+H++APGRM+AIYTAGM+AR+R+ 
Sbjct  181  ASMDLRVSKCELALKGLPEVVYEREWDLIMVDAPTGFHEDAPGRMSAIYTAGMLARSRK-  239

Query  829  GGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSY--RNHLDMPFCP  993
             G  T VFVHDV+R VED+FS AFLC  YM +QEGRLRHFT+PS+   N     +CP
Sbjct  240  NGETTAVFVHDVDRTVEDEFSMAFLCRDYMTEQEGRLRHFTVPSHWDSNIAGGKYCP  296



>gb|ACE97109.1| expressed protein [Populus tremula]
 gb|ACE97110.1| expressed protein [Populus tremula]
 gb|ACE97111.1| expressed protein [Populus tremula]
 gb|ACE97112.1| expressed protein [Populus tremula]
 gb|ACE97119.1| expressed protein [Populus tremula]
 gb|ACE97120.1| expressed protein [Populus tremula]
 gb|ACE97122.1| expressed protein [Populus tremula]
 gb|ACE97124.1| expressed protein [Populus tremula]
 gb|ACE97126.1| expressed protein [Populus tremula]
 gb|ACE97127.1| expressed protein [Populus tremula]
 gb|ACE97131.1| expressed protein [Populus tremula]
 gb|ACE97133.1| expressed protein [Populus tremula]
Length=167

 Score =   293 bits (749),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTRKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGYHDEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNR  167



>gb|ACE97121.1| expressed protein [Populus tremula]
 gb|ACE97125.1| expressed protein [Populus tremula]
Length=167

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTHKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGYHDEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNR  167



>gb|ACE97115.1| expressed protein [Populus tremula]
 gb|ACE97128.1| expressed protein [Populus tremula]
 gb|ACE97130.1| expressed protein [Populus tremula]
Length=167

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTRKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+G+GPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGRGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGYHDEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNR  167



>gb|ACE97116.1| expressed protein [Populus tremula]
 gb|ACE97129.1| expressed protein [Populus tremula]
Length=167

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTRKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAIGDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGYHDEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYHDEAPGRMTAIYTAGMMARNR  167



>ref|XP_010480867.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Camelina 
sativa]
Length=275

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 175/238 (74%), Gaps = 24/238 (10%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGL  459
            + EA L++     K+P S++ A++HY TS +TPQQT  E+SV+ R+L++KSP NFLVFGL
Sbjct  55   KPEACLTTSQQCTKMPLSLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGL  114

Query  460  GHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP  639
            GHDSLMW +LN+GGRT+F+EED+AWI  +T+KFP LESYHV YDTKV  +  LME+G+  
Sbjct  115  GHDSLMWASLNHGGRTLFIEEDKAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSE  174

Query  640  ECTAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            E                       Y+  WDLIMVDAPTGYH+EAPGRM+AIYTAG++ARN
Sbjct  175  E----------------------FYDTKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARN  212

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R +  GET+VFVHDVNR VED+FS  FLC+GYM++Q GRLRHFTIPS+R     PFCP
Sbjct  213  RED--GETDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCP  268



>gb|ACE97107.1| expressed protein [Populus tremula]
 gb|ACE97108.1| expressed protein [Populus tremula]
 gb|ACE97114.1| expressed protein [Populus tremula]
 gb|ACE97118.1| expressed protein [Populus tremula]
 gb|ACE97123.1| expressed protein [Populus tremula]
 gb|ACE97132.1| expressed protein [Populus tremula]
 gb|ACE97134.1| expressed protein [Populus tremula]
Length=167

 Score =   290 bits (743),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTRKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNR  167



>dbj|BAK02602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   295 bits (755),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 171/228 (75%), Gaps = 3/228 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+P +VA+A++HY+TS +TPQQT  EI V+ R+L+++SP NFLVFGLGHDS MW  LN+G
Sbjct  71   KLPGAVAEALVHYATSNVTPQQTAAEIGVSLRVLQRRSPCNFLVFGLGHDSPMWAALNHG  130

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRY  669
            GRTVFLEED +WI  +    P LESYHVTYDT++++A DL+ +   P CTA  D      
Sbjct  131  GRTVFLEEDASWIASVRAAHPGLESYHVTYDTRLTEADDLIALRDHPGCTAQPDLAAAAE  190

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            + C+LAL+ LP++ +E  WDLIMVDAPTG+  EAPGRM AIYTAGM AR RR G G T+V
Sbjct  191  ASCRLALRGLPAVFHETEWDLIMVDAPTGWTPEAPGRMGAIYTAGMAARARRPGDGATDV  250

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDV+R VED FSKAFLC+ Y+ +Q GR+R F IPS+R     PFCP
Sbjct  251  FVHDVDRAVEDSFSKAFLCDAYLAEQVGRIRRFVIPSHREKPGTPFCP  298



>gb|ACE97113.1| expressed protein [Populus tremula]
 gb|ACE97117.1| expressed protein [Populus tremula]
 gb|ACE97138.1| expressed protein [Populus tremula]
 gb|ACE97141.1| expressed protein [Populus tremula]
 gb|ACE97142.1| expressed protein [Populus tremula]
Length=167

 Score =   290 bits (741),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTHKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNR  167



>gb|ACE97135.1| expressed protein [Populus tremula]
 gb|ACE97137.1| expressed protein [Populus tremula]
 gb|ACE97139.1| expressed protein [Populus tremula]
Length=167

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTHKEISVSAKVLEKKSPCNFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++S+CQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSLCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNR  167



>gb|ACE97136.1| expressed protein [Populus tremula]
Length=167

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP NFLVFGLGHDS MW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTHKEISVSAKVLEKKSPCNFLVFGLGHDSFMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNR  167



>gb|EPS67958.1| hypothetical protein M569_06817 [Genlisea aurea]
Length=294

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 176/238 (74%), Gaps = 4/238 (2%)
 Frame = +1

Query  286  EARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGH  465
            + R S  +   KIP S+++A+ HY+   +TPQQT  EI VT R+LE++SP N LVFGLG 
Sbjct  59   KCRQSVSDICSKIPPSLSRAIAHYAALNVTPQQTLDEIGVTLRVLERRSPCNLLVFGLGI  118

Query  466  DSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP-E  642
            DSLMW +LN+ GRTVFLEED  WI Q+  + P LES+HV YDTK++QA +L+E G+   E
Sbjct  119  DSLMWASLNHNGRTVFLEEDRGWIQQVREQNPSLESHHVVYDTKLTQAAELLETGRQERE  178

Query  643  CTAITDPRYSMCQLAL-KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARN  819
            C+ + DPR S C+L+L   LP  VY++ WD+IMVDAPTGY + APGRM AIYT G+MARN
Sbjct  179  CSVVVDPRRSKCKLSLGDRLPREVYDLEWDVIMVDAPTGYFEGAPGRMKAIYTVGLMARN  238

Query  820  RREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            R    GET+VFVHDVNR VE +FS A+LCEGY++++ GRLRHFTIPS+R      FCP
Sbjct  239  RE--SGETDVFVHDVNRAVEHQFSMAWLCEGYLREEVGRLRHFTIPSHRTREGRSFCP  294



>gb|ACE97140.1| expressed protein [Populus tremula]
Length=167

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            IP S+ +A+IHY+TS ITPQQT KEISV++++LE+KSP  FLVFGLGHDSLMW  LNYGG
Sbjct  1    IPRSLTQALIHYTTSTITPQQTHKEISVSAKVLEKKSPCYFLVFGLGHDSLMWSALNYGG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQ  681
            RTVFLEEDEAWI QI R+FPMLE +HVTYD+KV++A +LME+GKGPECTAI+DP++SMCQ
Sbjct  61   RTVFLEEDEAWIAQIKRRFPMLEYHHVTYDSKVNEADNLMEVGKGPECTAISDPKFSMCQ  120

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNR  822
            LA+K LPS VYE+ WDLIMVDAPTGY+DEAPGRM AIYTAGMMARNR
Sbjct  121  LAMKGLPSEVYEIEWDLIMVDAPTGYYDEAPGRMTAIYTAGMMARNR  167



>ref|XP_004977142.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Setaria 
italica]
Length=298

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 170/230 (74%), Gaps = 3/230 (1%)
 Frame = +1

Query  313  NKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLN  492
             K +P  VA+A++HY+TS +TPQQT  EI V+ R+L++++P NFLVFGLG DS MW  LN
Sbjct  69   GKGLPLPVAEALVHYTTSNVTPQQTADEIGVSLRVLQRRAPCNFLVFGLGFDSPMWAALN  128

Query  493  YGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---P  663
            +GGRTVFLEED +WI  +  K P LESYHVTYDT ++++  L+E+   P C A  D    
Sbjct  129  HGGRTVFLEEDASWIANVRSKHPALESYHVTYDTVLTESDALLELRDHPACVAQPDLASA  188

Query  664  RYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGET  843
              + C+LALK LP + +++ WDLIMVDAPTG+  EAPGRM AIYTAGM AR RR G G T
Sbjct  189  AEASCRLALKGLPPVFHDLQWDLIMVDAPTGWTPEAPGRMGAIYTAGMAARARRPGEGAT  248

Query  844  EVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +VFVHDV+R VED FSKAFLCEGY+ +Q GR+RHF IPS+R     PFCP
Sbjct  249  DVFVHDVDRPVEDAFSKAFLCEGYLAEQVGRIRHFVIPSHREKEGTPFCP  298



>ref|XP_002443019.1| hypothetical protein SORBIDRAFT_08g006410 [Sorghum bicolor]
 gb|EES16857.1| hypothetical protein SORBIDRAFT_08g006410 [Sorghum bicolor]
Length=303

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 167/227 (74%), Gaps = 3/227 (1%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            +P +V +A++HY+TS +TPQQT  EI V+ R+L++++P NFLVFGLGHDS MW  LN+GG
Sbjct  77   LPLAVMEALVHYTTSNVTPQQTADEIGVSLRVLQRRAPCNFLVFGLGHDSPMWAALNHGG  136

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRYS  672
            RTVFLEED +WI  +    P LESYHV YDT ++ A  L+++   P C A  D      +
Sbjct  137  RTVFLEEDASWIASVRATHPSLESYHVAYDTVLTDADALLQLRDHPACVAQPDLASAADA  196

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL+ LP + +E+ WDLIMVDAPTG+  EAPGRM AIYTAGM AR RR G G T+VF
Sbjct  197  SCRLALRGLPPVFHELEWDLIMVDAPTGWTPEAPGRMGAIYTAGMAARARRPGDGPTDVF  256

Query  853  VHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VHDV+R VED FSKAFLCEGY+ +Q GR+RHF IPS+R     PFCP
Sbjct  257  VHDVDRPVEDAFSKAFLCEGYLAEQVGRIRHFVIPSHREKDGTPFCP  303



>gb|EAY89414.1| hypothetical protein OsI_10920 [Oryza sativa Indica Group]
Length=295

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 170/228 (75%), Gaps = 3/228 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+PA+VA+A++HY+T+ +TPQQT  EI V+ R+L++++P NFLVFGLG DS MW  LN+G
Sbjct  68   KLPAAVAQAMVHYATANVTPQQTAAEIGVSLRVLQRRAPCNFLVFGLGLDSAMWAALNHG  127

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRY  669
            GRTVFLEED +WI  +    P LESYHV YDT+V+ A +L+ +   P CT+  D      
Sbjct  128  GRTVFLEEDASWIASVKAGHPGLESYHVAYDTRVTDADELIALRHEPACTSQPDLAAAAA  187

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            + C+LAL+ LP + +EV WDLIMVDAPTG+  E+PGRM AIYTAGM AR R  G G TEV
Sbjct  188  ASCRLALRGLPPVFHEVEWDLIMVDAPTGWTPESPGRMGAIYTAGMAARARTPGAGATEV  247

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDV+R VED FSKAFLC+GY+ +Q GR+R F IPS+R+    PFCP
Sbjct  248  FVHDVDRHVEDTFSKAFLCDGYLVEQVGRIRRFVIPSHRDKDGTPFCP  295



>gb|EYU22746.1| hypothetical protein MIMGU_mgv1a023936mg [Erythranthe guttata]
Length=246

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 170/228 (75%), Gaps = 3/228 (1%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            CNK IP S+++ ++ Y+T+  T  QT +EISVTSRIL++KSP NFLVFG+GHDS +W TL
Sbjct  22   CNK-IPPSLSETLVRYATTNATLLQTFEEISVTSRILKEKSPCNFLVFGVGHDSPLWATL  80

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY  669
            N GGRT+FLEE + W  ++ ++ P LE  HV Y TKVS+A  L +IGK  +C  + DPR 
Sbjct  81   NQGGRTLFLEESKYWTLELNKEIPWLEIRHVMYKTKVSEAKKLFDIGKSKQCQTVGDPRL  140

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            S C L LK LPS VYE  WDLIMVDAPT +    PGRM AIYTAG++A+NRR+  GET+V
Sbjct  141  SKCPLVLKELPSEVYETEWDLIMVDAPTAFTKNLPGRMTAIYTAGLLAKNRRD--GETDV  198

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHD++R VEDKFS++FLCEGY  +Q GRLRH+ IPS+ +    PFCP
Sbjct  199  FVHDIDRDVEDKFSRSFLCEGYTTEQVGRLRHYRIPSHMSGDHTPFCP  246



>ref|NP_001066378.1| Os12g0204500 [Oryza sativa Japonica Group]
 gb|ABA96114.1| uncharacterized plant-specific domain TIGR01627 family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29397.1| Os12g0204500 [Oryza sativa Japonica Group]
 dbj|BAG91647.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 169/228 (74%), Gaps = 3/228 (1%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+PA+VA+A++HY+T+ +TPQQT  EI V+ R+L+ ++P NFLVFGLG DS MW  LN+G
Sbjct  68   KLPAAVAQAMVHYATANVTPQQTAAEIGVSLRVLQLRAPCNFLVFGLGLDSAMWAALNHG  127

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRY  669
            GRTVFLEED +WI  +    P LESYHV YDT+V+ A +L+ +   P CT+  D      
Sbjct  128  GRTVFLEEDASWIASVKAGHPGLESYHVAYDTRVTDADELIALRHEPACTSQPDLAAAAA  187

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            + C+LAL+ LP + +EV WDLIMVDAPTG+  E+PGRM AIYTAGM AR R  G G TEV
Sbjct  188  ASCRLALRGLPPVFHEVEWDLIMVDAPTGWTPESPGRMGAIYTAGMAARARTPGAGATEV  247

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDV+R VED FSKAFLC+GY+ +Q GR+R F IPS+R+    PFCP
Sbjct  248  FVHDVDRHVEDTFSKAFLCDGYLVEQVGRIRRFVIPSHRDKDGTPFCP  295



>ref|XP_009785261.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Nicotiana 
sylvestris]
Length=282

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 175/234 (75%), Gaps = 5/234 (2%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            +S  CNK IP S+A+A+ HY+ + ITPQQ   EIS+T R+LE+KSP NFL+FGLG DSLM
Sbjct  52   TSSTCNK-IPPSLAEALFHYAATNITPQQKHDEISMTFRVLEKKSPCNFLIFGLGFDSLM  110

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPM-LESYHVTYDTKVSQAGDLMEIGKGPE-CTA  651
            W + N+ GRT+F+EED+ WI +IT++ P  +E+YH TY+TK+ QA +L+ IG+  + C  
Sbjct  111  WSSFNHNGRTIFIEEDKDWIEKITKEVPTKIEAYHYTYETKLDQATELLNIGRREDSCKI  170

Query  652  ITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
            + DPR S C LALK+LP  VYE+ WD+IMVDAPTG   + PGRM  IYTAG++ARN+   
Sbjct  171  VGDPRNSKCPLALKNLPKQVYEIEWDVIMVDAPTGSSFDQPGRMNVIYTAGLLARNKE--  228

Query  832  GGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
             GET+VFVHD  R  EDKFS++FLCE Y++++   LRHFTIPSYR+ L   FCP
Sbjct  229  NGETDVFVHDCKRYAEDKFSRSFLCEEYIREEVRYLRHFTIPSYRSGLIKSFCP  282



>ref|XP_003576967.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Brachypodium 
distachyon]
Length=301

 Score =   282 bits (721),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 167/230 (73%), Gaps = 5/230 (2%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+PA+VA+ ++HY+T+  TPQQT  EI V+ R+L+++SP NFLVFGLG DS MW  LN+G
Sbjct  70   KLPAAVAETLVHYATTNTTPQQTAAEIGVSLRVLQRRSPCNFLVFGLGLDSPMWAALNHG  129

Query  499  GRTVFLEEDEAWIHQITRKFPML--ESYHVTYDTKVSQAGDLMEIGKGPECTAI---TDP  663
            GRTVFLEED +WI  +      L  ESYHV YDT+++ A DL+ +    +C        P
Sbjct  130  GRTVFLEEDASWIESVRAAHSGLDLESYHVRYDTRLTDADDLLALRDHSDCVGADLDAGP  189

Query  664  RYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGET  843
              S C+LALK LP++  EV WDLIMVDAPTG+  EAPGRM AIYTAGM AR RR G G T
Sbjct  190  ESSSCKLALKGLPAVFREVEWDLIMVDAPTGWTPEAPGRMGAIYTAGMAARARRPGDGAT  249

Query  844  EVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +VFVHDV+R VED+FSKAFLCE Y+++Q GR+RHF +PS+R     PFCP
Sbjct  250  DVFVHDVDRSVEDRFSKAFLCEAYLEEQVGRIRHFVVPSHREKPGTPFCP  299



>gb|KDP45647.1| hypothetical protein JCGZ_17254 [Jatropha curcas]
Length=171

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = +1

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI  654
            MW +LN+GGRTVFLEED+AWI QI  K P LESYHV+YDTKV +A  LME G+G EC  +
Sbjct  1    MWTSLNHGGRTVFLEEDKAWIEQIKGKLPSLESYHVSYDTKVHEADGLMETGQGEECKIV  60

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            +DPR+S CQLALK  PS VY++ WDLIMVDAPTGYHDEAPGRM AIYTAG+MARNR    
Sbjct  61   SDPRFSKCQLALKGFPSDVYDIEWDLIMVDAPTGYHDEAPGRMTAIYTAGLMARNRE--N  118

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            GET+VFVHDV+RVVEDKFSKAFLCEGYM +QEGRLRHFTIPS+R  L   FCP
Sbjct  119  GETDVFVHDVDRVVEDKFSKAFLCEGYMTEQEGRLRHFTIPSHRTRLGRSFCP  171



>ref|XP_010322783.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Solanum 
lycopersicum]
Length=277

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%), Gaps = 5/239 (2%)
 Frame = +1

Query  283  KEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLG  462
            K   LS  +CNK IP S+A++++HY+T+  T QQ  +EIS+T ++LE+KSP NFLVFGLG
Sbjct  42   KLKNLSISSCNK-IPPSLAESILHYATTNKTIQQKHEEISITLKVLEKKSPCNFLVFGLG  100

Query  463  HDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE  642
             DSLMW +LN+ GRTVF+EE+  WI +IT++ P LE+YH  YDT++ QA +L+ IGK  +
Sbjct  101  LDSLMWSSLNHNGRTVFIEENIHWIQKITKEVPSLEAYHYIYDTRLDQAPELLSIGKRED  160

Query  643  CTA--ITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMAR  816
                 + DPR S C LAL ++P  VYE+ WDLIM+DAPTG     PGRM  IYT G++AR
Sbjct  161  SCKKNLGDPRNSKCPLALTNMPKEVYEIEWDLIMIDAPTGSFYNLPGRMKVIYTVGLLAR  220

Query  817  NRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            NR    GET+VFVHD  R VED+FS+ FLCEGY++ Q   LRHFTIPSYR+ L   FCP
Sbjct  221  NRE--NGETDVFVHDCKRYVEDQFSRNFLCEGYIRGQVRNLRHFTIPSYRSGLVKSFCP  277



>ref|XP_008662640.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 isoform X2 
[Zea mays]
 gb|AFW56619.1| hypothetical protein ZEAMMB73_933275 [Zea mays]
Length=309

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 164/232 (71%), Gaps = 5/232 (2%)
 Frame = +1

Query  313  NKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLN  492
            N  +P +VA+A++HY+TS +TPQQT  EI V+ R+L++++P NFLVFGLG DS MW  LN
Sbjct  78   NAGLPLAVAEALVHYTTSNVTPQQTADEIGVSLRVLQRRAPCNFLVFGLGLDSPMWAALN  137

Query  493  YGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYS  672
            +GGRTVFLEED +WI  +  K P LESYHV YDT ++ A  L+ +   P C A  D   +
Sbjct  138  HGGRTVFLEEDASWIASVRSKHPGLESYHVAYDTVLTDADSLLGLRDHPACVAQPDLAAA  197

Query  673  MCQLAL-----KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
                       K LP + +E+ WDL+MVDAPTG+  +APGRMAAIYTAGM AR RR G G
Sbjct  198  AAASCRLALALKGLPPVFHELEWDLVMVDAPTGWTPQAPGRMAAIYTAGMAARARRPGDG  257

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
             T+VFVHDV+R VED FSKAFLCEGY+ +Q GR+RHF IPS+R     PFCP
Sbjct  258  PTDVFVHDVDRPVEDNFSKAFLCEGYLAEQVGRIRHFVIPSHREKDGTPFCP  309



>tpg|DAA55455.1| TPA: plant-specific domain TIGR01627 family protein [Zea mays]
Length=298

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 162/227 (71%), Gaps = 3/227 (1%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            +P  VA+A++HY+TS  TPQQT +EI V  R+L++++P NFLVFGLG DS MW  LN+GG
Sbjct  72   LPLPVAEALVHYATSNATPQQTAEEIGVALRVLQRRAPCNFLVFGLGLDSPMWAALNHGG  131

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRYS  672
            RTVFLEED AWI  +  + P LES+HV YDT ++ A  L+ +   P C A  D      +
Sbjct  132  RTVFLEEDAAWIGSVRGRHPALESHHVAYDTALADADALLGLRAHPACVAQPDLAAAAAA  191

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL+ LP +   + WDL+MVDAPTG+   APGRM AIYTAGM AR RR G G T VF
Sbjct  192  SCRLALRGLPPVFAGLDWDLVMVDAPTGWTPRAPGRMGAIYTAGMAARARRPGAGPTHVF  251

Query  853  VHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            VHDV+R VED FS+AFLCEGY+ +Q GR+RHF IPS+R+    PFCP
Sbjct  252  VHDVDRPVEDAFSRAFLCEGYLAEQVGRIRHFVIPSHRDKDGTPFCP  298



>ref|NP_001147380.1| plant-specific domain TIGR01627 family protein [Zea mays]
 gb|ACG27201.1| plant-specific domain TIGR01627 family protein [Zea mays]
Length=285

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 160/223 (72%), Gaps = 3/223 (1%)
 Frame = +1

Query  334  VAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVF  513
            VA+A++HY+TS  TPQQT +EI V  R+L++++P NFLVFGLG DS +W  LN+GGRTVF
Sbjct  63   VAEALVHYATSNATPQQTAEEIGVALRVLQRRAPCNFLVFGLGLDSPLWAALNHGGRTVF  122

Query  514  LEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRYSMCQL  684
            LEED AWI  +  + P LES+HV YDT ++ A  L+ +   P C A  D      + C+L
Sbjct  123  LEEDAAWITSVRGRHPALESHHVAYDTALADADALLGLRAHPACVAQPDLAAAAAASCRL  182

Query  685  ALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDV  864
            AL+ LP +   + WDL+MVDAPTG+   APGRM AIYTAGM AR RR G G T VFVHDV
Sbjct  183  ALRGLPPVFAGLDWDLVMVDAPTGWTPRAPGRMGAIYTAGMAARARRPGAGPTHVFVHDV  242

Query  865  NRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +R +ED FS+AFLCEGY+ +Q GR+RHF IPS+R+    PFCP
Sbjct  243  DRSIEDAFSRAFLCEGYLAEQVGRIRHFVIPSHRDKDGTPFCP  285



>ref|XP_006356560.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Solanum 
tuberosum]
Length=438

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 169/230 (73%), Gaps = 4/230 (2%)
 Frame = +1

Query  310  CNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            C+ KIP S+A++ +HY+T+  T QQ   EIS+T ++LE+KSP NFLVFGLG DSLMW + 
Sbjct  211  CDPKIPPSLAESFLHYATTNRTMQQKHDEISITLKVLEKKSPCNFLVFGLGFDSLMWSSF  270

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTA--ITDP  663
            N+ GRTVF+EE++ WIH+IT++ P LE+Y  TY+T++ QA +L+ IGK  +     + DP
Sbjct  271  NHNGRTVFIEENKDWIHKITKEVPSLEAYQYTYETRLDQAPELLSIGKREDSCKKNLGDP  330

Query  664  RYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGET  843
            R S C LAL ++P  VYE+ WDLIM+DAPTG   + PGRM  IYT G++ARNR    GET
Sbjct  331  RNSKCPLALTNMPKEVYEIEWDLIMIDAPTGSFYDLPGRMKVIYTVGLLARNRE--NGET  388

Query  844  EVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            +VFVHD  R VEDKFS+ FLCEGY++ Q   LRHFTIPSYR+ L   FCP
Sbjct  389  DVFVHDCKRYVEDKFSRNFLCEGYIRGQVRNLRHFTIPSYRSGLIKSFCP  438



>ref|XP_008662641.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 isoform X3 
[Zea mays]
Length=303

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 160/223 (72%), Gaps = 5/223 (2%)
 Frame = +1

Query  313  NKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLN  492
            N  +P +VA+A++HY+TS +TPQQT  EI V+ R+L++++P NFLVFGLG DS MW  LN
Sbjct  78   NAGLPLAVAEALVHYTTSNVTPQQTADEIGVSLRVLQRRAPCNFLVFGLGLDSPMWAALN  137

Query  493  YGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYS  672
            +GGRTVFLEED +WI  +  K P LESYHV YDT ++ A  L+ +   P C A  D   +
Sbjct  138  HGGRTVFLEEDASWIASVRSKHPGLESYHVAYDTVLTDADSLLGLRDHPACVAQPDLAAA  197

Query  673  MCQLAL-----KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
                       K LP + +E+ WDL+MVDAPTG+  +APGRMAAIYTAGM AR RR G G
Sbjct  198  AAASCRLALALKGLPPVFHELEWDLVMVDAPTGWTPQAPGRMAAIYTAGMAARARRPGDG  257

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYR  966
             T+VFVHDV+R VED FSKAFLCEGY+ +Q GR+RHF IPS++
Sbjct  258  PTDVFVHDVDRPVEDNFSKAFLCEGYLAEQVGRIRHFVIPSHQ  300



>gb|KFK32037.1| hypothetical protein AALP_AA6G191900 [Arabis alpina]
Length=180

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +1

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAI  654
            MW +LN+GGRT+FLEED+ WI+ +++KFP LESYHV YDTK+  +  LME+GK  +C ++
Sbjct  1    MWASLNHGGRTLFLEEDKVWINTVSKKFPSLESYHVVYDTKLKDSNKLMELGKTEDCKSV  60

Query  655  TDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGG  834
            +DPR S C L+LK  P+  YE  WDLIMVDAPTG+HDEAPGRM+AIYTAG++ARNR + G
Sbjct  61   SDPRDSKCALSLKGFPADFYETQWDLIMVDAPTGFHDEAPGRMSAIYTAGLLARNRYD-G  119

Query  835  GETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            GET+VFVHDVNR VED+FS AFLC GY+K+Q+GRLRHFTIPS+R     PFCP
Sbjct  120  GETDVFVHDVNRPVEDEFSAAFLCRGYLKEQQGRLRHFTIPSHRGRSGTPFCP  172



>ref|XP_008662639.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 isoform X1 
[Zea mays]
Length=320

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 151/211 (72%), Gaps = 5/211 (2%)
 Frame = +1

Query  313  NKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLN  492
            N  +P +VA+A++HY+TS +TPQQT  EI V+ R+L++++P NFLVFGLG DS MW  LN
Sbjct  78   NAGLPLAVAEALVHYTTSNVTPQQTADEIGVSLRVLQRRAPCNFLVFGLGLDSPMWAALN  137

Query  493  YGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD----  660
            +GGRTVFLEED +WI  +  K P LESYHV YDT ++ A  L+ +   P C A  D    
Sbjct  138  HGGRTVFLEEDASWIASVRSKHPGLESYHVAYDTVLTDADSLLGLRDHPACVAQPDLAAA  197

Query  661  -PRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG  837
                    LALK LP + +E+ WDL+MVDAPTG+  +APGRMAAIYTAGM AR RR G G
Sbjct  198  AAASCRLALALKGLPPVFHELEWDLVMVDAPTGWTPQAPGRMAAIYTAGMAARARRPGDG  257

Query  838  ETEVFVHDVNRVVEDKFSKAFLCEGYMKKQE  930
             T+VFVHDV+R VED FSKAFLCEGY+ +Q 
Sbjct  258  PTDVFVHDVDRPVEDNFSKAFLCEGYLAEQN  288



>gb|EMS51769.1| hypothetical protein TRIUR3_12679 [Triticum urartu]
Length=324

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 167/252 (66%), Gaps = 15/252 (6%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFG-  456
            R+  +   +    K+P  VA+A++HY+T+  T  QT  E+++T+R+L Q++P N LVFG 
Sbjct  74   RRNTQQQQQGGCAKLPGPVAEALVHYATANATLPQTAAEVAMTARLLAQRAPCNLLVFGG  133

Query  457  LGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPML--ESYHVTYDTKVSQAGDLMEIG  630
            LG DS +W  LN+GGRT FLEED A I ++  + P L  ES+ V Y T ++ A +L+ + 
Sbjct  134  LGPDSALWAALNHGGRTAFLEEDAALITEVGARHPGLGLESHQVAYQTTLADADELLGLR  193

Query  631  KGPECTAITDPR----------YSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGR  780
              P+CTA + P+           S C+LA++ LP+  YE  WD+IMVDAP G+  EAPGR
Sbjct  194  GSPDCTA-SPPKDHPLSPDHFEGSPCKLAMRGLPAAFYETEWDVIMVDAPIGWVPEAPGR  252

Query  781  MA-AIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            +  AIY AGM AR RR G GETEV VHDV+R VED FS+AFLC GY++++ GRLR F IP
Sbjct  253  VGGAIYMAGMAARARRPGSGETEVLVHDVDRTVEDSFSRAFLCAGYLEEEVGRLRRFAIP  312

Query  958  SYRNHLDMPFCP  993
            S+R    MPFCP
Sbjct  313  SHREKEGMPFCP  324



>dbj|BAK07602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 167/252 (66%), Gaps = 15/252 (6%)
 Frame = +1

Query  280  RKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFG-  456
            R+  +   +    K+P  V +A++HY+T+  T +QT  E++VT+R+L Q++P N LVFG 
Sbjct  74   RRNTQQQQQGGCAKLPGPVGEALVHYATTNATLRQTAPEVAVTARLLAQRAPCNLLVFGG  133

Query  457  LGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPML--ESYHVTYDTKVSQAGDLMEIG  630
            LG DS +W  LN+GGRT FLEED A I ++  + P L  ES+ V Y T ++ A +L+ + 
Sbjct  134  LGPDSALWAALNHGGRTAFLEEDAALIAEVGARHPGLGLESHQVAYQTTLADADELLGLR  193

Query  631  KGPECTAITDPRY----------SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGR  780
              P+CTA + P+           S C+LA++ LP+  YE  WD+I+VDAPTG+  EAPGR
Sbjct  194  GSPDCTA-SPPKGRPLSPDNFEGSPCKLAMRGLPAAFYETEWDVIIVDAPTGWVPEAPGR  252

Query  781  MA-AIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            +  AIY AGM AR RR G GET+V VHDV+  VED FS+AFLC GY++++ GRLR F IP
Sbjct  253  IGGAIYMAGMAARARRPGNGETDVLVHDVDMPVEDSFSRAFLCAGYLEEEVGRLRRFAIP  312

Query  958  SYRNHLDMPFCP  993
            S+R    MPFCP
Sbjct  313  SHREKEGMPFCP  324



>gb|AAO22808.1| unknown protein [Arabidopsis thaliana]
Length=164

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 127/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRYSMCQLALKSL  699
            EDEAWI  +T+KFP LESYHV YDTKV  +  LME+ +  +C A++DPR S C L+LK  
Sbjct  1    EDEAWIETVTKKFPNLESYHVVYDTKVKDSNKLMELKRTEDCKAVSDPRDSKCALSLKGF  60

Query  700  PSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVE  879
            P+ VYE  WD+IMVDAPTGYHDEAPGRM+AIYTAG++ARNR + GGET+VFVHD+NR VE
Sbjct  61   PADVYETQWDVIMVDAPTGYHDEAPGRMSAIYTAGLLARNRYD-GGETDVFVHDINRPVE  119

Query  880  DKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            D+FS AFLC GYMK+Q+GRLRHF IPS+R     PFCP
Sbjct  120  DEFSVAFLCGGYMKEQQGRLRHFNIPSHRASFGTPFCP  157



>ref|XP_006848337.1| hypothetical protein AMTR_s00013p00174150 [Amborella trichopoda]
 gb|ERN09918.1| hypothetical protein AMTR_s00013p00174150 [Amborella trichopoda]
Length=267

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 146/217 (67%), Gaps = 2/217 (1%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+T++ITPQQ+  EI++T  +L  ++P NFLVFGLGHDSLMW  LN GGRT+FLEE
Sbjct  52   AILHYATTSITPQQSFSEINLTYSVLLHRAPCNFLVFGLGHDSLMWAALNPGGRTLFLEE  111

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSMCQLALKSL  699
            D  W+H +    P L ++ V Y+TK+SQA +L+   +  P+C        S C LA+K  
Sbjct  112  DPKWLHSVLSSAPYLNAHAVQYETKLSQAENLINSHRSYPDCEMGETLLESKCPLAIKRF  171

Query  700  PSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVE  879
            P  VYE  WD+IMVDAP GY D APGRM AIY+  +MAR RR G G T+VFVHDVNR VE
Sbjct  172  PREVYETEWDVIMVDAPRGYFDSAPGRMGAIYSVAVMAR-RRRGAGTTDVFVHDVNRKVE  230

Query  880  DKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
             ++S+ FLC  Y+ +  GRL HF IP        PFC
Sbjct  231  KRYSEEFLCRKYLVEGTGRLWHFRIPPSNAMEGKPFC  267



>ref|XP_009629764.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = +1

Query  298  SSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLM  477
            S+ +   KIP S+A+A+ HY+ + ITPQQ   EIS+T R+LE+KSP NFL+FGLG DSLM
Sbjct  51   STSSTYNKIPPSLAEALFHYAATNITPQQKHDEISMTFRVLEKKSPCNFLIFGLGFDSLM  110

Query  478  WHTLNYGGRTVFLEEDEAWIHQITRKFPM-LESYHVTYDTKVSQAGDLMEIGKGPE-CTA  651
            W + NY GRT+F+EED+ WI +IT++ P  +E+YH TY+TK+ QA +L+ IG+  + C  
Sbjct  111  WSSFNYNGRTIFIEEDKDWIEKITKEVPTKIEAYHYTYETKLDQATELLNIGRREDSCKV  170

Query  652  ITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREG  831
            + DPR S C LALK+LP  VYE+ WD+IMVDAPTG   + PGRM  IYTAG++ARN+   
Sbjct  171  VVDPRNSKCPLALKNLPKQVYEIEWDVIMVDAPTGSSFDQPGRMKVIYTAGLLARNKE--  228

Query  832  GGETEVFVHDVNRVVEDKFSKA  897
             GET+VFVHD  R   ++ S+A
Sbjct  229  SGETDVFVHDCKRSSTEQESRA  250



>gb|EAZ27036.1| hypothetical protein OsJ_10966 [Oryza sativa Japonica Group]
Length=271

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 149/228 (65%), Gaps = 27/228 (12%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            K+PA+VA+A++HY+T+ +TPQQT  EI V+ R+L+ ++P NFL                 
Sbjct  68   KLPAAVAQAMVHYATANVTPQQTAAEIGVSLRVLQLRAPCNFL-----------------  110

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITD---PRY  669
                   ED +WI  +    P LESYHV YDT+V+ A +L+ +   P CT+  D      
Sbjct  111  -------EDASWIASVKAGHPGLESYHVAYDTRVTDADELIALRHEPACTSQPDLAAAAA  163

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            + C+LAL+ LP + +EV WDLIMVDAPTG+  E+PGRM AIYTAGM AR R  G G TEV
Sbjct  164  ASCRLALRGLPPVFHEVEWDLIMVDAPTGWTPESPGRMGAIYTAGMAARARTPGAGATEV  223

Query  850  FVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFCP  993
            FVHDV+R VED FSKAFLC+GY+ +Q GR+R F IPS+R+    PFCP
Sbjct  224  FVHDVDRHVEDTFSKAFLCDGYLVEQVGRIRRFVIPSHRDKDGTPFCP  271



>ref|NP_176901.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG00240.1|AC002130_5 F1N21.15 [Arabidopsis thaliana]
 gb|AAR92263.1| At1g67330 [Arabidopsis thaliana]
 gb|AAS76250.1| At1g67330 [Arabidopsis thaliana]
 dbj|BAE99322.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34632.1| uncharacterized protein AT1G67330 [Arabidopsis thaliana]
Length=291

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 161/256 (63%), Gaps = 17/256 (7%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVAK---------AVIHYSTSAITPQQTTKEISVTSRILE  423
            F+   +  LS  +  K   AS+AK         +++HY+TS   PQQ+ +EIS++  +L+
Sbjct  37   FIRATDNTLSLCSTAKNTAASIAKYTATPIQLQSIVHYATSHTVPQQSFEEISISLNVLK  96

Query  424  QKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVS  603
            ++ P NFLVFGLG DSLMW +LN GG TVFLEED  WI  + +  P L ++HV Y T +S
Sbjct  97   ERLPCNFLVFGLGRDSLMWASLNPGGTTVFLEEDPEWIEAVLKDAPSLRAHHVQYRTHLS  156

Query  604  QAGDLMEIGKG-PECT-AITDP-RYS-MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEA  771
            +AG L+   K  P C  A   P RY+  C LAL SLP   Y+  WDLIMVDAP GY  EA
Sbjct  157  EAGRLLSTYKNEPMCLPAKAFPIRYNEKCPLALTSLPDEFYDTEWDLIMVDAPKGYFPEA  216

Query  772  PGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFT  951
            PGRMAAI+++ +MARNR+ G G T VF+HDVNR VE+ F+  FLCE Y     GRL HF 
Sbjct  217  PGRMAAIFSSAIMARNRK-GDGTTHVFLHDVNRKVENAFANEFLCEKYKVNSVGRLWHFE  275

Query  952  IPSYRNHLDMP---FC  990
            IP+  N  D P   FC
Sbjct  276  IPNAANMTDQPGDRFC  291



>emb|CDY28894.1| BnaC06g26820D [Brassica napus]
Length=291

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 151/224 (67%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQ+ +EIS++  +L+++ P NFLVFGLGHDSLMW +LN  G TVFLE
Sbjct  69   QSIVHYATSQTVPQQSFEEISISLNVLKERIPCNFLVFGLGHDSLMWASLNPRGTTVFLE  128

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            ED  WI  + +  P L ++HV Y T++SQA +L+   +  P+C  A   P RY+  C LA
Sbjct  129  EDPEWIQAVLKDAPSLRAHHVQYRTQLSQADNLLATYRSEPKCLPANAFPIRYNEKCPLA  188

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI++A +MARNR+ G G T VF+HDV+
Sbjct  189  LTSLPDEFYDTEWDLIMVDAPKGYFPTAPGRMAAIFSAAIMARNRK-GAGTTHVFLHDVD  247

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R+VE  ++  FLCE Y     GRL HF IP+  N  D P   FC
Sbjct  248  RIVEKTYANEFLCEKYRVNSAGRLWHFEIPNAANMSDQPGDRFC  291



>ref|XP_010415308.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Camelina 
sativa]
Length=291

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 159/256 (62%), Gaps = 17/256 (7%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVA---------KAVIHYSTSAITPQQTTKEISVTSRILE  423
            F+   +  LS  +  K   AS+A         ++++HY+TS   PQQ+ +EIS++  +L+
Sbjct  37   FIRATDNTLSLCSTAKNTAASIAEYTATPIQLQSIVHYATSHTVPQQSFEEISISLNVLK  96

Query  424  QKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVS  603
            ++ P NFLVFGLG DSLMW +LN GG TVFLEED  WI  + +  P L ++HV Y T +S
Sbjct  97   ERLPCNFLVFGLGRDSLMWASLNPGGNTVFLEEDPEWIEAVLKDAPSLRAHHVQYRTHLS  156

Query  604  QAGDLMEIGKG-PECT-AITDP-RYSM-CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEA  771
            QAG L+   K  P C  A   P RY+  C LAL SLP   Y+  WDLIMVDAP GY   A
Sbjct  157  QAGSLLSYYKNEPMCLPANAFPIRYNQKCPLALTSLPDEFYDTEWDLIMVDAPKGYFPLA  216

Query  772  PGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFT  951
            PGRMAAI+++ +MARNR+ G G T VF+HDV+R VE  F+  FLCE Y     GRL HF 
Sbjct  217  PGRMAAIFSSAVMARNRK-GAGTTHVFLHDVDRKVEKAFANEFLCEKYKTTSAGRLWHFE  275

Query  952  IPSYRNHLDMP---FC  990
            IP+  N  D P   FC
Sbjct  276  IPNAANMSDQPGDRFC  291



>ref|XP_010470638.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010470639.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=291

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 159/256 (62%), Gaps = 17/256 (7%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVA---------KAVIHYSTSAITPQQTTKEISVTSRILE  423
            F+   +  LS  +  K   AS+A         ++++HY+TS   PQQ+ +EIS++  +L+
Sbjct  37   FIRATDNTLSLCSTAKNTAASIAEYTATPIQLQSIVHYATSHTVPQQSFEEISISLNVLK  96

Query  424  QKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVS  603
            ++ P NFLVFGLG DSLMW +LN GG TVFLEED  WI  + +  P L ++HV Y T +S
Sbjct  97   ERLPCNFLVFGLGRDSLMWASLNPGGNTVFLEEDPEWIEAVLKDAPSLRAHHVQYRTHLS  156

Query  604  QAGDLMEIGKG-PECT-AITDP-RYSM-CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEA  771
            QAG L+   K  P C  A   P RY+  C LAL SLP   Y+  WDLIMVDAP GY   A
Sbjct  157  QAGSLLSYYKNEPMCLPANAFPIRYNQKCPLALTSLPDEFYDTEWDLIMVDAPKGYFPLA  216

Query  772  PGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFT  951
            PGRMAAI+++ +MARNR+ G G T VF+HDV+R VE  F+  FLCE Y     GRL HF 
Sbjct  217  PGRMAAIFSSAVMARNRK-GAGTTHVFLHDVDRKVEKAFANEFLCEKYKTTSAGRLWHFE  275

Query  952  IPSYRNHLDMP---FC  990
            IP+  N  D P   FC
Sbjct  276  IPNAANMSDQPGDRFC  291



>ref|XP_010511661.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Camelina 
sativa]
Length=291

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 159/256 (62%), Gaps = 17/256 (7%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVA---------KAVIHYSTSAITPQQTTKEISVTSRILE  423
            F+   +  LS  +  K   AS+A         ++++HY+TS   PQQ+ +EIS++  +L+
Sbjct  37   FIRATDNTLSLCSTAKNTAASIAEYTATPIQLQSIVHYATSHTVPQQSFEEISISLNVLK  96

Query  424  QKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVS  603
            ++ P NFLVFGLG DSLMW +LN GG TVFLEED  WI  + +  P L ++HV Y T +S
Sbjct  97   ERLPCNFLVFGLGRDSLMWASLNPGGNTVFLEEDPEWIEAVLKDAPSLRAHHVKYRTHLS  156

Query  604  QAGDLMEIGKG-PECT-AITDP-RYSM-CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEA  771
            QAG L+   K  P C  A   P RY+  C LAL SLP   Y+  WDLIMVDAP GY   A
Sbjct  157  QAGSLLSYYKNEPMCLPANAFPIRYNQKCPLALTSLPDEFYDTEWDLIMVDAPKGYFPLA  216

Query  772  PGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFT  951
            PGRMAAI+++ +MARNR+ G G T VF+HDV+R VE  F+  FLCE Y     GRL HF 
Sbjct  217  PGRMAAIFSSAVMARNRK-GAGTTHVFLHDVDRKVEKAFANEFLCEKYKTTSAGRLWHFE  275

Query  952  IPSYRNHLDMP---FC  990
            IP+  N  D P   FC
Sbjct  276  IPNAANMSDQPGDRFC  291



>ref|XP_009105125.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Brassica 
rapa]
 emb|CDY07428.1| BnaA07g25070D [Brassica napus]
Length=291

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 151/224 (67%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQ+ +EIS++  +L+++ P NFLVFGLGHDSLMW +LN  G TVFLE
Sbjct  69   QSIVHYATSQTVPQQSFEEISISLNVLKERIPCNFLVFGLGHDSLMWASLNPRGTTVFLE  128

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            +D  WI  + +  P L ++HV Y T++SQA +L+   +  P+C  A   P RY+  C LA
Sbjct  129  DDPEWIQAVLKDAPSLRAHHVQYRTQLSQADNLLATYRSEPKCLPANAFPIRYNEKCPLA  188

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI++A +MARNR+ G G T VF+HDV+
Sbjct  189  LTSLPDEFYDTEWDLIMVDAPKGYFPTAPGRMAAIFSAAIMARNRK-GAGTTHVFLHDVD  247

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R+VE  ++  FLCE Y     GRL HF IP+  N  D P   FC
Sbjct  248  RIVEKTYANEFLCEKYRVNSAGRLWHFEIPNAANMSDQPGDRFC  291



>ref|XP_004310084.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 148/224 (66%), Gaps = 4/224 (2%)
 Frame = +1

Query  328  ASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRT  507
            A+  +AV+HY+TS+ TPQQ+  EISV+  +L+ ++P NFLVFGLG+DSLMW + N  G T
Sbjct  53   ATQLQAVLHYATSSKTPQQSRAEISVSFDVLKSRAPCNFLVFGLGYDSLMWASFNPRGTT  112

Query  508  VFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMC  678
            +FLEED  W+  + +  P L +  V Y T++ QA +L+   K     A ++        C
Sbjct  113  LFLEEDPKWVQTVLKASPELRAETVNYRTQLKQADELLSSYKSEATCAPSEAVLRGNERC  172

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL +LP  VYE  WDLIM+DAP GY  EAPGRMAAI++A +MAR RR G G T VF+H
Sbjct  173  KLALSNLPEEVYEKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMAR-RRRGSGATHVFLH  231

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            DV+R VE  F++ FLC  ++ K  GRL HF IPS  N  D+ FC
Sbjct  232  DVDRKVEKAFAEEFLCRNFLVKAVGRLWHFEIPSAVNATDVSFC  275



>ref|XP_006301418.1| hypothetical protein CARUB_v10021834mg [Capsella rubella]
 gb|EOA34316.1| hypothetical protein CARUB_v10021834mg [Capsella rubella]
Length=291

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 144/224 (64%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQ+ +EIS++  +L+++ P NFLVFGLG DSLMW +LN GG TVFLE
Sbjct  69   QSIVHYATSQTVPQQSFEEISISLNVLKERLPCNFLVFGLGRDSLMWASLNPGGTTVFLE  128

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC---TAITDPRYSMCQLA  687
            ED  WI  + +  P L ++HV Y T +SQAG L+   K  P C    A        C LA
Sbjct  129  EDPDWIQAVLKDAPSLRAHHVQYRTHLSQAGRLLSTYKTEPMCLPANAFPIRNNEKCPLA  188

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI+++ +MARNR+ G G T VF+HDV+
Sbjct  189  LTSLPDEFYDTEWDLIMVDAPKGYFPLAPGRMAAIFSSAIMARNRK-GDGTTHVFLHDVD  247

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  F+  FLCE Y     GRL HF IP+  N  D P   FC
Sbjct  248  RKVEKAFANEFLCEKYKVNSAGRLWHFEIPNAANMSDQPGDRFC  291



>ref|XP_002887113.1| hypothetical protein ARALYDRAFT_475830 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63372.1| hypothetical protein ARALYDRAFT_475830 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 159/256 (62%), Gaps = 17/256 (7%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVA---------KAVIHYSTSAITPQQTTKEISVTSRILE  423
            F+   +  LS  +  K   AS+A         ++++HY+TS   PQQ+ +EIS++  +L+
Sbjct  37   FIRATDNTLSLCSTAKNTAASIAEYSATPIQLQSIVHYATSHTVPQQSFEEISISLNVLK  96

Query  424  QKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVS  603
            ++ P NFLVFGLG DSLMW +LN GG TVFLEED  WI  + +  P L ++HV Y T +S
Sbjct  97   ERLPCNFLVFGLGRDSLMWASLNPGGTTVFLEEDPEWIEAVLKDAPSLRAHHVQYRTHLS  156

Query  604  QAGDLMEIGKG-PECT-AITDP-RYS-MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEA  771
            +AG L+   K  P C  A   P RY+  C LAL SLP   Y+  WDLIMVDAP GY   A
Sbjct  157  EAGRLLSTYKNEPMCLPAKAFPIRYNEKCPLALTSLPDEFYDTEWDLIMVDAPKGYFPVA  216

Query  772  PGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFT  951
            PGRMAAI+++ +MARNR+ G G T VF+HDV+R VE  F+  FLCE Y     GRL HF 
Sbjct  217  PGRMAAIFSSAVMARNRK-GDGTTHVFLHDVDRYVEKTFANEFLCEKYKVNSAGRLWHFE  275

Query  952  IPSYRNHLDMP---FC  990
            IP+  N  D P   FC
Sbjct  276  IPNAANMTDQPGDRFC  291



>ref|XP_009127546.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Brassica 
rapa]
Length=295

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 149/224 (67%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQT  EIS++  +L+ + P NFLVFGLG DSLMW +LN GG TVF+E
Sbjct  73   QSIVHYATSRTVPQQTFDEISISLEVLKDRLPCNFLVFGLGRDSLMWASLNPGGTTVFME  132

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            ED  WI  + +  P L ++HV Y T++SQA  L++  +  P+C  A   P RY+  C LA
Sbjct  133  EDPEWIQAVLKDAPSLRAHHVQYRTQLSQADRLLKTYRSEPKCLPANAFPIRYNEKCPLA  192

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI+++ +MARNR+ G G T VF+HDV+
Sbjct  193  LTSLPDEFYDTEWDLIMVDAPKGYFATAPGRMAAIFSSAVMARNRK-GAGTTHVFLHDVD  251

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  ++  FLCE Y  K  GRL HF IP+  N  D P   FC
Sbjct  252  RKVEKAYANEFLCEKYRVKSAGRLWHFEIPNAANMSDQPGDRFC  295



>emb|CDY12639.1| BnaA02g13070D [Brassica napus]
Length=288

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 149/224 (67%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQT  EIS++  +L+ + P NFLVFGLG DSLMW +LN GG TVF+E
Sbjct  66   QSIVHYATSRTVPQQTFDEISISLEVLKDRLPCNFLVFGLGRDSLMWASLNPGGTTVFME  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            ED  WI  + +  P L ++HV Y T++SQA  L++  +  P+C  A   P RY+  C LA
Sbjct  126  EDPEWIQAVLKDAPSLRAHHVQYRTQLSQADRLLKTYRSEPKCLPANAFPIRYNEKCPLA  185

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI+++ +MARNR+ G G T VF+HDV+
Sbjct  186  LTSLPDEFYDTEWDLIMVDAPKGYFATAPGRMAAIFSSAVMARNRK-GAGTTHVFLHDVD  244

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  ++  FLCE Y  K  GRL HF IP+  N  D P   FC
Sbjct  245  RKVEKAYANEFLCEKYRVKSAGRLWHFEIPNADNMSDQPGDRFC  288



>emb|CDY51186.1| BnaC02g45640D [Brassica napus]
Length=295

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 149/224 (67%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQT  EIS++  +L+ + P NFLVFGLG DSLMW +LN GG TVF+E
Sbjct  73   QSIVHYATSRTVPQQTFDEISISLEVLKDRLPCNFLVFGLGRDSLMWASLNPGGTTVFME  132

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            ED  WI  + +  P L ++HV Y T++SQA  L++  +  P+C  A   P RY+  C LA
Sbjct  133  EDPEWIQAVLKDAPSLRAHHVQYRTQLSQADRLLKTYRSEPKCLPANAFPIRYNEKCPLA  192

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI+++ +MARNR+ G G T VF+HDV+
Sbjct  193  LTSLPDEFYDTEWDLIMVDAPKGYFATAPGRMAAIFSSAVMARNRK-GAGTTHVFLHDVD  251

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  ++  FLCE Y  K  GRL HF IP+  N  D P   FC
Sbjct  252  RKVEKAYANEFLCEKYRIKSAGRLWHFEIPNAANMSDQPGDRFC  295



>gb|KFK41138.1| hypothetical protein AALP_AA2G090800 [Arabis alpina]
Length=291

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 148/224 (66%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQ+ +EIS++  +L+ + P NFLVFGLG DSLMW +LN GG TVFLE
Sbjct  69   QSIVHYATSRTVPQQSFEEISISLEVLKDRIPCNFLVFGLGRDSLMWASLNPGGTTVFLE  128

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            ED  WI  + +  P L ++HV Y T++SQA  L+   K  P+C  A   P RY+  C LA
Sbjct  129  EDPEWIEAVLKDAPSLRAHHVQYRTQLSQANRLLSTYKSEPKCLPANAFPIRYNEKCPLA  188

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI++A +MARNR+   G T VF+HDV+
Sbjct  189  LTSLPDEFYDTEWDLIMVDAPKGYFPTAPGRMAAIFSAAIMARNRK-SLGTTHVFLHDVD  247

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  ++  FLCE Y  K  GRL HF IP+  N  D P   FC
Sbjct  248  RSVEKAYANEFLCEKYKVKSAGRLWHFEIPNAANMSDQPGDRFC  291



>ref|XP_006391291.1| hypothetical protein EUTSA_v10018905mg [Eutrema salsugineum]
 gb|ESQ28577.1| hypothetical protein EUTSA_v10018905mg [Eutrema salsugineum]
Length=314

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 151/224 (67%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS   PQQ+ +EIS++  +L+ + P NFLVFGLG DSLMW +LN GG TVFLE
Sbjct  92   QSIVHYATSRTVPQQSFEEISISLDVLKDRLPCNFLVFGLGRDSLMWASLNPGGTTVFLE  151

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT-AITDP-RYS-MCQLA  687
            ED  WI  + ++ P L ++HV Y T++SQA  L+   +  P+C  A   P RY+  C LA
Sbjct  152  EDPEWIEAVLKEAPSLRAHHVQYRTQLSQADRLLSTYRSEPKCLPANAFPIRYNEKCPLA  211

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP   Y+  WDLIMVDAP GY   APGRMAAI+++ +MARNR+ G G T VF+HDV+
Sbjct  212  LTSLPDEFYDTEWDLIMVDAPKGYFATAPGRMAAIFSSAVMARNRK-GAGTTHVFLHDVD  270

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE+ ++  FLC+ Y  K  GRL HF IP+  N  D P   FC
Sbjct  271  RKVENAYANEFLCQKYKVKSAGRLWHFEIPNAANMSDQPGDRFC  314



>ref|XP_010530547.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Tarenaya hassleriana]
Length=291

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 147/224 (66%), Gaps = 8/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS I PQQ+  EI+VT  +L+ +SP NFLVFGLGHDSLMW +LN  G TVFLE
Sbjct  69   QAIVHYATSRIVPQQSLPEITVTLDVLKDRSPCNFLVFGLGHDSLMWASLNPRGTTVFLE  128

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC--TAITDPRYS-MCQLA  687
            ED  WI  + +  P L ++HVTY TK+S+A  L+   +  P C  +     RY+  C LA
Sbjct  129  EDPDWIGTVLKAAPSLHAHHVTYRTKLSEADRLLATYRSKPRCLPSKAFPIRYNEECPLA  188

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L SLP  +YE  WDLIM+DAP GY   APGRM+AI++A  MARNRR G G T VF+HDV+
Sbjct  189  LTSLPDEIYETEWDLIMIDAPRGYFAAAPGRMSAIFSAATMARNRR-GQGMTHVFLHDVD  247

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  F++ FLC  +     GRL HF IP+  N    P   FC
Sbjct  248  RKVEKTFAEEFLCRKFRVNSSGRLWHFEIPNAANMSGEPVDRFC  291



>ref|XP_004310083.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 146/224 (65%), Gaps = 4/224 (2%)
 Frame = +1

Query  328  ASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRT  507
            A+  +AV+HY+TS+ TPQQ+  EISV+  +L+ ++P NFLVFGLG+DSLMW + N  G T
Sbjct  50   ATQLQAVLHYATSSKTPQQSRAEISVSFDVLKSRAPCNFLVFGLGYDSLMWASFNPRGTT  109

Query  508  VFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMC  678
            +FLEED  W+  + +  P L +  V Y T++ QA +L+   K     A ++        C
Sbjct  110  LFLEEDPKWVQTVLKDSPELRAETVNYRTQLKQADELLSSYKSEAACAPSEAVLRGNERC  169

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL +LP  VYE  WDLIM+DAP GY  EAPGRMA I++A +MAR RR G G T VF+H
Sbjct  170  KLALSNLPEEVYEKEWDLIMIDAPRGYFPEAPGRMAVIFSAAVMAR-RRRGSGATHVFLH  228

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            DV+R VE  F++ FLC  Y+ K  GRL HF IPS  N  D  FC
Sbjct  229  DVDRKVEKAFAEEFLCRKYLVKAVGRLWHFEIPSATNGSDARFC  272



>ref|XP_008801843.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like, partial 
[Phoenix dactylifera]
Length=229

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 150/219 (68%), Gaps = 5/219 (2%)
 Frame = +1

Query  328  ASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRT  507
            + +A+A++HY+T+ + PQQ+  E+ ++  +L +++P NFLVFGLGHDSLMW   N GG T
Sbjct  1    SELAEALLHYATTNVVPQQSRAEMRISFDVLRRRAPCNFLVFGLGHDSLMWSAFNAGGTT  60

Query  508  VFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC---TAITDPRYSM  675
            VFLEED  W   +T+  P L +++V Y T++ +A DL++  +  P C    A        
Sbjct  61   VFLEEDPKWFQSVTKASPALRAHNVRYRTQLIEADDLIKSYRSEPSCLPPAAAPLKNNHR  120

Query  676  CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFV  855
            C+LAL  LP+ +++  WDLIM+DAP GY++EAPGRMAAI++A +MAR+RR G GET++F+
Sbjct  121  CRLALADLPAEIFDREWDLIMIDAPKGYYNEAPGRMAAIFSAAVMARSRR-GEGETDIFL  179

Query  856  HDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
            HDVNR VE  F+  FLC+ ++    GRL HF IP  R +
Sbjct  180  HDVNRKVEKMFAMEFLCKKHLVGGTGRLWHFRIPPVRGN  218



>ref|XP_011086800.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Sesamum 
indicum]
Length=288

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 148/220 (67%), Gaps = 5/220 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ+  EI+V+  +L    PSNFLVFGLGHDSLMW  +N GGRT+FLE
Sbjct  71   EAILHYATSRVVPQQSISEITVSYDVLRSLGPSNFLVFGLGHDSLMWAAINPGGRTLFLE  130

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITD--PRYSMCQLAL  690
            ED  W+  + +  P L    V Y T++SQA +L++  G  P+C+A          C+LAL
Sbjct  131  EDPKWVQTVLKDAPALRVDTVHYRTQLSQADELLQHYGTEPDCSAKNSFLRGNDKCRLAL  190

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
              L   VY+  WD+IMVDAP GY  EAPGRMAAIY+A +MARNR++  G T VFVHDV+R
Sbjct  191  NMLSDEVYDTEWDMIMVDAPRGYFAEAPGRMAAIYSAAVMARNRKK-SGVTHVFVHDVDR  249

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
             VE K+++AFLC+ ++ K  GRL HF IP   N +   FC
Sbjct  250  RVEKKYAEAFLCKKHLVKAVGRLWHFEIPPPAN-MSCDFC  288



>emb|CDP13345.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 142/209 (68%), Gaps = 6/209 (3%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQ+  EI V+  +L+ KSP NFLVFGLGHDSLMW +LN GG T+FLEE
Sbjct  69   AIVHYATSRVVPQQSLDEIRVSFDVLKAKSPCNFLVFGLGHDSLMWASLNPGGTTLFLEE  128

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLM-EIGKGPECTAITDPRY---SMCQLAL  690
            D  W+  + +  P L ++ V Y TK+S+A DL+ +    PEC+A   P     + C+LAL
Sbjct  129  DPKWVDTVLKDAPYLRAHTVKYRTKLSEADDLLKQYPSQPECSA-EKPFLRGNTKCKLAL  187

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
              LP  VY   WDLIM+DAP GY  EAPGRMAAIY+A +MARNR+ G G T VF+HDV+R
Sbjct  188  NMLPWEVYNKEWDLIMIDAPRGYFAEAPGRMAAIYSAAVMARNRK-GSGVTHVFLHDVDR  246

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
             VE  +++ FLC     K  GRL HF IP
Sbjct  247  KVEKVYAETFLCRKNRVKSVGRLWHFEIP  275



>ref|XP_002978695.1| hypothetical protein SELMODRAFT_57632, partial [Selaginella moellendorffii]
 gb|EFJ20142.1| hypothetical protein SELMODRAFT_57632, partial [Selaginella moellendorffii]
Length=198

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = +1

Query  319  KIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYG  498
            ++P  +  A++HY+++  TPQQT +EI +T+++L  + P NFLVFGLGHDSL+W  LNY 
Sbjct  1    RLPHDLMTALVHYASTDTTPQQTREEILMTAKVLASRGPCNFLVFGLGHDSLLWKMLNYA  60

Query  499  GRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP---ECTAITDPRY  669
            GRTVFLEE E WI QI+ K P LE++ V Y T +++A  L+E  +     +CTA+ +   
Sbjct  61   GRTVFLEESEDWIRQISEKHPELETHIVEYSTVLTEADQLLEHARSNRKGKCTAVQNLLL  120

Query  670  SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEV  849
            S C+LAL  L   +++V WD+IMVDAP GY   APGRMAAI++A +MAR+R+ G G T+V
Sbjct  121  SECKLALNGLADELFQVEWDVIMVDAPRGYFPGAPGRMAAIFSAAVMARSRKTGNG-TDV  179

Query  850  FVHDVNRVVEDKFSKAFLC  906
            FVHDV R VE  +S+ FLC
Sbjct  180  FVHDVERPVERSYSEEFLC  198



>ref|XP_002983636.1| hypothetical protein SELMODRAFT_47473, partial [Selaginella moellendorffii]
 gb|EFJ15132.1| hypothetical protein SELMODRAFT_47473, partial [Selaginella moellendorffii]
Length=233

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 148/231 (64%), Gaps = 8/231 (3%)
 Frame = +1

Query  316  KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNY  495
            + +P  V  A+  Y +S + PQQT  EI +T R+L  + P NFLVFGLG DS+MW TLN+
Sbjct  5    RGLPLEVGTALARYVSSKVIPQQTFDEIMMTVRVLAARGPCNFLVFGLGFDSVMWKTLNH  64

Query  496  GGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME---IGKGPECTAITDPR  666
            GGRTVFLEE E WI Q+T K P LE+Y V Y+TK+  AG LM+     +  +C  +   R
Sbjct  65   GGRTVFLEETEDWIKQVTGKNPDLEAYLVRYNTKLMDAGRLMDHARKNRNGKCRPVQAIR  124

Query  667  YSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
             S C++AL  LP  +YEV WD+IMVDAP GY  EAPGRMAAI++A +MAR+R+   G T+
Sbjct  125  NSTCKIALSYLPKKLYEVDWDVIMVDAPRGYFAEAPGRMAAIFSASVMARSRK--NGTTD  182

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQE--GRLRHFTI-PSYRNHLDMPFC  990
            ++VHDV R VE ++ + FLC   + ++    RL HF + P         FC
Sbjct  183  IYVHDVERPVERQYCEEFLCRANLVEEAPTKRLWHFRLAPQLSGSSSKSFC  233



>ref|XP_002990576.1| hypothetical protein SELMODRAFT_47472, partial [Selaginella moellendorffii]
 gb|EFJ08453.1| hypothetical protein SELMODRAFT_47472, partial [Selaginella moellendorffii]
Length=218

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 144/216 (67%), Gaps = 7/216 (3%)
 Frame = +1

Query  316  KKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNY  495
            + +P  V  A+  Y +S + PQQT  EI +T R+L  + P NFLVFGLG DS+MW TLN+
Sbjct  5    RGLPLEVGTALARYVSSKVIPQQTFDEIMMTVRVLAARGPCNFLVFGLGFDSVMWKTLNH  64

Query  496  GGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME---IGKGPECTAITDPR  666
            GGRTVFLEE E WI Q+T K P LE+Y V Y+TK+  AG LM+     +  +C  +   R
Sbjct  65   GGRTVFLEETEDWIKQVTGKNPDLEAYLVRYNTKLMDAGRLMDHARKNRNGKCRPVQAIR  124

Query  667  YSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
             S C++AL  LP  +YEV WD+IMVDAP GY  EAPGRMAAI++A +MAR+R+   G T+
Sbjct  125  NSTCKIALSYLPKKLYEVDWDVIMVDAPRGYFAEAPGRMAAIFSASVMARSRK--NGTTD  182

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQE--GRLRHF  948
            ++VHDV R VE ++ + FLC   + ++    RL HF
Sbjct  183  IYVHDVERPVERQYCEEFLCRANLVEEAPTKRLWHF  218



>ref|XP_011002126.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=285

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 143/214 (67%), Gaps = 6/214 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS I PQQ+  EISVT  +L+ +SP NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  65   QSILHYATSKIVPQQSLAEISVTFDVLKTRSPCNFLVFGLGFDSLMWTSLNPHGTTLFLE  124

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  I +K P L ++ V Y T++ +A  L++  +  P C+   A     Y  C+LA
Sbjct  125  EDPKWVQTIVKKAPTLNAHTVQYRTQLQEADSLLKTYRSEPLCSPSKACLRGNYK-CRLA  183

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR R+ G G T VF+HDVN
Sbjct  184  LSGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARGRK-GSGVTHVFLHDVN  242

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            R VE  F++ FLC  Y+ K  GRL HF IP   N
Sbjct  243  RRVEKMFAEEFLCRKYLVKAVGRLWHFEIPPAAN  276



>ref|XP_002984622.1| hypothetical protein SELMODRAFT_47575, partial [Selaginella moellendorffii]
 gb|EFJ14267.1| hypothetical protein SELMODRAFT_47575, partial [Selaginella moellendorffii]
Length=197

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = +1

Query  322  IPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            +P  +  A++HY+++  TPQQT +EI +T+++L  + P NFLVFGLGHDSL+W  LNY G
Sbjct  1    LPHDLMTALVHYASTDTTPQQTREEILMTAKVLASRGPCNFLVFGLGHDSLLWKMLNYAG  60

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGP---ECTAITDPRYS  672
            RT FLEE E WI QI+ K P LE++ V Y T +++A  L+E  +     +CTA+ +   S
Sbjct  61   RTAFLEESEDWIRQISEKHPELETHIVEYSTVLTEADQLLEHARSNRKGKCTAVQNLLLS  120

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL  L   +++V WD+IMVDAP GY   APGRMAAI++A +MAR+R+ G G T+VF
Sbjct  121  ECKLALNGLADELFQVEWDVIMVDAPRGYFPGAPGRMAAIFSAAVMARSRKTGNG-TDVF  179

Query  853  VHDVNRVVEDKFSKAFLC  906
            VHDV R VE  +S+ FLC
Sbjct  180  VHDVERPVERSYSEEFLC  197



>ref|XP_010499283.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Camelina 
sativa]
Length=289

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 140/213 (66%), Gaps = 12/213 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTVVPQQNMAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYSM------C  678
            ED  W  ++T+  P L ++HV Y T++ QA  L+    K P C     P  S       C
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLLRSYKKEPSCY----PAKSYLRGNEKC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDL+MVDAP GY  EAPGRMAAI++A +MARNR++  G T VF+H
Sbjct  182  KLALTGLPDEFYDTEWDLLMVDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            DVNR VE  F++ FLC  Y     GRL HF IP
Sbjct  241  DVNRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>ref|XP_010460560.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=289

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 140/213 (66%), Gaps = 12/213 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTVVPQQNMAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYSM------C  678
            ED  W  ++T+  P L ++HV Y T++ QA  L+    K P C     P  S       C
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLLRSYKKEPSCF----PAKSYLRGNEKC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDL+MVDAP GY  EAPGRMAAI++A +MARNR++  G T VF+H
Sbjct  182  KLALTGLPDEFYDTEWDLLMVDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            DVNR VE  F++ FLC  Y     GRL HF IP
Sbjct  241  DVNRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>ref|XP_011036083.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=285

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 143/214 (67%), Gaps = 6/214 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS I PQQ+  EI+VT  +L+ +SP NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  65   QSILHYATSKIVPQQSFAEITVTFNVLKTRSPCNFLVFGLGFDSLMWTSLNPHGTTLFLE  124

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  I +K P L ++ V Y T++ +A  L++  +  P C+   A     Y  C+LA
Sbjct  125  EDPKWVQTIVKKAPTLNAHTVQYLTQLKEADSLLKTYRSEPLCSPSKACLRGNYK-CRLA  183

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR R+ G G T VF+HDVN
Sbjct  184  LSGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARGRK-GSGVTHVFLHDVN  242

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            R VE  F++ FLC  Y+ K  GRL HF IP   N
Sbjct  243  RRVEKMFAEEFLCRKYLVKAVGRLWHFEIPPAAN  276



>ref|XP_010460559.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010478142.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Camelina 
sativa]
Length=289

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 140/213 (66%), Gaps = 12/213 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTVVPQQNMAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYSM------C  678
            ED  W  ++T+  P L ++HV Y T++ QA  L+    K P C     P  S       C
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLLRSYKKEPSCF----PAKSYLRGNEKC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDL+MVDAP GY  EAPGRMAAI++A +MARNR++  G T VF+H
Sbjct  182  KLALTGLPDEFYDTEWDLLMVDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            DVNR VE  F++ FLC  Y     GRL HF IP
Sbjct  241  DVNRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>ref|XP_006304065.1| hypothetical protein CARUB_v10009914mg [Capsella rubella]
 gb|EOA36963.1| hypothetical protein CARUB_v10009914mg [Capsella rubella]
Length=289

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 139/211 (66%), Gaps = 8/211 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS I PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSNIVPQQNLAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRY----SMCQL  684
            ED  W  ++T+  P L ++HV Y T++ QA  LM   K  P C       Y      C+L
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLMRSYKTEPSC--FPAKAYLRGNDKCKL  183

Query  685  ALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDV  864
            AL  LP   Y+  WDL+M+DAP GY  EAPGRMAAI++A +MARNR++  G T VF+HDV
Sbjct  184  ALTGLPDEFYDTEWDLLMLDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLHDV  242

Query  865  NRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            NR VE  F++ FLC  Y     GRL HF IP
Sbjct  243  NRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>ref|NP_564297.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51480.1|AC069471_11 unknown protein [Arabidopsis thaliana]
 gb|AAK91402.1| At1g27930/F13K9_4 [Arabidopsis thaliana]
 gb|AAM70529.1| At1g27930/F13K9_4 [Arabidopsis thaliana]
 gb|AEE30892.1| uncharacterized protein AT1G27930 [Arabidopsis thaliana]
Length=289

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 141/213 (66%), Gaps = 12/213 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSNVVPQQNLAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSM------C  678
            ED  W  ++T+  P L ++HV Y T++ QA  L+   K  P+C     P  S       C
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLLRSYKTEPKCF----PAKSYLRGNEKC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDL+MVDAP GY  EAPGRMAAI++A +MARNR++  G T VF+H
Sbjct  182  KLALTGLPDEFYDTEWDLLMVDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            DVNR VE  F++ FLC  Y     GRL HF IP
Sbjct  241  DVNRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>gb|AAM61740.1| unknown [Arabidopsis thaliana]
Length=289

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 140/213 (66%), Gaps = 12/213 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSNVVPQQNLAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSM------C  678
            ED  W  ++T+  P L ++HV Y T++ QA  L+   K  P C     P  S       C
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLLRSYKTEPNCF----PAKSYLRGNEKC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDL+MVDAP GY  EAPGRMAAI++A +MARNR++  G T VF+H
Sbjct  182  KLALTGLPDEFYDTEWDLLMVDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            DVNR VE  F++ FLC  Y     GRL HF IP
Sbjct  241  DVNRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>ref|XP_002297842.1| hypothetical protein POPTR_0001s13850g [Populus trichocarpa]
 gb|ABK93495.1| unknown [Populus trichocarpa]
 gb|EEE82647.1| hypothetical protein POPTR_0001s13850g [Populus trichocarpa]
Length=285

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 145/223 (65%), Gaps = 8/223 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS I PQQ+  EISVT  +L+ +SP NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  65   QSILHYATSKIVPQQSLAEISVTFDVLKTRSPCNFLVFGLGFDSLMWTSLNPHGTTLFLE  124

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  I +  P L ++ V Y T++ +A  L++  +  P C+   A     Y  C+LA
Sbjct  125  EDPKWVQTIVKNTPTLNAHTVQYLTQLKEADSLLKTYRSEPLCSPSKAYLRGNYK-CRLA  183

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR R+ G G T VF+HDVN
Sbjct  184  LTGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARERK-GSGVTHVFLHDVN  242

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFC  990
            R VE  F++ FLC  Y+ K  GRL HF IP   N    D  FC
Sbjct  243  RRVEKMFAEEFLCRKYLVKAVGRLWHFEIPPAANVSQSDGWFC  285



>ref|XP_010549289.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Tarenaya hassleriana]
Length=285

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 143/220 (65%), Gaps = 12/220 (5%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  +L++ +P NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   EAIVHYATSRVVPQQNMAEISISFSVLKRHAPCNFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSM------C  678
            ED  W  ++T+  PML ++HV Y T++ +A  L+   +  PEC     P  +       C
Sbjct  126  EDLEWFQKVTKDSPMLRAHHVRYRTQLQEADALLSAYRSQPECL----PSNAFLRGNDRC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDLIM+DAP GY  EAPGRMAAI++A +MAR+RR   G T VF+H
Sbjct  182  KLALTGLPEEFYDTEWDLIMIDAPKGYFPEAPGRMAAIFSAAVMARHRRR-SGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLD  978
            DV+R +E  F++ FLC  Y     GRL HF IP+  N  D
Sbjct  241  DVDRRIEKVFAEEFLCRKYRVGAAGRLWHFAIPAAANSTD  280



>ref|XP_008446029.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Cucumis melo]
Length=284

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 144/220 (65%), Gaps = 6/220 (3%)
 Frame = +1

Query  325  PASVA-KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            PA V  +++IHY+TS   PQQ+  EI ++  +L+ + P NFLVFGLGHDSLMW +LN  G
Sbjct  54   PAEVQFQSIIHYATSKTVPQQSIDEIHISYDVLKVRCPCNFLVFGLGHDSLMWASLNPLG  113

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC--TAITDPRYS  672
             T+FLEED  W+  + +  PML +YHV Y T++ +A  L+   K  P C  T        
Sbjct  114  TTIFLEEDPKWVQTVLKDAPMLRAYHVQYRTQLQEADRLLSTYKSEPYCSPTKAFLKGNE  173

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL +LP  +YE  WDLIM+DAP GY  EAPGRMAAI++A +MARNR+ G G T+VF
Sbjct  174  KCKLALHNLPEEIYEKEWDLIMIDAPRGYFAEAPGRMAAIFSAAVMARNRK-GSGVTDVF  232

Query  853  VHDVNRVVEDKFSKAFLCEG-YMKKQEGRLRHFTIPSYRN  969
            +HDV+R VE  F++ FLC+  Y     GRL HF IP   N
Sbjct  233  LHDVDRKVERTFAQEFLCKNKYYVNGVGRLWHFKIPPAAN  272



>ref|XP_007044007.1| Cell wall integrity and stress response component 1 [Theobroma 
cacao]
 gb|EOX99838.1| Cell wall integrity and stress response component 1 [Theobroma 
cacao]
Length=289

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 142/217 (65%), Gaps = 12/217 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A+IHY+TS I PQQ+  EIS+T  +L++ SP NFLVFGLG+DSLMW +LN  G T+FLE
Sbjct  68   QAIIHYATSRIIPQQSFAEISITFDVLKKLSPCNFLVFGLGYDSLMWTSLNPRGTTIFLE  127

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSM------C  678
            ED  W+  + +  P L ++ V Y T++ QA DL+   +  P C+    P  +       C
Sbjct  128  EDPKWVQTVLKDAPNLHAHAVKYRTQLQQADDLLSHYQSEPSCS----PSEAYLRGNEKC  183

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL   P   YE  WDLIM+DAP GY   APGRMAAI++A +MARNR+ G G T VF+H
Sbjct  184  KLALTGFPDEFYETQWDLIMIDAPRGYFAVAPGRMAAIFSAAVMARNRK-GSGVTHVFLH  242

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            DV+R VE  F++ FLC  ++ K  GRL HF IPS  N
Sbjct  243  DVDRRVEKVFAEEFLCRKFLVKSVGRLWHFEIPSAAN  279



>ref|XP_002893494.1| hypothetical protein ARALYDRAFT_890326 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69753.1| hypothetical protein ARALYDRAFT_890326 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 140/213 (66%), Gaps = 12/213 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  IL++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTVVPQQNLAEISISFNILKKLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSM------C  678
            ED  W  ++T+  P L ++HV Y T++ QA  L+   K  P C     P  S       C
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQQADSLLRSYKTEPNCF----PAKSYLRGNEKC  181

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP   Y+  WDL+M+DAP GY  EAPGRMAAI++A +MARNR++  G T VF+H
Sbjct  182  KLALTGLPDEFYDTEWDLLMLDAPKGYFPEAPGRMAAIFSAAVMARNRKK-PGVTHVFLH  240

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            D+NR VE  F++ FLC  Y     GRL HF IP
Sbjct  241  DINRRVEKTFAEEFLCRKYRVNAAGRLWHFAIP  273



>gb|KFK44666.1| hypothetical protein AALP_AA1G288200 [Arabis alpina]
Length=289

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 139/210 (66%), Gaps = 6/210 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  +L++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTVVPQQNFAEISISFAVLKELAPANFLVFGLGRDSLMWASLNPRGKTMFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY----SMCQLA  687
            ED  W  ++ +  P L+++HV Y T++ +A  L+  G   E        Y      C+LA
Sbjct  126  EDLEWFQKVMKDSPFLKAHHVRYRTQLKEADTLLR-GYKTEPNCFPGKSYLQGNDRCKLA  184

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LPS  Y+  WDLIMVDAP GY  EAPGRMAAIY+A +MARNR++  G T VF+HDVN
Sbjct  185  LTGLPSEFYDTEWDLIMVDAPKGYFPEAPGRMAAIYSAAVMARNRKK-PGVTHVFLHDVN  243

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            R VE  F++ FLC  Y     GRL HF IP
Sbjct  244  RRVEKTFAEEFLCRKYRVHAAGRLWHFAIP  273



>ref|XP_009113726.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Brassica rapa]
 emb|CDY27638.1| BnaA09g27690D [Brassica napus]
 emb|CDX84898.1| BnaC05g21570D [Brassica napus]
Length=289

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 141/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ   EIS++  +L++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTVVPQQNMAEISISFNVLKELAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC-TAITDPRYS-MCQLAL  690
            ED  W  ++T+  P L ++HV Y T++ +A  L+   K  P C  A +  R +  C+LAL
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQEADRLLRSYKTEPSCFPAKSYLRGNERCKLAL  185

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
              LP   Y+  WDLIMVDAP GY  EAPGRMAAIY+A +MARNR++  G T VF+HDVNR
Sbjct  186  TGLPDEFYDTEWDLIMVDAPKGYFAEAPGRMAAIYSAAVMARNRKK-PGVTHVFLHDVNR  244

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
             VE  F+  FLC  Y     GRL HF IP
Sbjct  245  RVEKTFANEFLCRKYRVHAAGRLWHFAIP  273



>ref|XP_010099365.1| hypothetical protein L484_000866 [Morus notabilis]
 gb|EXB77973.1| hypothetical protein L484_000866 [Morus notabilis]
Length=296

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 146/216 (68%), Gaps = 10/216 (5%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQK-----SPSNFLVFGLGHDSLMWHTLNYGGR  504
            +A++HY+TS + PQQ+  EI+V+  +++ +     +P NFLVFGLGHDSLMW + N  G 
Sbjct  65   QAILHYATSKVVPQQSLGEITVSFNVIKSREGGFGAPFNFLVFGLGHDSLMWDSFNPRGT  124

Query  505  TVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC--TAITDPRYSM  675
            T+FLEED  W+  + +K P L ++HV Y T++ QA +L+   +  P C  T     R ++
Sbjct  125  TLFLEEDPRWVQTVLQKAPNLRAHHVRYRTQLRQANELLSSYRAEPRCAPTEAAALRGNV  184

Query  676  -CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL +LP  VYE  WDLIM+DAP GY  EAPGRMAAI++A +MARNRR G G T VF
Sbjct  185  RCRLALDNLPEEVYEREWDLIMIDAPRGYFPEAPGRMAAIFSAAVMARNRR-GLGPTHVF  243

Query  853  VHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPS  960
            +HDV+R VE  F++ FLC  Y+    GRL HF IPS
Sbjct  244  LHDVDRRVEKTFAEEFLCRKYLVNAVGRLWHFEIPS  279



>ref|XP_009102942.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Brassica 
rapa]
Length=289

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 140/211 (66%), Gaps = 8/211 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS ITPQQ   EIS++  +L++ +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIVHYATSTITPQQNIHEISISFNVLKELAPANFLVFGLGLDSLMWASLNPRGKTIFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRY----SMCQL  684
            ED  W  ++T+  P L ++HV Y T++ +A  L+   K  P C       Y      C+L
Sbjct  126  EDLEWFQKVTKDAPFLHAHHVRYRTQLQEADKLLRSYKTEPSC--FPAKAYLRGNERCKL  183

Query  685  ALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDV  864
            AL  LP   Y+  WDLIM+DAP GY  EAPGRMAAI++A +MARNR++  G T VF+HDV
Sbjct  184  ALTGLPDEFYDTEWDLIMLDAPKGYFAEAPGRMAAIFSAAVMARNRKK-PGVTHVFLHDV  242

Query  865  NRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            NR VE  F++ FLC  Y     GRL HF IP
Sbjct  243  NRRVEKTFAEEFLCAKYRVHAAGRLWHFAIP  273



>gb|KGN51667.1| hypothetical protein Csa_5G589350 [Cucumis sativus]
Length=284

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 146/224 (65%), Gaps = 14/224 (6%)
 Frame = +1

Query  325  PASVA-KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            PA V  +++IHY+TS   PQQ+  EI ++  +L+ + P NFLVFGLGHDSLMW +LN  G
Sbjct  54   PAEVQFQSIIHYATSKTVPQQSIDEIHISYDVLKVRCPCNFLVFGLGHDSLMWASLNPLG  113

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYSM-  675
             T+FLEED  W+  + +  PML +YHV Y T++ +A  L+   K  P C+    P  +  
Sbjct  114  TTIFLEEDPKWVQTVLKDAPMLRAYHVQYRTQLQEADRLLSTYKSEPYCS----PSKAFL  169

Query  676  -----CQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
                 C+LAL +LP  +YE  WDLIM+DAP GY  EAPGRMAAI++A +MARNR+ G G 
Sbjct  170  KGNEKCKLALHNLPEEIYEKEWDLIMIDAPRGYFAEAPGRMAAIFSATVMARNRK-GSGV  228

Query  841  TEVFVHDVNRVVEDKFSKAFLCEG-YMKKQEGRLRHFTIPSYRN  969
            T+VF+HDV+R VE  F++ FLC+  Y     GRL HF IP   N
Sbjct  229  TDVFLHDVDRKVERTFAQEFLCKNKYYVNGVGRLWHFKIPPAAN  272



>ref|XP_006415716.1| hypothetical protein EUTSA_v10010026mg [Eutrema salsugineum]
 gb|ESQ34069.1| hypothetical protein EUTSA_v10010026mg [Eutrema salsugineum]
Length=289

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A+ HY+TS + PQQ   EIS++  +L+Q +P+NFLVFGLG DSLMW +LN  G+T+FLE
Sbjct  66   QAIFHYATSTVVPQQNINEISISFNVLKQLAPANFLVFGLGRDSLMWASLNPRGKTLFLE  125

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC-TAITDPR-YSMCQLAL  690
            ED  W  ++T+  P L ++HV Y T++ +A  L+   K  P C  A +  R    C+LAL
Sbjct  126  EDLEWFQKVTKDSPFLRAHHVRYRTQLQEADKLLRSYKSEPSCFPAKSYLRGNDRCKLAL  185

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
              LP   Y+  WDLIMVDAP GY  EAPGRMAAI++A ++ARNR++  G T VF+HDVNR
Sbjct  186  TGLPDEFYDTEWDLIMVDAPKGYFAEAPGRMAAIFSAAVIARNRKK-PGVTHVFLHDVNR  244

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
             VE  +++ FLC  Y     GRL HF IP
Sbjct  245  RVEKTYAEEFLCRKYRVHAAGRLWHFAIP  273



>ref|XP_011071227.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Sesamum indicum]
Length=280

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 142/213 (67%), Gaps = 4/213 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A+ HY+TS + PQQ+  E++V+  +L+  +P NFLVFGLGHDSLMW  LN  GRT+FLE
Sbjct  63   EAIRHYATSQVVPQQSLGEVTVSFDVLKATAPCNFLVFGLGHDSLMWAALNPRGRTLFLE  122

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITD--PRYSMCQLAL  690
            ED  W   + +  P LE+  V Y T++S+A +L++  +  P C+         S C+LAL
Sbjct  123  EDPKWYQAVLKDAPALEAETVAYRTQLSEADELLQHYRTEPLCSPTNSFLRGNSKCRLAL  182

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
              L   VY+  WDLIM+DAP GY  EAPGRMAAIY+A +MARNR+ G G T VF+HDV+R
Sbjct  183  NMLSDKVYDTEWDLIMIDAPRGYFPEAPGRMAAIYSAAVMARNRK-GSGVTHVFLHDVDR  241

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
             VE  +++ FLC+  + K EGRL HF IP   N
Sbjct  242  KVEKTYAEMFLCKRNLVKAEGRLWHFEIPPVTN  274



>ref|XP_008361849.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Malus 
domestica]
Length=284

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 141/213 (66%), Gaps = 4/213 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS  TPQQ+ KEI V+ ++L+ ++P NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  63   QAILHYATSRQTPQQSRKEIGVSFQVLKSRAPCNFLVFGLGFDSLMWASLNPRGTTLFLE  122

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMCQLAL  690
            ED  W+  + +  P L +  V Y T++ +A  L+   +     + ++      + C+LAL
Sbjct  123  EDPKWVQSVLKDAPQLRAQTVRYRTQLKEADKLLSSYRSKRSCSPSEAVLRGNTECRLAL  182

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
             +LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR RR G G T VF+HDV+R
Sbjct  183  HNLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMAR-RRRGSGXTHVFLHDVDR  241

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
             VE  F+  FLC  ++ K  GRL HF IPS  N
Sbjct  242  KVEKAFANEFLCRKFLVKAVGRLWHFEIPSAAN  274



>ref|XP_008389872.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Malus 
domestica]
 ref|XP_008389873.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Malus 
domestica]
Length=282

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 146/219 (67%), Gaps = 5/219 (2%)
 Frame = +1

Query  325  PASVA-KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGG  501
            PA++  +A++HY+TS+ TPQQ+  EI+V+  +L+ +SP NFLVFGLG DSLMW +LN  G
Sbjct  55   PAAIQLQAILHYATSSQTPQQSRDEITVSFEVLKSRSPCNFLVFGLGFDSLMWASLNPRG  114

Query  502  RTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---S  672
             T+FLEED  W+  + +  P L +  V Y T++ +A +L+   +     + ++      +
Sbjct  115  TTLFLEEDPKWVQTVLKDAPQLRAETVRYRTQLKEADELLSSYRSQRSCSPSEAVLRGNT  174

Query  673  MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVF  852
             C+LAL +LP  VY+  WDLIMVDAP GY  EAPGRM AI++A +MAR RR G G T VF
Sbjct  175  ECRLALDNLPDDVYDKEWDLIMVDAPRGYFPEAPGRMGAIFSAAVMARRRR-GSGVTHVF  233

Query  853  VHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            +HDV+R VE  F++ FLC  ++ K  GRL HF IPS  N
Sbjct  234  LHDVDRKVEKAFAEEFLCRKFLVKAVGRLWHFEIPSVAN  272



>ref|XP_002304685.1| hypothetical protein POPTR_0003s17080g [Populus trichocarpa]
 gb|EEE79664.1| hypothetical protein POPTR_0003s17080g [Populus trichocarpa]
Length=285

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 142/211 (67%), Gaps = 6/211 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS I PQQ+  EISVT  +L+ +SP NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  65   QSILHYATSKIVPQQSLAEISVTFDVLKTRSPCNFLVFGLGFDSLMWTSLNPHGTTLFLE  124

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  I +K P L ++ V Y T++ +A  L++  +  P C+   A     Y  C+LA
Sbjct  125  EDPKWVQTIVKKAPTLNAHTVQYRTQLQEANSLLKTYRSEPLCSPSKAYLRGNYK-CKLA  183

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR R+ G G T VF+HDV+
Sbjct  184  LTGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAVVMARGRK-GSGVTHVFLHDVD  242

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPS  960
            R VE  F++ FLC   + K  GRL HF IP+
Sbjct  243  RKVEKMFAEEFLCRKNLVKAVGRLWHFEIPA  273



>ref|XP_006484106.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Citrus 
sinensis]
 ref|XP_006484107.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Citrus 
sinensis]
Length=283

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 146/226 (65%), Gaps = 14/226 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS I PQQ+  EI+V+  +L++ SP NFLVFGLG+DSLMW++ N  G T+FLE
Sbjct  63   RAILHYATSKIVPQQSLAEITVSFNVLKEISPCNFLVFGLGYDSLMWNSFNPRGTTLFLE  122

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLM-EIGKGPECTAITDPRYSM------C  678
            ED  W+  + +  P L ++ V Y T++S+A  L+    K P C+    P  +       C
Sbjct  123  EDPKWVQSVLKDAPTLNAHAVQYRTQLSEADALLSSYKKEPLCS----PSKAFLRGNVGC  178

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP  VY+  WD+IM+DAP GY   APGRMAAI++A +MAR RR G G T V++H
Sbjct  179  KLALTGLPDEVYDQQWDIIMIDAPRGYFPRAPGRMAAIFSAAVMAR-RRRGSGVTHVYLH  237

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFC  990
            DV+R VE  F++ FLC  Y+K   GR+ HF IP   N  + D  FC
Sbjct  238  DVDRRVEKAFAEEFLCRKYLKDAVGRIWHFEIPPAANSTNADDRFC  283



>ref|XP_010905171.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Elaeis 
guineensis]
Length=281

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 138/211 (65%), Gaps = 5/211 (2%)
 Frame = +1

Query  352  HYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEEDEA  531
            HY+TS   PQQ+  EI V+  +L ++ P NFLVFGLG DSLMW   N GG TVFLEED  
Sbjct  59   HYATSTAVPQQSRAEIRVSFDVLRRRRPCNFLVFGLGRDSLMWSAFNAGGTTVFLEEDPQ  118

Query  532  WIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC---TAITDPRYSMCQLALKSL  699
            W   +T+  P L ++ V Y T++ +A DL++  +  P C    A        C LAL  L
Sbjct  119  WFQSVTKSSPNLRAHSVRYRTRLIEADDLIKSYRSEPSCLPPAAAPLKNNHRCPLALADL  178

Query  700  PSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRVVE  879
            PS +++  WDLIM+DAP GY++EAPGRMAAI++A +MAR+RR G GET++F+HDVNR VE
Sbjct  179  PSEIFDREWDLIMIDAPKGYYNEAPGRMAAIFSAAVMARSRR-GEGETDIFLHDVNRKVE  237

Query  880  DKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
              ++  FLC+ ++    GRL HF IP  R +
Sbjct  238  KMYAMEFLCKKHLVGGSGRLWHFRIPPVRGN  268



>ref|XP_007223739.1| hypothetical protein PRUPE_ppa010492mg [Prunus persica]
 gb|EMJ24938.1| hypothetical protein PRUPE_ppa010492mg [Prunus persica]
Length=247

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 141/214 (66%), Gaps = 6/214 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS  TPQQ+  EI V+  +L+ ++P NFLVFGLG DS MW + N  G T+FLE
Sbjct  26   QAILHYATSRQTPQQSRGEIGVSFEVLKARAPCNFLVFGLGFDSQMWASFNPRGTTLFLE  85

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  + +  P L +  V Y T + +A DL+   +  P C+   A+     + C+LA
Sbjct  86   EDPKWVQTVLKDAPHLRAQTVRYRTHLKEADDLLSSYRSEPSCSPSEAVLRGN-AQCRLA  144

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L +LP  VYE  WDLIM+DAP GY  EAPGRMAAI++A +MAR RR+G G T VF+HDVN
Sbjct  145  LNNLPDEVYEREWDLIMIDAPRGYFPEAPGRMAAIFSAAVMAR-RRQGSGVTHVFLHDVN  203

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            R VE  +++ FLC  Y+ K  GRL HF IPS  N
Sbjct  204  RRVEKVYAEEFLCRKYLVKAVGRLWHFEIPSAAN  237



>ref|XP_007158681.1| hypothetical protein PHAVU_002G173400g [Phaseolus vulgaris]
 gb|ESW30675.1| hypothetical protein PHAVU_002G173400g [Phaseolus vulgaris]
Length=281

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 145/223 (65%), Gaps = 7/223 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQ-KSPSNFLVFGLGHDSLMWHTLNYGGRTVFL  516
            KA++HY+TS + PQQ+  EI+VT  +L+    P+NFLVFGLGHDSLMW  LN GG T+FL
Sbjct  60   KAILHYATSQVVPQQSLSEITVTFDVLQALNRPANFLVFGLGHDSLMWAGLNPGGTTLFL  119

Query  517  EEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYS--MCQLA  687
            EED  W+  + +  P L ++ V Y T++ +A  L+   +  P C+  T        C+LA
Sbjct  120  EEDPKWVQTVLKDAPGLRAHTVHYRTQLREADHLLSSYRSEPACSPATATLRGNERCKLA  179

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L++LP  VY   WDLIM+DAP GY  EAPGRMAAI++A +MAR+R+ G G T VF+HDV+
Sbjct  180  LQNLPDEVYSREWDLIMIDAPKGYFPEAPGRMAAIFSAAVMARDRK-GSGVTHVFLHDVD  238

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHL--DMPFC  990
            R VE  +++ FLC   + K  GRL HF IP   NH   D  FC
Sbjct  239  RKVEKVYAEEFLCRKQLVKGVGRLWHFEIPPKANHSRDDARFC  281



>ref|XP_009775021.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=286

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 142/219 (65%), Gaps = 5/219 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQT  EI V+  +L+ K+P NFLVFGLGHDSLMW + N GG T+FLEE
Sbjct  70   AILHYATSRVIPQQTIDEIRVSFDVLKNKTPCNFLVFGLGHDSLMWASFNSGGNTLFLEE  129

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYS--MCQLALK  693
            D  W+  I +  P L +  V Y T +S+A +L+E   K P+C+A          C+LAL 
Sbjct  130  DPKWVETILKDAPFLHADTVKYRTMLSEADELVEHYHKEPDCSAKKSFLRGNHRCKLALD  189

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             L   VY   WD+IM+DAP GY  EAPGRMAAIY+A +MARNR+ G G T V++HDV+R 
Sbjct  190  MLSDEVYNKEWDVIMIDAPRGYFAEAPGRMAAIYSAAVMARNRK-GNGVTHVYLHDVDRK  248

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            VE  +++ FLC   + K  GR+ HF IP   N  +  FC
Sbjct  249  VEKIYAELFLCRKNLVKGVGRIWHFEIPPASNAAN-NFC  286



>ref|XP_011020742.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Populus 
euphratica]
Length=284

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 142/211 (67%), Gaps = 6/211 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            ++++HY+TS I PQQ+  EISVT  +L+ +SP NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  65   QSILHYATSKIVPQQSLAEISVTFDVLKTRSPCNFLVFGLGFDSLMWTSLNPHGTTLFLE  124

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  I +K P L ++ V Y T++ +A  L++  +  P C+   A     Y  C+LA
Sbjct  125  EDPKWVQTIVKKAPTLNAHTVQYRTQLQEADSLLKTYRSEPLCSPSKAYLRGNYR-CKLA  183

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR R+ G G T VF+HDV+
Sbjct  184  LTGLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAVVMARGRK-GSGVTHVFLHDVD  242

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPS  960
            R VE  F++ FLC   + K  GRL HF IP+
Sbjct  243  RRVEKMFAEEFLCRKNLVKAVGRLWHFEIPA  273



>ref|XP_002514909.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47463.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 139/214 (65%), Gaps = 6/214 (3%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A+IHY+TS + PQQ+  EISVT  +L+  +P NFLVFGLGHDSLMW +LN  G T+FLE
Sbjct  65   QAIIHYATSRVVPQQSLGEISVTFNVLKSLAPCNFLVFGLGHDSLMWSSLNPHGTTLFLE  124

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  WI  +    P L ++ V Y T++ +A  L+   +  P C    A     Y  C+LA
Sbjct  125  EDPKWIQTVLANAPTLHAHAVQYRTQLQEANQLLSSYRSEPYCLPSKAYLRGNYR-CKLA  183

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L  LP  VY+  WDLIM+DAP GY +EAPGRMAAI++A +MAR R+   G T VF+HDV+
Sbjct  184  LTGLPDEVYDKEWDLIMIDAPRGYFNEAPGRMAAIFSAAVMARARK-ASGATHVFLHDVD  242

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            R VE  +++ FLC  Y+ K  GRL HF +P   N
Sbjct  243  RKVEKIYAEEFLCRKYLVKAVGRLWHFELPPAAN  276



>ref|XP_006438023.1| hypothetical protein CICLE_v10032331mg [Citrus clementina]
 gb|ESR51263.1| hypothetical protein CICLE_v10032331mg [Citrus clementina]
Length=283

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 145/226 (64%), Gaps = 14/226 (6%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS I PQQ+  EI+V+  +L++ SP NFLVFGLG+DSLMW++ N  G T+FLE
Sbjct  63   RAILHYATSKIVPQQSLAEITVSFNVLKEISPCNFLVFGLGYDSLMWNSFNPRGTTLFLE  122

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLM-EIGKGPECTAITDPRYSM------C  678
            ED  W+  + +  P L ++ V Y T +S+A  L+    K P C+    P  +       C
Sbjct  123  EDPKWVQSVLKDAPTLNAHAVQYRTHLSEADALLSSYKKEPLCS----PSKAFLRGNVGC  178

Query  679  QLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVH  858
            +LAL  LP  VY+  WD+IM+DAP GY   APGRMAAI++A +MAR RR G G T V++H
Sbjct  179  KLALTGLPDEVYDQQWDIIMIDAPRGYFPRAPGRMAAIFSAAVMAR-RRRGSGVTHVYLH  237

Query  859  DVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN--HLDMPFC  990
            DV+R VE  F++ FLC  Y+K   GR+ HF IP   N  + D  FC
Sbjct  238  DVDRRVEKAFAEEFLCRKYLKDAVGRIWHFEIPPAANSTNADDRFC  283



>ref|XP_009394065.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 142/217 (65%), Gaps = 8/217 (4%)
 Frame = +1

Query  328  ASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRT  507
            + +AKA+++Y+T+ + PQQ+  EI ++  +L ++SP NFLVFGLG DS MW  LN GG T
Sbjct  49   SELAKALLYYATTTVVPQQSRDEIRLSFDVLRRRSPCNFLVFGLGRDSQMWAALNPGGTT  108

Query  508  VFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPEC-----TAITDPRY  669
            +FLEED  W   + +  P L ++HV Y T++SQA  L+    K  EC       +   ++
Sbjct  109  IFLEEDPQWYAAVKKDSPELRAHHVKYRTQLSQAEQLLRGYRKNAECRPGRVDGVEGLQH  168

Query  670  S-MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
            +  C LAL  LP  VYE  WD++M+DAP GY  EAPGRMAAIY+A +MAR RR G GET+
Sbjct  169  NGGCPLALVGLPGEVYEREWDVLMIDAPKGYFPEAPGRMAAIYSAAVMARGRR-GEGETD  227

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            VF+HDV+R VE  F+  FLCE Y     GRL HF IP
Sbjct  228  VFLHDVDRRVEKSFAMEFLCEKYRVGGTGRLWHFKIP  264



>ref|XP_009372279.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Pyrus x bretschneideri]
Length=284

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 140/213 (66%), Gaps = 4/213 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS  TPQQ+ KEI V+ ++L+ ++P NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  63   QAILHYATSRQTPQQSRKEIGVSFQVLKSRAPCNFLVFGLGFDSLMWASLNPRGTTLFLE  122

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMCQLAL  690
            ED  W+  + +  P L +  V Y T + +A  L+   +     + ++      + C+LAL
Sbjct  123  EDPKWVQSVLKDAPQLRAQTVRYRTHLKEADQLLSSYRSKRSCSPSEAVLRGNTECRLAL  182

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
             +LP  VY+  WDLIM+DAP GY  EAPGRM AI++A +MAR RR+G G T VF+HDV+R
Sbjct  183  DNLPDEVYDKEWDLIMIDAPRGYFPEAPGRMGAIFSAAVMAR-RRQGSGVTHVFLHDVDR  241

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
             VE  F+  FLC  ++ K  GRL HF IPS  N
Sbjct  242  KVEKAFANEFLCRKFLVKAVGRLWHFEIPSAAN  274



>gb|KDP26809.1| hypothetical protein JCGZ_17967 [Jatropha curcas]
Length=282

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 143/213 (67%), Gaps = 6/213 (3%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++ Y+TS + PQQ+  EISV+  +L+ ++P NFLVFGLGHDSLMW +LN  G T+FLEE
Sbjct  64   AILQYATSRVVPQQSLGEISVSFDVLKDRAPCNFLVFGLGHDSLMWTSLNPRGTTIFLEE  123

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLAL  690
            D  W+  + +  P L++Y V Y T++ +A  L+   +  P C+   A     Y+ C+LAL
Sbjct  124  DPKWVRTVLKDAPTLQAYTVQYRTQLQEADKLLAGYQSEPYCSPSKAYLRGNYN-CKLAL  182

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
              LP +VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR R+ G G T VF+HDV+R
Sbjct  183  TGLPDVVYDKEWDLIMIDAPKGYFAEAPGRMAAIFSAAVMARARK-GSGVTHVFLHDVDR  241

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
             VE  +++ FLC  ++ K  GRL HF IP   N
Sbjct  242  KVEKVYAEEFLCRKHLVKAVGRLWHFEIPPAAN  274



>ref|XP_008389874.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Malus 
domestica]
Length=282

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 141/213 (66%), Gaps = 4/213 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS  TPQQ+  EI+V+  +L+ +SP NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  61   QAILHYATSRQTPQQSRDEIAVSFEVLKSRSPCNFLVFGLGFDSLMWASLNPRGTTLFLE  120

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMCQLAL  690
            ED  W+  + +  P L +  V Y T++ +A +L+   +     + ++      + C+LAL
Sbjct  121  EDPKWVQTVLKDVPQLRAETVHYRTQLKEADELLSSYRSLRSCSPSEAVLRGNTECRLAL  180

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
             +LP  VY+  WDLIMVDAP GY  EAPGRM AI++A +MAR RR G G T VF+HDV+R
Sbjct  181  DNLPDEVYDKEWDLIMVDAPRGYFPEAPGRMGAIFSAAVMARRRR-GSGVTHVFLHDVDR  239

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
             VE  F++ FLC  ++ K  GRL HF IPS  N
Sbjct  240  KVEKAFAEEFLCRKFLVKAVGRLWHFEIPSAAN  272



>ref|XP_002274054.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Vitis vinifera]
Length=282

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 141/220 (64%), Gaps = 5/220 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQ+  EI V+  +L+  +P NFLV+GLGHDS+MW + N  G T+FLEE
Sbjct  64   AILHYATSRVVPQQSLAEIRVSFDVLQSLAPCNFLVYGLGHDSVMWSSFNPKGTTIFLEE  123

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMCQLALK  693
            D  W+  + ++ P L ++ V Y T +S+A  L+   K        D R    + C+LAL 
Sbjct  124  DPKWVQTVLKQAPNLLAHTVRYRTHLSEADQLLRSYKSEPACLPPDVRLRDNTACRLALT  183

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             LP  VY+  WDLIM+DAP GY  EAPGRM AI+TA +MAR R+   G T VF+HDVNR 
Sbjct  184  GLPEEVYDTEWDLIMIDAPRGYFPEAPGRMGAIFTAAVMARARKR-QGVTHVFLHDVNRR  242

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH-LDMPFC  990
            +E  +++ FLC+  + K EGRL HF IPS  N  ++  FC
Sbjct  243  IEKVYAEEFLCKKNLVKAEGRLWHFAIPSAANDTMNSAFC  282



>emb|CDY37946.1| BnaC02g20650D [Brassica napus]
Length=265

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 143/225 (64%), Gaps = 28/225 (12%)
 Frame = +1

Query  295  LSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSL  474
            L S +C K IP S+A A+I+Y+ S  TPQQT  EISVT +          L  G+     
Sbjct  61   LESASCGK-IPPSLADALIYYAASNTTPQQTLSEISVTKK----------LDVGVPEPP-  108

Query  475  MWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHV--TYDTKVSQAGDLMEIG-KGPEC  645
                      T+FL+EDE+WI +I  KFP LESYHV   YDTKV  A  L+       EC
Sbjct  109  ---------GTIFLDEDESWIRKIAEKFPSLESYHVHVQYDTKVRDAAALLSAAIDSEEC  159

Query  646  TAITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRR  825
                    S C+LALK LP +VYE  WD+I+VDAP  +H+EAPGRM+AIYTAGM+AR+R+
Sbjct  160  RPGV---ASKCELALKGLPEVVYETEWDIIVVDAPRRFHEEAPGRMSAIYTAGMIARSRK  216

Query  826  EGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPS  960
            +G     VFVHDV+R VED+FS AFLC  YM +Q+GRLRHFT+PS
Sbjct  217  KGETRA-VFVHDVDRTVEDEFSMAFLCRDYMTEQQGRLRHFTVPS  260



>gb|ABF72010.1| hypothetical protein MA4_111B14.64 [Musa acuminata]
Length=278

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 142/217 (65%), Gaps = 8/217 (4%)
 Frame = +1

Query  328  ASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRT  507
            + +AKA+++Y+T+ + PQQ+  EI ++  +L ++SP NFLVFGLG DS MW  LN GG T
Sbjct  49   SELAKALLYYATTTVVPQQSRDEIRLSFDVLRRRSPCNFLVFGLGRDSQMWAALNPGGTT  108

Query  508  VFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPEC-----TAITDPRY  669
            +FLEED  W   + +  P L ++HV Y T++SQA  L+    K  EC       +   ++
Sbjct  109  IFLEEDPQWYAAVKKDSPELRAHHVKYRTQLSQAEQLLRGYRKNAECRPGRVDGVEGLQH  168

Query  670  S-MCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETE  846
            +  C LAL  LP  VYE  WD++M+DAP GY  EAPGRMAAIY+A +MAR RR G GET+
Sbjct  169  NGGCPLALVGLPGEVYEREWDVLMIDAPKGYFPEAPGRMAAIYSAAVMARGRR-GEGETD  227

Query  847  VFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            VF+HDV+R VE  ++  FLCE Y     GRL HF IP
Sbjct  228  VFLHDVDRRVEKSYAMEFLCEKYRVGGTGRLWHFKIP  264



>ref|XP_006352193.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=282

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 140/219 (64%), Gaps = 5/219 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQ   EI ++  +L+ ++P NFLVFGLGHDS MW + N  G T+FLEE
Sbjct  66   AILHYATSRVIPQQNINEIRISFDVLKNRTPCNFLVFGLGHDSQMWASFNSRGNTLFLEE  125

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITD--PRYSMCQLALK  693
            D  W+  I +  P + +  V Y T +S+A +L+E   K P+C+A          C+LAL 
Sbjct  126  DPKWVETILKDAPFVHAETVKYRTMLSEADELVEHFHKEPDCSAKKSFIRGNHGCKLALD  185

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             L   VY   WDLIM+DAP GY  EAPGRMAAIY+A +MARNR+ G G T VF+HDV R 
Sbjct  186  MLSDEVYNKEWDLIMIDAPRGYFAEAPGRMAAIYSAAVMARNRK-GKGVTHVFLHDVERK  244

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            VE  +++ FLC  Y+ K  GRL HF IP+  N +   FC
Sbjct  245  VEKIYAELFLCRKYLVKGVGRLWHFEIPAASN-VGNSFC  282



>ref|XP_009620086.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 141/216 (65%), Gaps = 12/216 (6%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQT  EI V+  +L+ K+P +FLVFGLGHDSLMW + N  G T+FLEE
Sbjct  70   AILHYATSRVIPQQTIDEIRVSFDVLKNKTPCHFLVFGLGHDSLMWASFNSRGNTLFLEE  129

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYSM------CQ  681
            D  W+  I +  P L +  V Y T +S+A +L+E   K P+C+A    R S       C+
Sbjct  130  DPKWVETILKDAPFLHADTVKYRTMLSEAEELVEHYHKEPDCSA----RKSFLRGNHRCK  185

Query  682  LALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHD  861
            LAL  L   VY   WD+IM+DAP GY  EAPGRMAAIY+A +MARNR+ G G T V++HD
Sbjct  186  LALDMLSDEVYNKEWDVIMIDAPRGYFAEAPGRMAAIYSAAVMARNRK-GNGVTHVYLHD  244

Query  862  VNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            V+R VE  +++ FLC  Y+ K  GR+ HF IP   N
Sbjct  245  VDRKVEKIYAELFLCRKYLVKGVGRIWHFEIPPASN  280



>ref|XP_008353046.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Malus 
domestica]
Length=379

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 141/213 (66%), Gaps = 4/213 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS  TPQQ+ KEI V+ ++L+ ++P NFLVFGLG DSLMW +LN  G T+FLE
Sbjct  158  QAILHYATSRQTPQQSRKEIGVSFQVLKSRAPCNFLVFGLGFDSLMWASLNPRGTTLFLE  217

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPECTAITDPRY---SMCQLAL  690
            ED  W+  + +  P L +  V Y T++ +A  L+   +     + ++      + C+LAL
Sbjct  218  EDPKWVQSVLKDAPQLRAQTVRYRTQLKEADKLLSSYRSKRSCSPSEAVLRGNTECRLAL  277

Query  691  KSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNR  870
             +LP  VY+  WDLIM+DAP GY  EAPGRMAAI++A +MAR RR G G T VF+HDV+R
Sbjct  278  HNLPDEVYDKEWDLIMIDAPRGYFPEAPGRMAAIFSAAVMAR-RRRGSGXTHVFLHDVDR  336

Query  871  VVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
             VE  F+  FLC  ++ K  GRL HF IPS  N
Sbjct  337  KVEKAFANEFLCRKFLVKAVGRLWHFEIPSAAN  369



>gb|AFK44106.1| unknown [Medicago truncatula]
Length=297

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 149/239 (62%), Gaps = 5/239 (2%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQ-KSPSNFL  447
            F       L + N N        +A++HY+TS + PQQ+  EI+VT  +++    P NFL
Sbjct  48   FCSLTRTNLQTTNQNPYPTPIQLRALLHYATSHVVPQQSFSEITVTLDVIKSLNRPFNFL  107

Query  448  VFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEI  627
            VFGLGHDSLMW   N  G+T+FLEED  W+  + +  P L+++ V Y T++ +A +L++ 
Sbjct  108  VFGLGHDSLMWAGFNPQGKTLFLEEDPKWVQTVLKDAPELQAFTVHYRTQLQEADELLKS  167

Query  628  GKG-PECT--AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYT  798
             K  P C+    T      C+LAL +LP  +YE  WDLIM+DAP GY  EAPGRMAAI++
Sbjct  168  YKSEPSCSPAKATLKGNEQCKLALHNLPDEIYETEWDLIMIDAPRGYFAEAPGRMAAIFS  227

Query  799  AGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHL  975
              +MARNR+ G G T VF+HDV+R VE  +++ FLC   + K  GRL HF IP+  N+L
Sbjct  228  MAVMARNRK-GSGVTHVFLHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFEIPALGNNL  285



>ref|XP_008222167.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1 [Prunus mume]
Length=284

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 144/224 (64%), Gaps = 9/224 (4%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS  TPQQ+  EI V+  +L+ ++P NFLVFGLG DS MW + N  G T+FLE
Sbjct  63   QAILHYATSRQTPQQSRGEIGVSFEVLKARAPCNFLVFGLGFDSQMWASFNPRGTTLFLE  122

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECT---AITDPRYSMCQLA  687
            ED  W+  + +  P L +  V Y T + +A  L+   +  P C+   A+     + C+LA
Sbjct  123  EDPKWVQTVLKDAPHLRAQTVRYRTHLKEADGLLSSYRSEPSCSPSEAVLRGN-AQCRLA  181

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L +LP  VYE  WDLIM+DAP GY  EAPGRMAAI++A +MAR RR+G G T VF+HDVN
Sbjct  182  LNNLPDEVYEREWDLIMIDAPRGYFPEAPGRMAAIFSAAVMAR-RRQGSGVTHVFLHDVN  240

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMP---FC  990
            R VE  +++ FLC  Y+ K  GRL HF IPS  N  ++    FC
Sbjct  241  RRVEKVYAEEFLCRKYLVKAVGRLWHFEIPSAANATEIDGERFC  284



>ref|XP_003577659.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Brachypodium 
distachyon]
Length=319

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 165/259 (64%), Gaps = 22/259 (8%)
 Frame = +1

Query  277  PRKEARLSSKNCNKKIPASVAKAVIHYSTSAI-----TPQQTTKEISVTSRILEQ-KSPS  438
            P  + +L  ++C  K+PA VA+A+++Y+T++      + QQT  E++VT+R L + ++P 
Sbjct  63   PATQLQLRGQHC-AKLPAPVAEALVYYATTSANNATSSQQQTAAELAVTARALARCRAPC  121

Query  439  NFLVFGL--GHDSLMWHTLNYG--GRTVFLEEDEAWIHQITRKFPML--ESYHVTYDTKV  600
            N LVFG   G +S +W  LN+G  GRTVFLEED + I +I+ + P L  E + V Y T +
Sbjct  122  NVLVFGGLGGTESALWAALNHGQGGRTVFLEEDASLISEISSRHPGLGIEPHQVAYQTTL  181

Query  601  SQAGDLMEIGKGPECTAITDP-------RYSMCQLALKSLPSLVYEVPWDLIMVDAPTGY  759
            + A +L+ +   P+C    +          S C+LA++ LP+  YE  WD+I+VDAP G+
Sbjct  182  ADADELLALRDSPDCKKTQNRPLSPDEFESSKCKLAMRGLPAAFYETEWDVIIVDAPPGW  241

Query  760  HDEAPGRM-AAIYTAGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGR  936
              EAPGR+  AIY AGM AR RR   G+TEV VHDV+R VED  S AFLC GY++++ GR
Sbjct  242  VPEAPGRIGGAIYMAGMAARARR-WPGKTEVIVHDVDRAVEDGLSMAFLCRGYLEEEVGR  300

Query  937  LRHFTIPSYRNHLDMPFCP  993
            +R F +PS+R    MPFCP
Sbjct  301  VRRFAVPSHREKDVMPFCP  319



>ref|XP_009787024.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=276

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 138/212 (65%), Gaps = 4/212 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            AV+HY+TS + PQQT  EI V+  +L+  +P NFLVFGLGHDS MW ++N  G T+FLEE
Sbjct  60   AVLHYATSRVIPQQTLDEIKVSFDVLKSLTPCNFLVFGLGHDSFMWASINPRGTTLFLEE  119

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYS--MCQLALK  693
            D  W+  + +  P L +  V Y TK+S+A  L+E   K P+C+A          C+LAL 
Sbjct  120  DPKWVKAVIKDVPFLRTNTVNYRTKLSEAEKLIEHYHKEPDCSAKKSFLRGNHKCKLALD  179

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             L + VY+  WD+IM+D P GY D+APGRM+AIY+A +MARNR+ G G T +F+HDV+R 
Sbjct  180  MLSNEVYDKEWDMIMIDGPKGYFDKAPGRMSAIYSAAVMARNRK-GSGITHIFLHDVDRN  238

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRN  969
            VE  +++ FLC   +    GRL HF IP   N
Sbjct  239  VEKVYAELFLCRKNLVTSVGRLWHFEIPPASN  270



>gb|KEH20602.1| polysaccharide biosynthesis protein [Medicago truncatula]
Length=297

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 149/239 (62%), Gaps = 5/239 (2%)
 Frame = +1

Query  271  FLPRKEARLSSKNCNKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQ-KSPSNFL  447
            F       L + N N        +A++HY+TS + PQQ+  EI+VT  +++    P NFL
Sbjct  48   FCSLTRTNLQTTNQNPYPTPIQLRALLHYATSHVVPQQSFSEITVTLDVIKSLNRPFNFL  107

Query  448  VFGLGHDSLMWHTLNYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEI  627
            VFGLGHDSLMW   N  G+T+FLEED  W+  + +  P L+++ V Y T++ +A +L++ 
Sbjct  108  VFGLGHDSLMWAGFNPQGKTLFLEEDPKWVQTVLKDAPELQAFTVHYRTQLQEADELLKS  167

Query  628  GKG-PECT--AITDPRYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYT  798
             K  P C+    T      C+LAL +LP  +YE  WDLIM+DAP GY  EAPGRMAAI++
Sbjct  168  YKSEPSCSPAKATLKGNEQCKLALHNLPDEIYETEWDLIMIDAPRGYFAEAPGRMAAIFS  227

Query  799  AGMMARNRREGGGETEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHL  975
              +MARNR+ G G T VF+HDV+R VE  +++ FLC   + K  GRL HF IP+  N+L
Sbjct  228  MTVMARNRK-GSGVTHVFLHDVDRKVEKVYAEEFLCRKNLVKGVGRLWHFEIPALGNNL  285



>ref|XP_006352194.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=234

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 138/219 (63%), Gaps = 5/219 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQ   EI ++  +L+ ++P NFLVFGLGHDS MW + N  G T+FLEE
Sbjct  18   AILHYATSRVIPQQNINEIRISFDVLKNRTPCNFLVFGLGHDSQMWASFNSRGNTLFLEE  77

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITD--PRYSMCQLALK  693
            D  W+  I +  P L +  V Y T +S+A +L+E   K  +C+A          C+LAL 
Sbjct  78   DPKWVETILKDAPFLHAETVKYRTMLSEADELVEHFHKEADCSAKKSFIRGNHGCKLALD  137

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             L   VY   WDLIM+DAP GY  EAPGRMAAIY+A +MARNR+ G G T VF+HDV R 
Sbjct  138  MLSDEVYNKEWDLIMIDAPRGYFAEAPGRMAAIYSAAVMARNRK-GKGVTHVFLHDVERK  196

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            VE  +++ FLC  Y+ K  GRL HF IP   N +   FC
Sbjct  197  VEKIYAELFLCRKYLVKGVGRLWHFEIPPSSN-VGNSFC  234



>ref|XP_003552780.2| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Glycine 
max]
Length=320

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 140/221 (63%), Gaps = 5/221 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQ-KSPSNFLVFGLGHDSLMWHTLNYGGRTVFL  516
            +A++HY+TS + PQQ+  EI ++  +++    P NFLVFGLGHDSLMW + N GG TVFL
Sbjct  101  RAILHYATSRVVPQQSVSEIKISLDVIKSLGRPINFLVFGLGHDSLMWASFNPGGTTVFL  160

Query  517  EEDEAWIHQITRKFPMLESYHVTYDTKVSQA-GDLMEIGKGPEC--TAITDPRYSMCQLA  687
            EED  W+H I +  P L ++ V Y T++  A G L      P C  T         C+LA
Sbjct  161  EEDPKWVHSILKDAPGLRAHTVRYRTQLRDAKGLLTSYRSEPSCSPTKAYLRGNEACKLA  220

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L++LP  VYE  WDLIM+DAP GY  EAPGRMAA+++A +MARNR+ G G T VF+HDV+
Sbjct  221  LENLPDEVYETEWDLIMIDAPKGYFAEAPGRMAAVFSAAVMARNRK-GSGVTHVFLHDVD  279

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            R VE  +++ FLC   + K  GRL HF IP   +     FC
Sbjct  280  RKVEKVYAEEFLCRKNLVKGVGRLWHFQIPPSNDTHASRFC  320



>ref|XP_009628062.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=225

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 140/219 (64%), Gaps = 5/219 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            AV+HY+TS + PQQT  EI V+  IL+  +P NFLVFGLGHDS MW ++N  G T+FLEE
Sbjct  9    AVLHYATSRVIPQQTLDEIKVSFDILKSLTPCNFLVFGLGHDSFMWASINPRGTTLFLEE  68

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLME-IGKGPECTAITDPRYS--MCQLALK  693
            D  W+  + +  P L +  V Y TK+S A  L+E   K  +C+A          C+LAL 
Sbjct  69   DPKWVKAVIKVVPFLRTNTVNYRTKLSDAEKLIEHYHKESDCSAKKSFLRGNHKCKLALD  128

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             L + VY+  WD+IM+D P GY D+APGRM+AIY+A +MARNR+ G G T +F+HDV+R 
Sbjct  129  MLSNEVYDKEWDMIMIDGPKGYFDKAPGRMSAIYSAAVMARNRK-GSGVTHIFLHDVDRN  187

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            VE  +++ FLC   + K  GRL HF IP   N +   FC
Sbjct  188  VEKVYAELFLCRKNLVKGVGRLWHFEIPPASN-VTNDFC  225



>ref|XP_004293059.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=280

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = +1

Query  313  NKKIPASVA-KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTL  489
            + KIP ++   A++HY+TS  TPQ +  EIS+   +L+ ++P NFL+FGLGHDSLMW + 
Sbjct  49   DDKIPTAIQLHAILHYATSRTTPQLSKDEISLAFDVLKSRAPCNFLIFGLGHDSLMWVSF  108

Query  490  NYGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKGPE-CTAITDPR  666
            N  G T+FLEED  W+ +  +    L + HVTY T++ QA DL+   K    C       
Sbjct  109  NPRGTTLFLEEDPKWLKKALQDASQLRAVHVTYHTQLKQADDLLTSYKSETICRTSVAVL  168

Query  667  Y--SMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGE  840
            +  + C+LAL +LP  VYE  WDLIM+D P G+  EAPGRM+ I+   +MAR RR G G 
Sbjct  169  HGNTHCRLALSNLPDEVYEREWDLIMIDGPQGWFAEAPGRMSVIFAVAVMARKRR-GPGS  227

Query  841  TEVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPS---YRNHLDMPFC  990
            T VF+HDV+R VE  F++ FLC  Y+    GRL HF IPS     +  D  FC
Sbjct  228  THVFLHDVDRKVEKAFAEEFLCRKYLVNAVGRLWHFVIPSAVDVNDTDDASFC  280



>ref|XP_003537534.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like isoform 
X1 [Glycine max]
 ref|XP_006591452.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like isoform 
X2 [Glycine max]
Length=284

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 142/221 (64%), Gaps = 5/221 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQ-KSPSNFLVFGLGHDSLMWHTLNYGGRTVFL  516
            +A++HY+TS + PQQ+  EI ++  +++    P NFLVFGLGHDSLMW + N GG TVFL
Sbjct  65   RAIMHYATSRVVPQQSVSEIKISLDVIKSLGRPINFLVFGLGHDSLMWASFNPGGTTVFL  124

Query  517  EEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PEC--TAITDPRYSMCQLA  687
            EED  W+H I +  P L ++ V Y T++  A  L+   +  P C  T         C+LA
Sbjct  125  EEDPKWVHSILKDAPGLRAHTVRYRTQLRDAKGLITSYRSEPSCSPTKAYLRGNEACKLA  184

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L++LP  VYE  WD+IM+DAP GY  EAPGRMAA+++A +MARNR+E  G T VF+HDV+
Sbjct  185  LENLPDEVYETEWDMIMIDAPKGYFAEAPGRMAAVFSAAVMARNRKE-SGVTHVFLHDVD  243

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
            R VE  +++ FLC+  + K  GRL HF IP   +     FC
Sbjct  244  RKVEKVYAEEFLCKKNLVKGVGRLWHFEIPPSNDTRASRFC  284



>ref|XP_006855212.1| hypothetical protein AMTR_s00051p00191940 [Amborella trichopoda]
 gb|ERN16679.1| hypothetical protein AMTR_s00051p00191940 [Amborella trichopoda]
Length=311

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 146/233 (63%), Gaps = 7/233 (3%)
 Frame = +1

Query  313  NKKIPASVAKAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLN  492
             +KIP  +  A++HYSTS +T   T +E+   + +L ++ P N LVFGLGH+SL+W  LN
Sbjct  68   GQKIPQDIVHALLHYSTSNLTGGMTVREMRAIADVLVRRCPCNLLVFGLGHESLVWRALN  127

Query  493  YGGRTVFLEEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGK---GPECTAITDP  663
            +GGRTVFL+E E WI  I ++ P +E+Y V Y TKV+Q  DLM   K   G +C  + + 
Sbjct  128  HGGRTVFLDESEYWIAHIEKRHPGIEAYDVQYTTKVAQKEDLMRAAKEQVGGDCRPVQNL  187

Query  664  RYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGG-E  840
             +S C LA+  LP+ +Y+VPWD+++VD P GY   APGRM+AI+TA ++AR+ ++G    
Sbjct  188  LFSECPLAINDLPNELYQVPWDVVLVDGPRGYSPLAPGRMSAIFTAAVLARSTKKGSHMP  247

Query  841  TEVFVHDVNRVVEDKFSKAFLC-EGYMKKQEGR--LRHFTIPSYRNHLDMPFC  990
            T VFVHD NR VE  +S  FLC E  +    G   L HFTI    +     FC
Sbjct  248  THVFVHDFNRDVERAYSNHFLCPENMVVLPAGAEMLAHFTIHGTGDAAVSGFC  300



>ref|XP_010028995.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW55827.1| hypothetical protein EUGRSUZ_I01644 [Eucalyptus grandis]
Length=303

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 138/229 (60%), Gaps = 22/229 (10%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLE  519
            +A++HY+TS + PQQ+  EIS+   +L + +P NFLVFGLGHDSLMW  LN  G TVFLE
Sbjct  85   QAILHYATSRVVPQQSLAEISLCFNVLREAAPCNFLVFGLGHDSLMWAALNPRGTTVFLE  144

Query  520  EDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLM------------EIGKGPECTAITDP  663
            E E+WI  +  K P L ++HV Y T++++A +L+              G G E       
Sbjct  145  EGESWIRSVITKAPSLHAFHVHYPTRLAEANELLATYRDERDCMPGHAGMGGE-------  197

Query  664  RYSMCQLALKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGET  843
              S C+LAL  LP  V E  WD+IM+DAP GY  EAPGRM AI+TA +MAR  R G G T
Sbjct  198  --SRCRLALPGLPEEVREKQWDVIMIDAPRGYFAEAPGRMGAIFTAAVMARG-RTGEGVT  254

Query  844  EVFVHDVNRVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNHLDMPFC  990
             VF+HDVNR VE  ++K FLC     +  GRL HF IP   N     FC
Sbjct  255  HVFLHDVNRRVERAYAKEFLCMKNKVEGVGRLWHFEIPPSSNVNATRFC  303



>ref|XP_003531197.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 3-like [Glycine 
max]
Length=286

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 142/215 (66%), Gaps = 5/215 (2%)
 Frame = +1

Query  340  KAVIHYSTSAITPQQTTKEISVTSRILEQ-KSPSNFLVFGLGHDSLMWHTLNYGGRTVFL  516
            KA++HY+TS I PQQ+  EI++T  +L+    P+NFLVFGLG DSLMW +LN  G T+FL
Sbjct  65   KAILHYATSQIVPQQSLSEITITFDVLQSLHRPANFLVFGLGRDSLMWASLNPHGTTLFL  124

Query  517  EEDEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITDPRYS--MCQLA  687
            EED  W   +T++ P L ++ V Y T++ +A  LM   +  P C   T        C+LA
Sbjct  125  EEDPKWFGIVTKEAPYLRAHTVRYRTQLREADSLMSSYRSEPACFPATATLRGNERCKLA  184

Query  688  LKSLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVN  867
            L +LP  VYE  WDLIM+DAP GY  EAPGRMAAI++A +MAR+R+ G G T VF+HDV+
Sbjct  185  LHNLPDEVYEKEWDLIMIDAPKGYFAEAPGRMAAIFSAAVMARDRK-GSGVTHVFLHDVD  243

Query  868  RVVEDKFSKAFLCEGYMKKQEGRLRHFTIPSYRNH  972
            R VE  +++ FLC  ++ K  GRL HF IP   N+
Sbjct  244  RKVEKVYAEEFLCRKHLVKGVGRLWHFEIPPMGNN  278



>ref|XP_010249031.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Nelumbo 
nucifera]
Length=291

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 132/208 (63%), Gaps = 4/208 (2%)
 Frame = +1

Query  343  AVIHYSTSAITPQQTTKEISVTSRILEQKSPSNFLVFGLGHDSLMWHTLNYGGRTVFLEE  522
            A++HY+TS + PQQ+  EI V+  +L+  SP NFLVFGLGHDSLMW   N  G T+FLEE
Sbjct  68   AILHYATSRVVPQQSLAEIRVSFDVLKTASPCNFLVFGLGHDSLMWSAFNPTGTTLFLEE  127

Query  523  DEAWIHQITRKFPMLESYHVTYDTKVSQAGDLMEIGKG-PECTAITD--PRYSMCQLALK  693
            D  W+H + +  P L+++ V Y T++SQA +L+   +  P C            C+LAL 
Sbjct  128  DPKWVHTVLKDAPYLQAHTVQYRTQLSQADELLRTYRSEPSCLPANAFLRGNDRCKLALT  187

Query  694  SLPSLVYEVPWDLIMVDAPTGYHDEAPGRMAAIYTAGMMARNRREGGGETEVFVHDVNRV  873
             LP  VY   WDLIM+DAP GY  EAPGRMAAI++  +MAR R    G T VF+HD++R 
Sbjct  188  GLPDEVYNKEWDLIMIDAPRGYFAEAPGRMAAIFSVAVMARARVR-PGVTHVFLHDIDRK  246

Query  874  VEDKFSKAFLCEGYMKKQEGRLRHFTIP  957
            VE  F++ FLC  Y+    GRL HF IP
Sbjct  247  VEKTFAEEFLCRKYLVNSVGRLWHFEIP  274



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2821057249490