BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78336_g1_i1 len=1524 path=[1:0-1523]

Length=1524
                                                                      Score     E

emb|CDP09479.1|  unnamed protein product                                295   6e-90   
ref|XP_007052179.1|  Basic helix-loop-helix DNA-binding superfami...    287   4e-87   
ref|XP_007052180.1|  Basic helix-loop-helix DNA-binding superfami...    288   5e-87   
ref|XP_009586993.1|  PREDICTED: transcription factor UNE10 isofor...    282   1e-85   
ref|XP_002301261.2|  hypothetical protein POPTR_0002s14430g             281   3e-85   Populus trichocarpa [western balsam poplar]
ref|XP_009586991.1|  PREDICTED: transcription factor UNE10 isofor...    282   4e-85   
ref|XP_009792483.1|  PREDICTED: transcription factor UNE10 isofor...    280   6e-85   
ref|XP_009792481.1|  PREDICTED: transcription factor UNE10 isofor...    280   2e-84   
ref|XP_006386561.1|  hypothetical protein POPTR_0002s14430g             281   3e-84   
ref|XP_011017451.1|  PREDICTED: transcription factor UNE10-like         278   2e-83   
ref|XP_006347913.1|  PREDICTED: transcription factor UNE10-like         273   2e-81   
gb|KDP28805.1|  hypothetical protein JCGZ_14576                         270   2e-80   
ref|XP_006591039.1|  PREDICTED: transcription factor UNE10-like         269   5e-80   
ref|XP_007140812.1|  hypothetical protein PHAVU_008G144300g             264   5e-78   
ref|XP_002320711.2|  hypothetical protein POPTR_0014s06190g             263   1e-77   Populus trichocarpa [western balsam poplar]
ref|XP_004229781.1|  PREDICTED: transcription factor UNE10              261   3e-77   
ref|XP_011033896.1|  PREDICTED: transcription factor UNE10              261   5e-77   
ref|XP_003516808.1|  PREDICTED: transcription factor UNE10-like         259   2e-76   
ref|XP_002511647.1|  DNA binding protein, putative                      254   2e-74   Ricinus communis
ref|XP_008375803.1|  PREDICTED: transcription factor UNE10 isofor...    249   1e-72   
ref|XP_002275629.2|  PREDICTED: transcription factor UNE10              248   3e-72   Vitis vinifera
ref|XP_010053944.1|  PREDICTED: transcription factor UNE10              248   1e-71   
gb|KHG29328.1|  Transcription factor UNE10 -like protein                244   5e-71   
ref|XP_010258917.1|  PREDICTED: transcription factor UNE10 isofor...    232   6e-66   
ref|XP_007052181.1|  Basic helix-loop-helix DNA-binding superfami...    231   8e-66   
ref|XP_010258915.1|  PREDICTED: transcription factor UNE10 isofor...    232   9e-66   
ref|XP_008375804.1|  PREDICTED: transcription factor UNE10 isofor...    229   2e-65   
ref|XP_010264312.1|  PREDICTED: transcription factor UNE10-like         229   3e-65   
ref|XP_007217992.1|  hypothetical protein PRUPE_ppa005629mg             228   1e-64   
ref|XP_009344081.1|  PREDICTED: transcription factor UNE10              226   4e-64   
ref|XP_009586992.1|  PREDICTED: transcription factor UNE10 isofor...    226   6e-64   
ref|XP_010258916.1|  PREDICTED: transcription factor UNE10 isofor...    227   8e-64   
ref|XP_004514235.1|  PREDICTED: transcription factor UNE10-like         226   1e-63   
ref|XP_009792482.1|  PREDICTED: transcription factor UNE10 isofor...    224   3e-63   
ref|XP_008232566.1|  PREDICTED: transcription factor UNE10              222   2e-62   
gb|EYU31942.1|  hypothetical protein MIMGU_mgv1a026423mg                222   5e-62   
gb|KDO85692.1|  hypothetical protein CISIN_1g012387mg                   220   5e-62   
gb|KDO85687.1|  hypothetical protein CISIN_1g012387mg                   219   2e-61   
ref|XP_006445332.1|  hypothetical protein CICLE_v10020053mg             219   3e-61   
ref|XP_009762879.1|  PREDICTED: transcription factor UNE10-like         214   6e-59   
ref|XP_004289799.1|  PREDICTED: transcription factor UNE10-like         211   2e-58   
ref|XP_011093295.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    211   3e-58   
ref|XP_010426522.1|  PREDICTED: transcription factor UNE10-like         209   5e-58   
ref|XP_009609287.1|  PREDICTED: transcription factor UNE10-like         205   1e-55   
ref|XP_010089247.1|  Transcription factor UNE10                         202   1e-54   
gb|KGN46559.1|  hypothetical protein Csa_6G108570                       199   9e-54   
ref|XP_010419529.1|  PREDICTED: transcription factor UNE10-like         195   6e-53   
ref|XP_010456327.1|  PREDICTED: transcription factor UNE10              195   7e-53   
ref|XP_004140610.1|  PREDICTED: transcription factor UNE10-like         194   5e-52   
ref|XP_004164979.1|  PREDICTED: transcription factor UNE10-like         194   6e-52   
ref|XP_008459727.1|  PREDICTED: transcription factor UNE10              192   3e-51   
ref|XP_006386559.1|  hypothetical protein POPTR_0002s14430g             177   4e-47   
emb|CBI16590.3|  unnamed protein product                                172   9e-47   
ref|XP_006838180.1|  hypothetical protein AMTR_s00106p00127480          179   2e-46   
gb|KEH22301.1|  transcription factor                                    176   3e-46   
gb|KDO85688.1|  hypothetical protein CISIN_1g012387mg                   174   6e-46   
ref|XP_011094525.1|  PREDICTED: transcription factor UNE10-like         176   1e-45   
gb|AAM10933.1|AF488561_1  putative bHLH transcription factor            170   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191916.3|  transcription factor UNE10                            170   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875048.1|  hypothetical protein ARALYDRAFT_912247             169   2e-43   
ref|XP_009792484.1|  PREDICTED: transcription factor UNE10 isofor...    169   3e-43   
ref|XP_006375304.1|  hypothetical protein POPTR_0014s06190g             168   4e-43   
gb|KFK30585.1|  hypothetical protein AALP_AA6G000800                    167   1e-42   
ref|XP_006396203.1|  hypothetical protein EUTSA_v10028687mg             166   2e-42   
ref|XP_006396204.1|  hypothetical protein EUTSA_v10028687mg             166   6e-42   
ref|XP_007134724.1|  hypothetical protein PHAVU_010G070600g             162   4e-41   
gb|KFK30584.1|  hypothetical protein AALP_AA6G000800                    159   6e-40   
ref|XP_010692153.1|  PREDICTED: transcription factor UNE10 isofor...    160   1e-39   
ref|XP_007134725.1|  hypothetical protein PHAVU_010G070600g             157   2e-39   
ref|XP_007134726.1|  hypothetical protein PHAVU_010G070600g             158   2e-39   
ref|XP_006288320.1|  hypothetical protein CARUB_v10001567mg             152   3e-38   
ref|XP_010327313.1|  PREDICTED: transcription factor UNE10-like         154   4e-38   
ref|XP_009411572.1|  PREDICTED: transcription factor UNE10              150   1e-36   
ref|XP_009111529.1|  PREDICTED: transcription factor UNE10-like         149   2e-36   
ref|XP_009133970.1|  PREDICTED: transcription factor UNE10              146   3e-35   
gb|KHN11866.1|  Transcription factor UNE10                              145   6e-35   
ref|XP_003522046.1|  PREDICTED: transcription factor UNE10-like         144   1e-34   
gb|KHM99413.1|  Transcription factor UNE10                              142   4e-34   
ref|XP_010523094.1|  PREDICTED: transcription factor UNE10 isofor...    140   2e-33   
gb|EYU42377.1|  hypothetical protein MIMGU_mgv1a022487mg                134   6e-33   
ref|XP_010934137.1|  PREDICTED: transcription factor UNE10-like         139   8e-33   
emb|CDX74328.1|  BnaA03g27190D                                          138   1e-32   
emb|CDY65390.1|  BnaAnng20430D                                          132   4e-32   
ref|XP_010692154.1|  PREDICTED: transcription factor UNE10 isofor...    137   5e-32   
ref|XP_010692152.1|  PREDICTED: transcription factor UNE10 isofor...    137   8e-32   
emb|CDX83214.1|  BnaA03g22920D                                          133   3e-31   
emb|CDX91917.1|  BnaC03g32190D                                          132   5e-31   
gb|KDO85691.1|  hypothetical protein CISIN_1g012387mg                   131   2e-30   
ref|XP_004137596.1|  PREDICTED: transcription factor UNE10-like         132   2e-30   
emb|CDY21498.1|  BnaC03g26990D                                          131   3e-30   
ref|XP_008447613.1|  PREDICTED: transcription factor PIF7-like is...    130   6e-30   
ref|XP_008447543.1|  PREDICTED: transcription factor PIF7-like is...    130   1e-29   
ref|XP_010106642.1|  Transcription factor UNE10                         128   7e-29   
ref|XP_004983681.1|  PREDICTED: transcription factor UNE10-like i...    127   1e-28   
ref|XP_004983682.1|  PREDICTED: transcription factor UNE10-like i...    127   2e-28   
ref|XP_010663295.1|  PREDICTED: transcription factor PIF7 isoform X4    126   2e-28   
gb|EEC67419.1|  hypothetical protein OsI_34609                          126   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010663296.1|  PREDICTED: transcription factor UNE10 isofor...    125   3e-28   
emb|CBI15153.3|  unnamed protein product                                125   3e-28   
ref|XP_010663294.1|  PREDICTED: transcription factor PIF7 isoform X2    125   5e-28   
ref|XP_002284441.1|  PREDICTED: transcription factor PIF7 isoform X3    125   5e-28   Vitis vinifera
ref|XP_010663293.1|  PREDICTED: transcription factor PIF7 isoform X1    125   5e-28   
ref|XP_008658345.1|  PREDICTED: transcription factor UNE10 isofor...    125   9e-28   
ref|XP_008658350.1|  PREDICTED: transcription factor UNE10 isofor...    124   1e-27   
ref|XP_010234992.1|  PREDICTED: transcription factor UNE10 isofor...    122   5e-27   
ref|XP_003574318.1|  PREDICTED: transcription factor UNE10 isofor...    122   5e-27   
ref|XP_010678431.1|  PREDICTED: transcription factor PIF7               122   1e-26   
dbj|BAJ92626.1|  predicted protein                                      121   2e-26   
dbj|BAJ99017.1|  predicted protein                                      121   2e-26   
ref|XP_006837031.1|  hypothetical protein AMTR_s00110p00030150          120   3e-26   
ref|XP_006581991.1|  PREDICTED: transcription factor UNE10-like i...    119   4e-26   
ref|XP_008658344.1|  PREDICTED: transcription factor UNE10 isofor...    120   4e-26   
ref|XP_007037472.1|  DNA binding protein, putative isoform 3            118   4e-26   
ref|XP_008658346.1|  PREDICTED: transcription factor UNE10 isofor...    120   5e-26   
ref|XP_006581990.1|  PREDICTED: transcription factor UNE10-like i...    119   5e-26   
gb|KHN06901.1|  Transcription factor PIF7                               119   6e-26   
gb|KHN43754.1|  Transcription factor PIF7                               116   7e-26   
ref|XP_007037470.1|  DNA binding protein, putative isoform 1            119   8e-26   
ref|XP_007037473.1|  DNA binding protein, putative isoform 4            118   8e-26   
ref|XP_009630767.1|  PREDICTED: transcription factor UNE10-like i...    117   2e-25   
gb|KDO54570.1|  hypothetical protein CISIN_1g026943mg                   114   2e-25   
gb|KDP31307.1|  hypothetical protein JCGZ_11683                         117   3e-25   
ref|XP_002514702.1|  DNA binding protein, putative                      117   3e-25   Ricinus communis
ref|XP_009630765.1|  PREDICTED: transcription factor UNE10-like i...    117   4e-25   
ref|XP_008802832.1|  PREDICTED: transcription factor UNE10-like         114   7e-25   
ref|XP_010037189.1|  PREDICTED: transcription factor PIF7               115   8e-25   
emb|CDP17490.1|  unnamed protein product                                116   9e-25   
ref|XP_009630766.1|  PREDICTED: transcription factor UNE10-like i...    115   1e-24   
ref|XP_006440685.1|  hypothetical protein CICLE_v10020323mg             114   4e-24   
ref|XP_006477612.1|  PREDICTED: transcription factor PIF7-like          111   2e-23   
ref|XP_009339115.1|  PREDICTED: transcription factor PIF7-like is...    111   3e-23   
ref|XP_008239975.1|  PREDICTED: transcription factor PIF7               111   3e-23   
ref|XP_004242180.1|  PREDICTED: transcription factor UNE10-like         111   3e-23   
ref|XP_011087345.1|  PREDICTED: transcription factor UNE10-like         107   7e-23   
ref|XP_009801833.1|  PREDICTED: transcription factor PIF7               110   7e-23   
ref|XP_007210132.1|  hypothetical protein PRUPE_ppa022963mg             109   1e-22   
ref|XP_008374594.1|  PREDICTED: transcription factor PIF7-like          108   2e-22   
ref|XP_003517013.2|  PREDICTED: transcription factor UNE10-like         104   2e-22   
ref|XP_008367556.1|  PREDICTED: transcription factor UNE10-like         106   6e-22   
ref|XP_009595347.1|  PREDICTED: transcription factor PIF7-like          107   7e-22   
gb|KHG21647.1|  Transcription factor UNE10 -like protein                107   8e-22   
ref|XP_008393195.1|  PREDICTED: transcription factor PIF7-like          106   9e-22   
ref|XP_006408930.1|  hypothetical protein EUTSA_v10001974mg             107   1e-21   
ref|XP_009339116.1|  PREDICTED: transcription factor PIF7-like is...    106   1e-21   
ref|XP_007204562.1|  hypothetical protein PRUPE_ppa014897mg             104   1e-21   
ref|XP_009338700.1|  PREDICTED: transcription factor PIF7-like is...    106   1e-21   
ref|XP_009338693.1|  PREDICTED: transcription factor PIF7-like is...    106   1e-21   
ref|XP_008241481.1|  PREDICTED: transcription factor SPATULA isof...    105   2e-21   
gb|ADG56590.1|  ALCATRAZ/SPATULA-like protein                           105   3e-21   
gb|KHN49105.1|  Transcription factor UNE10                              104   4e-21   
ref|XP_001766358.1|  predicted protein                                97.8    4e-21   
ref|XP_009109363.1|  PREDICTED: transcription factor SPATULA-like       103   5e-21   
ref|XP_008241480.1|  PREDICTED: transcription factor SPATULA isof...    104   7e-21   
ref|XP_010688822.1|  PREDICTED: transcription factor ALC-like           102   7e-21   
ref|XP_002981138.1|  hypothetical protein SELMODRAFT_114141           97.4    8e-21   
ref|XP_008241478.1|  PREDICTED: transcription factor SPATULA isof...    104   8e-21   
ref|XP_002982619.1|  hypothetical protein SELMODRAFT_116654           97.4    8e-21   
ref|XP_002984591.1|  hypothetical protein SELMODRAFT_29179            96.3    1e-20   
ref|XP_006589101.1|  PREDICTED: transcription factor PIF3-like          105   1e-20   
gb|KHN24194.1|  Transcription factor PIF3                               105   1e-20   
ref|XP_004301128.1|  PREDICTED: uncharacterized protein LOC101303618    102   1e-20   
ref|XP_002978656.1|  hypothetical protein SELMODRAFT_39143            96.3    2e-20   
ref|XP_001772223.1|  predicted protein                                96.3    2e-20   
ref|XP_007224914.1|  hypothetical protein PRUPE_ppa021918mg             102   2e-20   
ref|XP_010258171.1|  PREDICTED: transcription factor UNE10-like         102   2e-20   
ref|XP_001764602.1|  predicted protein                                  105   2e-20   
dbj|BAF00716.1|  putative bHLH transcription factor                     103   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461998.1|  PREDICTED: transcription factor PIF1               104   2e-20   
ref|NP_849996.1|  transcription factor PIF1                             102   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009771454.1|  PREDICTED: transcription factor UNE10-like i...    102   3e-20   
ref|XP_004495811.1|  PREDICTED: transcription factor PIF3-like is...    104   3e-20   
ref|XP_004495812.1|  PREDICTED: transcription factor PIF3-like is...    104   3e-20   
ref|XP_007047305.1|  Homeodomain-like superfamily protein isoform 2     101   3e-20   
ref|XP_008447346.1|  PREDICTED: transcription factor PIF1-like is...    102   3e-20   
gb|KHN26204.1|  Transcription factor PIF3                               104   3e-20   
ref|XP_008447345.1|  PREDICTED: transcription factor PIF1-like is...    103   4e-20   
ref|XP_008382659.1|  PREDICTED: transcription factor PIF1-like          103   4e-20   
ref|XP_006605776.1|  PREDICTED: transcription factor PIF3-like          103   4e-20   
ref|XP_009407100.1|  PREDICTED: transcription factor PIF1-like          102   4e-20   
gb|EYU42383.1|  hypothetical protein MIMGU_mgv1a020754mg                100   4e-20   
ref|NP_179608.2|  transcription factor PIF1                             102   4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056902.2|  Os06g0164400                                     98.2    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160865.1|  hypothetical protein PHAVU_001G023200g             100   5e-20   
gb|KDO84120.1|  hypothetical protein CISIN_1g0227822mg                97.4    5e-20   
ref|XP_010093617.1|  Transcription factor SPATULA                       101   5e-20   
ref|XP_008367660.1|  PREDICTED: transcription factor SPATULA-like...    100   5e-20   
ref|XP_007160864.1|  hypothetical protein PHAVU_001G023200g             100   5e-20   
gb|KDP41706.1|  hypothetical protein JCGZ_16113                         100   6e-20   
ref|XP_008367659.1|  PREDICTED: transcription factor SPATULA-like...    100   6e-20   
ref|XP_008453232.1|  PREDICTED: transcription factor UNE10              100   6e-20   
gb|AAD24380.1|  unknown protein                                         102   6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009771453.1|  PREDICTED: transcription factor UNE10-like i...    102   6e-20   
ref|XP_009359830.1|  PREDICTED: transcription factor SPATULA-like...    100   6e-20   
ref|XP_008338329.1|  PREDICTED: transcription factor SPATULA            100   6e-20   
gb|AHK05707.1|  bHLH transcription factor SPT                           100   6e-20   
gb|KDO84121.1|  hypothetical protein CISIN_1g0227822mg                97.1    7e-20   
ref|XP_009359822.1|  PREDICTED: transcription factor SPATULA-like...    100   7e-20   
gb|KGN58326.1|  hypothetical protein Csa_3G622450                       102   7e-20   
ref|XP_004142005.1|  PREDICTED: uncharacterized protein LOC101217594    101   8e-20   
gb|AES59419.2|  helix loop helix DNA-binding domain protein           99.4    8e-20   
ref|XP_010444695.1|  PREDICTED: transcription factor ALC-like         97.8    8e-20   
ref|XP_009367270.1|  PREDICTED: transcription factor SPATULA-like       100   8e-20   
gb|KHG00584.1|  Transcription factor SPATULA -like protein              100   9e-20   
emb|CDX69281.1|  BnaC01g01720D                                          100   9e-20   
ref|XP_010416217.1|  PREDICTED: transcription factor PIF1-like is...    102   9e-20   
ref|XP_009410364.1|  PREDICTED: transcription factor SPATULA-like...    100   9e-20   
ref|XP_007047304.1|  Basic helix-loop-helix DNA-binding superfami...    101   1e-19   
ref|XP_007144439.1|  hypothetical protein PHAVU_007G156200g             102   1e-19   
emb|CDX75629.1|  BnaA01g00730D                                          100   1e-19   
gb|EPS62617.1|  hypothetical protein M569_12173                       94.4    1e-19   
ref|XP_004157205.1|  PREDICTED: uncharacterized protein LOC101227644    100   1e-19   
emb|CDY22448.1|  BnaC03g61610D                                          100   1e-19   
ref|XP_006282286.1|  hypothetical protein CARUB_v10028570mg           97.4    1e-19   
ref|XP_003589168.1|  Transcription factor SPATULA                     99.0    1e-19   
ref|XP_002983759.1|  hypothetical protein SELMODRAFT_118904           94.4    1e-19   
ref|XP_001764406.1|  predicted protein                                  102   1e-19   
ref|XP_006656678.1|  PREDICTED: transcription factor SPATULA-like     97.8    1e-19   
ref|XP_011083103.1|  PREDICTED: transcription factor PIF1               102   1e-19   
ref|XP_006283961.1|  hypothetical protein CARUB_v10005083mg             100   1e-19   
ref|XP_009138272.1|  PREDICTED: transcription factor SPATULA          99.8    1e-19   
ref|XP_007201708.1|  hypothetical protein PRUPE_ppa004070mg             101   2e-19   
emb|CDY05725.1|  BnaC07g00780D                                          101   2e-19   
ref|XP_010548419.1|  PREDICTED: transcription factor SPATULA-like     97.8    2e-19   
gb|ACG39275.1|  hypothetical protein                                  98.6    2e-19   Zea mays [maize]
ref|XP_008235752.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    100   2e-19   
gb|EEC78487.1|  hypothetical protein OsI_18387                        98.6    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004499048.1|  PREDICTED: transcription factor SPATULA-like...  98.2    2e-19   
ref|XP_004499049.1|  PREDICTED: transcription factor SPATULA-like...  97.8    2e-19   
dbj|BAL63287.1|  basic helix-loop-helix protein APG                     100   2e-19   
ref|XP_008440296.1|  PREDICTED: transcription factor SPATULA            100   2e-19   
ref|XP_008776593.1|  PREDICTED: transcription factor PIF4-like is...    101   2e-19   
ref|XP_008776592.1|  PREDICTED: transcription factor PIF4-like is...    101   2e-19   
ref|XP_006473301.1|  PREDICTED: transcription factor SPATULA-like...  98.6    2e-19   
ref|XP_010489088.1|  PREDICTED: transcription factor PIF1-like          101   2e-19   
emb|CCE46185.1|  bHLH transcription factor                              100   2e-19   
gb|EEE62266.1|  hypothetical protein OsJ_17053                          100   2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002523613.1|  conserved hypothetical protein                     100   2e-19   Ricinus communis
ref|XP_010432081.1|  PREDICTED: transcription factor SPATULA-like...  99.4    2e-19   
ref|XP_002510190.1|  conserved hypothetical protein                   98.6    2e-19   Ricinus communis
ref|NP_001054593.1|  Os05g0139100                                       100   2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008340273.1|  PREDICTED: transcription factor SPATULA-like...  99.4    2e-19   
gb|KHN48974.1|  Transcription factor PIF1                             97.4    2e-19   
ref|XP_010112171.1|  Transcription factor SPATULA                     99.0    2e-19   
ref|XP_009366017.1|  PREDICTED: transcription factor PIF3-like is...    101   3e-19   
ref|XP_008340258.1|  PREDICTED: transcription factor SPATULA-like...  99.4    3e-19   
ref|XP_006473302.1|  PREDICTED: transcription factor SPATULA-like...  98.2    3e-19   
ref|XP_008340265.1|  PREDICTED: transcription factor SPATULA-like...  99.4    3e-19   
dbj|BAD43719.1|  putative bHLH transcription factor (bHLH073/ALCA...  96.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30312.1|  hypothetical protein AALP_AA7G245600                  99.0    3e-19   
ref|XP_006339939.1|  PREDICTED: transcription factor SPATULA-like     99.0    3e-19   
ref|XP_006595974.1|  PREDICTED: transcription factor SPATULA-like     97.8    3e-19   
ref|XP_008370334.1|  PREDICTED: transcription factor PIF3 isoform X2    100   3e-19   
ref|XP_010432080.1|  PREDICTED: transcription factor SPATULA-like...  99.0    3e-19   
gb|KFK40384.1|  hypothetical protein AALP_AA3G366400                    100   3e-19   
ref|XP_006297599.1|  hypothetical protein CARUB_v10013621mg             100   3e-19   
ref|XP_010432082.1|  PREDICTED: transcription factor SPATULA-like...  99.0    3e-19   
ref|XP_010484550.1|  PREDICTED: transcription factor ALC-like         95.9    3e-19   
ref|XP_009794497.1|  PREDICTED: transcription factor PIF1               100   3e-19   
dbj|BAD19423.1|  hypothetical protein                                 93.6    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_172424.1|  transcription factor PIF3                             100   4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007047306.1|  Homeodomain-like superfamily protein, putati...  99.0    4e-19   
ref|XP_009366015.1|  PREDICTED: transcription factor PIF3-like is...    100   4e-19   
ref|XP_010315963.1|  PREDICTED: transcription factor SPATULA isof...  98.6    4e-19   
gb|KGN44558.1|  hypothetical protein Csa_7G333400                       100   4e-19   
ref|XP_010538109.1|  PREDICTED: transcription factor SPATULA-like     97.4    4e-19   
ref|XP_002306475.2|  hypothetical protein POPTR_0005s18280g           96.3    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010315964.1|  PREDICTED: transcription factor SPATULA isof...  98.6    4e-19   
ref|XP_008370333.1|  PREDICTED: transcription factor PIF3 isoform X1    100   4e-19   
ref|XP_008388421.1|  PREDICTED: transcription factor PIF3-like          100   4e-19   
ref|XP_010485325.1|  PREDICTED: transcription factor ALC-like         94.0    4e-19   
gb|KCW54935.1|  hypothetical protein EUGRSUZ_I00906                   95.1    4e-19   
ref|XP_004139727.1|  PREDICTED: transcription factor PIF1-like          100   4e-19   
gb|AEX32796.1|  phytochrome-interacting factor 3                        100   5e-19   
ref|XP_007049885.1|  Phytochrome interacting factor 3-like 5, put...    100   5e-19   
ref|XP_007049883.1|  Phytochrome interacting factor 3-like 5, put...    100   5e-19   
ref|XP_010464528.1|  PREDICTED: transcription factor ALC-like         95.5    5e-19   
ref|XP_010446691.1|  PREDICTED: transcription factor SPATULA-like...  98.6    5e-19   
ref|XP_006856483.1|  hypothetical protein AMTR_s00046p00066610        99.4    5e-19   
ref|XP_010531245.1|  PREDICTED: transcription factor SPATULA-like...  97.8    5e-19   
ref|XP_010467931.1|  PREDICTED: transcription factor PIF1-like          100   5e-19   
emb|CDP01313.1|  unnamed protein product                              97.4    5e-19   
ref|XP_009783823.1|  PREDICTED: transcription factor SPATULA-like...  98.2    6e-19   
gb|AAC99771.1|  phytochrome-associated protein 3                      99.8    7e-19   
ref|XP_010909460.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    100   7e-19   
ref|XP_004302325.1|  PREDICTED: transcription factor PIF3-like          100   7e-19   
ref|XP_008658092.1|  PREDICTED: putative HLH DNA-binding domain s...  96.7    7e-19   
ref|XP_009783822.1|  PREDICTED: transcription factor SPATULA-like...  98.2    7e-19   
ref|XP_002883941.1|  hypothetical protein ARALYDRAFT_319546           99.4    7e-19   
gb|KDP31951.1|  hypothetical protein JCGZ_12412                       97.8    7e-19   
ref|XP_011099122.1|  PREDICTED: transcription factor SPATULA-like     97.8    8e-19   
ref|XP_009335549.1|  PREDICTED: transcription factor PIF3-like is...  99.8    8e-19   
ref|XP_003591254.1|  Transcription factor PIF3                          100   8e-19   
ref|NP_201512.1|  transcription factor ALC                            95.1    8e-19   
gb|AAM61195.1|  unknown                                               95.1    8e-19   
emb|CBY05403.1|  ALCATRAZ-like protein                                94.4    8e-19   
ref|XP_010038341.1|  PREDICTED: transcription factor PIF1-like is...  99.8    8e-19   
ref|XP_011074391.1|  PREDICTED: transcription factor SPATULA-like     95.9    8e-19   
ref|XP_010038342.1|  PREDICTED: transcription factor PIF1-like is...  99.4    9e-19   
ref|NP_001131794.1|  putative HLH DNA-binding domain superfamily ...  96.7    9e-19   
gb|KCW50158.1|  hypothetical protein EUGRSUZ_K03592                   99.4    9e-19   
ref|XP_010446689.1|  PREDICTED: transcription factor SPATULA-like...  97.4    9e-19   
emb|CDY06870.1|  BnaC01g09690D                                        98.6    1e-18   
emb|CDX94963.1|  BnaC05g07080D                                        99.0    1e-18   
dbj|BAJ90909.1|  predicted protein                                    99.0    1e-18   
dbj|BAJ92913.1|  predicted protein                                    99.0    1e-18   
emb|CBY05409.1|  ALCATRAZ-like protein                                94.7    1e-18   
gb|EYU46364.1|  hypothetical protein MIMGU_mgv1a007040mg              98.2    1e-18   
dbj|BAK07789.1|  predicted protein                                    99.0    1e-18   
gb|KHG18014.1|  Transcription factor PIF1 -like protein               99.4    1e-18   
ref|XP_006354865.1|  PREDICTED: transcription factor SPATULA-like     96.7    1e-18   
gb|KHG02827.1|  Transcription factor SPATULA -like protein            95.5    1e-18   
ref|XP_009591396.1|  PREDICTED: transcription factor PIF1-like        99.4    1e-18   
ref|XP_008372429.1|  PREDICTED: transcription factor PIF1-like        99.4    1e-18   
ref|XP_010446690.1|  PREDICTED: transcription factor SPATULA-like...  97.4    1e-18   
ref|XP_004247109.1|  PREDICTED: transcription factor PIF1-like        99.4    1e-18   
ref|XP_009365453.1|  PREDICTED: transcription factor PIF3-like        99.8    1e-18   
ref|XP_004164938.1|  PREDICTED: transcription factor PIF1-like        99.4    1e-18   
ref|XP_002865027.1|  hypothetical protein ARALYDRAFT_496889           94.7    1e-18   
dbj|BAD67851.1|  basic helix-loop-helix protein SPATULA-like          96.7    1e-18   
gb|EAY99814.1|  hypothetical protein OsI_21804                        96.7    1e-18   
ref|XP_006840391.1|  hypothetical protein AMTR_s00045p00141060        99.8    1e-18   
ref|XP_010416208.1|  PREDICTED: transcription factor PIF1-like is...  99.0    1e-18   
gb|EYU25441.1|  hypothetical protein MIMGU_mgv1a010846mg              96.3    1e-18   
ref|XP_009397370.1|  PREDICTED: transcription factor PIF4-like        99.0    1e-18   
emb|CDY31989.1|  BnaA07g00060D                                        98.6    1e-18   
ref|XP_008800313.1|  PREDICTED: transcription factor PIF3-like is...  99.4    1e-18   
gb|KFK28388.1|  hypothetical protein AALP_AA8G508500                  94.4    1e-18   
ref|XP_008800314.1|  PREDICTED: transcription factor PIF3-like is...  99.4    1e-18   
ref|XP_010667415.1|  PREDICTED: transcription factor SPATULA-like...  97.8    1e-18   
ref|XP_007207211.1|  hypothetical protein PRUPE_ppa001899mg           99.4    1e-18   
ref|XP_008378028.1|  PREDICTED: transcription factor SPATULA-like...  96.7    1e-18   
ref|XP_008246329.1|  PREDICTED: transcription factor PIF3             99.4    1e-18   
gb|KEH23988.1|  transcription factor                                  98.2    1e-18   
gb|KEH42414.1|  transcription factor                                  99.0    1e-18   
gb|ABN08903.1|  Helix-loop-helix DNA-binding                          98.6    1e-18   
ref|XP_010652804.1|  PREDICTED: transcription factor SPATULA          97.1    1e-18   
ref|XP_009372305.1|  PREDICTED: transcription factor PIF1             98.6    1e-18   
ref|XP_010109673.1|  hypothetical protein L484_015158                 99.0    1e-18   
ref|XP_006350296.1|  PREDICTED: transcription factor PIF1-like is...  99.0    1e-18   
ref|XP_004243631.1|  PREDICTED: transcription factor PIF4             98.6    1e-18   
emb|CBI21410.3|  unnamed protein product                              97.1    2e-18   
ref|XP_003625475.1|  Transcription factor PIF1                        98.2    2e-18   
ref|XP_006303172.1|  hypothetical protein CARUB_v10008815mg           98.6    2e-18   
ref|XP_010475789.1|  PREDICTED: transcription factor PIF3             98.6    2e-18   
ref|XP_010490103.1|  PREDICTED: transcription factor PIF3-like        98.6    2e-18   
ref|XP_008453053.1|  PREDICTED: transcription factor PIF3 isoform X2  99.0    2e-18   
gb|KDO56397.1|  hypothetical protein CISIN_1g006040mg                 99.0    2e-18   
gb|AHM26463.1|  PIF3                                                  91.3    2e-18   
gb|KDO56393.1|  hypothetical protein CISIN_1g006040mg                 99.0    2e-18   
gb|AHM26454.1|  PIF3                                                  91.3    2e-18   
gb|KDO56396.1|  hypothetical protein CISIN_1g006040mg                 99.0    2e-18   
ref|XP_009607891.1|  PREDICTED: transcription factor SPATULA isof...  96.7    2e-18   
ref|XP_003545154.1|  PREDICTED: transcription factor PIF4-like is...  98.6    2e-18   
ref|XP_006350295.1|  PREDICTED: transcription factor PIF1-like is...  98.6    2e-18   
ref|XP_010667416.1|  PREDICTED: transcription factor SPATULA-like...  97.4    2e-18   
ref|XP_010458240.1|  PREDICTED: transcription factor PIF3-like        98.6    2e-18   
ref|XP_008453043.1|  PREDICTED: transcription factor PIF3 isoform X1  99.0    2e-18   
gb|AHM26451.1|  PIF3                                                  90.9    2e-18   
gb|KDO56394.1|  hypothetical protein CISIN_1g006040mg                 98.6    2e-18   
gb|AHM26455.1|  PIF3                                                  90.9    2e-18   
gb|KGN61033.1|  hypothetical protein Csa_2G035330                     98.6    2e-18   
gb|AHM26476.1|  PIF3                                                  90.9    2e-18   
ref|XP_010941466.1|  PREDICTED: transcription factor PIF3-like is...  98.6    2e-18   
ref|XP_008347615.1|  PREDICTED: transcription factor SPATULA-like...  94.4    2e-18   
gb|ABK23705.1|  unknown                                               95.9    2e-18   
ref|XP_008347614.1|  PREDICTED: transcription factor SPATULA-like...  94.4    2e-18   
ref|XP_010320324.1|  PREDICTED: transcription factor SPATULA-like     95.9    2e-18   
ref|XP_006594070.1|  PREDICTED: transcription factor PIF1-like is...  98.2    2e-18   
ref|XP_004152073.1|  PREDICTED: transcription factor PIF1-like        98.2    2e-18   
ref|XP_004144801.1|  PREDICTED: transcription factor PIF3-like        98.6    2e-18   
ref|XP_008444604.1|  PREDICTED: transcription factor SPATULA-like     96.7    2e-18   
gb|KHN12001.1|  Transcription factor PIF4                             98.2    2e-18   
ref|XP_009607890.1|  PREDICTED: transcription factor SPATULA isof...  96.7    2e-18   
ref|XP_010941465.1|  PREDICTED: transcription factor PIF3-like is...  98.6    2e-18   
ref|XP_008378027.1|  PREDICTED: transcription factor SPATULA-like...  96.3    2e-18   
ref|XP_010932049.1|  PREDICTED: transcription factor SPATULA          96.7    2e-18   
ref|XP_004172700.1|  PREDICTED: uncharacterized protein LOC101229339  96.7    2e-18   
ref|XP_010271069.1|  PREDICTED: transcription factor PIF3 isoform X1  98.6    2e-18   
ref|XP_002889756.1|  hypothetical protein ARALYDRAFT_471048           98.2    2e-18   
ref|XP_010271074.1|  PREDICTED: transcription factor PIF3 isoform X2  98.6    2e-18   
ref|XP_009129261.1|  PREDICTED: transcription factor ALC-like         92.4    2e-18   
ref|XP_010906805.1|  PREDICTED: transcription factor PIF4-like is...  98.2    3e-18   
ref|XP_008378026.1|  PREDICTED: transcription factor SPATULA-like...  95.9    3e-18   
gb|EYU23581.1|  hypothetical protein MIMGU_mgv1a009746mg              95.9    3e-18   
ref|XP_010906815.1|  PREDICTED: transcription factor PIF4-like is...  97.8    3e-18   
ref|XP_010042473.1|  PREDICTED: transcription factor PIF3-like        98.2    3e-18   
ref|XP_004955437.1|  PREDICTED: transcription factor PIF4-like        96.3    3e-18   
ref|XP_009148251.1|  PREDICTED: transcription factor PIF3 isoform X2  97.8    3e-18   
ref|XP_006357888.1|  PREDICTED: transcription factor PIF4-like        97.8    3e-18   
ref|XP_006364548.1|  PREDICTED: transcription factor PIF1-like        97.8    3e-18   
ref|XP_003561052.1|  PREDICTED: transcription factor SPATULA-like     95.5    3e-18   
ref|XP_007162650.1|  hypothetical protein PHAVU_001G168700g           97.4    3e-18   
ref|XP_009129263.1|  PREDICTED: transcription factor bHLH119-like...  97.4    3e-18   
ref|XP_010659766.1|  PREDICTED: transcription factor PIF3-like is...  98.2    3e-18   
ref|XP_002306764.2|  hypothetical protein POPTR_0005s22870g           97.8    3e-18   
ref|XP_009148249.1|  PREDICTED: transcription factor PIF3 isoform X1  97.8    3e-18   
ref|XP_006423961.1|  hypothetical protein CICLE_v10027890mg           98.2    3e-18   
emb|CDY67566.1|  BnaCnng55460D                                        94.7    3e-18   
ref|XP_010940774.1|  PREDICTED: putative transcription factor bHL...  97.1    3e-18   
gb|ACM41588.1|  bHLH transcription factor MYC5                        95.1    3e-18   
gb|ACR38655.1|  unknown                                               96.7    3e-18   
ref|XP_009420906.1|  PREDICTED: transcription factor SPATULA-like     95.5    3e-18   
ref|XP_010659764.1|  PREDICTED: transcription factor PIF3-like is...  97.8    4e-18   
emb|CAN76246.1|  hypothetical protein VITISV_023382                   97.8    4e-18   
ref|XP_010659765.1|  PREDICTED: transcription factor PIF3-like is...  97.8    4e-18   
gb|EYU17967.1|  hypothetical protein MIMGU_mgv1a007316mg              96.3    4e-18   
emb|CBI39676.3|  unnamed protein product                              97.4    4e-18   
ref|XP_002459338.1|  hypothetical protein SORBIDRAFT_02g002760        96.7    4e-18   
ref|XP_006575634.1|  PREDICTED: transcription factor PIF4-like        97.4    4e-18   
ref|XP_002521150.1|  Phytochrome-interacting factor, putative         97.4    4e-18   
gb|KHN38358.1|  Transcription factor PIF5                             97.4    4e-18   
ref|XP_002454736.1|  hypothetical protein SORBIDRAFT_04g036450        94.4    4e-18   
ref|XP_010914796.1|  PREDICTED: transcription factor PIF3-like is...  97.8    4e-18   
gb|KHN09413.1|  Transcription factor PIF1                             94.4    4e-18   
gb|AGW52145.1|  PIL                                                   97.4    4e-18   
ref|XP_007031278.1|  Phytochrome interacting factor 3, putative i...  97.8    4e-18   
ref|XP_010914797.1|  PREDICTED: transcription factor PIF3-like is...  97.4    4e-18   
ref|XP_010927433.1|  PREDICTED: putative transcription factor bHL...  95.5    4e-18   
ref|XP_010927432.1|  PREDICTED: putative transcription factor bHL...  95.5    5e-18   
ref|XP_010245660.1|  PREDICTED: transcription factor PIF1-like is...  97.4    5e-18   
ref|XP_008793892.1|  PREDICTED: uncharacterized protein LOC103710...  95.5    5e-18   
ref|XP_009129259.1|  PREDICTED: transcription factor bHLH119-like...  97.1    5e-18   
ref|XP_010245661.1|  PREDICTED: transcription factor PIF1-like is...  97.1    5e-18   
ref|XP_008654839.1|  PREDICTED: uncharacterized protein LOC100279...  97.4    5e-18   
gb|ACR35132.1|  unknown                                               97.4    5e-18   
ref|XP_010245662.1|  PREDICTED: transcription factor PIF1-like is...  97.1    5e-18   
ref|XP_006393909.1|  hypothetical protein EUTSA_v10004889mg           93.2    5e-18   
dbj|BAJ92170.1|  predicted protein                                    94.7    5e-18   
ref|XP_009401971.1|  PREDICTED: transcription factor PIF3-like is...  97.1    5e-18   
ref|XP_009401973.1|  PREDICTED: transcription factor PIF3-like is...  97.1    5e-18   
gb|AAK98706.1|AC069158_18  Putative SPATULA                           94.4    5e-18   
ref|XP_006358519.1|  PREDICTED: transcription factor PIF3-like        97.4    6e-18   
ref|XP_010245663.1|  PREDICTED: transcription factor PIF1-like is...  96.7    6e-18   
gb|EMT30687.1|  Transcription factor PIF5                             92.8    6e-18   
ref|XP_008793888.1|  PREDICTED: transcription factor SPATULA-like...  95.1    6e-18   
emb|CDP03833.1|  unnamed protein product                              96.7    6e-18   
ref|XP_004954276.1|  PREDICTED: transcription factor SPATULA-like     94.7    6e-18   
ref|XP_006282937.1|  hypothetical protein CARUB_v10007459mg           96.3    7e-18   
ref|XP_009356576.1|  PREDICTED: transcription factor PIF4-like        96.7    7e-18   
ref|XP_011032742.1|  PREDICTED: transcription factor PIF4-like is...  97.1    7e-18   
ref|XP_011032741.1|  PREDICTED: transcription factor PIF4-like is...  97.1    7e-18   
dbj|BAD81566.1|  putative BP-5 protein                                96.7    7e-18   
gb|KDO65840.1|  hypothetical protein CISIN_1g014090mg                 95.5    7e-18   
ref|XP_007031279.1|  Phytochrome interacting factor 3, putative i...  97.1    7e-18   
ref|XP_010030576.1|  PREDICTED: transcription factor SPATULA-like     95.1    7e-18   
ref|XP_010054152.1|  PREDICTED: transcription factor PIF5             96.7    7e-18   
emb|CDY64745.1|  BnaA06g37850D                                        96.3    8e-18   
gb|EAZ24998.1|  hypothetical protein OsJ_08778                        94.4    8e-18   
gb|EAY87922.1|  hypothetical protein OsI_09345                        94.4    8e-18   
gb|KCW89798.1|  hypothetical protein EUGRSUZ_A02043                   96.7    8e-18   
gb|KFK43254.1|  phytochrome-interacting factor                        96.3    8e-18   
ref|XP_010231744.1|  PREDICTED: transcription factor APG-like         94.0    8e-18   
ref|XP_011032743.1|  PREDICTED: transcription factor PIF4-like is...  96.3    8e-18   
ref|XP_010522932.1|  PREDICTED: transcription factor PIF7-like is...  94.4    8e-18   
gb|KDO44799.1|  hypothetical protein CISIN_1g0077971mg                90.5    8e-18   
emb|CDY01438.1|  BnaA07g12110D                                        92.4    8e-18   
ref|XP_010437251.1|  PREDICTED: transcription factor SPATULA-like     94.4    9e-18   
gb|KDP23327.1|  hypothetical protein JCGZ_23160                       96.7    9e-18   
ref|XP_004967645.1|  PREDICTED: transcription factor PIF3-like is...  96.7    9e-18   
ref|XP_010240809.1|  PREDICTED: transcription factor PIF3-like is...  96.7    9e-18   
ref|XP_004967640.1|  PREDICTED: transcription factor PIF3-like is...  96.7    9e-18   
ref|XP_006575134.1|  PREDICTED: transcription factor PIF1-like        90.1    9e-18   
ref|XP_004292266.1|  PREDICTED: transcription factor PIF1-like        96.3    9e-18   
ref|XP_010522924.1|  PREDICTED: transcription factor PIF7-like is...  94.4    1e-17   
ref|NP_001042775.2|  Os01g0286100                                     96.7    1e-17   
ref|XP_009118315.1|  PREDICTED: transcription factor PIF3-like        95.9    1e-17   
gb|KCW89801.1|  hypothetical protein EUGRSUZ_A02043                   95.1    1e-17   
ref|XP_009130461.1|  PREDICTED: LOW QUALITY PROTEIN: putative tra...  95.9    1e-17   
gb|KHG01839.1|  Transcription factor PIF1 -like protein               96.3    1e-17   
ref|XP_010523095.1|  PREDICTED: transcription factor UNE10 isofor...  94.0    1e-17   
ref|XP_009399053.1|  PREDICTED: transcription factor PIF4-like        96.3    1e-17   
gb|KDP26428.1|  hypothetical protein JCGZ_17586                       96.3    1e-17   
ref|XP_004292809.1|  PREDICTED: uncharacterized protein LOC101312900  96.7    1e-17   
emb|CDY22636.1|  BnaC08g42700D                                        95.9    1e-17   
ref|XP_010674470.1|  PREDICTED: transcription factor PIF3-like        96.3    1e-17   
ref|XP_010240811.1|  PREDICTED: transcription factor PIF3-like is...  96.7    1e-17   
gb|KDO65837.1|  hypothetical protein CISIN_1g014090mg                 95.1    1e-17   
gb|EMT29569.1|  Transcription factor PIF5                             92.4    1e-17   
ref|NP_001136510.1|  putative HLH DNA-binding domain superfamily ...  93.2    1e-17   
ref|XP_008681256.1|  PREDICTED: putative HLH DNA-binding domain s...  93.2    1e-17   
dbj|BAJ90328.1|  predicted protein                                    91.7    1e-17   
ref|XP_006443673.1|  hypothetical protein CICLE_v10019585mg           95.9    1e-17   
ref|XP_010228426.1|  PREDICTED: transcription factor PIF4-like is...  94.4    1e-17   
ref|XP_006480179.1|  PREDICTED: transcription factor PIF1-like is...  95.9    1e-17   
ref|XP_002512587.1|  conserved hypothetical protein                   96.3    1e-17   
ref|XP_002439246.1|  hypothetical protein SORBIDRAFT_09g003090        95.5    1e-17   
gb|KHN36350.1|  Transcription factor PIF1                             91.7    1e-17   
gb|EMT27650.1|  Transcription factor PIF3                             93.6    1e-17   
ref|XP_010228425.1|  PREDICTED: transcription factor PIF4-like is...  94.4    1e-17   
ref|XP_006417565.1|  hypothetical protein EUTSA_v10007343mg           95.5    1e-17   
ref|XP_008777260.1|  PREDICTED: transcription factor PIF3-like        95.9    1e-17   
ref|XP_004240467.1|  PREDICTED: transcription factor PIF1-like is...  95.5    1e-17   
ref|XP_006576979.1|  PREDICTED: transcription factor PIF1-like is...  95.5    1e-17   
ref|XP_006645783.1|  PREDICTED: transcription factor PIF1-like        95.9    2e-17   
ref|XP_009774964.1|  PREDICTED: transcription factor PIF3-like is...  95.9    2e-17   
ref|XP_009774962.1|  PREDICTED: transcription factor PIF3-like is...  95.9    2e-17   
ref|XP_010321805.1|  PREDICTED: transcription factor PIF1-like is...  95.5    2e-17   
gb|EEC70435.1|  hypothetical protein OsI_01449                        95.9    2e-17   
ref|XP_008796446.1|  PREDICTED: transcription factor PIF1-like        94.4    2e-17   
gb|EEE54353.1|  hypothetical protein OsJ_01348                        95.9    2e-17   



>emb|CDP09479.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   295 bits (755),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 226/375 (60%), Positives = 256/375 (68%), Gaps = 32/375 (9%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnn------sntntpaataRVAGFSG  164
             VPWF+ H   A    AA   S+T+TMDALVPC+NN        S      +   V   S 
Sbjct  127   VPWFEDHRRAARAPAAA---SLTLTMDALVPCSNNTRNDHREPSTHVPKISACPVGCSST  183

Query  165   LVGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRD  344
              VGSCS A        ++    AA  +W ++ ADQ S SGSAT GRDS+QVT++T  DR+
Sbjct  184   CVGSCSAAAGNAWLRRMSAAAAAAPMEWGSK-ADQ-SASGSATCGRDSRQVTLDTC-DRE  240

Query  345   LGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSV  524
              GT AYTS S GSPENTSS KQCT K+ DD D S C SR +     ++E KKKGNGKSSV
Sbjct  241   FGTAAYTSTSFGSPENTSSGKQCT-KTVDDQD-SPCQSRYE---ARNEEQKKKGNGKSSV  295

Query  525   STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             STKRSRAAA+HNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV 
Sbjct  296   STKRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVN  355

Query  705   mmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPG  884
             +MSRMNMSPM   +      Q   M+  A+  MGMNMGMGMGVMD+NS+    GRSNI G
Sbjct  356   IMSRMNMSPM---MLPLALQQQLQMSMMASMGMGMNMGMGMGVMDLNSI----GRSNIAG  408

Query  885   IPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAY  1064
             +P LLHP A   A +A       W+   DR+  A+ S  MPDPL AFLA QSQPMTMDAY
Sbjct  409   LPPLLHPTAYMPATSA-------WDGLADRL-AASTSQAMPDPLAAFLACQSQPMTMDAY  460

Query  1065  SRMAALYQQFQQAPG  1109
             SRMAALYQQFQQ PG
Sbjct  461   SRMAALYQQFQQPPG  475



>ref|XP_007052179.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX96336.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
Length=470

 Score =   287 bits (735),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 248/383 (65%), Gaps = 39/383 (10%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR------VAGFSG  164
             VPWFDHH         A++++ T+TMDALVPC+N +   T     + R      V G S 
Sbjct  108   VPWFDHHRAAVAAAAVASSSA-TMTMDALVPCSNRSEDRTTHVMESIRGLGGTCVVGCST  166

Query  165   LVGSCSGAGAATREASL--------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVT  320
              VGSCSG      +  L        ARV  + A +WS++  DQ + S SAT+G DSQ VT
Sbjct  167   RVGSCSGPTGTQDDGVLLTGKRAREARV--SVAPEWSSK--DQ-NASASATFGTDSQHVT  221

Query  321   IETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKK  500
             +++ Y++D G   +TS S+GSPENTSS + CT  +  D+  SVCHSR QR+ G  +EDK+
Sbjct  222   VDS-YEKDFGV-GFTSTSLGSPENTSSPRPCTKATTADDHDSVCHSRPQRKAG--EEDKR  277

Query  501   KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  680
             K  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL
Sbjct  278   KETGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  337

Query  681   KQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAA  860
             KQLQAQV MMSRMN+ PMMFP           +  +  A MGM MGMGMG+       + 
Sbjct  338   KQLQAQVHMMSRMNIPPMMFP-----MTMQQQLQMSMMAPMGMGMGMGMGIGMGVMDMST  392

Query  861   AGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQS  1040
              GR NI GI  +L     +            W+ S DR+  AA++++MPDPL+AFLA QS
Sbjct  393   MGRPNITGISPVLPNPFVTMTP---------WDGSGDRL-QAASAAVMPDPLSAFLACQS  442

Query  1041  QPMTMDAYSRMAALYQQFQQAPG  1109
             QP+TMDAYSRMAA+YQQ Q  P 
Sbjct  443   QPITMDAYSRMAAMYQQMQHPPA  465



>ref|XP_007052180.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96337.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
Length=478

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 248/383 (65%), Gaps = 39/383 (10%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR------VAGFSG  164
             VPWFDHH         A++++ T+TMDALVPC+N +   T     + R      V G S 
Sbjct  116   VPWFDHHRAAVAAAAVASSSA-TMTMDALVPCSNRSEDRTTHVMESIRGLGGTCVVGCST  174

Query  165   LVGSCSGAGAATREASL--------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVT  320
              VGSCSG      +  L        ARV  + A +WS++  DQ + S SAT+G DSQ VT
Sbjct  175   RVGSCSGPTGTQDDGVLLTGKRAREARV--SVAPEWSSK--DQ-NASASATFGTDSQHVT  229

Query  321   IETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKK  500
             +++ Y++D G   +TS S+GSPENTSS + CT  +  D+  SVCHSR QR+ G  +EDK+
Sbjct  230   VDS-YEKDFGV-GFTSTSLGSPENTSSPRPCTKATTADDHDSVCHSRPQRKAG--EEDKR  285

Query  501   KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  680
             K  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL
Sbjct  286   KETGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  345

Query  681   KQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAA  860
             KQLQAQV MMSRMN+ PMMFP           +  +  A MGM MGMGMG+       + 
Sbjct  346   KQLQAQVHMMSRMNIPPMMFP-----MTMQQQLQMSMMAPMGMGMGMGMGIGMGVMDMST  400

Query  861   AGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQS  1040
              GR NI GI  +L     +            W+ S DR+  AA++++MPDPL+AFLA QS
Sbjct  401   MGRPNITGISPVLPNPFVTMTP---------WDGSGDRL-QAASAAVMPDPLSAFLACQS  450

Query  1041  QPMTMDAYSRMAALYQQFQQAPG  1109
             QP+TMDAYSRMAA+YQQ Q  P 
Sbjct  451   QPITMDAYSRMAAMYQQMQHPPA  473



>ref|XP_009586993.1| PREDICTED: transcription factor UNE10 isoform X3 [Nicotiana tomentosiformis]
Length=417

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 222/375 (59%), Positives = 261/375 (70%), Gaps = 18/375 (5%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF++H   A         S+T+  DALVPC+ N+N +   P++  +V G  G   VGS
Sbjct  53    VPWFNYHHVVADTPLVPG--SLTMAKDALVPCSANSNYHRRPPSSV-QVPGLDGSTHVGS  109

Query  177   CSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTE  356
             CSGA       +   VG    H+ S+R    MS+SGSAT   DS+Q+T++T YDR++GT 
Sbjct  110   CSGATNNRDWMAAPLVGTEPTHEGSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGTG  166

Query  357   AYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
              YTS SMGSPENTSSDKQCTN++ DD+D SVCHSRS+RE+G D+ED+KKG+  SS STKR
Sbjct  167   MYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRSKREVG-DEEDEKKGSKNSSSSTKR  224

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms-  713
              RAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQ+QV MMS 
Sbjct  225   KRAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQSQVNMMSR  284

Query  714   rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSV-AAAAGRSNIPGIP  890
                   MM PLAMQQQLQMSMMA      MGM MGMGMG+     +      R NI G+P
Sbjct  285   MNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMGMGVAGVLDINTLSRPNITGLP  344

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  345   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  398

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQFQQ   G+
Sbjct  399   MAALYQQFQQPAAGS  413



>ref|XP_002301261.2| hypothetical protein POPTR_0002s14430g [Populus trichocarpa]
 gb|EEE80534.2| hypothetical protein POPTR_0002s14430g [Populus trichocarpa]
Length=432

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 219/394 (56%), Positives = 259/394 (66%), Gaps = 52/394 (13%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR--------VAGF  158
             VPWF+HH   A         S T+TMDALVPC+  ++    T    +         V G 
Sbjct  61    VPWFNHHRASA---------SATMTMDALVPCSKRSDQERTTRVIDSSPAGLGTDCVVGC  111

Query  159   SGLVGSCSGAGAATREASL--------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQ  314
             S  VGSCS   A   E  L        ARV   A  +WS    DQ    G+    +DSQQ
Sbjct  112   STRVGSCSAPTATQNEVGLLTRKREKVARVPVPA--EWSR---DQSVNRGATFSKKDSQQ  166

Query  315   VTIETTYDRDLGTEAYTSASMGSPENTSS-DKQCTNKSNDDNDHSVCHSRSQREIGSDDE  491
             VT+++  +R+LG    ++ S GS ENTSS  K CT  +  D + SVCHSR QRE G D++
Sbjct  167   VTVDSC-ERELGVGFTSTTSFGSQENTSSGTKPCTKTNTADENDSVCHSRPQREAG-DED  224

Query  492   DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
             DKKKGNGKSSVS +RSRAAA+HNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI
Sbjct  225   DKKKGNGKSSVSNRRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  284

Query  672   EYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmd----  839
             EYLKQLQAQVQM+SRMNM PMM P+A+QQQLQMSMMAP +    GM MGMGMG+      
Sbjct  285   EYLKQLQAQVQMVSRMNMQPMMLPMALQQQLQMSMMAPISMGMAGMGMGMGMGMGMGVVD  344

Query  840   mNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWE--NSLDRMPTAAAS-SMMPD  1010
             MN++AA   RSNI G+  +LHP A              W+  NS +R+PTAA S ++MPD
Sbjct  345   MNTLAA---RSNITGVSPVLHPTAFMPMTT--------WDGSNSHERLPTAAPSATVMPD  393

Query  1011  PLTAFLASQSQPMTMDAYSRMAALYQQF-QQAPG  1109
             PL+AFLA QSQPMTMDAYSRMA++YQQ  QQ+P 
Sbjct  394   PLSAFLACQSQPMTMDAYSRMASMYQQLHQQSPA  427



>ref|XP_009586991.1| PREDICTED: transcription factor UNE10 isoform X1 [Nicotiana tomentosiformis]
Length=467

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 222/375 (59%), Positives = 261/375 (70%), Gaps = 18/375 (5%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF++H   A         S+T+  DALVPC+ N+N +   P++  +V G  G   VGS
Sbjct  103   VPWFNYHHVVADTPLVPG--SLTMAKDALVPCSANSNYHRRPPSSV-QVPGLDGSTHVGS  159

Query  177   CSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTE  356
             CSGA       +   VG    H+ S+R    MS+SGSAT   DS+Q+T++T YDR++GT 
Sbjct  160   CSGATNNRDWMAAPLVGTEPTHEGSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGTG  216

Query  357   AYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
              YTS SMGSPENTSSDKQCTN++ DD+D SVCHSRS+RE+G D+ED+KKG+  SS STKR
Sbjct  217   MYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRSKREVG-DEEDEKKGSKNSSSSTKR  274

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms-  713
              RAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQ+QV MMS 
Sbjct  275   KRAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQSQVNMMSR  334

Query  714   rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSV-AAAAGRSNIPGIP  890
                   MM PLAMQQQLQMSMMA      MGM MGMGMG+     +      R NI G+P
Sbjct  335   MNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMGMGVAGVLDINTLSRPNITGLP  394

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  395   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  448

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQFQQ   G+
Sbjct  449   MAALYQQFQQPAAGS  463



>ref|XP_009792483.1| PREDICTED: transcription factor UNE10 isoform X3 [Nicotiana sylvestris]
Length=417

 Score =   280 bits (716),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 218/375 (58%), Positives = 260/375 (69%), Gaps = 18/375 (5%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF+++   A          +T+  DALVPC+ N+N     P++  +V G  G   VGS
Sbjct  53    VPWFNYNHVVADTPLVPGL--LTMAKDALVPCSANSNYQNRPPSSV-QVPGLDGSTHVGS  109

Query  177   CSGAGAATRE-ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGT  353
             CS     +R+  ++ RV     H+WS+R    MS+SGSAT   DS+Q+T++T YDR++GT
Sbjct  110   CSTGATNSRDWMAVPRVRMEPTHEWSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGT  166

Query  354   EAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
               YTS SMGSPENTSSDKQCTN++ DD+D SVCHSRS+RE+G D+ED+KKG+  SS STK
Sbjct  167   GMYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRSKREVG-DEEDEKKGSKNSSSSTK  224

Query  534   RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms  713
             R RAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQ+QV MMS
Sbjct  225   RKRAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQSQVNMMS  284

Query  714   -rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIP  890
                    MM PLAMQQQLQMSMMA      MGM MGMGM  +          R NI G+P
Sbjct  285   RMNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMTGVAGVLDINTLSRPNITGLP  344

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  345   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  398

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQF Q+  G+
Sbjct  399   MAALYQQFLQSAAGS  413



>ref|XP_009792481.1| PREDICTED: transcription factor UNE10 isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 218/375 (58%), Positives = 260/375 (69%), Gaps = 18/375 (5%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF+++   A          +T+  DALVPC+ N+N     P++  +V G  G   VGS
Sbjct  103   VPWFNYNHVVADTPLVPGL--LTMAKDALVPCSANSNYQNRPPSSV-QVPGLDGSTHVGS  159

Query  177   CSGAGAATRE-ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGT  353
             CS     +R+  ++ RV     H+WS+R    MS+SGSAT   DS+Q+T++T YDR++GT
Sbjct  160   CSTGATNSRDWMAVPRVRMEPTHEWSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGT  216

Query  354   EAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
               YTS SMGSPENTSSDKQCTN++ DD+D SVCHSRS+RE+G D+ED+KKG+  SS STK
Sbjct  217   GMYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRSKREVG-DEEDEKKGSKNSSSSTK  274

Query  534   RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms  713
             R RAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQ+QV MMS
Sbjct  275   RKRAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQSQVNMMS  334

Query  714   -rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIP  890
                    MM PLAMQQQLQMSMMA      MGM MGMGM  +          R NI G+P
Sbjct  335   RMNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMTGVAGVLDINTLSRPNITGLP  394

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  395   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  448

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQF Q+  G+
Sbjct  449   MAALYQQFLQSAAGS  463



>ref|XP_006386561.1| hypothetical protein POPTR_0002s14430g [Populus trichocarpa]
 gb|ERP64358.1| hypothetical protein POPTR_0002s14430g [Populus trichocarpa]
Length=484

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 219/394 (56%), Positives = 259/394 (66%), Gaps = 52/394 (13%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR--------VAGF  158
             VPWF+HH   A         S T+TMDALVPC+  ++    T    +         V G 
Sbjct  113   VPWFNHHRASA---------SATMTMDALVPCSKRSDQERTTRVIDSSPAGLGTDCVVGC  163

Query  159   SGLVGSCSGAGAATREASL--------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQ  314
             S  VGSCS   A   E  L        ARV   A  +WS    DQ    G+    +DSQQ
Sbjct  164   STRVGSCSAPTATQNEVGLLTRKREKVARVPVPA--EWSR---DQSVNRGATFSKKDSQQ  218

Query  315   VTIETTYDRDLGTEAYTSASMGSPENTSS-DKQCTNKSNDDNDHSVCHSRSQREIGSDDE  491
             VT+++  +R+LG    ++ S GS ENTSS  K CT  +  D + SVCHSR QRE G D++
Sbjct  219   VTVDSC-ERELGVGFTSTTSFGSQENTSSGTKPCTKTNTADENDSVCHSRPQREAG-DED  276

Query  492   DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
             DKKKGNGKSSVS +RSRAAA+HNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI
Sbjct  277   DKKKGNGKSSVSNRRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  336

Query  672   EYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmd----  839
             EYLKQLQAQVQM+SRMNM PMM P+A+QQQLQMSMMAP +    GM MGMGMG+      
Sbjct  337   EYLKQLQAQVQMVSRMNMQPMMLPMALQQQLQMSMMAPISMGMAGMGMGMGMGMGMGVVD  396

Query  840   mNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWE--NSLDRMPTAAAS-SMMPD  1010
             MN++AA   RSNI G+  +LHP A              W+  NS +R+PTAA S ++MPD
Sbjct  397   MNTLAA---RSNITGVSPVLHPTAFMPMTT--------WDGSNSHERLPTAAPSATVMPD  445

Query  1011  PLTAFLASQSQPMTMDAYSRMAALYQQF-QQAPG  1109
             PL+AFLA QSQPMTMDAYSRMA++YQQ  QQ+P 
Sbjct  446   PLSAFLACQSQPMTMDAYSRMASMYQQLHQQSPA  479



>ref|XP_011017451.1| PREDICTED: transcription factor UNE10-like [Populus euphratica]
Length=478

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 248/391 (63%), Gaps = 52/391 (13%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR--------VAGF  158
             VPWF+HH   A         S T+TMDALVPC+  ++    T    +         V G 
Sbjct  113   VPWFNHHRASA---------SATMTMDALVPCSKRSDQERTTRVIDSSPAGLGTDCVVGC  163

Query  159   SGLVGSCSGAGAATREA---------SLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQ  311
             S  VGSCS   A   E           +ARV   A  +WS    DQ    G+    +DSQ
Sbjct  164   STRVGSCSAPTATQNEVVGLLTRKREKVARVPVPA--EWSR---DQSVNRGATFSKKDSQ  218

Query  312   QVTIETTYDRDLGTEAYTSASMGSPENTSS-DKQCTNKSNDDNDHSVCHSRSQREIGSDD  488
             QVT+++  +R+LG   +TS S GS ENTSS  K CT     D + SVCH R QRE G D+
Sbjct  219   QVTVDSC-ERELGV-GFTSTSFGSQENTSSGTKPCTKTITADENDSVCHRRPQREAG-DE  275

Query  489   EDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEV  668
             +DKKKGNGKSSVS +RSRAAA+HNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEV
Sbjct  276   DDKKKGNGKSSVSNRRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEV  335

Query  669   IEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNS  848
             IEYLKQLQAQVQM+ RMNM PMM P+    Q Q+ M   A  +     MGMGMGV+DMN+
Sbjct  336   IEYLKQLQAQVQMVIRMNMQPMMLPM--ALQQQLQMSMMAPLSMGMAGMGMGMGVVDMNT  393

Query  849   VAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWE--NSLDRMPTAAAS-SMMPDPLT  1019
             +AA   RSNI G+  +LHP A              W+  N  +R+PTAA S ++MPDPL+
Sbjct  394   LAA---RSNITGVSPVLHPTAFMPMTT--------WDGSNCHERLPTAAPSATVMPDPLS  442

Query  1020  AFLASQSQPMTMDAYSRMAALYQQF-QQAPG  1109
             AFLA QSQPMTMDAYSRMA++YQQ  QQ+P 
Sbjct  443   AFLACQSQPMTMDAYSRMASMYQQLHQQSPA  473



>ref|XP_006347913.1| PREDICTED: transcription factor UNE10-like [Solanum tuberosum]
Length=464

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 208/378 (55%), Positives = 248/378 (66%), Gaps = 29/378 (8%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF++H   A   PA     VT+T DALVPC+ N +++ N  +    V G  G   VGS
Sbjct  105   VPWFNNHNAVAYAPPATGL--VTMTKDALVPCSRNTSNSDNHRSV--HVPGIDGSTHVGS  160

Query  177   CSGAGAATREASLA---RVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL  347
             CSGA   +R+  +A   RV      +W++R  D +S+SGS T G DS+Q+T++T +DR+ 
Sbjct  161   CSGA-TNSRDWMVAPRMRVR-PTKREWNSR-TDMISVSGSETCGGDSRQLTVDT-FDREF  216

Query  348   GTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDK-KKGNGKSSV  524
             GT  YTS SMGSPENTSSDKQCTN++ DD+D SVCHSR +RE G D++D  KKG+  SS 
Sbjct  217   GTTMYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRDEREAGDDEDDNNKKGSKNSSC  275

Query  525   STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
              TKR RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV 
Sbjct  276   FTKRKRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVH  335

Query  705   mmsrmnms-pmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIP  881
             MMSRMNMS  MM PL      Q   M+               GV D+N+++    R NIP
Sbjct  336   MMSRMNMSPAMMLPL---AMQQQLQMSMMGMGMGMGMGMGVAGVFDINNLS----RPNIP  388

Query  882   GIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDA  1061
             G+P  LHP+AA+AA    M     W+NS    P   A       L A LA QSQP+ MDA
Sbjct  389   GLPSFLHPSAATAAFMQPMTS---WDNSSAAPPPPPAMPDP---LAALLACQSQPINMDA  442

Query  1062  YSRMAALYQQFQQAPGGT  1115
             Y RMAALYQQFQQ P G+
Sbjct  443   YRRMAALYQQFQQPPTGS  460



>gb|KDP28805.1| hypothetical protein JCGZ_14576 [Jatropha curcas]
Length=474

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 214/374 (57%), Positives = 250/374 (67%), Gaps = 37/374 (10%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR------VAGFSG  164
             VPWF+++   A         S T TMDALVPC+N    +    A  +       V G S 
Sbjct  110   VPWFENNRAAAVAAS-----SATTTMDALVPCSNRTTDDRKKRAMESVPALGNCVVGSST  164

Query  165   LVGSCSGAGAATREASL-----ARVGGA-AAHDWSNRGADQMSMSGSATYGRDSQQVTIE  326
              VGSCSG  A   E +L     ARV     A +WS+R  DQ S+S SAT+GRDSQ VT+E
Sbjct  165   RVGSCSGPTATQDEDALLTAKRARVARVPVAPEWSSR--DQ-SVSCSATFGRDSQHVTLE  221

Query  327   TTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKG  506
             T  + DLG + +TS S GS ENTS  K  T  +  D + SVCHSR QRE  +D+EDKKKG
Sbjct  222   TC-EPDLGMD-FTSTSFGSQENTSCGKPGTKTATVDENDSVCHSRPQRE-EADEEDKKKG  278

Query  507   NGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQ  686
             N KSS STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQ
Sbjct  279   NVKSSASTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQ  338

Query  687   LQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAG  866
             LQAQVQMMSRMNM PMM P+      Q   M+  A   MG+ +GMGMGV+DMNS++    
Sbjct  339   LQAQVQMMSRMNMQPMMLPM---AMQQQLQMSMLAPMNMGIGIGMGMGVVDMNSIS----  391

Query  867   RSNI-PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQ  1043
             R NI  GI   LHP+A     AA       W+ S +R+  AA++++MPDPL+AFLA QSQ
Sbjct  392   RPNIAAGISPALHPSAFMPVMAAS------WDGSAERLQAAASTTVMPDPLSAFLACQSQ  445

Query  1044  PMTMDAYSRMAALY  1085
             PMTMDAYSRMAA+Y
Sbjct  446   PMTMDAYSRMAAMY  459



>ref|XP_006591039.1| PREDICTED: transcription factor UNE10-like [Glycine max]
Length=465

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 240/374 (64%), Gaps = 26/374 (7%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWFD H             + T+TMDALVPC+N             +  G     G+C 
Sbjct  117   VPWFDPHAAATTTTTT----TNTMTMDALVPCSNREQG---------KKKGMESGPGTCM  163

Query  183   GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
               G +TR  S     GA  H+ S R  DQ S+SGSAT+GRDS+ VT++T  DR+ G  A+
Sbjct  164   -VGCSTRVGSCCGGKGAKGHEASGR--DQ-SVSGSATFGRDSKHVTLDTC-DREFGV-AF  217

Query  363   TSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSR  542
             TS S+ S ENTS  K CT  +  +   SV HS+   E G D+E KK+ NGKSSVSTKRSR
Sbjct  218   TSTSINSLENTSYAKHCTKTTTIEEHDSVSHSKPMGEDG-DEEKKKRANGKSSVSTKRSR  276

Query  543   AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmn  722
             AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMM+R+N
Sbjct  277   AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMNRIN  336

Query  723   mspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLH  902
             MS MM PL MQQQLQMSMM+P                MDMNS+     R+NIPGIP +LH
Sbjct  337   MSSMMLPLTMQQQLQMSMMSPMGMGLGMGMGMGMGMGMDMNSM----NRANIPGIPPVLH  392

Query  903   paaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAAL  1082
             P+A    AA++    A      DR+     +S+MPDPL+     QSQPMTMDAYSR+AA+
Sbjct  393   PSAFMPMAASWDAAVAAAAGGGDRL-QGTPASVMPDPLSTIFGCQSQPMTMDAYSRLAAM  451

Query  1083  YQQFQQAP-GGTKN  1121
             YQQ  Q P  G+KN
Sbjct  452   YQQLHQPPTSGSKN  465



>ref|XP_007140812.1| hypothetical protein PHAVU_008G144300g [Phaseolus vulgaris]
 gb|ESW12806.1| hypothetical protein PHAVU_008G144300g [Phaseolus vulgaris]
Length=478

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 200/374 (53%), Positives = 239/374 (64%), Gaps = 34/374 (9%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPW D HG     N        TVTMDALVPC+    S            G   +  +C 
Sbjct  138   VPWLDPHGSAGTAN--------TVTMDALVPCSKREQSKQ----------GMKSVPSTCM  179

Query  183   GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
               G +TR  S     GA   + S R  DQ S+SGSAT+GRDS+ VT++T  DR+ G  A+
Sbjct  180   -VGCSTRVGSCCGNHGAKGQEMSGR--DQ-SVSGSATFGRDSKHVTLDTC-DREFGV-AF  233

Query  363   TSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSR  542
             TS+S+ S +NTSS K CTN +  D+  SV HS+   E G D+E K++  GKSSVSTKRSR
Sbjct  234   TSSSINSLDNTSSAKHCTNTTTVDDHDSVSHSKPVGENG-DEEKKQRAKGKSSVSTKRSR  292

Query  543   AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmn  722
             AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMM+R+N
Sbjct  293   AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMNRIN  352

Query  723   mspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLH  902
             MS MM PL MQQQLQMSMM+P                +DMNS+     R+NIP IP +LH
Sbjct  353   MSSMMLPLTMQQQLQMSMMSPMGMGLGMGMGMGMGMGLDMNSM----NRANIPAIPPVLH  408

Query  903   paaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAAL  1082
             P+A    AA++   AA   +     P    +++MPDPL+     QSQPMTMDAYSR+ A+
Sbjct  409   PSAFMPMAASWDAAAAGAADRFQGNP----ATVMPDPLSTLFGCQSQPMTMDAYSRLVAM  464

Query  1083  YQQFQQAP-GGTKN  1121
             YQQ  Q P  G+KN
Sbjct  465   YQQLHQPPVSGSKN  478



>ref|XP_002320711.2| hypothetical protein POPTR_0014s06190g [Populus trichocarpa]
 gb|EEE99026.2| hypothetical protein POPTR_0014s06190g [Populus trichocarpa]
Length=471

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 246/385 (64%), Gaps = 51/385 (13%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR-------VAGFS  161
             +PWF+HH   A         S T+TMDALVPC+N ++    T    +        V G S
Sbjct  114   IPWFNHHKASA---------SATMTMDALVPCSNRSDQGRTTHVIDSGPAGLGTCVVGCS  164

Query  162   GLVGSCSGAGAATREASL-----ARVGGAAAH-DWSNRGADQMSMSGSATYGR-DSQQVT  320
               VGSCS   A   E  L     ARV       +WS    DQ S++ SAT+G+ DSQQ+T
Sbjct  165   TRVGSCSAPAATQDEDGLLTGKRARVARVPVPPEWSR---DQ-SVNHSATFGKKDSQQMT  220

Query  321   IETTYDRDLGTEAYTSASMGSPENTSSDKQ-CTNKSNDDNDHSVCHSRSQREIGSDDEDK  497
             +++  +R+ G   +TS S GS ENTSS    CT     D + SVCHSR QRE G +D DK
Sbjct  221   VDSC-EREFGV-GFTSTSFGSQENTSSGTNPCTKTLTADENDSVCHSRPQREAGKED-DK  277

Query  498   KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEY  677
             KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVP+SSKTDKASMLDEVIEY
Sbjct  278   KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPSSSKTDKASMLDEVIEY  337

Query  678   LKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAA  857
             LKQLQAQVQMMSRMNM PMM  L +  Q Q+ M   A  +     MGMGMGVMDMN++AA
Sbjct  338   LKQLQAQVQMMSRMNMQPMM--LPLALQQQLQMSMMAPMSIGMAGMGMGMGVMDMNTIAA  395

Query  858   AAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENS--LDRMPTAAASSMMPDPLTAFLA  1031
                RSN+ GIP  LHP A              W+ S   DR+ T AA     DP++AFLA
Sbjct  396   ---RSNMTGIPPALHPTAFIPLTT--------WDGSSGHDRLQTTAA-----DPMSAFLA  439

Query  1032  SQSQPMTMDAYSRMAALYQQFQQAP  1106
              Q+QPMTMDAYSRMAA+YQQ  Q P
Sbjct  440   CQTQPMTMDAYSRMAAMYQQLHQQP  464



>ref|XP_004229781.1| PREDICTED: transcription factor UNE10 [Solanum lycopersicum]
Length=464

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 199/379 (53%), Positives = 242/379 (64%), Gaps = 32/379 (8%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF++H   A   PA     V +T DALVPC+ N +++ N  +    V G  G   VGS
Sbjct  106   VPWFNNHNAVAYAPPATGL--VAMTKDALVPCSRNTSNSDNQRSV--HVPGIDGSTHVGS  161

Query  177   CSGAGAATREASLA---RVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL  347
             CSGA   +R+ ++A   RV      +WS+R AD +S+SGS T G DS+Q+T++T +DR+ 
Sbjct  162   CSGA-TNSRDWTVAPRMRVR-PTRREWSSR-ADMISVSGSETCGGDSRQLTVDT-FDREF  217

Query  348   GTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVS  527
             GT  YTS SMGSPENTSSDKQCTN++ DD+D SVCHSR Q+E G D++D     G  + S
Sbjct  218   GTTMYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRDQKEGGDDEDDNDNKKGSKNSS  276

Query  528   TKRS--RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
             +     RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  277   SSTKRKRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  336

Query  702   Qmms-rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNI  878
              MMS       MM PL      Q   M+               GV D+N+++    R NI
Sbjct  337   HMMSRMNMSPAMMLPL---AMQQQLQMSMMGMGMGMGMGMGVAGVFDINNLS----RPNI  389

Query  879   PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMD  1058
             PG+P  LHP+AA             W+NS +  P+   S+ MPDPL A LA QSQP+ MD
Sbjct  390   PGLPSFLHPSAAFMQPITS------WDNS-NSAPS-PPSAAMPDPLAALLACQSQPINMD  441

Query  1059  AYSRMAALYQQFQQAPGGT  1115
             AYSRMAALY QFQQ P G+
Sbjct  442   AYSRMAALYLQFQQPPTGS  460



>ref|XP_011033896.1| PREDICTED: transcription factor UNE10 [Populus euphratica]
Length=471

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 237/385 (62%), Gaps = 51/385 (13%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR-------VAGFS  161
             +PWF+HH   A         S T+TMDALVPC+N ++    T    +        V G S
Sbjct  114   IPWFNHHKASA---------SATMTMDALVPCSNRSDQGRTTHVIDSGPAGLGTCVVGCS  164

Query  162   GLVGSCSGAGAATREASL-----ARVGGAAAH-DWSNRGADQMSMSGSATYGR-DSQQVT  320
               VGSCS   A   E  L     ARV       +WS    DQ S++ SA +G+ DSQQ+T
Sbjct  165   TRVGSCSAPAATQDEDGLLTGKRARVARVPVPPEWSR---DQ-SVNHSAAFGKKDSQQMT  220

Query  321   IETTYDRDLGTEAYTSASMGSPENTSSDKQ-CTNKSNDDNDHSVCHSRSQREIGSDDEDK  497
             +++  +R+ G   +TS S GS ENTSS    CT     D + SVCHSR +RE G +D DK
Sbjct  221   VDSC-EREFGV-GFTSTSFGSQENTSSGTNPCTKTLTADENDSVCHSRPKREAGKED-DK  277

Query  498   KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEY  677
             KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVP+SSKTDKASMLDEVIEY
Sbjct  278   KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPSSSKTDKASMLDEVIEY  337

Query  678   LKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAA  857
             LKQLQAQVQMMSRMNM     P+ +   LQ  +     A       GMGMG+  M+  A 
Sbjct  338   LKQLQAQVQMMSRMNMQ----PMMLPLALQQQLQMSMMAPMSMGMAGMGMGMGVMDMNAI  393

Query  858   AAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENS--LDRMPTAAASSMMPDPLTAFLA  1031
             AA RSN+ GIP  LHP A              W+ S   DR+ T AA     DPL+AFLA
Sbjct  394   AA-RSNMTGIPPALHPTAFIPLTT--------WDGSSGHDRLQTTAA-----DPLSAFLA  439

Query  1032  SQSQPMTMDAYSRMAALYQQFQQAP  1106
              Q+QPMTMDAYSRMAA+YQQ  Q P
Sbjct  440   CQTQPMTMDAYSRMAAMYQQLHQQP  464



>ref|XP_003516808.1| PREDICTED: transcription factor UNE10-like [Glycine max]
Length=458

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 199/377 (53%), Positives = 242/377 (64%), Gaps = 37/377 (10%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWFD H             + TVTMDALVPC+N   S            G   + G   
Sbjct  115   VPWFDPHATATT--------TNTVTMDALVPCSNREQSKQ----------GMESVPGGTC  156

Query  183   GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
               G +TR  S     GA  H+ + R  DQ S+SGSAT+GRDS+ VT++T  DR+ G   +
Sbjct  157   MVGCSTRVGSCCGGKGAKGHEATGR--DQ-SVSGSATFGRDSKHVTLDTC-DREFGV-GF  211

Query  363   TSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDED--KKKGNGKSSVSTKR  536
             TS S+ S ENTSS K CT  +  D+  SV HS+    +G D ++  KK+ NGKSSVSTKR
Sbjct  212   TSTSINSLENTSSAKHCTKTTTVDDHDSVSHSK---PVGEDQDEGKKKRANGKSSVSTKR  268

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsr  716
             SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK+DKASMLDEVIEYLKQLQAQ+QM++R
Sbjct  269   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKSDKASMLDEVIEYLKQLQAQLQMINR  328

Query  717   mnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGL  896
             +NMS MM PL MQQQLQMSMM+P                MDMNS+     R++IPGIP +
Sbjct  329   INMSSMMLPLTMQQQLQMSMMSPMGMGLGMGMGMGMGMGMDMNSM----NRAHIPGIPPV  384

Query  897   LHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMA  1076
             LHP+A    AA++   AA      DR+     +++MPDPL+ F   QSQPMT+DAYSR+A
Sbjct  385   LHPSAFMPMAASWDAAAA--AGGGDRL-QGTPANVMPDPLSTFFGCQSQPMTIDAYSRLA  441

Query  1077  ALYQQFQQAP--GGTKN  1121
             A+YQQ  Q P   G+KN
Sbjct  442   AMYQQLHQPPPASGSKN  458



>ref|XP_002511647.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF50316.1| DNA binding protein, putative [Ricinus communis]
Length=465

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 198/367 (54%), Positives = 236/367 (64%), Gaps = 55/367 (15%)
 Frame = +3

Query  63    SVTVTMDALVPCannnnsntntpaataRVAGFSG--------LVGSCSGAGAATRE----  206
             S T+TMDALVPC   ++ + +     +  AG  G         VGSCS    AT++    
Sbjct  128   SPTMTMDALVPCTKQSDDHRSAHVIDSVPAGIGGNCVVGSSTRVGSCSAPTTATQDEEAL  187

Query  207   -----ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSA  371
                  A +ARV    A +WS+R  DQ S+SGSAT+GRDS  VT++T  + DLG   +TS 
Sbjct  188   LAAKRARVARV--PVAPEWSSR--DQ-SVSGSATFGRDSHHVTLDTC-EMDLGV-GFTST  240

Query  372   SMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAA  551
             S GS ENT      T  + D+ND SVCHS        DD+DK+K NGKSSVSTKRSRAAA
Sbjct  241   SFGSQENTK-----TATAVDEND-SVCHS--------DDDDKQKANGKSSVSTKRSRAAA  286

Query  552   IHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmsp  731
             IHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMSRMN+ P
Sbjct  287   IHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMSRMNIQP  346

Query  732   mmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaa  911
             +M P+    Q Q+ M   A         G+GM VMDMN+++    R NI GI  +LHP A
Sbjct  347   VMLPM--TMQQQLQMSMLAPMNMGMGLAGIGMNVMDMNTIS----RPNIAGISPVLHPTA  400

Query  912   asaaaaafmpmaaWWENSL--DRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALY  1085
                  +        W+ S   DR+ TA+  ++M DPL AFLA Q+QPMTMDAYSRMAA+Y
Sbjct  401   FMPMTS--------WDGSSGGDRLQTASP-TVMHDPLAAFLACQTQPMTMDAYSRMAAIY  451

Query  1086  QQFQQAP  1106
             QQ QQ P
Sbjct  452   QQLQQQP  458



>ref|XP_008375803.1| PREDICTED: transcription factor UNE10 isoform X1 [Malus domestica]
Length=456

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 200/388 (52%), Positives = 237/388 (61%), Gaps = 74/388 (19%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF---SGLVG  173
             V WFD H   A         S TVTMDALVPC N ++  ++    +  V G    +G+VG
Sbjct  119   VTWFDRHRAVATP-------STTVTMDALVPCRNQSDDPSSQMIESISVPGVISGTGMVG  171

Query  174   ------SCSGA-GAATRE---------ASLARVGGAAAHDWSNRGADQMSMSGSATYGRD  305
                   SCSGA GAAT +          SLARV      +WS+R     S+SGSAT+G D
Sbjct  172   CSTRVDSCSGATGAATHDDDTLLSGKGTSLARV--PETPEWSSRSQ---SVSGSATFGID  226

Query  306   SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
             SQ VT+++T                             K++D +  SVCHSR Q E+G  
Sbjct  227   SQHVTLDST-----------------------------KASDYD--SVCHSRPQGEVGDG  255

Query  486   DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             D+ KK+  GKSS+STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE
Sbjct  256   DDRKKRSTGKSSISTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  315

Query  666   VIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmN  845
             VIEYLKQLQAQVQM+SRMNM  +M P+AMQQ     M A      MGM MGMGMG+   N
Sbjct  316   VIEYLKQLQAQVQMISRMNMPTIMLPMAMQQLQMSMMAAAPRNMGMGMGMGMGMGMDMNN  375

Query  846   SVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAF  1025
                   GR +IPGIP +LH       +A     A+W     DR+P AA++ +MPDP++AF
Sbjct  376   -----IGRPSIPGIPPILH------PSAFMPMAASWDGTGGDRLP-AASTGVMPDPMSAF  423

Query  1026  LASQSQPMTMDAYSRMAALYQQFQQAPG  1109
             LA QSQPMTMDAYS MAA+YQQF Q P 
Sbjct  424   LACQSQPMTMDAYSMMAAMYQQFHQPPA  451



>ref|XP_002275629.2| PREDICTED: transcription factor UNE10 [Vitis vinifera]
Length=465

 Score =   248 bits (634),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 244/388 (63%), Gaps = 57/388 (15%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGL-----  167
             VPW DH    A    AA   SV +TMDALVPC+NNNN+  N   +    +  +GL     
Sbjct  108   VPWLDHQRAVAAAAAAA---SVAMTMDALVPCSNNNNTTNNNNPSHVMDSVPAGLGPCGG  164

Query  168   -----VGSCSGAGAATREASL-------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQ  311
                  VGSCSG      +A L       ARV   + HDWS+R  DQ S++GSAT+  DSQ
Sbjct  165   GSSTRVGSCSGGATKDDDAILPGKRERVARV--PSTHDWSSR--DQ-SVTGSATFDLDSQ  219

Query  312   QVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDE  491
             QVT++T               +GSPENTSS K CT     D+  SVCHSR QR  G D+E
Sbjct  220   QVTLDT-------------CDLGSPENTSSGKPCTKTITVDDHDSVCHSRPQRRAG-DEE  265

Query  492   DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
             DKK+G GKSSVS+KRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI
Sbjct  266   DKKRGTGKSSVSSKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  325

Query  672   EYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSV  851
             EYLKQLQAQVQMM+RMNMSPMM    M  Q Q+ M   A          MGMGV+DMN++
Sbjct  326   EYLKQLQAQVQMMNRMNMSPMMM--PMTLQQQLQMSLMAQMGMGMGMSPMGMGVVDMNTI  383

Query  852   AAAAGRSNIP--GIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAF  1025
             A    R N+   GI  LLHP       +        W+ S DR+P  AA +M+PDPL AF
Sbjct  384   A----RPNVATTGISPLLHPTPFLPLTS--------WDVSGDRLP--AAPTMVPDPLAAF  429

Query  1026  LASQSQPMTMDAYSRMAALYQQFQQAPG  1109
             LA QSQPMTMDAYSRMAALYQ   Q P 
Sbjct  430   LACQSQPMTMDAYSRMAALYQHLHQHPA  457



>ref|XP_010053944.1| PREDICTED: transcription factor UNE10 [Eucalyptus grandis]
 gb|KCW78320.1| hypothetical protein EUGRSUZ_D02499 [Eucalyptus grandis]
Length=515

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 212/297 (71%), Gaps = 14/297 (5%)
 Frame = +3

Query  243   DWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNK  422
             +WS  G DQ S SGSAT+GRDSQQ+T++T  + ++G    TS S+GSPENTSS K CT  
Sbjct  229   EWS--GMDQ-SASGSATFGRDSQQMTLDTG-EMEIGA-GMTSTSLGSPENTSSGKGCTRA  283

Query  423   SNDDNDH-SVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQR  599
             +   +DH SVCHSR  RE G DDED KK +GKSSVSTKRSRAAAIHNQSERKRRDKINQR
Sbjct  284   TAAADDHDSVCHSRPPRE-GGDDEDNKKRSGKSSVSTKRSRAAAIHNQSERKRRDKINQR  342

Query  600   MKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmm  779
             MKTLQKLVPNSSKTDKAS+LDEVIEYLKQLQAQVQM++RMNM PMM         Q   M
Sbjct  343   MKTLQKLVPNSSKTDKASVLDEVIEYLKQLQAQVQMVNRMNMQPMM---MPMAMQQQLQM  399

Query  780   apaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWE  959
             +      MG+ M              A GRSN+ GI  +LHPAAA+A AAAFMPM +W +
Sbjct  400   SMMGPMGMGLGMVGMGMPGMGMMDMNALGRSNLAGISPVLHPAAAAATAAAFMPMGSWGD  459

Query  960   NSLDRMPTAAASSM-MPDPLTAFLASQSQPMTMDAYSRMAALY--QQFQQAPGGTKN  1121
                DR  TA  + M MPDP++ FLASQSQPMT+DAYSR+AA+Y  Q  Q  P G+KN
Sbjct  460   GG-DRAATATTAPMVMPDPMSPFLASQSQPMTLDAYSRIAAMYAQQMHQPPPSGSKN  515



>gb|KHG29328.1| Transcription factor UNE10 -like protein [Gossypium arboreum]
Length=427

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 241/364 (66%), Gaps = 39/364 (11%)
 Frame = +3

Query  81    DALVPCannnnsntntpaataR------VAGFSGLVGSCSG-AGAATREASLARVGGAAA  239
             DALVPC+       +    +        + G S  VGSCSG AG    E  ++     AA
Sbjct  77    DALVPCSKRTEGRPSHAMESIPGLGRTCLVGGSTRVGSCSGPAGTHDDEVLVSGKSTPAA  136

Query  240   H-----DWSNRGADQMSMSGSATYG--RDSQQVTIETTYDRDLGTEAYTSASMGSPENTS  398
                   +WS++   + S S SAT+G  RDS+ VT++T Y++D G   +TS S+GSPEN S
Sbjct  137   RAPEMPEWSSK---EQSASASATFGKDRDSRYVTLDT-YEKDFGM-GFTSTSLGSPENAS  191

Query  399   SDKQCTNKSNDDNDH-SVCHSRSQREIG-----SDDEDKKKGNGKSSVSTKRSRAAAIHN  560
             S K CT  +   +DH SVCHSR Q +        + E+ KK  GKSSVS KRSRAAAIHN
Sbjct  192   STKPCTKATTTADDHDSVCHSRPQAKFFPFNYREEFEEDKKETGKSSVSNKRSRAAAIHN  251

Query  561   QSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmF  740
             QSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMM+RMN+  MM 
Sbjct  252   QSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMNRMNIPQMML  311

Query  741   PLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasa  920
             P+AMQQQLQMSMMAPA    MGM MGMGMGVMD+N++    GR NI GI  ++     + 
Sbjct  312   PMAMQQQLQMSMMAPAMGMGMGMGMGMGMGVMDINTM----GRPNITGISPVMPNPFMAM  367

Query  921   aaaafmpmaaWWENSLDRM-PTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQ  1097
              +         W+ S +R+   A+A++MMPDPL+ FLA Q QPMTMDAYSR+AA+YQQ Q
Sbjct  368   TS---------WDGSGERLQQAASAAAMMPDPLSTFLACQPQPMTMDAYSRLAAMYQQMQ  418

Query  1098  QAPG  1109
             Q P 
Sbjct  419   QPPA  422



>ref|XP_010258917.1| PREDICTED: transcription factor UNE10 isoform X3 [Nelumbo nucifera]
Length=476

 Score =   232 bits (592),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 237/389 (61%), Gaps = 57/389 (15%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWFD  G  A           ++TMDALVPC N   S  +      RV   +  VG+C+
Sbjct  116   VPWFDPRGTAAAQ---------SMTMDALVPCTNRTTSADDHCT---RVPEPNPGVGTCA  163

Query  183   GAGAATREAS--------------LARVGGAAAHDWSNRGADQMSMSGSATYGRDS--QQ  314
              A +   E+S              LA+      H     G+ + S+S SA++G+D+  Q 
Sbjct  164   IACSTRLESSSETGTLDRRLEQEALAKKRPRLEH-VPVEGSSKQSVSISASFGKDNSRQD  222

Query  315   VTIETTYDRDLGTEA-YTSASMGSPENTSS--DKQCTNKSN---DDNDHSVCHSRSQREI  476
             +T++T    +L TE  +TS S+GSPENTS+   +    KS    DD+D SV HSR ++E 
Sbjct  223   MTLDT---YELDTEVGFTSTSLGSPENTSTGHPRASYTKSTTMVDDHD-SVSHSRPEKES  278

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
             G + EDKK   GKSS+STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM
Sbjct  279   GFE-EDKKGQTGKSSISTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  337

Query  657   LDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvm  836
             LDEVIEYLKQLQAQVQMMSRM+M  MM P+      Q   M+  A   M M M MGMG M
Sbjct  338   LDEVIEYLKQLQAQVQMMSRMSMPHMMLPM---TMQQQLQMSMLAQMGMFMGMNMGMGTM  394

Query  837   dmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPL  1016
             DMNSV     R+NI G+P +LHP       +        W+ + DR+P  ++S+ MPDPL
Sbjct  395   DMNSVT----RNNIAGVPPVLHPNVLMTLPS--------WDGTGDRLP--SSSTTMPDPL  440

Query  1017  TAFLASQSQPMTMDAYSRMAALYQQFQQA  1103
             + FLA QSQP  MD Y+RM ALYQQ  Q+
Sbjct  441   STFLACQSQPNNMDTYNRMVALYQQLYQS  469



>ref|XP_007052181.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
3 [Theobroma cacao]
 gb|EOX96338.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
3 [Theobroma cacao]
Length=448

 Score =   231 bits (588),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 182/382 (48%), Positives = 226/382 (59%), Gaps = 61/382 (16%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR------VAGFSG  164
             VPWFDHH         A++++ T+TMDALVPC+N +   T     + R      V G S 
Sbjct  108   VPWFDHHRAAVAAAAVASSSA-TMTMDALVPCSNRSEDRTTHVMESIRGLGGTCVVGCST  166

Query  165   LVGSCSGAGAATREASL--------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVT  320
              VGSCSG      +  L        ARV  + A +WS++  DQ + S SAT+G DSQ VT
Sbjct  167   RVGSCSGPTGTQDDGVLLTGKRAREARV--SVAPEWSSK--DQ-NASASATFGTDSQHVT  221

Query  321   IETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKK  500
             +++ Y++D G   +TS S+GSPENTSS + CT  +  D+  SVCHSR QR+ G  +EDK+
Sbjct  222   VDS-YEKDFGV-GFTSTSLGSPENTSSPRPCTKATTADDHDSVCHSRPQRKAG--EEDKR  277

Query  501   KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  680
             K  GKSSVSTKRSRAAAIHNQSER                      TDKASMLDEVIEYL
Sbjct  278   KETGKSSVSTKRSRAAAIHNQSER----------------------TDKASMLDEVIEYL  315

Query  681   KQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAA  860
             KQLQAQV MMSRMN+ PMMFP           +  +  A MGM MGMGMG+       + 
Sbjct  316   KQLQAQVHMMSRMNIPPMMFP-----MTMQQQLQMSMMAPMGMGMGMGMGIGMGVMDMST  370

Query  861   AGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQS  1040
              GR NI GI  +L     +            W+ S DR+  AA++++MPDPL+AFLA QS
Sbjct  371   MGRPNITGISPVLPNPFVTMTP---------WDGSGDRL-QAASAAVMPDPLSAFLACQS  420

Query  1041  QPMTMDAYSRMAALYQQFQQAP  1106
             QP+TMDAYSRMAA+YQQ Q  P
Sbjct  421   QPITMDAYSRMAAMYQQMQHPP  442



>ref|XP_010258915.1| PREDICTED: transcription factor UNE10 isoform X1 [Nelumbo nucifera]
Length=491

 Score =   232 bits (591),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 237/389 (61%), Gaps = 57/389 (15%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWFD  G  A           ++TMDALVPC N   S  +      RV   +  VG+C+
Sbjct  131   VPWFDPRGTAAAQ---------SMTMDALVPCTNRTTSADDHCT---RVPEPNPGVGTCA  178

Query  183   GAGAATREAS--------------LARVGGAAAHDWSNRGADQMSMSGSATYGRDS--QQ  314
              A +   E+S              LA+      H     G+ + S+S SA++G+D+  Q 
Sbjct  179   IACSTRLESSSETGTLDRRLEQEALAKKRPRLEH-VPVEGSSKQSVSISASFGKDNSRQD  237

Query  315   VTIETTYDRDLGTEA-YTSASMGSPENTSS--DKQCTNKSN---DDNDHSVCHSRSQREI  476
             +T++T    +L TE  +TS S+GSPENTS+   +    KS    DD+D SV HSR ++E 
Sbjct  238   MTLDT---YELDTEVGFTSTSLGSPENTSTGHPRASYTKSTTMVDDHD-SVSHSRPEKES  293

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
             G + EDKK   GKSS+STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM
Sbjct  294   GFE-EDKKGQTGKSSISTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  352

Query  657   LDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvm  836
             LDEVIEYLKQLQAQVQMMSRM+M  MM P+      Q   M+  A   M M M MGMG M
Sbjct  353   LDEVIEYLKQLQAQVQMMSRMSMPHMMLPM---TMQQQLQMSMLAQMGMFMGMNMGMGTM  409

Query  837   dmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPL  1016
             DMNSV     R+NI G+P +LHP       +        W+ + DR+P  ++S+ MPDPL
Sbjct  410   DMNSVT----RNNIAGVPPVLHPNVLMTLPS--------WDGTGDRLP--SSSTTMPDPL  455

Query  1017  TAFLASQSQPMTMDAYSRMAALYQQFQQA  1103
             + FLA QSQP  MD Y+RM ALYQQ  Q+
Sbjct  456   STFLACQSQPNNMDTYNRMVALYQQLYQS  484



>ref|XP_008375804.1| PREDICTED: transcription factor UNE10 isoform X2 [Malus domestica]
Length=443

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 226/388 (58%), Gaps = 87/388 (22%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF---SGLVG  173
             V WFD H   A         S TVTMDALVPC N ++  ++    +  V G    +G+VG
Sbjct  119   VTWFDRHRAVATP-------STTVTMDALVPCRNQSDDPSSQMIESISVPGVISGTGMVG  171

Query  174   ------SCSGA-GAATRE---------ASLARVGGAAAHDWSNRGADQMSMSGSATYGRD  305
                   SCSGA GAAT +          SLARV      +WS+R     S+SGSAT+G D
Sbjct  172   CSTRVDSCSGATGAATHDDDTLLSGKGTSLARV--PETPEWSSRSQ---SVSGSATFGID  226

Query  306   SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
             SQ VT+++T                                            + E+G  
Sbjct  227   SQHVTLDST--------------------------------------------KGEVGDG  242

Query  486   DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             D+ KK+  GKSS+STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE
Sbjct  243   DDRKKRSTGKSSISTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  302

Query  666   VIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmN  845
             VIEYLKQLQAQVQM+SRMNM  +M P+AMQQ     M A      MGM MGMGMG+   N
Sbjct  303   VIEYLKQLQAQVQMISRMNMPTIMLPMAMQQLQMSMMAAAPRNMGMGMGMGMGMGMDMNN  362

Query  846   SVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAF  1025
                   GR +IPGIP +LH       +A     A+W     DR+P AA++ +MPDP++AF
Sbjct  363   -----IGRPSIPGIPPILH------PSAFMPMAASWDGTGGDRLP-AASTGVMPDPMSAF  410

Query  1026  LASQSQPMTMDAYSRMAALYQQFQQAPG  1109
             LA QSQPMTMDAYS MAA+YQQF Q P 
Sbjct  411   LACQSQPMTMDAYSMMAAMYQQFHQPPA  438



>ref|XP_010264312.1| PREDICTED: transcription factor UNE10-like [Nelumbo nucifera]
Length=463

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 192/378 (51%), Positives = 239/378 (63%), Gaps = 43/378 (11%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWF  HG  A            +TMDALVPCAN   S  +       V   + L    S
Sbjct  111   VPWFYPHGTIAAQP---------ITMDALVPCANRTTSTDDQSN---HVPEPNSLRPESS  158

Query  183   G-AGAA---TREASLAR-VGGAAAHDWSNRGADQMSMSGSATYGRDSQQ--VTIETTYDR  341
             G AG     T+E +L + +   A    ++  + + S+S SAT+GRDS +  +++  TY+ 
Sbjct  159   GEAGTVERRTKEVALTKKLARKALVPVTHERSSKQSVSISATFGRDSSRHDMSLIDTYEL  218

Query  342   DLGTEAYTSASMGSPENTSSDKQC--TNKSNDDNDH-SVCHSRSQREIGSDDEDKKKGNG  512
             D  T  +TS S+GSPENTS+ K     NK    +DH SVCHS SQRE    DED KK   
Sbjct  219   DPDT-GFTSNSLGSPENTSTGKPSGSYNKPTTVDDHDSVCHSGSQREPTGLDEDNKK---  274

Query  513   KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
             KS  S+KRSRAA IHN+SERKRRDKINQ++KTLQKLVPNSSKTDKASMLDEVIEYLKQLQ
Sbjct  275   KSFTSSKRSRAAEIHNESERKRRDKINQKLKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  334

Query  693   AQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRS  872
             AQVQMMSRM+M  MM P+      Q   M+  A   M M M MGMG+MD+NS+A    R 
Sbjct  335   AQVQMMSRMSMPHMMLPM---AMQQQFQMSMLAQMGMTMGMNMGMGMMDINSIA----RP  387

Query  873   NIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMT  1052
             NI GIP ++        +  FMP+++W  NS DR+P++   S+MPDPLT FL+ QS+P+T
Sbjct  388   NITGIPPVV-------PSGVFMPLSSWDNNSADRLPSSC--SIMPDPLTTFLSCQSKPIT  438

Query  1053  MDAY-SRMAALYQQFQQA  1103
             MD+Y SRMAALYQQ  Q+
Sbjct  439   MDSYSSRMAALYQQLHQS  456



>ref|XP_007217992.1| hypothetical protein PRUPE_ppa005629mg [Prunus persica]
 gb|EMJ19191.1| hypothetical protein PRUPE_ppa005629mg [Prunus persica]
Length=450

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 233/388 (60%), Gaps = 74/388 (19%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR---------VAG  155
             V WFDHH   A  +      S T+TMDALVPC N ++++++    +           V G
Sbjct  113   VSWFDHHRAAAVRSTEVTP-STTMTMDALVPCRNQSDNSSSHMMESMSMPVVISGSDVVG  171

Query  156   FSGLVGSCSGA-GAATRE---------ASLARVGGAAAHDWSNRGADQMSMSGSATYGRD  305
              S  V SCSGA GAAT++          SL+RV      +WS+R     S+SGSAT+G D
Sbjct  172   CSTGVESCSGATGAATQDDDTMLSGKHGSLSRV--PETPEWSSRSQ---SVSGSATFGMD  226

Query  306   SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
             S  VT+++T                             K++D +  SVCHSR QRE G +
Sbjct  227   SHPVTLDST-----------------------------KASDHD--SVCHSRPQREAGDE  255

Query  486   DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             D+ KK+  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE
Sbjct  256   DDRKKRSTGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  315

Query  666   VIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmN  845
             VIEYLK LQAQ+QM+SRMNM  M     +   +Q  +     AAA           MDMN
Sbjct  316   VIEYLKNLQAQIQMISRMNMPAM----MLPMAMQQQLQMSMMAAAPRNMGMGMGMGMDMN  371

Query  846   SVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAF  1025
             ++     R NIPGI  +LH        AAFMPMA+W  +  DR   +A++++MPDPL+AF
Sbjct  372   TMV----RPNIPGISPVLH-------PAAFMPMASWDGSGGDR---SASATVMPDPLSAF  417

Query  1026  LASQSQPMTMDAYSRMAALYQQFQQAPG  1109
             LA QSQPMTMDAYS MAA+YQQF Q P 
Sbjct  418   LACQSQPMTMDAYSMMAAMYQQFHQPPA  445



>ref|XP_009344081.1| PREDICTED: transcription factor UNE10 [Pyrus x bretschneideri]
Length=442

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 220/388 (57%), Gaps = 89/388 (23%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF---SGLVG  173
             V WFD H   A         S TVTMDALVPC N ++  ++    +  + G    +G+VG
Sbjct  120   VTWFDRHRAVATP-------STTVTMDALVPCRNQSDDPSSQMIESISMPGVISGAGMVG  172

Query  174   ------SCSGA-GAATRE---------ASLARVGGAAAHDWSNRGADQMSMSGSATYGRD  305
                   SCSG  GAAT +          SLARV      +WS+R     S+SGSAT+G D
Sbjct  173   CSTRVDSCSGTTGAATHDDDTLLSGKGTSLARV--PETPEWSSRSQ---SVSGSATFGID  227

Query  306   SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
             SQ VT+++T                             K++D +  SVCHSR Q E+G +
Sbjct  228   SQHVTLDST-----------------------------KASDYD--SVCHSRPQGEVGDE  256

Query  486   DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             D+ KK+  GKSS+STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE
Sbjct  257   DDRKKRSTGKSSISTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  316

Query  666   VIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmN  845
             VIEYLKQLQAQVQM+SRMNM  MM P+AMQQ                             
Sbjct  317   VIEYLKQLQAQVQMISRMNMPTMMLPMAMQQLQM--------------------------  350

Query  846   SVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAF  1025
             S+ AAA R+   G+   +               A+W     DR+P AA++ +MPD L+AF
Sbjct  351   SMMAAAPRNMGMGMGIGMGMGMDMNNIGRPARAASWDGTGGDRLP-AASTGVMPDHLSAF  409

Query  1026  LASQSQPMTMDAYSRMAALYQQFQQAPG  1109
             LA QSQPMTMDAYS MAA+YQQF Q P 
Sbjct  410   LACQSQPMTMDAYSMMAAMYQQFHQPPA  437



>ref|XP_009586992.1| PREDICTED: transcription factor UNE10 isoform X2 [Nicotiana tomentosiformis]
Length=445

 Score =   226 bits (575),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 201/375 (54%), Positives = 239/375 (64%), Gaps = 40/375 (11%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF++H   A         S+T+  DALVPC+ N+N +   P++  +V G  G   VGS
Sbjct  103   VPWFNYHHVVADTPLVPG--SLTMAKDALVPCSANSNYHRRPPSSV-QVPGLDGSTHVGS  159

Query  177   CSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTE  356
             CSGA       +   VG    H+ S+R    MS+SGSAT   DS+Q+T++T YDR++GT 
Sbjct  160   CSGATNNRDWMAAPLVGTEPTHEGSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGTG  216

Query  357   AYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
              YTS SMGSPENTSSDKQCTN++ DD+D SVCHSRS+RE+G D+ED+KKG+  SS STKR
Sbjct  217   MYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRSKREVG-DEEDEKKGSKNSSSSTKR  274

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms-  713
              RAAAIHNQSER                      TDKASMLDEVIEYLKQLQ+QV MMS 
Sbjct  275   KRAAAIHNQSER----------------------TDKASMLDEVIEYLKQLQSQVNMMSR  312

Query  714   rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSV-AAAAGRSNIPGIP  890
                   MM PLAMQQQLQMSMMA      MGM MGMGMG+     +      R NI G+P
Sbjct  313   MNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMGMGVAGVLDINTLSRPNITGLP  372

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  373   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  426

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQFQQ   G+
Sbjct  427   MAALYQQFQQPAAGS  441



>ref|XP_010258916.1| PREDICTED: transcription factor UNE10 isoform X2 [Nelumbo nucifera]
Length=490

 Score =   227 bits (578),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 234/389 (60%), Gaps = 58/389 (15%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWFD  G  A           ++TMDALVPC N   S  +      RV   +  VG+C+
Sbjct  131   VPWFDPRGTAAAQ---------SMTMDALVPCTNRTTSADDHCT---RVPEPNPGVGTCA  178

Query  183   GAGAATREAS--------------LARVGGAAAHDWSNRGADQMSMSGSATYGRDS--QQ  314
              A +   E+S              LA+      H     G+ + S+S SA++G+D+  Q 
Sbjct  179   IACSTRLESSSETGTLDRRLEQEALAKKRPRLEH-VPVEGSSKQSVSISASFGKDNSRQD  237

Query  315   VTIETTYDRDLGTEA-YTSASMGSPENTSS--DKQCTNKSN---DDNDHSVCHSRSQREI  476
             +T++T    +L TE  +TS S+GSPENTS+   +    KS    DD+D SV HSR   E 
Sbjct  238   MTLDT---YELDTEVGFTSTSLGSPENTSTGHPRASYTKSTTMVDDHD-SVSHSRP--EE  291

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
                +EDKK   GKSS+STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM
Sbjct  292   SGFEEDKKGQTGKSSISTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  351

Query  657   LDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvm  836
             LDEVIEYLKQLQAQVQMMSRM+M  MM P+      Q   M+  A   M M M MGMG M
Sbjct  352   LDEVIEYLKQLQAQVQMMSRMSMPHMMLPM---TMQQQLQMSMLAQMGMFMGMNMGMGTM  408

Query  837   dmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPL  1016
             DMNSV     R+NI G+P +LHP       +        W+ + DR+P  ++S+ MPDPL
Sbjct  409   DMNSVT----RNNIAGVPPVLHPNVLMTLPS--------WDGTGDRLP--SSSTTMPDPL  454

Query  1017  TAFLASQSQPMTMDAYSRMAALYQQFQQA  1103
             + FLA QSQP  MD Y+RM ALYQQ  Q+
Sbjct  455   STFLACQSQPNNMDTYNRMVALYQQLYQS  483



>ref|XP_004514235.1| PREDICTED: transcription factor UNE10-like [Cicer arietinum]
Length=488

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 217/379 (57%), Gaps = 38/379 (10%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGL-----  167
             VPW D     A            +TMDALVPC+N           +    G         
Sbjct  115   VPWLDPQRAAAISATTNG-----MTMDALVPCSNPTKEQRIQTMDSISRVGIGTYMVGGP  169

Query  168   --VGSCSGAGAATRE------ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTI  323
               VGSCS A AAT+E      A+  + G  A    S RG    S+SGS T+GR S+QVT+
Sbjct  170   TPVGSCSAAPAATQEEGALVVAAAVKRGRVAHVVGSGRG---QSVSGSGTFGRQSEQVTL  226

Query  324   ETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKK  503
             +T Y+R+ G   +TS S+ S +NTSS+KQCT  + DD+D SVCHSR   E  +D + KK+
Sbjct  227   DT-YEREFGMGGFTSTSIASLDNTSSEKQCTKTTVDDHD-SVCHSRPTME-DADVDAKKR  283

Query  504   GNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLK  683
              N KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNS+KTDKASMLDEVIEYLK
Sbjct  284   ENRKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSNKTDKASMLDEVIEYLK  343

Query  684   ----QLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSV  851
                 Q+Q   +      M PM     +Q  +   M         GM MG+GMG+    + 
Sbjct  344   NLQAQVQIVNRFNMSSMMMPMNMQQQLQMSIMNQMGMGMGMGMTGMPMGIGMGMGMDMNT  403

Query  852   AAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWE--NSLDRMPTAAASSMMPDPLTAF  1025
                A   NIPG+P +LHP+A    A+        W+   S DR+     ++ M DPL+  
Sbjct  404   MNRANIPNIPGMPPVLHPSAFMPMAS--------WDVGGSCDRLQGPPGATGMTDPLSTL  455

Query  1026  LASQSQPMTMDAYSRMAAL  1082
             L  QSQPM+MDAYSR+AA+
Sbjct  456   LGCQSQPMSMDAYSRIAAM  474



>ref|XP_009792482.1| PREDICTED: transcription factor UNE10 isoform X2 [Nicotiana sylvestris]
Length=445

 Score =   224 bits (570),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 197/375 (53%), Positives = 238/375 (63%), Gaps = 40/375 (11%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF+++   A          +T+  DALVPC+ N+N     P++  +V G  G   VGS
Sbjct  103   VPWFNYNHVVADTPLVPGL--LTMAKDALVPCSANSNYQNRPPSSV-QVPGLDGSTHVGS  159

Query  177   CSGAGAATRE-ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGT  353
             CS     +R+  ++ RV     H+WS+R    MS+SGSAT   DS+Q+T++T YDR++GT
Sbjct  160   CSTGATNSRDWMAVPRVRMEPTHEWSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGT  216

Query  354   EAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
               YTS SMGSPENTSSDKQCTN++ DD+D SVCHSRS+RE+G D+ED+KKG+  SS STK
Sbjct  217   GMYTSTSMGSPENTSSDKQCTNRTGDDHD-SVCHSRSKREVG-DEEDEKKGSKNSSSSTK  274

Query  534   RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms  713
             R RAAAIHNQSER                      TDKASMLDEVIEYLKQLQ+QV MMS
Sbjct  275   RKRAAAIHNQSER----------------------TDKASMLDEVIEYLKQLQSQVNMMS  312

Query  714   -rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIP  890
                    MM PLAMQQQLQMSMMA      MGM MGMGM  +          R NI G+P
Sbjct  313   RMNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMTGVAGVLDINTLSRPNITGLP  372

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  373   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  426

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQF Q+  G+
Sbjct  427   MAALYQQFLQSAAGS  441



>ref|XP_008232566.1| PREDICTED: transcription factor UNE10 [Prunus mume]
Length=456

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 224/392 (57%), Gaps = 72/392 (18%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR---------VAG  155
             V WFDHH   A  + A    S T+TMDALVPC N +++++N    +           V G
Sbjct  113   VSWFDHHRAAAVRSTAVTP-STTMTMDALVPCRNQSDNSSNHMMESMSMPVVISGSDVVG  171

Query  156   FSGLVGSCSGA-GAATRE---------ASLARVGGAAAHDWSNRGADQMSMSGSATYGRD  305
              S  V SCSGA GAAT++          SL+ V      +WS+R     S+SGSAT+G D
Sbjct  172   CSTRVESCSGATGAATQDDDTKLSGKHGSLSSV--PETPEWSSRSQ---SVSGSATFGMD  226

Query  306   SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
             +Q VT+++T                             K++D +  SVCHSR QRE G +
Sbjct  227   NQPVTLDST-----------------------------KASDHD--SVCHSRPQREAGDE  255

Query  486   DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             D+ KK+  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE
Sbjct  256   DDRKKRSTGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  315

Query  666   VIEYLKQLQA--QVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmd  839
             VIEYLK LQA  Q+     M    +   +  Q Q+ M   AP                MD
Sbjct  316   VIEYLKNLQAQIQMMSRMNMPAMMLPMAMQQQLQMSMMAAAPRNMGMGMGMGMGMGMGMD  375

Query  840   mNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLT  1019
             MN++     R NIPGI  +LHP A    A+       W  +  DR   +A++++MPDPL+
Sbjct  376   MNTMV----RPNIPGISPVLHPTAFMPMAS-------WDGSGGDR---SASATVMPDPLS  421

Query  1020  AFLASQSQPMTMDAYSRMAALYQQFQQAPGGT  1115
             AFLA QSQPMTMDAYS MAA+YQQF Q P  +
Sbjct  422   AFLACQSQPMTMDAYSMMAAMYQQFHQPPASS  453



>gb|EYU31942.1| hypothetical protein MIMGU_mgv1a026423mg [Erythranthe guttata]
Length=487

 Score =   222 bits (565),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 194/393 (49%), Positives = 239/393 (61%), Gaps = 59/393 (15%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaa---aSVTVTMDALVPCannnnsntntpaataR---------  146
             VPW DHH   A    AA     ASVT+TMDALVPC N N   +                 
Sbjct  115   VPWIDHHRAVANHAGAARTDADASVTMTMDALVPCNNGNLRRSTHENQERHSMRLPLGPA  174

Query  147   VAGFSG---LVGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSAT-YGRD-SQ  311
             VAG  G   +VGSCSGAG            G       N     +S+SGSAT +G D S+
Sbjct  175   VAGNGGGTCMVGSCSGAGIPR--------AGIKRRSCRNDDDRSVSVSGSATCWGSDGSR  226

Query  312   QVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRS-----QREI  476
             Q+T++T ++R+ G    ++ S+ SPE T        +++DD D SVCHS S     +R++
Sbjct  227   QLTVDT-WEREFGGGFTSATSLASPEYT--------RTSDDRDDSVCHSISHQTCHERKL  277

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
               ++  K+KGN +SSVSTKR+RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK+DKASM
Sbjct  278   -EEETGKRKGNRESSVSTKRNRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKSDKASM  336

Query  657   LDEVIEYLKQLQAQVQmmsrmnmsp-mmFPLamqqqlqmsmmapaaaaamgmnmgmgmgv  833
             LDEVIE+LKQLQ Q+ +MSRMNM+  MM PLAMQ Q Q           MGM MGMG+ V
Sbjct  337   LDEVIEHLKQLQGQLSIMSRMNMTSPMMLPLAMQHQQQQLHQLSMMGMGMGMGMGMGVNV  396

Query  834   mdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWE--NSLDRMPTAAASSMMP  1007
             MD+N++  AA  +   G+P ++HP+AA             W+  N  D +P A       
Sbjct  397   MDINAITLAAAAAAAAGMPPVIHPSAAFNKP---------WDSRNPGDCLPPA-------  440

Query  1008  DPLTAFLASQSQPMTMDAYSRMAALYQQFQQAP  1106
             DPL+AFLA QSQPMTMDAYSRMAALYQQ+Q  P
Sbjct  441   DPLSAFLACQSQPMTMDAYSRMAALYQQYQLQP  473



>gb|KDO85692.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
Length=411

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 156/229 (68%), Gaps = 24/229 (10%)
 Frame = +3

Query  72   VTMDALVPCannnnsntntpaa--taRVAGFSGL-VGSCSGAGAAT-------------R  203
             TMDALVPC+N  +    T       RV G   + VGSCSG                  +
Sbjct  69   TTMDALVPCSNRRSEERTTQVMDPAPRVGGTRSIRVGSCSGPVPLPIPDSTKDDDVLNGK  128

Query  204  EASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTI-ETTYDRDLGT-EAYTSASM  377
             A +ARV    A +WS+R  DQ S SGSAT+GR+SQ+V++   TYD D+     +T  SM
Sbjct  129  RARVARV--PVAPEWSSR--DQ-SFSGSATFGRESQRVSVTHDTYDMDMDMGVGFTGTSM  183

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            GSPENTSS KQ    +  D+  SVCHSR  RE G D+E KKKGNGKS++STKRSRAAAIH
Sbjct  184  GSPENTSSAKQGNKATTADDHDSVCHSRPLREAG-DEEYKKKGNGKSTISTKRSRAAAIH  242

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  243  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  291



>gb|KDO85687.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
Length=438

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 156/229 (68%), Gaps = 24/229 (10%)
 Frame = +3

Query  72   VTMDALVPCannnnsntntpaa--taRVAGFSGL-VGSCSGAGAAT-------------R  203
             TMDALVPC+N  +    T       RV G   + VGSCSG                  +
Sbjct  122  TTMDALVPCSNRRSEERTTQVMDPAPRVGGTRSIRVGSCSGPVPLPIPDSTKDDDVLNGK  181

Query  204  EASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTI-ETTYDRDLGTEA-YTSASM  377
             A +ARV    A +WS+R  DQ S SGSAT+GR+SQ+V++   TYD D+     +T  SM
Sbjct  182  RARVARV--PVAPEWSSR--DQ-SFSGSATFGRESQRVSVTHDTYDMDMDMGVGFTGTSM  236

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            GSPENTSS KQ    +  D+  SVCHSR  RE G D+E KKKGNGKS++STKRSRAAAIH
Sbjct  237  GSPENTSSAKQGNKATTADDHDSVCHSRPLREAG-DEEYKKKGNGKSTISTKRSRAAAIH  295

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  296  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  344



>ref|XP_006445332.1| hypothetical protein CICLE_v10020053mg [Citrus clementina]
 ref|XP_006490847.1| PREDICTED: transcription factor UNE10-like [Citrus sinensis]
 gb|ESR58572.1| hypothetical protein CICLE_v10020053mg [Citrus clementina]
 gb|KDO85686.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
Length=464

 Score =   219 bits (557),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 156/229 (68%), Gaps = 24/229 (10%)
 Frame = +3

Query  72   VTMDALVPCannnnsntntpaa--taRVAGFSGL-VGSCSGAGAAT-------------R  203
             TMDALVPC+N  +    T       RV G   + VGSCSG                  +
Sbjct  122  TTMDALVPCSNRRSEERTTQVMDPAPRVGGTRSIRVGSCSGPVPLPIPDSTKDDDVLNGK  181

Query  204  EASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTI-ETTYDRDLGTEA-YTSASM  377
             A +ARV    A +WS+R  DQ S SGSAT+GR+SQ+V++   TYD D+     +T  SM
Sbjct  182  RARVARV--PVAPEWSSR--DQ-SFSGSATFGRESQRVSVTHDTYDMDMDMGVGFTGTSM  236

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            GSPENTSS KQ    +  D+  SVCHSR  RE G D+E KKKGNGKS++STKRSRAAAIH
Sbjct  237  GSPENTSSAKQGNKATTADDHDSVCHSRPLREAG-DEEYKKKGNGKSTISTKRSRAAAIH  295

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  296  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  344



>ref|XP_009762879.1| PREDICTED: transcription factor UNE10-like [Nicotiana sylvestris]
Length=505

 Score =   214 bits (545),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 169/269 (63%), Gaps = 12/269 (4%)
 Frame = +3

Query  306   SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
             SQ+  I+T+ +RDLG E +TS SM S E TSS KQC +K+ D++D S CH+RSQR    D
Sbjct  242   SQRDNIDTS-ERDLGAEKFTSTSMSSVEKTSSVKQCNSKTVDEHD-STCHNRSQRPEAGD  299

Query  486   DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             ++DKKK +  SS STKRSRAAA HNQSERKRRD+INQRMKTLQKLVP SSKT+KASMLDE
Sbjct  300   EDDKKKRSKISSFSTKRSRAAATHNQSERKRRDRINQRMKTLQKLVPYSSKTNKASMLDE  359

Query  666   VIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmN  845
             VIEYLKQLQAQVQ MSRMN +     L     +Q         + M              
Sbjct  360   VIEYLKQLQAQVQAMSRMNNNMSPMMLPNMAIMQQQQQQHLQMSMMASMGMGMGMA----  415

Query  846   SVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAA-SSMMPDPLTA  1022
                 A    NI  +P LLHP A+       +        S DR   AA+ SS++PDPL A
Sbjct  416   GFNGALSHPNITAMPSLLHPTASFMPIPTGVS-----PGSGDRNINAASTSSLVPDPLAA  470

Query  1023  FLASQSQPMTMDAYSRMAALYQQFQQAPG  1109
             F   QSQPM MDAYSR+AALYQQ+ Q P 
Sbjct  471   FRTCQSQPMNMDAYSRIAALYQQYLQPPA  499



>ref|XP_004289799.1| PREDICTED: transcription factor UNE10-like [Fragaria vesca subsp. 
vesca]
Length=454

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 177/394 (45%), Positives = 210/394 (53%), Gaps = 91/394 (23%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             V WFDHH   A         S TVTMDALVPC NN +   N+      +    G++GS +
Sbjct  113   VTWFDHHRSVATSGAP----SNTVTMDALVPCRNNQSDEPNSSHLIDSLVSVPGVLGSSA  168

Query  183   GAG----AATR--------------------EASLARVGGAAAHDWSNRGADQMSMSGSA  290
             G G     +TR                     AS+ARV   +  +W++R     S+SGSA
Sbjct  169   GTGLINGCSTRVGSCSVAAAHGENTRRMEKHAASVARV--PSTPEWNSRSP---SVSGSA  223

Query  291   TYGRDSQQVTIETT-YDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQ  467
             T+G DSQQVT++T   DRD                                 S CHSR Q
Sbjct  224   TFGLDSQQVTLDTKGSDRD---------------------------------SACHSRLQ  250

Query  468   REIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  647
             RE    +E KK+  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK
Sbjct  251   REASDQEERKKRCTGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  310

Query  648   ASMLDEVIEYLKQLQAQ---VQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmg  818
             ASMLDEVIEYLKQLQAQ   +  M+   M   M      Q   M+         MGM MG
Sbjct  311   ASMLDEVIEYLKQLQAQVHVISRMNMPAMMLPMAMQQQLQMSMMAPRNMGMGIGMGMGMG  370

Query  819   mgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASS  998
             M    MDMN++A      NI G+P +LHP A  A   +       W+ S      A  + 
Sbjct  371   MPGIGMDMNNIALP----NIAGVPPVLHPTAFMAPMTS-------WDGS------AGGA-  412

Query  999   MMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
                DPL+A+LA QSQPM+M+AYS MAA+YQQF Q
Sbjct  413   ---DPLSAYLACQSQPMSMEAYSMMAAMYQQFHQ  443



>ref|XP_011093295.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor UNE10-like 
[Sesamum indicum]
Length=468

 Score =   211 bits (537),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 180/258 (70%), Gaps = 20/258 (8%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR---------VAG  155
            VPWFD H     +   A+A S+TVTMDALVPC NN+    +     +          V G
Sbjct  116  VPWFDPHRAAIVNPATASA-SITVTMDALVPCNNNSICRNDNNQENSAHVLEGIGTCVVG  174

Query  156  FSGLVGSCSGAGAATREAS-LARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETT  332
             S  VGSCS A  AT     +ARVG  +    +N  A + +  G    GRDS+Q+T++T 
Sbjct  175  CSTRVGSCSAAAVATDGGDRVARVGVCSCK--ANASASESATCG----GRDSRQLTLDTC  228

Query  333  YDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG  512
             +R+LG   +TS S+ SPENTSS K+ T  S DD+D SVCHSRSQR+   D+E KKKG+G
Sbjct  229  -ERELGGGGFTSTSLWSPENTSSGKEYTKTSADDHD-SVCHSRSQRD-AFDEEGKKKGSG  285

Query  513  KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
            KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQ
Sbjct  286  KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQ  345

Query  693  AQVQmmsrmnmspmmFPL  746
            AQVQMMSRMNM  MM PL
Sbjct  346  AQVQMMSRMNMPSMMLPL  363


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = +3

Query  954   WENSLDRMPTAAASSMMPDPLTA-FLASQSQPMTMDAYSRMAALYQQFQQAP  1106
             W+   DR+P+ A   ++PD L+A  LA QSQPMT+D YSR+AAL+QQFQQ P
Sbjct  417   WDIQGDRLPSPA---VVPDFLSAALLACQSQPMTIDGYSRLAALFQQFQQPP  465



>ref|XP_010426522.1| PREDICTED: transcription factor UNE10-like [Camelina sativa]
Length=401

 Score =   209 bits (531),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 208/368 (57%), Gaps = 69/368 (19%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF-SGLVGSC  179
             VPWF H                 + MDALVPC+N     +       +  G  S  VGSC
Sbjct  93    VPWFHHRSSR-----------AAMAMDALVPCSNLQEQQS-------KPGGVGSTRVGSC  134

Query  180   SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
             S  G        ARV    A +WS  G+ +++M                 TYD       
Sbjct  135   SD-GRTMAGGKRARV----APEWSGSGSQRLTMD----------------TYD-----VG  168

Query  360   YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
             +TS SMGSP+NT           DD+D SVCHSR Q E    DE++KKG GKSSVSTKRS
Sbjct  169   FTSTSMGSPDNTI----------DDHD-SVCHSRPQME----DEEEKKGGGKSSVSTKRS  213

Query  540   RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrm  719
             RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV MMSRM
Sbjct  214   RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSRM  273

Query  720   nmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmd-mNSVAAAAGRSNIPGIPGL  896
             NM  MM P+A+QQQ Q+ M   +    +G+ MGM    +  +NS+  AA  +  P I   
Sbjct  274   NMPSMMLPMALQQQQQLQMSLMSNPMGLGIGMGMPGLGLLDLNSMNRAASPAATPNI---  330

Query  897   LHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMA  1076
                A         M   +W  +S D   T   S ++PDP+ AFLA  SQP TM+AYSRMA
Sbjct  331   --HANMMPNPFVPMTSPSWDASSND---TRFQSPLIPDPMAAFLACSSQPTTMEAYSRMA  385

Query  1077  ALYQQFQQ  1100
             ALYQQ Q 
Sbjct  386   ALYQQMQH  393



>ref|XP_009609287.1| PREDICTED: transcription factor UNE10-like [Nicotiana tomentosiformis]
Length=495

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 209/387 (54%), Gaps = 56/387 (14%)
 Frame = +3

Query  63    SVTVTMDALVPCannnnsntntpaataRVAGFSG-LVGS----CSGAGAATR---EASLA  218
             +V+V MDALVP   +  +          V G +  L+G      S +G   R   E S A
Sbjct  131   TVSVAMDALVPSFAHPQNFHQGEQLPTHVPGITTCLIGDSTHVISRSGDVNRTDGEMSRA  190

Query  219   RVGGAAAHDWSN-------RGADQM---------------SMSGSATYGRDSQQVTIETT  332
             ++G ++  + S         G  ++               SM+  +   RD    TI+T 
Sbjct  191   KIGASSYEEISKDLEITEYFGKQEVKNLINEKHIDAVLLRSMADPSMSRRD----TIDTG  246

Query  333   YDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG  512
              +RDL  E +TS S+ S ENTSS K+CT+K  D++D SVCHSRS R+   D +DK+KG+ 
Sbjct  247   -ERDLVAERFTSTSVMSTENTSSVKKCTSKRVDEHD-SVCHSRSHRQETGDGDDKRKGSK  304

Query  513   KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
              SS STKRS +A  HNQSERKRRDKINQRMKTLQKLVPNSSKT+KASMLDEVIEYLKQLQ
Sbjct  305   ISSFSTKRSLSAVTHNQSERKRRDKINQRMKTLQKLVPNSSKTNKASMLDEVIEYLKQLQ  364

Query  693   AQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRS  872
             AQVQ MS MN +    P+     +         A+      G            A   R 
Sbjct  365   AQVQAMSGMNNNMS--PMLANMAVLQQQQQLQMASMGMGMAGFMHIN------GALISRP  416

Query  873   NIPG--IPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQP  1046
             NI    +P LLHP A++    A            DR   AA  S++PDPL AF   QSQP
Sbjct  417   NITAMPMPSLLHPTASNFMPIASGVSPG------DRNINAA--SLVPDPLAAFPTCQSQP  468

Query  1047  MTMDAYSRMAALYQQFQQAPG--GTKN  1121
             M MDAYSR+AALYQQ+ Q P   G KN
Sbjct  469   MNMDAYSRIAALYQQYLQPPANLGFKN  495



>ref|XP_010089247.1| Transcription factor UNE10 [Morus notabilis]
 gb|EXB37572.1| Transcription factor UNE10 [Morus notabilis]
Length=493

 Score =   202 bits (514),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 225/399 (56%), Gaps = 64/399 (16%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRV-AGFSGL----  167
             VPWFD        +  AAAA++T  MDA VPC+N ++ + +  +      AG  G+    
Sbjct  128   VPWFD-------HHHNAAAAAMTTNMDAQVPCSNRHHHHNDVVSRRPSARAGGGGVNIGS  180

Query  168   ----VGSCSGAG--------AATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQ  311
                 V SCSGA         AA ++   ARV      +WS  G      SGS        
Sbjct  181   LYTQVSSCSGAATRDENNNAAAGQQMKRARVAARVPPEWSVSGT-----SGS-------H  228

Query  312   QVTI-ETTYDRDLGTEAYTSASMGSPENTSSDK------QCTNKSNDDNDHSVCHSRSQ-  467
             QVT+ + + +RD G    TS S+GSPEN SS K        T  + DD+D SVCHSR Q 
Sbjct  229   QVTMDQYSCERDFGVGFMTSTSLGSPENASSGKPSTKAATATTTAADDHD-SVCHSRLQA  287

Query  468   REIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  647
              +   ++EDKKKG+GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK
Sbjct  288   SDEEEEEEDKKKGSGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  347

Query  648   ASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgm  827
             ASMLDEVI+YLKQLQAQVQMMSRMNM  MM P+        +M      + M        
Sbjct  348   ASMLDEVIDYLKQLQAQVQMMSRMNMPAMMLPV--------AMQQQLQLSMMSHMGMGMG  399

Query  828   gvmdmNSVAAAAGRSNIPGI-PGLLHpaaasaaaaafmpmaaWWENS--LDRMPTAAASS  998
               M M       GR N+ GI P +LHP      A         W+ S  +D       ++
Sbjct  400   MGMGMGMDMNTMGRPNLHGISPAVLHPNPFMTMAQ--------WDGSGTVDGRLQPQMAA  451

Query  999   MMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAPGGT  1115
             ++PDPL+ F A QSQPMT +AYSRM A+YQQ  Q P  +
Sbjct  452   VIPDPLSQFFACQSQPMTTEAYSRMVAMYQQLHQPPASS  490



>gb|KGN46559.1| hypothetical protein Csa_6G108570 [Cucumis sativus]
Length=485

 Score =   199 bits (507),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 222/399 (56%), Gaps = 64/399 (16%)
 Frame = +3

Query  3     VPWF-DHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSC  179
             VPWF DHH      +          T DA+VPC    ++          V G  G   S 
Sbjct  125   VPWFSDHHRQTPTAS----------TADAMVPCDGEKSAT---------VGG--GGDKSS  163

Query  180   SGAGAATREASLARV-----GGAAAH------DWSNRGADQMSMSGSATYGRDSQQVTIE  326
                 AA +E    RV     G   A       +WS+   +Q+S+SG+   G   Q+VT+ 
Sbjct  164   DIPVAARKEDEDCRVIHGKRGKVVARVVHAEGEWSS-CRNQISVSGNRESG---QKVTLN  219

Query  327   TTYDRDL-------GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH---SVCHSRSQREI  476
             ++ DR+        G  A T+ S GS +NTSSDK C   +         SVCHS  Q E 
Sbjct  220   SSRDRNFVAVDVSVGFTATTATSQGSLDNTSSDKPCVKNTTVTTTDDHDSVCHSTHQVE-  278

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
               D+ D+KK N KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNS+KTDKASM
Sbjct  279   EEDEGDRKKENAKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSNKTDKASM  338

Query  657   LDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvm  836
             LDEVIEYLKQLQAQVQMMSRMNM  M   L M  Q Q+SM    A   +GM MG     +
Sbjct  339   LDEVIEYLKQLQAQVQMMSRMNMPMM---LPMAMQQQLSMAPLMAPMGLGMGMGGMGMPL  395

Query  837   dmNSVAAAAGRSNI-PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDP  1013
              M+ +   AGRS +  G+  LLHP A              W+   D++   + ++M+ DP
Sbjct  396   GMDHLNMMAGRSGLTAGMSPLLHPTAFMPIPT--------WDGGTDQL-QHSPTTMVADP  446

Query  1014  LTAFLASQSQPMTMDAYSRMAALYQQFQQ---APGGTKN  1121
              + FLA Q QPMTM+AY+R+A ++QQ  Q     GG+KN
Sbjct  447   FSTFLACQQQPMTMEAYNRIATMFQQLHQHTPTVGGSKN  485



>ref|XP_010419529.1| PREDICTED: transcription factor UNE10-like [Camelina sativa]
Length=399

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 195/396 (49%), Gaps = 127/396 (32%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF-SGLVGSC  179
             VPWF H                 + MDALVPC+N     +       +  G  S  VGSC
Sbjct  93    VPWFHHRSSR-----------AAMAMDALVPCSNLQEQQS-------KPGGVGSTRVGSC  134

Query  180   SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
             S  G        ARV    A +WS  G               SQ++T++T YD       
Sbjct  135   SD-GRTMAGGKRARV----APEWSGSG---------------SQRLTMDT-YD-----VG  168

Query  360   YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
             +TS SMGSP+NT           DD+D SVCHSR   E    DE++KKG GKSSVSTKRS
Sbjct  169   FTSTSMGSPDNTI----------DDHD-SVCHSRPLME----DEEEKKGGGKSSVSTKRS  213

Query  540   RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrm  719
             RAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQAQV MMSRM
Sbjct  214   RAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSRM  273

Query  720   nmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLL  899
             NM  MM P+                             +  N +    G   +PG+ GLL
Sbjct  274   NMPSMMLPM------------------ALQQQQQLQMSLMSNPMGLGIGM-GMPGL-GLL  313

Query  900   HpaaasaaaaafmpmaaWWENSLDRMPTAAA---SSMMPDP-------------------  1013
                                 NS++R   A     ++MMP+P                   
Sbjct  314   DL------------------NSMNRAAAATPNIHANMMPNPFAPMTSPSWDASSNDTRFQ  355

Query  1014  -------LTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
                    + AFLA  SQP TM+AYSRMAALYQQ QQ
Sbjct  356   SPLIPDPMAAFLACSSQPTTMEAYSRMAALYQQMQQ  391



>ref|XP_010456327.1| PREDICTED: transcription factor UNE10 [Camelina sativa]
Length=399

 Score =   195 bits (495),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 166/396 (42%), Positives = 193/396 (49%), Gaps = 127/396 (32%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF-SGLVGSC  179
             VPWF H                 + MDALVPC+N     +       +  G  S  VGSC
Sbjct  93    VPWFHHRSSR-----------AAMAMDALVPCSNLQEQQS-------KPGGVGSTRVGSC  134

Query  180   SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
             S  G        ARV    A +WS  G+ +++M                 TYD       
Sbjct  135   SD-GRTMAGGKRARV----APEWSGSGSQRLTMD----------------TYD-----VG  168

Query  360   YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
             +TS SMGSP+NT           DD+D SVCHSR   E    DE++KKG GKSSVSTKRS
Sbjct  169   FTSTSMGSPDNTI----------DDHD-SVCHSRPLME----DEEEKKGGGKSSVSTKRS  213

Query  540   RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrm  719
             RAAAIHNQSERKRRDKINQRMKTLQK+VPNSSKTDKASMLDEVIEYLKQLQAQV MMSRM
Sbjct  214   RAAAIHNQSERKRRDKINQRMKTLQKMVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSRM  273

Query  720   nmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLL  899
             NM  MM P+                             +  N +    G   +PG+ GLL
Sbjct  274   NMPSMMLPM------------------ALQQQQQLQMSLMSNPMGLGIGM-GMPGL-GLL  313

Query  900   HpaaasaaaaafmpmaaWWENSLDRMPTAAA---SSMMPDP-------------------  1013
                                 NS++R   A     ++MMP+P                   
Sbjct  314   DL------------------NSMNRAAAATPNIHANMMPNPFAPMTSPSWDASSNDTRFQ  355

Query  1014  -------LTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
                    + AFLA  SQP TM+AYSRMAALYQQ QQ
Sbjct  356   SPLIPDPMAAFLACSSQPTTMEAYSRMAALYQQMQQ  391



>ref|XP_004140610.1| PREDICTED: transcription factor UNE10-like [Cucumis sativus]
Length=478

 Score =   194 bits (494),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 219/399 (55%), Gaps = 71/399 (18%)
 Frame = +3

Query  3     VPWF-DHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSC  179
             VPWF DHH      +          T DA+VPC    ++          V G  G   S 
Sbjct  125   VPWFSDHHRQTPTAS----------TADAMVPCDGEKSAT---------VGG--GGDKSS  163

Query  180   SGAGAATREASLARV-----GGAAAH------DWSNRGADQMSMSGSATYGRDSQQVTIE  326
                 AA +E    RV     G   A       +WS+   +Q+S+SG+   G   Q+VT+ 
Sbjct  164   DIPVAARKEDEDCRVIHGKRGKVVARVVHAEGEWSS-CRNQISVSGNRESG---QKVTLN  219

Query  327   TTYDRDL-------GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH---SVCHSRSQREI  476
             ++ DR+        G  A T+ S GS +NTSSDK C   +         SVCH       
Sbjct  220   SSRDRNFVAVDVSVGFTATTATSQGSLDNTSSDKPCVKNTTVTTTDDHDSVCHK------  273

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
               D+ D+KK N KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNS+KTDKASM
Sbjct  274   --DEGDRKKENAKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSNKTDKASM  331

Query  657   LDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvm  836
             LDEVIEYLKQLQAQVQMMSRMNM  M   L M  Q Q+SM    A   +GM MG     +
Sbjct  332   LDEVIEYLKQLQAQVQMMSRMNMPMM---LPMAMQQQLSMAPLMAPMGLGMGMGGMGMPL  388

Query  837   dmNSVAAAAGRSNI-PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDP  1013
              M+ +   AGRS +  G+  LLHP A              W+   D++   + ++M+ DP
Sbjct  389   GMDHLNMMAGRSGLTAGMSPLLHPTAFMPIPT--------WDGGTDQL-QHSPTTMVADP  439

Query  1014  LTAFLASQSQPMTMDAYSRMAALYQQFQQ---APGGTKN  1121
              + FLA Q QPMTM+AY+R+A ++QQ  Q     GG+KN
Sbjct  440   FSTFLACQQQPMTMEAYNRIATMFQQLHQHTPTVGGSKN  478



>ref|XP_004164979.1| PREDICTED: transcription factor UNE10-like [Cucumis sativus]
Length=478

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 219/399 (55%), Gaps = 71/399 (18%)
 Frame = +3

Query  3     VPWF-DHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSC  179
             VPWF DHH      +          T DA+VPC    ++          V G  G   S 
Sbjct  125   VPWFSDHHRQTPTAS----------TADAMVPCDGEKSAT---------VGG--GGDKSS  163

Query  180   SGAGAATREASLARV-----GGAAAH------DWSNRGADQMSMSGSATYGRDSQQVTIE  326
                 AA +E    RV     G   A       +WS+   +Q+S+SG+   G   Q+VT+ 
Sbjct  164   DIPVAARKEDEDCRVIHGKRGKVVARVVHAEGEWSS-CRNQISVSGNRESG---QKVTLN  219

Query  327   TTYDRDL-------GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH---SVCHSRSQREI  476
             ++ DR+        G  A T+ S GS +NTSSDK C   +         SVCH       
Sbjct  220   SSRDRNFVAVDVSVGFTATTATSQGSLDNTSSDKPCVKNTTVTTTDDHDSVCHK------  273

Query  477   GSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
               D+ D+KK N KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNS+KTDKASM
Sbjct  274   --DEGDRKKENAKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSNKTDKASM  331

Query  657   LDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvm  836
             LDEVIEYLKQLQAQVQMMSRMNM  M   L +  Q Q+SM    A   +GM MG     +
Sbjct  332   LDEVIEYLKQLQAQVQMMSRMNMPMM---LPIAMQQQLSMAPLMAPMGLGMGMGGMGMPL  388

Query  837   dmNSVAAAAGRSNI-PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDP  1013
              M+ +   AGRS +  G+  LLHP A              W+   D++   + ++M+ DP
Sbjct  389   GMDHLNMMAGRSGLTAGMSPLLHPTAFMPIPT--------WDGGTDQL-QHSPTTMVADP  439

Query  1014  LTAFLASQSQPMTMDAYSRMAALYQQFQQ---APGGTKN  1121
              + FLA Q QPMTM+AY+R+A ++QQ  Q     GG+KN
Sbjct  440   FSTFLACQQQPMTMEAYNRIATMFQQLHQHTPTVGGSKN  478



>ref|XP_008459727.1| PREDICTED: transcription factor UNE10 [Cucumis melo]
Length=490

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 175/393 (45%), Positives = 219/393 (56%), Gaps = 52/393 (13%)
 Frame = +3

Query  6     PWF-DHHgggagdnpaaaaaSVTVTMDALVPCan-nnnsntntpaataRVAGFSGLVGSC  179
             PWF DHH             +   T DA+VPC    + +   + A ++ +   +      
Sbjct  129   PWFSDHHRQT----------TTASTADAMVPCDGDKSATAGGSAAKSSDIPVVAREEDED  178

Query  180   SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL----  347
              G     R   +ARV  A+  +WS    +Q+S+SG+   G   Q+VT+ +T  R+     
Sbjct  179   CGVIHGKRGRVVARVVHASG-EWST-CRNQISVSGNRESG---QKVTLNSTRVRNFAAVD  233

Query  348   ---GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH---SVCHSRSQREIGSDDEDKKKGN  509
                G  A T+ S GS +NT+SDK C   +         SVCHS  Q E   D+ D+KK N
Sbjct  234   GSVGFTATTATSQGSLDNTTSDKPCVKNTTVTTTDDHDSVCHSTHQVE-EEDEGDRKKEN  292

Query  510   GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
              KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNS+KTDKASMLDEVIEYLKQL
Sbjct  293   AKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSNKTDKASMLDEVIEYLKQL  352

Query  690   QAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGR  869
             QAQVQMMSRMNM  M   L M  Q Q+SM    A   +GM MG     + M+ +   AGR
Sbjct  353   QAQVQMMSRMNMPMM---LPMAMQQQLSMAPLMAPMGLGMGMGGMGMPLGMDHLNMLAGR  409

Query  870   SNI-PGIPGLLHpaaasaaaaafmpmaaWWE-----NSLDRMPTAAASSMMPDPLTAFLA  1031
             S +  G+  LLHP A              W+     + L   PT    +M+ DP + FLA
Sbjct  410   SGLTAGMSPLLHPTAFMPIPT--------WDGGTCTDQLQHSPT----TMVADPFSTFLA  457

Query  1032  SQSQPMTMDAYSRMAALYQQFQQ---APGGTKN  1121
              Q QPMTM+AY+R+A + QQ  Q     GG+KN
Sbjct  458   CQQQPMTMEAYNRIATMLQQLHQHTPTVGGSKN  490



>ref|XP_006386559.1| hypothetical protein POPTR_0002s14430g [Populus trichocarpa]
 gb|ERP64356.1| hypothetical protein POPTR_0002s14430g [Populus trichocarpa]
Length=335

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 141/236 (60%), Gaps = 33/236 (14%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR--------VAGF  158
            VPWF+HH   A         S T+TMDALVPC+  ++    T    +         V G 
Sbjct  113  VPWFNHHRASA---------SATMTMDALVPCSKRSDQERTTRVIDSSPAGLGTDCVVGC  163

Query  159  SGLVGSCSGAGAATREASL--------ARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQ  314
            S  VGSCS   A   E  L        ARV   A  +WS    DQ    G+    +DSQQ
Sbjct  164  STRVGSCSAPTATQNEVGLLTRKREKVARVPVPA--EWSR---DQSVNRGATFSKKDSQQ  218

Query  315  VTIETTYDRDLGTEAYTSASMGSPENTSS-DKQCTNKSNDDNDHSVCHSRSQREIGSDDE  491
            VT+++  +R+LG    ++ S GS ENTSS  K CT  +  D + SVCHSR QRE G D++
Sbjct  219  VTVDSC-ERELGVGFTSTTSFGSQENTSSGTKPCTKTNTADENDSVCHSRPQREAG-DED  276

Query  492  DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASML  659
            DKKKGNGKSSVS +RSRAAA+HNQSERKRRDKINQRMKTLQKLVPNSSK  K S +
Sbjct  277  DKKKGNGKSSVSNRRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSSKVRKVSSV  332



>emb|CBI16590.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 153/213 (72%), Gaps = 18/213 (8%)
 Frame = +3

Query  483   DDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
             D+EDKK+G GKSSVS+KRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD
Sbjct  9     DEEDKKRGTGKSSVSSKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  68

Query  663   EVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdm  842
             EVIEYLKQLQAQVQMM+RMNMSPMM    M  Q Q+ M   A          MGMGV+DM
Sbjct  69    EVIEYLKQLQAQVQMMNRMNMSPMMM--PMTLQQQLQMSLMAQMGMGMGMSPMGMGVVDM  126

Query  843   NSVAAAAGRSNIP--GIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPL  1016
             N++A    R N+   GI  LLHP       +        W+ S DR+P  AA +M+PDPL
Sbjct  127   NTIA----RPNVATTGISPLLHPTPFLPLTS--------WDVSGDRLP--AAPTMVPDPL  172

Query  1017  TAFLASQSQPMTMDAYSRMAALYQQFQQAPGGT  1115
              AFLA QSQPMTMDAYSRMAALYQ   Q P  +
Sbjct  173   AAFLACQSQPMTMDAYSRMAALYQHLHQHPASS  205



>ref|XP_006838180.1| hypothetical protein AMTR_s00106p00127480 [Amborella trichopoda]
 gb|ERN00749.1| hypothetical protein AMTR_s00106p00127480 [Amborella trichopoda]
Length=487

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 166/269 (62%), Gaps = 27/269 (10%)
 Frame = +3

Query  318   TIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDK  497
             T E ++D  L      S SMGS + TSS ++   + +D    S  HSR QRE   + ++K
Sbjct  238   TCERSFDLGLA-----STSMGSQDKTSSARRLATEDHD----SASHSRPQREDDGEHDEK  288

Query  498   KKGNG-KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIE  674
             +K  G +SSVSTKRSRAAA+H+QSERKRRD+INQ+MK LQKLVPNSSKTDKASMLDEVIE
Sbjct  289   RKCQGERSSVSTKRSRAAAVHSQSERKRRDRINQKMKALQKLVPNSSKTDKASMLDEVIE  348

Query  675   YLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVA  854
             YLKQLQAQV M+SRMNMS MM P+      Q+ M   A               MD+NS  
Sbjct  349   YLKQLQAQVHMISRMNMSQMMMPI---TMQQLQMAMMAQMGMGMSMGMGMGMGMDINSAM  405

Query  855   AAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLAS  1034
               A   N  G+P ++HPA      +        W+NS DR+P  A+ ++M DP +AFLA 
Sbjct  406   RPAAIPN--GMPPIIHPAFLPFPMS--------WDNSGDRLP--ASGNVMEDPFSAFLAC  453

Query  1035  QSQPMTMDAYSRMAALYQQF--QQAPGGT  1115
               Q MTMDAY +MAALYQ    QQ P  T
Sbjct  454   HPQSMTMDAYGKMAALYQHLHQQQTPPNT  482



>gb|KEH22301.1| transcription factor [Medicago truncatula]
Length=339

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 138/224 (62%), Gaps = 18/224 (8%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGL-----  167
            VPW D     A     AA+  + V  DALVPC+N               +G         
Sbjct  118  VPWLDPQRAAAIAAATAASNGMAV--DALVPCSNTTKEQRTHAMDPVPRSGIGSCMVGGH  175

Query  168  --VGSCSGAGAATRE-----ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIE  326
              VGSCS   AAT++     A+ A   G  AH  +  G DQ SMSGSAT+GR SQQVT++
Sbjct  176  TPVGSCSAVVAATQDEGGILAASAAKRGRVAH-VAGSGRDQ-SMSGSATFGRQSQQVTLD  233

Query  327  TTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKG  506
            T YDR+ G   +TS S+ S +NTSS+KQCT  +  D+  SVCHSR  RE    DE KK+ 
Sbjct  234  T-YDREFGMTGFTSTSIASMDNTSSEKQCTRTTTIDDHDSVCHSRPPREEADVDE-KKRE  291

Query  507  NGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            N KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK
Sbjct  292  NRKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  335



>gb|KDO85688.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
 gb|KDO85689.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
 gb|KDO85690.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
Length=338

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 134/207 (65%), Gaps = 24/207 (12%)
 Frame = +3

Query  72   VTMDALVPCannnnsntntpa--ataRVAGFSGL-VGSCSGAGAAT-------------R  203
             TMDALVPC+N  +    T       RV G   + VGSCSG                  +
Sbjct  122  TTMDALVPCSNRRSEERTTQVMDPAPRVGGTRSIRVGSCSGPVPLPIPDSTKDDDVLNGK  181

Query  204  EASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTI-ETTYDRDLGTEA-YTSASM  377
             A +ARV    A +WS+R  DQ S SGSAT+GR+SQ+V++   TYD D+     +T  SM
Sbjct  182  RARVARV--PVAPEWSSR--DQ-SFSGSATFGRESQRVSVTHDTYDMDMDMGVGFTGTSM  236

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            GSPENTSS KQ    +  D+  SVCHSR  RE G D+E KKKGNGKS++STKRSRAAAIH
Sbjct  237  GSPENTSSAKQGNKATTADDHDSVCHSRPLREAG-DEEYKKKGNGKSTISTKRSRAAAIH  295

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSK  638
            NQSERKRRDKINQRMKTLQKLVPNSSK
Sbjct  296  NQSERKRRDKINQRMKTLQKLVPNSSK  322



>ref|XP_011094525.1| PREDICTED: transcription factor UNE10-like [Sesamum indicum]
Length=420

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 140/213 (66%), Gaps = 21/213 (10%)
 Frame = +3

Query  468   REIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  647
             R+ G D+E K KGN KSSVSTKRSRAA +HNQSERKRRDKINQRMKTLQKLVPNSSKTDK
Sbjct  209   RQTG-DEEAKNKGNEKSSVSTKRSRAADVHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  267

Query  648   ASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgm  827
             ASMLDEVIEYL+QLQAQVQMM R+N+S MM PL    Q Q+ M                 
Sbjct  268   ASMLDEVIEYLRQLQAQVQMMGRINISSMMLPL--AMQQQLQMSMMPHMGMGIGMGMGMA  325

Query  828   gvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMP  1007
             GVMDMN+++ A G   +P +    HP                   S DRM +A   S  P
Sbjct  326   GVMDMNAISHANG---MPPVIPPTHPFMPLP--------------SGDRM-SAPTGSTFP  367

Query  1008  DPLTAFLASQSQPMTMDAYSRMAALYQQFQQAP  1106
             DPL+ FLA QSQPM MDAYSR+AALYQQ QQ P
Sbjct  368   DPLSVFLACQSQPMAMDAYSRLAALYQQMQQPP  400



>gb|AAM10933.1|AF488561_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=399

 Score =   170 bits (431),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 134/234 (57%), Gaps = 59/234 (25%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF-SGLVGSC  179
            VPWF H                 + MDALVPC+N  +   +      +  G  S  VGSC
Sbjct  91   VPWFHHRSSR-----------AAMAMDALVPCSNLVHEQQS------KPGGVGSTRVGSC  133

Query  180  SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
            S  G        ARV    A +WS  G+ +++M                 TYD       
Sbjct  134  SD-GRTMGGGKRARV----APEWSGGGSQRLTMD----------------TYD-----VG  167

Query  360  YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
            +TS SMGS +NT           DD+D SVCHSR Q E    DE++KK  GKSSVSTKRS
Sbjct  168  FTSTSMGSHDNTI----------DDHD-SVCHSRPQME----DEEEKKAGGKSSVSTKRS  212

Query  540  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  213  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  266


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP++AFLA  +QP TM+AYSRMA LYQQ Q+
Sbjct  355   SPLIPDPMSAFLACSTQPTTMEAYSRMATLYQQMQR  390



>ref|NP_191916.3| transcription factor UNE10 [Arabidopsis thaliana]
 sp|Q8GZ38.1|UNE10_ARATH RecName: Full=Transcription factor UNE10; AltName: Full=Basic 
helix-loop-helix protein 16; Short=AtbHLH16; Short=bHLH 16; 
AltName: Full=Protein UNFERTILIZED EMBRYO SAC 10; AltName: 
Full=Transcription factor EN 108; AltName: Full=bHLH transcription 
factor bHLH016 [Arabidopsis thaliana]
 dbj|BAC41905.1| putative bHLH transcription factor bHLH016 [Arabidopsis thaliana]
 gb|ABG25060.1| At4g00050 [Arabidopsis thaliana]
 gb|AEE81818.1| transcription factor UNE10 [Arabidopsis thaliana]
Length=399

 Score =   170 bits (431),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 134/234 (57%), Gaps = 59/234 (25%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF-SGLVGSC  179
            VPWF H                 + MDALVPC+N  +   +      +  G  S  VGSC
Sbjct  91   VPWFHHRSSR-----------AAMAMDALVPCSNLVHEQQS------KPGGVGSTRVGSC  133

Query  180  SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
            S  G        ARV    A +WS  G+ +++M                 TYD       
Sbjct  134  SD-GRTMGGGKRARV----APEWSGGGSQRLTMD----------------TYD-----VG  167

Query  360  YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
            +TS SMGS +NT           DD+D SVCHSR Q E    DE++KK  GKSSVSTKRS
Sbjct  168  FTSTSMGSHDNTI----------DDHD-SVCHSRPQME----DEEEKKAGGKSSVSTKRS  212

Query  540  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  213  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  266



>ref|XP_002875048.1| hypothetical protein ARALYDRAFT_912247 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51307.1| hypothetical protein ARALYDRAFT_912247 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 131/234 (56%), Gaps = 59/234 (25%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGF-SGLVGSC  179
            VPWF H                 + MDALVPC+       +      +  G  S  VGSC
Sbjct  93   VPWFHHRSSR-----------AAMAMDALVPCSKLVQEQQS------KPGGVGSTRVGSC  135

Query  180  SGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
            S  G        ARV    A +WS  G+ +++M                 TYD       
Sbjct  136  SD-GRTMAGGKRARV----APEWSGGGSQRLTMD----------------TYD-----VG  169

Query  360  YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
            +TS SMGS +NT           DD+D SVCHSR Q E    DE++KK  GKSSVSTKRS
Sbjct  170  FTSTSMGSQDNTI----------DDHD-SVCHSRPQME----DEEEKKAGGKSSVSTKRS  214

Query  540  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            RAAAIHNQSERKRRDKINQRMK LQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  215  RAAAIHNQSERKRRDKINQRMKILQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  268


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP+ AFLA  +QP TM+AYSRMAALYQQ QQ
Sbjct  360   SPLIPDPMAAFLACSTQPTTMEAYSRMAALYQQMQQ  395



>ref|XP_009792484.1| PREDICTED: transcription factor UNE10 isoform X4 [Nicotiana sylvestris]
Length=411

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 169/375 (45%), Positives = 204/375 (54%), Gaps = 74/375 (20%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSG--LVGS  176
             VPWF+++   A          +T+  DALVPC+ N+N     P++  +V G  G   VGS
Sbjct  103   VPWFNYNHVVADTPLVPGL--LTMAKDALVPCSANSNYQNRPPSSV-QVPGLDGSTHVGS  159

Query  177   CSGAGAATRE-ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGT  353
             CS     +R+  ++ RV     H+WS+R    MS+SGSAT   DS+Q+T++T YDR++GT
Sbjct  160   CSTGATNSRDWMAVPRVRMEPTHEWSSRA--DMSVSGSATCAGDSRQLTVDT-YDREMGT  216

Query  354   EAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
               YTS SMGSPENTSSDKQCTN++                   DD D        SV   
Sbjct  217   GMYTSTSMGSPENTSSDKQCTNRT------------------GDDHD--------SVCHS  250

Query  534   RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms  713
             RS                                KTDKASMLDEVIEYLKQLQ+QV MMS
Sbjct  251   RS--------------------------------KTDKASMLDEVIEYLKQLQSQVNMMS  278

Query  714   -rmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIP  890
                    MM PLAMQQQLQMSMMA      MGM MGMGM  +          R NI G+P
Sbjct  279   RMNMSPAMMLPLAMQQQLQMSMMAAPMGMGMGMGMGMGMTGVAGVLDINTLSRPNITGLP  338

Query  891   GLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSR  1070
               LHP AA+AAA      +  W+ S DR+  AA    +PDPL A LA QSQPMTMDAYSR
Sbjct  339   PFLHPTAAAAAAFMQPMTS--WDGSTDRLNAAA----VPDPLAALLACQSQPMTMDAYSR  392

Query  1071  MAALYQQFQQAPGGT  1115
             MAALYQQF Q+  G+
Sbjct  393   MAALYQQFLQSAAGS  407



>ref|XP_006375304.1| hypothetical protein POPTR_0014s06190g [Populus trichocarpa]
 gb|ERP53101.1| hypothetical protein POPTR_0014s06190g [Populus trichocarpa]
Length=412

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 138/223 (62%), Gaps = 31/223 (14%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataR-------VAGFS  161
            +PWF+HH   A         S T+TMDALVPC+N ++    T    +        V G S
Sbjct  114  IPWFNHHKASA---------SATMTMDALVPCSNRSDQGRTTHVIDSGPAGLGTCVVGCS  164

Query  162  GLVGSCSGAGAATREASL-----ARVGGAAAH-DWSNRGADQMSMSGSATYGR-DSQQVT  320
              VGSCS   A   E  L     ARV       +WS    DQ S++ SAT+G+ DSQQ+T
Sbjct  165  TRVGSCSAPAATQDEDGLLTGKRARVARVPVPPEWSR---DQ-SVNHSATFGKKDSQQMT  220

Query  321  IETTYDRDLGTEAYTSASMGSPENTSSDKQ-CTNKSNDDNDHSVCHSRSQREIGSDDEDK  497
            +++  +R+ G   +TS S GS ENTSS    CT     D + SVCHSR QRE G +D DK
Sbjct  221  VDSC-EREFGV-GFTSTSFGSQENTSSGTNPCTKTLTADENDSVCHSRPQREAGKED-DK  277

Query  498  KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVP  626
            KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVP
Sbjct  278  KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVP  320



>gb|KFK30585.1| hypothetical protein AALP_AA6G000800 [Arabis alpina]
Length=394

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 177/370 (48%), Gaps = 97/370 (26%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWF H                + TMDALVPC N             RV   S  VGSCS
Sbjct  90    VPWFHHRS--------------STTMDALVPCFNLPEPA--------RVG--STRVGSCS  125

Query  183   GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
                     + +    G  A +WS  G               SQ++T++T          +
Sbjct  126   DG-----RSMVGGKRGRVAAEWSASG---------------SQRLTMDTC--------GF  157

Query  363   TSASMGSPENTSSD-KQCTNKSNDDNDHS-VCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
             T+ S+   EN+SS  K CT  +   +DH  V HSR Q E        ++  GKSSV TKR
Sbjct  158   TATSLD--ENSSSSGKPCTKTTTLFDDHDYVSHSRPQME--------EETGGKSSVLTKR  207

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsr  716
             SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV MM R
Sbjct  208   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMGR  267

Query  717   mnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGL  896
             MNM  MM P+               A             +  N +    G     G+PGL
Sbjct  268   MNMPSMMLPM---------------AMQQQQQQQQLQLSLMSNPMGLGIGM----GMPGL  308

Query  897   ------------LHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQS  1040
                         LH            P  +W  +S +   T   S +MPDP+ AFLA  S
Sbjct  309   LDLNSMNRTAPNLHANMMPNPFVPMPPPPSWDASSSNE--TRFHSPLMPDPMAAFLACSS  366

Query  1041  QPMTMDAYSR  1070
             QP T++AYSR
Sbjct  367   QPATIEAYSR  376



>ref|XP_006396203.1| hypothetical protein EUTSA_v10028687mg [Eutrema salsugineum]
 gb|ESQ37656.1| hypothetical protein EUTSA_v10028687mg [Eutrema salsugineum]
Length=395

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 194/369 (53%), Gaps = 82/369 (22%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWF H              S    MDALVP                     S  VGSCS
Sbjct  87    VPWFHHR-------------SSRAAMDALVPEQQ------------------SQHVGSCS  115

Query  183   -GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
              G   A ++   ARV    A +WS  G+ +++M    TYG                    
Sbjct  116   DGHHMAGKKR--ARV----APEWSASGSQRLTMD---TYG--------------------  146

Query  360   YTSASMGSPENTSSD-KQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
             +TS S+   +N+SS  K CT  +  D+  SVCHSR Q E    ++       KSSVSTKR
Sbjct  147   FTSTSLD--DNSSSGGKPCTKTTTIDDHDSVCHSRPQMEEEEGEKQGGG---KSSVSTKR  201

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsr  716
             SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV MMSR
Sbjct  202   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSR  261

Query  717   mnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmg------vmdmNSVAAAAGRSNI  878
             MNM  MM P+AMQQ  Q        +  MG+ +GMGM       +  MN VAAAA     
Sbjct  262   MNMPSMMLPMAMQQHQQQQFQLSLMSNPMGLGIGMGMPGLGLLDLNSMNRVAAAA-----  316

Query  879   PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMD  1058
                P  +H              +  W+ S     T   S ++PDP+ AFLA  SQP TM+
Sbjct  317   -ATPPNIHANMMPNPFVPITSPS--WDASSSN-DTRFQSPLIPDPMAAFLACSSQPTTME  372

Query  1059  AYSRMAALY  1085
             +YSRMAALY
Sbjct  373   SYSRMAALY  381



>ref|XP_006396204.1| hypothetical protein EUTSA_v10028687mg [Eutrema salsugineum]
 gb|ESQ37657.1| hypothetical protein EUTSA_v10028687mg [Eutrema salsugineum]
Length=420

 Score =   166 bits (419),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 199/369 (54%), Gaps = 82/369 (22%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWF H              S    MDALVP                     S  VGSCS
Sbjct  112   VPWFHHR-------------SSRAAMDALVPEQQ------------------SQHVGSCS  140

Query  183   -GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA  359
              G   A ++   ARV    A +WS  G+ +++M    TYG                    
Sbjct  141   DGHHMAGKKR--ARV----APEWSASGSQRLTMD---TYG--------------------  171

Query  360   YTSASMGSPENTSSD-KQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
             +TS S+   +N+SS  K CT  +  D+  SVCHSR Q     ++E +K+G GKSSVSTKR
Sbjct  172   FTSTSLD--DNSSSGGKPCTKTTTIDDHDSVCHSRPQM---EEEEGEKQGGGKSSVSTKR  226

Query  537   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsr  716
             SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV MMSR
Sbjct  227   SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSR  286

Query  717   mnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmg------vmdmNSVAAAAGRSNI  878
             MNM  MM P+AMQQ  Q        +  MG+ +GMGM       +  MN VAAAA     
Sbjct  287   MNMPSMMLPMAMQQHQQQQFQLSLMSNPMGLGIGMGMPGLGLLDLNSMNRVAAAA-----  341

Query  879   PGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMD  1058
                P  +H              +  W+ S     T   S ++PDP+ AFLA  SQP TM+
Sbjct  342   -ATPPNIHANMMPNPFVPITSPS--WDASSSN-DTRFQSPLIPDPMAAFLACSSQPTTME  397

Query  1059  AYSRMAALY  1085
             +YSRMAALY
Sbjct  398   SYSRMAALY  406



>ref|XP_007134724.1| hypothetical protein PHAVU_010G070600g [Phaseolus vulgaris]
 gb|ESW06718.1| hypothetical protein PHAVU_010G070600g [Phaseolus vulgaris]
Length=371

 Score =   162 bits (410),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 177/350 (51%), Gaps = 68/350 (19%)
 Frame = +3

Query  69    TVTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAHDW  248
             +VT DALVPC    ++            G+S  V S  GAG   R        G   H+ 
Sbjct  86    SVTKDALVPCFPKQSTMFGACKK-----GYSMRVES--GAGVVAR--------GPTTHEL  130

Query  249   SNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENT-SSDKQCTNKS  425
             S  G    ++SGS TY R+     +  T++ D         +MG PENT SS KQCT+ +
Sbjct  131   S--GGKDSNVSGSDTYPRE-----LSVTFNSD---------TMGCPENTCSSGKQCTDTT  174

Query  426   NDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMK  605
               D+  SV H RSQ E G +D  K+ G  +   S KR +A+A+HNQSER+RRDKINQRMK
Sbjct  175   AIDDRDSVSHRRSQSEAGEED-CKRSGVDRYCESNKRIKASAVHNQSERRRRDKINQRMK  233

Query  606   TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmap  785
              LQKLVPNSSKTDKASMLDEVI+Y+KQLQA +QMM+ M M   +  L +  Q Q   M+ 
Sbjct  234   ELQKLVPNSSKTDKASMLDEVIQYMKQLQAHLQMMNWMKMYSSIM-LPIAMQQQQLKMSM  292

Query  786   aaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENS  965
                             M+MN++       NIP IP +LH                     
Sbjct  293   IMTQMGIGMRMSKEMTMNMNNI-------NIPSIPPMLHLPPF-----------------  328

Query  966   LDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAPGGT  1115
                MP A+ +  +       L    + +T+DAYS+MAALY Q   +P  T
Sbjct  329   ---MPVASCADQL-------LGEPPKSVTVDAYSKMAALYNQMYHSPYST  368



>gb|KFK30584.1| hypothetical protein AALP_AA6G000800 [Arabis alpina]
Length=387

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 173/369 (47%), Gaps = 102/369 (28%)
 Frame = +3

Query  3     VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
             VPWF H                + TMDALVPC N             RV   S  VGSCS
Sbjct  90    VPWFHHRS--------------STTMDALVPCFNLPEPA--------RVG--STRVGSCS  125

Query  183   GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
                     + +    G  A +WS  G               SQ++T++T          +
Sbjct  126   DG-----RSMVGGKRGRVAAEWSASG---------------SQRLTMDTC--------GF  157

Query  363   TSASMGSPENTSSD-KQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
             T+ S+   EN+SS  K CT  +   +DH              D  +++  GKSSV TKRS
Sbjct  158   TATSLD--ENSSSSGKPCTKTTTLFDDH--------------DYMEEETGGKSSVLTKRS  201

Query  540   RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrm  719
             RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV MM RM
Sbjct  202   RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMGRM  261

Query  720   nmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGL-  896
             NM  MM P+               A             +  N +    G     G+PGL 
Sbjct  262   NMPSMMLPM---------------AMQQQQQQQQLQLSLMSNPMGLGIGM----GMPGLL  302

Query  897   -----------LHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQSQ  1043
                        LH            P  +W  +S +   T   S +MPDP+ AFLA  SQ
Sbjct  303   DLNSMNRTAPNLHANMMPNPFVPMPPPPSWDASSSNE--TRFHSPLMPDPMAAFLACSSQ  360

Query  1044  PMTMDAYSR  1070
             P T++AYSR
Sbjct  361   PATIEAYSR  369



>ref|XP_010692153.1| PREDICTED: transcription factor UNE10 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=477

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 145/250 (58%), Gaps = 46/250 (18%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
            VPWF               A V VT+DALVP              +  + G S  V SCS
Sbjct  131  VPWFG----------PKTTAPVPVTLDALVP--------------SNNMVGCSTRVESCS  166

Query  183  GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
             A         ARV      DWS   +   S +  +T  +   + T E     +     +
Sbjct  167  TA---------ARV--PLGSDWSVSVSASAS-ASESTRKKGHAEDTCEQLRSMN-NNNGF  213

Query  363  TSASMG--SPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
            TS S G  SPENT +       + D++D S CHSR QRE G ++E++K+G  KS VSTKR
Sbjct  214  TSTSFGQVSPENTKT------FTVDEHD-SACHSRPQRERGEEEENQKQGTEKSGVSTKR  266

Query  537  SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsr  716
            SRAAA+HNQSERKRRDKINQRMKTLQKLVPNS+K DKASMLDEVIEYLKQLQAQVQM+SR
Sbjct  267  SRAAAVHNQSERKRRDKINQRMKTLQKLVPNSNKADKASMLDEVIEYLKQLQAQVQMLSR  326

Query  717  mnmspmmFPL  746
            M++  MM PL
Sbjct  327  MSLPSMMMPL  336



>ref|XP_007134725.1| hypothetical protein PHAVU_010G070600g [Phaseolus vulgaris]
 gb|ESW06719.1| hypothetical protein PHAVU_010G070600g [Phaseolus vulgaris]
Length=372

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 136/351 (39%), Positives = 177/351 (50%), Gaps = 69/351 (20%)
 Frame = +3

Query  69    TVTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAHDW  248
             +VT DALVPC    ++            G+S  V S  GAG   R        G   H+ 
Sbjct  86    SVTKDALVPCFPKQSTMFGACKK-----GYSMRVES--GAGVVAR--------GPTTHEL  130

Query  249   SNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENT-SSDKQCTNKS  425
             S  G    ++SGS TY R+     +  T++ D         +MG PENT SS KQCT+ +
Sbjct  131   S--GGKDSNVSGSDTYPRE-----LSVTFNSD---------TMGCPENTCSSGKQCTDTT  174

Query  426   NDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMK  605
               D+  SV H RSQ E G +D  K+ G  +   S KR +A+A+HNQSER+RRDKINQRMK
Sbjct  175   AIDDRDSVSHRRSQSEAGEED-CKRSGVDRYCESNKRIKASAVHNQSERRRRDKINQRMK  233

Query  606   TLQKLVPNSSK-TDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmma  782
              LQKLVPNSSK TDKASMLDEVI+Y+KQLQA +QMM+ M M   +  L +  Q Q   M+
Sbjct  234   ELQKLVPNSSKQTDKASMLDEVIQYMKQLQAHLQMMNWMKMYSSIM-LPIAMQQQQLKMS  292

Query  783   paaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWEN  962
                              M+MN++       NIP IP +LH                    
Sbjct  293   MIMTQMGIGMRMSKEMTMNMNNI-------NIPSIPPMLHLPPF----------------  329

Query  963   SLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAPGGT  1115
                 MP A+ +  +       L    + +T+DAYS+MAALY Q   +P  T
Sbjct  330   ----MPVASCADQL-------LGEPPKSVTVDAYSKMAALYNQMYHSPYST  369



>ref|XP_007134726.1| hypothetical protein PHAVU_010G070600g [Phaseolus vulgaris]
 gb|ESW06720.1| hypothetical protein PHAVU_010G070600g [Phaseolus vulgaris]
Length=396

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 136/351 (39%), Positives = 177/351 (50%), Gaps = 69/351 (20%)
 Frame = +3

Query  69    TVTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAHDW  248
             +VT DALVPC    ++            G+S  V S  GAG   R        G   H+ 
Sbjct  110   SVTKDALVPCFPKQSTMFGACK-----KGYSMRVES--GAGVVAR--------GPTTHEL  154

Query  249   SNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENT-SSDKQCTNKS  425
             S  G    ++SGS TY R+     +  T++ D         +MG PENT SS KQCT+ +
Sbjct  155   S--GGKDSNVSGSDTYPRE-----LSVTFNSD---------TMGCPENTCSSGKQCTDTT  198

Query  426   NDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMK  605
               D+  SV H RSQ E G +D  K+ G  +   S KR +A+A+HNQSER+RRDKINQRMK
Sbjct  199   AIDDRDSVSHRRSQSEAGEED-CKRSGVDRYCESNKRIKASAVHNQSERRRRDKINQRMK  257

Query  606   TLQKLVPNSSK-TDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmma  782
              LQKLVPNSSK TDKASMLDEVI+Y+KQLQA +QMM+ M M   +  L +  Q Q   M+
Sbjct  258   ELQKLVPNSSKQTDKASMLDEVIQYMKQLQAHLQMMNWMKMYSSIM-LPIAMQQQQLKMS  316

Query  783   paaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWEN  962
                              M+MN++       NIP IP +LH                    
Sbjct  317   MIMTQMGIGMRMSKEMTMNMNNI-------NIPSIPPMLHLPPF----------------  353

Query  963   SLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAPGGT  1115
                 MP A+ +  +       L    + +T+DAYS+MAALY Q   +P  T
Sbjct  354   ----MPVASCADQL-------LGEPPKSVTVDAYSKMAALYNQMYHSPYST  393



>ref|XP_006288320.1| hypothetical protein CARUB_v10001567mg [Capsella rubella]
 gb|EOA21218.1| hypothetical protein CARUB_v10001567mg [Capsella rubella]
Length=301

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 143/226 (63%), Gaps = 49/226 (22%)
 Frame = +3

Query  72   VTMDALVPCannnnsntntpaataRVAGF-SGLVGSCSGAGAATREASLARVGGAAAHDW  248
            + MDALVPC+N     +       +  G  S  VGSCS  G        ARV    A +W
Sbjct  1    MAMDALVPCSNLQEQQS-------KHGGVGSTRVGSCSD-GRTMAGVKRARV----APEW  48

Query  249  SNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSN  428
            S  G               SQ++T++T YD  L     TS SMGSP+NT           
Sbjct  49   SGSG---------------SQRLTMDT-YDIGL-----TSTSMGSPDNTI----------  77

Query  429  DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT  608
            DD+D SVCHSR Q E    +E++KKG GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT
Sbjct  78   DDHD-SVCHSRPQME----EEEEKKGGGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT  132

Query  609  LQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            LQKLVPNSSKTDKASMLDEVIEYLKQLQAQV MMSRMNM  MM P+
Sbjct  133  LQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSRMNMPSMMLPM  178


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +3

Query  954   WENSLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             WE S +   T   S ++PDP+ AFLA  SQP TM+AYSRMAALYQQ QQ
Sbjct  247   WEASSND--TRFQSPLIPDPMAAFLACSSQPTTMEAYSRMAALYQQMQQ  293



>ref|XP_010327313.1| PREDICTED: transcription factor UNE10-like [Solanum lycopersicum]
Length=391

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 166/320 (52%), Gaps = 58/320 (18%)
 Frame = +3

Query  168   VGSCSGAGAATREASLARVGGAAA-----HDWSNRGADQMSMSGSATY-GRDSQQVTIET  329
             V SCSG      +A +ARVG  ++      D+ N+ A   ++ GS  Y G+++     ET
Sbjct  114   VASCSG------DAEMARVGMGSSFEEISEDFENQEAK--NLIGSMVYEGKNNTVSPGET  165

Query  330   TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
             +    LG E   +        TS+ K   NK    N+H    SR Q    ++DED+KK +
Sbjct  166   S----LGEERVLTT-------TSTFKH--NKRKTLNNHD---SRGQESRDNEDEDEKKRS  209

Query  510   GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
               SS STKR R AA HNQSERKRRDKINQR+KTLQKLVP SSKTD ASMLDEVIEYLKQL
Sbjct  210   KISSFSTKRCRVAATHNQSERKRRDKINQRLKTLQKLVPTSSKTDTASMLDEVIEYLKQL  269

Query  690   QAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGR  869
             +AQV+ MS M    M  P  M   +           +M                  A   
Sbjct  270   RAQVKAMSMMIHVNMQPPPMMLPNMAFQQQQQQFQMSMMGMARPID--------VNALSS  321

Query  870   SNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQ--SQ  1043
              NI  IP +LH  A                ++ +  P A+  +   DPL + +A +  SQ
Sbjct  322   PNITTIPSILHTTA---------------PSNFNNPPIASPGA---DPLASLVAVRQLSQ  363

Query  1044  PMTMDAYSRMAALYQQFQQA  1103
             PMTMDAYSRMAALYQQ+ Q+
Sbjct  364   PMTMDAYSRMAALYQQYLQS  383



>ref|XP_009411572.1| PREDICTED: transcription factor UNE10 [Musa acuminata subsp. 
malaccensis]
Length=435

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 180/370 (49%), Gaps = 77/370 (21%)
 Frame = +3

Query  63    SVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAH  242
             S +V +DALVPC ++  SN             + +VG CS  G+A               
Sbjct  109   STSVAVDALVPCQDDVASNRIADPDAPPCCKRARMVGVCSSQGSA---------------  153

Query  243   DWSNRGADQMSMSGSATYGRDSQQ-VTIETTYDRDLGTEAYT----------SASMGSPE  389
                         +GS     DS   VT++T  + D+G  A            +++    E
Sbjct  154   ------------AGSLPGRVDSTTFVTLDTWREDDVGLTATATTATTATATDTSAWPETE  201

Query  390   NTSSDKQCTNKSNDDNDH-SVCHSRSQREIGS----DDEDKKKGNGKSSVSTKRSRAAAI  554
             NTS  K+   K     DH S+ H+ SQ +  S    +++D K   GK S +TK+SRAAAI
Sbjct  202   NTSLGKR---KVRALYDHVSISHTSSQTKPDSLYDEEEKDTKGEVGKPSGATKKSRAAAI  258

Query  555   HNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ------mmsr  716
             HNQSERKRRD+INQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ       M  
Sbjct  259   HNQSERKRRDRINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQMMSRMSSMMV  318

Query  717   mnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGL  896
               M  +  P+  Q    M+         +                 A+ GRS  P +P L
Sbjct  319   AAMQQLQMPMVAQLLPHMAQFPQLPHMGLMDF--------------ASIGRSVPPVLP-L  363

Query  897   LHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAFLASQ--SQPMTMDAYSR  1070
             LHP+A    AA        W+   DR P     S++PDP +A LA Q   QPM++D YSR
Sbjct  364   LHPSAFLHLAATGG-----WDGIGDRRPVG---SVLPDPFSALLACQMAQQPMSLDEYSR  415

Query  1071  MAALYQQFQQ  1100
             M  L Q   Q
Sbjct  416   MVTLLQHLSQ  425



>ref|XP_009111529.1| PREDICTED: transcription factor UNE10-like [Brassica rapa]
Length=393

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 121/233 (52%), Gaps = 61/233 (26%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
            VPWF H              S    +DALVP   +                    V SCS
Sbjct  87   VPWFHHR-------------SSRAGLDALVPEQQSQPDTH---------------VDSCS  118

Query  183  GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
              G        ARV    A +WS  G               SQ +T ET          +
Sbjct  119  N-GHPMAGGKRARV----ASEWSTGG---------------SQNLTFETY--------GF  150

Query  363  TSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSR  542
            TS S+    ++S  K CT  +   +  SVCHSR Q E    +E++K+  GKS V TKRSR
Sbjct  151  TSTSLDD-NSSSGGKPCTKTTTIYDHDSVCHSRRQME----EEEEKQAGGKSPVPTKRSR  205

Query  543  AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            AAAIHNQ+ERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  206  AAAIHNQTERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  258



>ref|XP_009133970.1| PREDICTED: transcription factor UNE10 [Brassica rapa]
Length=395

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 116/179 (65%), Gaps = 34/179 (19%)
 Frame = +3

Query  168  VGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL  347
            VGSCS  G        +RV    A +WS  G               SQ++TI+T      
Sbjct  115  VGSCSD-GHPMNGGKRSRV----APEWSASG---------------SQRLTIDT------  148

Query  348  GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH-SVCHSRSQREIGSDDEDKKKGNGKSSV  524
                +TS S+   +N+SS  +   K+ + +DH SVCHSR Q  +  ++E+K  G GKSS 
Sbjct  149  --YGFTSTSLD--DNSSSGGKPFTKTTNIDDHDSVCHSRPQ--VEEEEEEKHTG-GKSSA  201

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  202  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  260


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP++AFLA  SQP TM+AYSRMAALYQQ QQ
Sbjct  352   SPLIPDPMSAFLACSSQPTTMEAYSRMAALYQQMQQ  387



>gb|KHN11866.1| Transcription factor UNE10 [Glycine soja]
Length=399

 Score =   145 bits (366),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 131/219 (60%), Gaps = 28/219 (13%)
 Frame = +3

Query  72   VTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAHDWS  251
            V MDALVPC+              R A  SG +G+C  + ++TR AS ARV  AA  +  
Sbjct  89   VAMDALVPCSKQGT----------RKAVESGRLGACRES-SSTRVASRARV--AAQEEVG  135

Query  252  NRGA------DQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTSS-DKQ  410
             R          + +SG   +      V+   T  R+L    + SA+ GSPENT+S  +Q
Sbjct  136  KRAGMVARLPTTLELSGCKDWS-----VSGSETCRRELSV-TFNSATTGSPENTTSAGRQ  189

Query  411  CTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRA-AAIHNQSERKRRDK  587
            CT  + +D+  S+ H  SQ E+  +D    K   +SS S KR +A + +HNQSER+RRDK
Sbjct  190  CTGTTTNDDRDSISHLISQSEVPDEDYMAAKVE-RSSGSNKRIKANSVVHNQSERRRRDK  248

Query  588  INQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            INQRMK LQKLVPNSSKTDKASMLDEVI+Y+KQLQAQVQ
Sbjct  249  INQRMKELQKLVPNSSKTDKASMLDEVIQYMKQLQAQVQ  287



>ref|XP_003522046.1| PREDICTED: transcription factor UNE10-like [Glycine max]
Length=397

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 132/349 (38%), Positives = 169/349 (48%), Gaps = 51/349 (15%)
 Frame = +3

Query  72    VTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAHDWS  251
             VTMDALVPC+    +     +      G S      +      R   +AR G        
Sbjct  92    VTMDALVPCSEQQGTQKAVVSERLDACGKSRFPRVVAQEEVEKRAGVVAR-GTRGTTTLE  150

Query  252   NRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENT-SSDKQCTNKSN  428
               G    S+SGS T  R+     +  T++         SA+ GSPENT SS KQCT  + 
Sbjct  151   LGGCKDWSVSGSETCRRE-----LSVTFN---------SATKGSPENTTSSGKQCTGTTT  196

Query  429   DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRA-AAIHNQSERKRRDKINQRMK  605
             +D+  S+ H  SQ E+  +D    K + +SS S KR +A + +H QSER+RRDKINQRMK
Sbjct  197   NDDRDSISHRISQGEVPDEDYKATKVD-RSSGSNKRIKANSVVHKQSERRRRDKINQRMK  255

Query  606   TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms-rmnmspmmFPLamqqqlqmsmma  782
              LQKLVPNSSKTDKASMLDEVI+Y+KQLQAQVQMM+     + MM P+ MQQQ Q   + 
Sbjct  256   ELQKLVPNSSKTDKASMLDEVIQYMKQLQAQVQMMNWMKMYTSMMLPITMQQQQQQQQLK  315

Query  783   paaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWEN  962
              +   A           M MN         NIPG P +L   +                 
Sbjct  316   MSMMMAQMGMGMGMSKDMVMN-----MNSMNIPGFPPMLPFPSF----------------  354

Query  963   SLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAPG  1109
                 MP A     +         +  + +TMDAYS MA+LYQQ    P 
Sbjct  355   ----MPMAPCGDQL-------QGTPEKSVTMDAYSTMASLYQQLFHPPA  392



>gb|KHM99413.1| Transcription factor UNE10 [Glycine soja]
Length=396

 Score =   142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 128/349 (37%), Positives = 167/349 (48%), Gaps = 52/349 (15%)
 Frame = +3

Query  72    VTMDALVPCannnnsntntpaataRVAGFSGLVGSCSGAGAATREASLARVGGAAAHDWS  251
             VTMDALVPC+   ++     +      G S      +      R   +AR G        
Sbjct  92    VTMDALVPCSEQQSTQKAVVSERLDACGKSRFPRVVAQEEVEKRAGVVAR-GTRGTTTLE  150

Query  252   NRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTS-SDKQCTNKSN  428
               G    S+SGS T  R+     +  T++         SA+ GSPENT+ S KQCT  + 
Sbjct  151   LGGCKDWSVSGSETCRRE-----LSVTFN---------SATKGSPENTTCSGKQCTGTTT  196

Query  429   DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRA-AAIHNQSERKRRDKINQRMK  605
             +D+  S+ H  SQ E+  +D    K + +SS S KR +A + +H QSER+RRDKINQRMK
Sbjct  197   NDDRDSISHRISQGEVPDEDYKATKVD-RSSGSNKRIKANSVVHKQSERRRRDKINQRMK  255

Query  606   TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQmms-rmnmspmmFPLamqqqlqmsmma  782
              LQKLVPNSSKTDKASMLDEVI+Y+KQLQAQVQMM+     + MM P+       M    
Sbjct  256   ELQKLVPNSSKTDKASMLDEVIQYMKQLQAQVQMMNWMKMYTSMMLPI------TMQQQQ  309

Query  783   paaaaamgmnmgmgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWEN  962
                     M   MGMG+     +       NIPG P +L   +                 
Sbjct  310   QQQLKMSMMMAQMGMGMGMSKDMVMNMNSMNIPGFPPMLPFPSF----------------  353

Query  963   SLDRMPTAAASSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAPG  1109
                 MP A     +         +  + +TMDAYS MA+LYQQ    P 
Sbjct  354   ----MPMAPCGDQL-------QGTPEKSVTMDAYSTMASLYQQLFHPPA  391



>ref|XP_010523094.1| PREDICTED: transcription factor UNE10 isoform X1 [Tarenaya hassleriana]
Length=343

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 101/157 (64%), Gaps = 32/157 (20%)
 Frame = +3

Query  231  AAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQ  410
            AAA     RG DQ+S+SGSAT GR      I TT    +G   +TS S+           
Sbjct  102  AAAPKRPRRG-DQISVSGSATVGR------IRTTDSSGMG---FTSTSL-----------  140

Query  411  CTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKI  590
                    +DH   +S S     + +ED K    KSSVSTKRSRAAAIHNQSERKRRDKI
Sbjct  141  --------DDH---YSFSPEMEVTHEEDTKNTAAKSSVSTKRSRAAAIHNQSERKRRDKI  189

Query  591  NQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            NQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  190  NQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  226


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP+ AFL+ QSQPMTMDAYSRMAALYQQ QQ
Sbjct  299   SPVIPDPMAAFLSCQSQPMTMDAYSRMAALYQQMQQ  334



>gb|EYU42377.1| hypothetical protein MIMGU_mgv1a022487mg, partial [Erythranthe 
guttata]
Length=182

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 110/167 (66%), Gaps = 18/167 (11%)
 Frame = +3

Query  147  VAGFSGLVGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYG--RDSQQVT  320
            V G S  VGSCSGA A    ++LA   G         GA   + S SAT+G   DS Q+T
Sbjct  31   VVGSSTHVGSCSGAAAHGGRSALAAACGCKV-----VGA-TTAASESATFGGRDDSFQLT  84

Query  321  IETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKK  500
            ++T           TS SM SPENTSS K+ +  S DD+D+S C SRSQ E  +DD  K+
Sbjct  85   LDTC-------GGLTSTSMWSPENTSSGKEYSRTSADDHDYSGCRSRSQSE--ADDCGKR  135

Query  501  K-GNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            K G+GKSSV+ K++RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK
Sbjct  136  KLGHGKSSVTIKKTRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  182



>ref|XP_010934137.1| PREDICTED: transcription factor UNE10-like [Elaeis guineensis]
Length=439

 Score =   139 bits (351),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 162/264 (61%), Gaps = 29/264 (11%)
 Frame = +3

Query  315   VTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIG--SDD  488
             VT++T    D+G   +T+ +  +  + + + + T+   DD D SVC SR  +  G   DD
Sbjct  178   VTLDTCGGDDVG---FTNTTATATNSVTPETENTSFGRDDRD-SVCLSRRSQLDGLCDDD  233

Query  489   EDKKKGN-GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
             E  + G+ G++S S +RSRAAAIHNQSERKRRD+INQRM+ LQKLVPNSSKTDKASMLDE
Sbjct  234   EKTRTGSAGRASTSARRSRAAAIHNQSERKRRDRINQRMRILQKLVPNSSKTDKASMLDE  293

Query  666   VIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmN  845
             VIEYLKQLQAQV+MMSRM+   M     M        M    A    M++G GMG+MD+N
Sbjct  294   VIEYLKQLQAQVEMMSRMSTMMM----PMAMPQLQMSMMAQMAQMTHMSIGRGMGMMDLN  349

Query  846   SVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMPDPLTAF  1025
             S+     R +  G+P LLHP+A      A       W+ S DRM      +++PDP +AF
Sbjct  350   SL----NRPSYAGLPPLLHPSAFRPLPTAS------WDISGDRM-QQHGGTILPDPFSAF  398

Query  1026  LASQS-------QPMTMDAYSRMA  1076
             LA Q+       QP + +AYSRMA
Sbjct  399   LAYQTAQQQQQQQPASGEAYSRMA  422



>emb|CDX74328.1| BnaA03g27190D [Brassica napus]
Length=387

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 109/178 (61%), Gaps = 39/178 (22%)
 Frame = +3

Query  168  VGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL  347
            VGSCS  G        ARV    A +WS  G               SQ++TI+T      
Sbjct  114  VGSCSD-GHPMDCGKRARV----APEWSASG---------------SQRLTIDTY-----  148

Query  348  GTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVS  527
                +TS S+   +N+SS  +   K+ + +DH             ++E++K+  GKSS S
Sbjct  149  ---GFTSTSLD--DNSSSGGKPFPKTTNIDDHDSME---------EEEEQKQTGGKSSAS  194

Query  528  TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  195  TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  252


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP++AFLA  SQP TM+AYSRMAALYQQ QQ
Sbjct  344   SPLIPDPMSAFLACSSQPTTMEAYSRMAALYQQMQQ  379



>emb|CDY65390.1| BnaAnng20430D [Brassica napus]
Length=209

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  483  DDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
            ++E++K+  GKS V TKRSRAAAIHNQ+ERKRRDKINQRMKTLQKLVPNSSKTDKASMLD
Sbjct  2    EEEEEKQAGGKSPVPTKRSRAAAIHNQTERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  61

Query  663  EVIEYLKQLQAQV  701
            EVIEYLKQLQAQV
Sbjct  62   EVIEYLKQLQAQV  74



>ref|XP_010692154.1| PREDICTED: transcription factor UNE10 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=440

 Score =   137 bits (345),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 140/268 (52%), Gaps = 64/268 (24%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
            VPWF               A V VT+DALVP              +  + G S  V SCS
Sbjct  76   VPWFG----------PKTTAPVPVTLDALVP--------------SNNMVGCSTRVESCS  111

Query  183  GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
             A         ARV      DWS   +   S +  +T  +   + T E     +     +
Sbjct  112  TA---------ARV--PLGSDWSVSVSASAS-ASESTRKKGHAEDTCEQLRSMN-NNNGF  158

Query  363  TSASMG--SPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDE---------------  491
            TS S G  SPENT +       + D++D S CHSR Q       +               
Sbjct  159  TSTSFGQVSPENTKT------FTVDEHD-SACHSRPQLSSSLKSKKSHPISRKKKRERGE  211

Query  492  ---DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
               ++K+G  KS VSTKRSRAAA+HNQSERKRRDKINQRMKTLQKLVPNS+K DKASMLD
Sbjct  212  EEENQKQGTEKSGVSTKRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSNKADKASMLD  271

Query  663  EVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            EVIEYLKQLQAQVQM+SRM++  MM PL
Sbjct  272  EVIEYLKQLQAQVQMLSRMSLPSMMMPL  299



>ref|XP_010692152.1| PREDICTED: transcription factor UNE10 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=495

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 140/268 (52%), Gaps = 64/268 (24%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
            VPWF               A V VT+DALVP              +  + G S  V SCS
Sbjct  131  VPWFG----------PKTTAPVPVTLDALVP--------------SNNMVGCSTRVESCS  166

Query  183  GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
             A         ARV      DWS   +   S +  +T  +   + T E     +     +
Sbjct  167  TA---------ARV--PLGSDWSVSVSASAS-ASESTRKKGHAEDTCEQLRSMN-NNNGF  213

Query  363  TSASMG--SPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDE---------------  491
            TS S G  SPENT +       + D++D S CHSR Q       +               
Sbjct  214  TSTSFGQVSPENTKT------FTVDEHD-SACHSRPQLSSSLKSKKSHPISRKKKRERGE  266

Query  492  ---DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
               ++K+G  KS VSTKRSRAAA+HNQSERKRRDKINQRMKTLQKLVPNS+K DKASMLD
Sbjct  267  EEENQKQGTEKSGVSTKRSRAAAVHNQSERKRRDKINQRMKTLQKLVPNSNKADKASMLD  326

Query  663  EVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            EVIEYLKQLQAQVQM+SRM++  MM PL
Sbjct  327  EVIEYLKQLQAQVQMLSRMSLPSMMMPL  354



>emb|CDX83214.1| BnaA03g22920D [Brassica napus]
Length=348

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 107/179 (60%), Gaps = 41/179 (23%)
 Frame = +3

Query  168  VGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL  347
            VGSCS  G        +RV    A +WS  G               SQ++TI+T      
Sbjct  75   VGSCSD-GHPMNGGKRSRV----APEWSASG---------------SQRLTIDT------  108

Query  348  GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH-SVCHSRSQREIGSDDEDKKKGNGKSSV  524
                +TS S+   +N+SS  +   K+ + +DH SV     ++  G          GKSS 
Sbjct  109  --YGFTSTSLD--DNSSSGGKPFTKTTNIDDHDSVEEEEEEKHTG----------GKSSA  154

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV
Sbjct  155  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  213


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP++AFLA  SQP TM+AYSRMAALYQQ QQ
Sbjct  305   SPLIPDPMSAFLACSSQPTTMEAYSRMAALYQQMQQ  340



>emb|CDX91917.1| BnaC03g32190D [Brassica napus]
Length=347

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 21/133 (16%)
 Frame = +3

Query  306  SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDH-SVCHSRSQREIGS  482
            SQ++TI+T          +TS S+   +N+SS  +   K+ + +DH SV     +++ G 
Sbjct  100  SQRLTIDT--------YGFTSTSLD--DNSSSGGKPFPKTTNIDDHDSVEEEEEEKQTG-  148

Query  483  DDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
                     GKSS STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD
Sbjct  149  ---------GKSSASTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  199

Query  663  EVIEYLKQLQAQV  701
            EVIEYLKQLQAQV
Sbjct  200  EVIEYLKQLQAQV  212


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP++AFLA  SQP TM+AYSRMAALY Q QQ
Sbjct  304   SPLIPDPMSAFLACSSQPTTMEAYSRMAALYHQMQQ  339



>gb|KDO85691.1| hypothetical protein CISIN_1g012387mg [Citrus sinensis]
Length=338

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 112/184 (61%), Gaps = 24/184 (13%)
 Frame = +3

Query  75   TMDALVPCannnnsntntpaa--taRVAGFSGL-VGSCSGAGAAT-------------RE  206
            TMDALVPC+N  +    T       RV G   + VGSCSG                  + 
Sbjct  123  TMDALVPCSNRRSEERTTQVMDPAPRVGGTRSIRVGSCSGPVPLPIPDSTKDDDVLNGKR  182

Query  207  ASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTI-ETTYDRDLGT-EAYTSASMG  380
            A +ARV    A +WS+R  DQ S SGSAT+GR+SQ+V++   TYD D+     +T  SMG
Sbjct  183  ARVARV--PVAPEWSSR--DQ-SFSGSATFGRESQRVSVTHDTYDMDMDMGVGFTGTSMG  237

Query  381  SPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHN  560
            SPENTSS KQ    +  D+  SVCHSR  RE G D+E KKKGNGKS++STKRSRAAAIHN
Sbjct  238  SPENTSSAKQGNKATTADDHDSVCHSRPLREAG-DEEYKKKGNGKSTISTKRSRAAAIHN  296

Query  561  QSER  572
            QSER
Sbjct  297  QSER  300



>ref|XP_004137596.1| PREDICTED: transcription factor UNE10-like [Cucumis sativus]
 ref|XP_004157490.1| PREDICTED: transcription factor UNE10-like [Cucumis sativus]
 gb|KGN64033.1| hypothetical protein Csa_1G039000 [Cucumis sativus]
Length=458

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 149/256 (58%), Gaps = 24/256 (9%)
 Frame = +3

Query  333   YDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG  512
             + RD  T   T AS  SP +  +      KS D++  S CH  S+ +   +++D K+   
Sbjct  203   FCRDNETTLMTWASFDSPRSLKT------KSIDED--SACHVESENQ--EEEQDTKRVAN  252

Query  513   KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
             +S  S +RSRAAAIHNQSER+RRD+IN++MK LQKLVPN+SKTDKASMLDEVIEYLKQLQ
Sbjct  253   RSH-SARRSRAAAIHNQSERRRRDRINEKMKALQKLVPNASKTDKASMLDEVIEYLKQLQ  311

Query  693   AQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRS  872
             AQVQ MS  +M  M+ P+ MQQQLQMS++A                        +   RS
Sbjct  312   AQVQFMSVRSMQQMIMPIGMQQQLQMSLLARMGMGVGLGMGMGM-------LDMSGMARS  364

Query  873   NIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRM-PTAA--ASSMMPDPLTAFLASQSQ  1043
                 +P L+HP +      AF+P       S+ R  PT A  A++   DP  AFLA   Q
Sbjct  365   AQQTLPPLIHPTSVPTTPPAFVPPHFLLPPSIPRQDPTQAKPATNGSVDPFCAFLA---Q  421

Query  1044  PMTMDAYSRMAALYQQ  1091
              M MD Y++MAA Y+Q
Sbjct  422   TMNMDIYNKMAAFYRQ  437



>emb|CDY21498.1| BnaC03g26990D [Brassica napus]
Length=387

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 106/179 (59%), Gaps = 41/179 (23%)
 Frame = +3

Query  168  VGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDL  347
            VGSCS  G        ARV    A +WS  G               SQ++TI+T      
Sbjct  114  VGSCSD-GHPMDGGKRARV----APEWSASG---------------SQRLTIDTY-----  148

Query  348  GTEAYTSASMGSPENTSSDKQCTNKSNDDNDH-SVCHSRSQREIGSDDEDKKKGNGKSSV  524
                +TS S+    N+SSD +   K+ + +DH SV     +++ G          GKSS 
Sbjct  149  ---GFTSTSLDV--NSSSDGKPFTKTTNIDDHDSVEEEEEEKQTG----------GKSSA  193

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIE LKQLQA V
Sbjct  194  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIENLKQLQAHV  252


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  993   SSMMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQ  1100
             S ++PDP++AFLA   QP TM+AYSRMAALYQQ QQ
Sbjct  344   SPLIPDPMSAFLACSLQPTTMEAYSRMAALYQQMQQ  379



>ref|XP_008447613.1| PREDICTED: transcription factor PIF7-like isoform X2 [Cucumis 
melo]
Length=391

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 150/256 (59%), Gaps = 24/256 (9%)
 Frame = +3

Query  333   YDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG  512
             + RD  T   T AS  SP +  +      KS D++  S CH  S+ +   +++D K+   
Sbjct  136   FCRDNETTLMTWASFDSPRSLKT------KSIDED--SACHVESENQ--EEEQDTKRVAN  185

Query  513   KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
             +S  S +RSRAAA+HNQSER+RRD+IN++MK LQKLVPN+SKTDKASMLDEVIEYLKQLQ
Sbjct  186   RSH-SARRSRAAAVHNQSERRRRDRINEKMKALQKLVPNASKTDKASMLDEVIEYLKQLQ  244

Query  693   AQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRS  872
             AQVQ MS  +M  M+ P+ +QQQLQMS++A                        +   RS
Sbjct  245   AQVQFMSVRSMQQMIMPIGIQQQLQMSLLARMGMGVGLGMGMGM-------LDMSGMPRS  297

Query  873   NIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRM-PTAA--ASSMMPDPLTAFLASQSQ  1043
                 +P L+HP +  +   AF+P       ++ R  PT A  A++   DP  AFLA   Q
Sbjct  298   APQALPPLIHPTSVPSTPPAFVPPHFLLPPAIPRQDPTQAKPATNGSVDPFCAFLA---Q  354

Query  1044  PMTMDAYSRMAALYQQ  1091
              M MD Y++MAA Y+Q
Sbjct  355   TMNMDIYNKMAAFYRQ  370



>ref|XP_008447543.1| PREDICTED: transcription factor PIF7-like isoform X1 [Cucumis 
melo]
Length=459

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 148/256 (58%), Gaps = 24/256 (9%)
 Frame = +3

Query  333   YDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG  512
             + RD  T   T AS  SP +  +      KS D++  S CH  S+ +   +++D K+   
Sbjct  204   FCRDNETTLMTWASFDSPRSLKT------KSIDED--SACHVESENQ--EEEQDTKRVAN  253

Query  513   KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
             +S  S +RSRAAA+HNQSER+RRD+IN++MK LQKLVPN+SKTDKASMLDEVIEYLKQLQ
Sbjct  254   RSH-SARRSRAAAVHNQSERRRRDRINEKMKALQKLVPNASKTDKASMLDEVIEYLKQLQ  312

Query  693   AQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdmNSVAAAAGRS  872
             AQVQ MS  +M  M+ P+               +    M MG+G+G+       +   RS
Sbjct  313   AQVQFMSVRSMQQMIMPI-------GIQQQLQMSLLARMGMGVGLGMGMGMLDMSGMPRS  365

Query  873   NIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRM-PTAA--ASSMMPDPLTAFLASQSQ  1043
                 +P L+HP +  +   AF+P       ++ R  PT A  A++   DP  AFLA   Q
Sbjct  366   APQALPPLIHPTSVPSTPPAFVPPHFLLPPAIPRQDPTQAKPATNGSVDPFCAFLA---Q  422

Query  1044  PMTMDAYSRMAALYQQ  1091
              M MD Y++MAA Y+Q
Sbjct  423   TMNMDIYNKMAAFYRQ  438



>ref|XP_010106642.1| Transcription factor UNE10 [Morus notabilis]
 gb|EXC11021.1| Transcription factor UNE10 [Morus notabilis]
Length=449

 Score =   128 bits (321),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 99/152 (65%), Gaps = 13/152 (9%)
 Frame = +3

Query  249  SNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSN  428
            S+ G   +S S S          +   T+ R+  T   T AS  SP N        NK+N
Sbjct  153  SDYGGRNLSSSSSMQEEHGGPSASASATFCRESDTTMMTWASFESPHN------LKNKTN  206

Query  429  DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT  608
            D++   + HS    ++ + DED++  +G+S+ ST+RSRAAA HNQSERKRRD+INQ+MK 
Sbjct  207  DED--FISHS----DMENHDEDQETKSGRSN-STRRSRAAATHNQSERKRRDRINQKMKA  259

Query  609  LQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            LQKLVPN+ KTDKASMLDEVIEYLKQLQAQVQ
Sbjct  260  LQKLVPNACKTDKASMLDEVIEYLKQLQAQVQ  291



>ref|XP_004983681.1| PREDICTED: transcription factor UNE10-like isoform X1 [Setaria 
italica]
Length=499

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 123/229 (54%), Gaps = 55/229 (24%)
 Frame = +3

Query  81   DALVPCannnnsntn--------tpaataRVAGFSGLVGSCSGAGAATR--EASLARVGG  230
            DALVPCA                +    ARV G  GLV +  G+ A  R  E++L  + G
Sbjct  154  DALVPCAARVVDEAAEGGDAADASRRKRARVVGEDGLVCASQGSAAPGRRGESALLTLDG  213

Query  231  AAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSP--ENTS--  398
                     GAD +           +      T+ DRD           GSP  ENTS  
Sbjct  214  GC-----GTGADDLCGF--------TTTTNNSTSLDRD---------DKGSPDTENTSIG  251

Query  399  ---SDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG----KSSVSTKRSRAAAIH  557
               SD +C ++            RSQR+   D+ +    NG    +SS+STKRSRAAAIH
Sbjct  252  GGASDSRCFSR------------RSQRDGLCDEGENVVINGDGAVRSSISTKRSRAAAIH  299

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N+SERKRRD+INQ+MKTLQKLVPNSSKTDKASMLDEVI+YLKQLQAQVQ
Sbjct  300  NESERKRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIDYLKQLQAQVQ  348



>ref|XP_004983682.1| PREDICTED: transcription factor UNE10-like isoform X2 [Setaria 
italica]
Length=498

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 123/229 (54%), Gaps = 55/229 (24%)
 Frame = +3

Query  81   DALVPCannnnsntn--------tpaataRVAGFSGLVGSCSGAGAATR--EASLARVGG  230
            DALVPCA                +    ARV G  GLV +  G+ A  R  E++L  + G
Sbjct  154  DALVPCAARVVDEAAEGGDAADASRRKRARVVGEDGLVCASQGSAAPGRRGESALLTLDG  213

Query  231  AAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSP--ENTS--  398
                     GAD +           +      T+ DRD           GSP  ENTS  
Sbjct  214  GC-----GTGADDLCGF--------TTTTNNSTSLDRD---------DKGSPDTENTSIG  251

Query  399  ---SDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNG----KSSVSTKRSRAAAIH  557
               SD +C ++            RSQR+   D+ +    NG    +SS+STKRSRAAAIH
Sbjct  252  GGASDSRCFSR------------RSQRDGLCDEGENVVINGDGAVRSSISTKRSRAAAIH  299

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N+SERKRRD+INQ+MKTLQKLVPNSSKTDKASMLDEVI+YLKQLQAQVQ
Sbjct  300  NESERKRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIDYLKQLQAQVQ  348



>ref|XP_010663295.1| PREDICTED: transcription factor PIF7 isoform X4 [Vitis vinifera]
Length=420

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 11/125 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
            T+ RD  T   T  S  SP +  +      K+ D++  S CH  S+ +   +D + K   
Sbjct  159  TFCRDNETTMMTWPSSESPRSLKA------KTTDED--SACHGGSENQ--DEDRETKTQT  208

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            G+S  ST+RSRAAAIHNQSER+RRD+INQ+MKTLQKLVPNSSKTDKASMLDEVIEYLKQL
Sbjct  209  GRSH-STRRSRAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  267

Query  690  QAQVQ  704
            QAQVQ
Sbjct  268  QAQVQ  272



>gb|EEC67419.1| hypothetical protein OsI_34609 [Oryza sativa Indica Group]
Length=465

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 90/121 (74%), Gaps = 23/121 (19%)
 Frame = +3

Query  378  GSPE--NTS-----SDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKK---KGNG--KSS  521
            GSPE  NTS     SD +C ++           S+SQR  G  DED+    +G G  +SS
Sbjct  220  GSPETENTSIAGGASDSRCFSR----------RSQSQRG-GMCDEDEHVVIRGEGAMRSS  268

Query  522  VSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            +STKRSRAAAIHN+SERKRRD+INQ+MKTLQKLVPNSSKTDKASMLDEVI+YLKQLQAQV
Sbjct  269  ISTKRSRAAAIHNESERKRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIDYLKQLQAQV  328

Query  702  Q  704
            Q
Sbjct  329  Q  329



>ref|XP_010663296.1| PREDICTED: transcription factor UNE10 isoform X5 [Vitis vinifera]
Length=387

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 11/125 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
            T+ RD  T   T  S  SP +  +      K+ D++  S CH  S+ +   +D + K   
Sbjct  126  TFCRDNETTMMTWPSSESPRSLKA------KTTDED--SACHGGSENQ--DEDRETKTQT  175

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            G+S  ST+RSRAAAIHNQSER+RRD+INQ+MKTLQKLVPNSSKTDKASMLDEVIEYLKQL
Sbjct  176  GRSH-STRRSRAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  234

Query  690  QAQVQ  704
            QAQVQ
Sbjct  235  QAQVQ  239



>emb|CBI15153.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 11/125 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
            T+ RD  T   T  S  SP +  +      K+ D++  S CH  S+ +   +D + K   
Sbjct  126  TFCRDNETTMMTWPSSESPRSLKA------KTTDED--SACHGGSENQ--DEDRETKTQT  175

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            G+S  ST+RSRAAAIHNQSER+RRD+INQ+MKTLQKLVPNSSKTDKASMLDEVIEYLKQL
Sbjct  176  GRSH-STRRSRAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  234

Query  690  QAQVQ  704
            QAQVQ
Sbjct  235  QAQVQ  239



>ref|XP_010663294.1| PREDICTED: transcription factor PIF7 isoform X2 [Vitis vinifera]
Length=424

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 11/125 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
            T+ RD  T   T  S  SP +  +      K+ D++  S CH  S+ +   +D + K   
Sbjct  164  TFCRDNETTMMTWPSSESPRSLKA------KTTDED--SACHGGSENQ--DEDRETKTQT  213

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            G+S  ST+RSRAAAIHNQSER+RRD+INQ+MKTLQKLVPNSSKTDKASMLDEVIEYLKQL
Sbjct  214  GRSH-STRRSRAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  272

Query  690  QAQVQ  704
            QAQVQ
Sbjct  273  QAQVQ  277



>ref|XP_002284441.1| PREDICTED: transcription factor PIF7 isoform X3 [Vitis vinifera]
Length=423

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 11/125 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
            T+ RD  T   T  S  SP +  +      K+ D++  S CH  S+ +   +D + K   
Sbjct  164  TFCRDNETTMMTWPSSESPRSLKA------KTTDED--SACHGGSENQ--DEDRETKTQT  213

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            G+S  ST+RSRAAAIHNQSER+RRD+INQ+MKTLQKLVPNSSKTDKASMLDEVIEYLKQL
Sbjct  214  GRSH-STRRSRAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  272

Query  690  QAQVQ  704
            QAQVQ
Sbjct  273  QAQVQ  277



>ref|XP_010663293.1| PREDICTED: transcription factor PIF7 isoform X1 [Vitis vinifera]
Length=425

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 11/125 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGN  509
            T+ RD  T   T  S  SP +  +      K+ D++  S CH  S+ +   +D + K   
Sbjct  164  TFCRDNETTMMTWPSSESPRSLKA------KTTDED--SACHGGSENQ--DEDRETKTQT  213

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            G+S  ST+RSRAAAIHNQSER+RRD+INQ+MKTLQKLVPNSSKTDKASMLDEVIEYLKQL
Sbjct  214  GRSH-STRRSRAAAIHNQSERRRRDRINQKMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  272

Query  690  QAQVQ  704
            QAQVQ
Sbjct  273  QAQVQ  277



>ref|XP_008658345.1| PREDICTED: transcription factor UNE10 isoform X2 [Zea mays]
Length=490

 Score =   125 bits (313),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 88/122 (72%), Gaps = 25/122 (20%)
 Frame = +3

Query  378  GSP--ENTS-----SDKQCTNKSNDDNDHSVCHSRSQRE-IGSDDEDKKKGNG-----KS  518
            GSP  ENTS     SD +C ++            RSQR+ +  DDE+    NG     +S
Sbjct  246  GSPDTENTSIGGGASDSRCFSR------------RSQRDGLCDDDEENVVINGDDGAMRS  293

Query  519  SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQ  698
            S+STKRSRAAA HN+SERKRRD+INQ+MKTLQKLVPNS+KTDKASMLDEVI+YLKQLQAQ
Sbjct  294  SISTKRSRAAATHNESERKRRDRINQKMKTLQKLVPNSNKTDKASMLDEVIDYLKQLQAQ  353

Query  699  VQ  704
            VQ
Sbjct  354  VQ  355



>ref|XP_008658350.1| PREDICTED: transcription factor UNE10 isoform X4 [Zea mays]
Length=489

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 88/122 (72%), Gaps = 25/122 (20%)
 Frame = +3

Query  378  GSP--ENTS-----SDKQCTNKSNDDNDHSVCHSRSQRE-IGSDDEDKKKGNG-----KS  518
            GSP  ENTS     SD +C ++            RSQR+ +  DDE+    NG     +S
Sbjct  246  GSPDTENTSIGGGASDSRCFSR------------RSQRDGLCDDDEENVVINGDDGAMRS  293

Query  519  SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQ  698
            S+STKRSRAAA HN+SERKRRD+INQ+MKTLQKLVPNS+KTDKASMLDEVI+YLKQLQAQ
Sbjct  294  SISTKRSRAAATHNESERKRRDRINQKMKTLQKLVPNSNKTDKASMLDEVIDYLKQLQAQ  353

Query  699  VQ  704
            VQ
Sbjct  354  VQ  355



>ref|XP_010234992.1| PREDICTED: transcription factor UNE10 isoform X2 [Brachypodium 
distachyon]
Length=452

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDD------EDKKKGNGKSSVSTKRS  539
            GSPE T+ +      +  D+ +     RSQR+   D+      +++     +SS+STKRS
Sbjct  202  GSPEETTENTSFGGGAASDSRY--FSRRSQRDGLCDEAETVVIKEEPPMRMRSSISTKRS  259

Query  540  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RAAAIHN+SERKRRD+INQ+M+TLQKLVPNSSKTDKASMLDEVIE+LKQLQAQVQ
Sbjct  260  RAAAIHNESERKRRDRINQKMQTLQKLVPNSSKTDKASMLDEVIEHLKQLQAQVQ  314



>ref|XP_003574318.1| PREDICTED: transcription factor UNE10 isoform X1 [Brachypodium 
distachyon]
Length=453

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDD------EDKKKGNGKSSVSTKRS  539
            GSPE T+ +      +  D+ +     RSQR+   D+      +++     +SS+STKRS
Sbjct  202  GSPEETTENTSFGGGAASDSRY--FSRRSQRDGLCDEAETVVIKEEPPMRMRSSISTKRS  259

Query  540  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RAAAIHN+SERKRRD+INQ+M+TLQKLVPNSSKTDKASMLDEVIE+LKQLQAQVQ
Sbjct  260  RAAAIHNESERKRRDRINQKMQTLQKLVPNSSKTDKASMLDEVIEHLKQLQAQVQ  314



>ref|XP_010678431.1| PREDICTED: transcription factor PIF7 [Beta vulgaris subsp. vulgaris]
Length=482

 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  399  SDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKR  578
            S + CT      ++ S CH  S+ +   ++E   KG    S +T++ RAAA+HNQSER+R
Sbjct  232  SPRSCTRTKTTTDEDSACHDGSENQ---EEERDTKGETGRSYTTRKGRAAAVHNQSERRR  288

Query  579  RDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RD+INQ+MK LQKLVPN+SKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  289  RDRINQKMKALQKLVPNASKTDKASMLDEVIEYLKQLQAQVQ  330



>dbj|BAJ92626.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 103/159 (65%), Gaps = 30/159 (19%)
 Frame = +3

Query  282  GSATYGR-DSQQVTIE---TTYDRDLG---TEAYTSASMGSPE--NTS-----SDKQCTN  419
            GSA  GR +S  +T+E   T  D   G   T   TS   GSPE  NTS     SD +C +
Sbjct  170  GSAAPGRGESSLLTLEPCGTGADDLCGFTTTNNSTSLDQGSPETENTSFGGGASDSRCFS  229

Query  420  KSNDDNDHSVCHSRSQREIGSDDED----KKKGNGKSSVSTKRSRAAAIHNQSERKRRDK  587
            +            RSQR+   D+ +    K +   +S++STKRSRAAAIHN+SERKRRD+
Sbjct  230  R------------RSQRDGLCDEAENVVVKGEAPMRSAISTKRSRAAAIHNESERKRRDR  277

Query  588  INQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            INQ+M+TLQKLVPNSSKTDKASMLDEVI++LKQLQA VQ
Sbjct  278  INQKMQTLQKLVPNSSKTDKASMLDEVIDHLKQLQATVQ  316



>dbj|BAJ99017.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 103/159 (65%), Gaps = 30/159 (19%)
 Frame = +3

Query  282  GSATYGR-DSQQVTIE---TTYDRDLG---TEAYTSASMGSPE--NTS-----SDKQCTN  419
            GSA  GR +S  +T+E   T  D   G   T   TS   GSPE  NTS     SD +C +
Sbjct  170  GSAAPGRGESSLLTLEPCGTGADDLCGFTTTNNSTSLDQGSPETENTSFGGGASDSRCFS  229

Query  420  KSNDDNDHSVCHSRSQREIGSDDED----KKKGNGKSSVSTKRSRAAAIHNQSERKRRDK  587
            +            RSQR+   D+ +    K +   +S++STKRSRAAAIHN+SERKRRD+
Sbjct  230  R------------RSQRDGLCDEAENVVVKGEAPMRSAISTKRSRAAAIHNESERKRRDR  277

Query  588  INQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            INQ+M+TLQKLVPNSSKTDKASMLDEVI++LKQLQA VQ
Sbjct  278  INQKMQTLQKLVPNSSKTDKASMLDEVIDHLKQLQATVQ  316



>ref|XP_006837031.1| hypothetical protein AMTR_s00110p00030150 [Amborella trichopoda]
 gb|ERM99884.1| hypothetical protein AMTR_s00110p00030150 [Amborella trichopoda]
Length=427

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 111/186 (60%), Gaps = 29/186 (16%)
 Frame = +3

Query  147  VAGFSGLVGSCSGAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIE  326
            VA  SG+ G+  G+    RE S     G  A   S      +  +GS ++GRD     IE
Sbjct  139  VASTSGICGNSEGS-LRDREKS---TPGFVAEGASEGACTTVDDNGSGSFGRD-----IE  189

Query  327  TTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKG  506
            TT+         T AS+ SP +T     C++K         C  RSQ E   DDE + K 
Sbjct  190  TTW--------MTWASLESPSSTG-KADCSSK---------CKRRSQAE--KDDEVENKT  229

Query  507  NGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQ  686
            +   S STKRSR+A +HNQSER+RRD+IN+RMK LQKLVPN+SKTDKASMLDEVIEYLKQ
Sbjct  230  DTGRSQSTKRSRSATVHNQSERRRRDRINERMKALQKLVPNASKTDKASMLDEVIEYLKQ  289

Query  687  LQAQVQ  704
            LQAQVQ
Sbjct  290  LQAQVQ  295



>ref|XP_006581991.1| PREDICTED: transcription factor UNE10-like isoform X2 [Glycine 
max]
Length=370

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +3

Query  438  DHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQK  617
            + S CH  S+     DD D K   G+S+ S +RSR AAIHNQSERKRRD+INQ+MK LQ+
Sbjct  155  EDSACHCGSEIRDNQDDRDSKAEVGQSN-SKRRSRTAAIHNQSERKRRDRINQKMKALQR  213

Query  618  LVPNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            LVPN++KTDKASMLDEVI YLKQLQAQ+QMM+  +M  MM PL
Sbjct  214  LVPNANKTDKASMLDEVINYLKQLQAQIQMMNMTSMPQMMVPL  256



>ref|XP_008658344.1| PREDICTED: transcription factor UNE10 isoform X1 [Zea mays]
Length=491

 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 26/123 (21%)
 Frame = +3

Query  378  GSP--ENTS-----SDKQCTNKSNDDNDHSVCHSRSQRE-IGSDDEDKKKGNG-----KS  518
            GSP  ENTS     SD +C ++            RSQR+ +  DDE+    NG     +S
Sbjct  246  GSPDTENTSIGGGASDSRCFSR------------RSQRDGLCDDDEENVVINGDDGAMRS  293

Query  519  SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK-TDKASMLDEVIEYLKQLQA  695
            S+STKRSRAAA HN+SERKRRD+INQ+MKTLQKLVPNS+K TDKASMLDEVI+YLKQLQA
Sbjct  294  SISTKRSRAAATHNESERKRRDRINQKMKTLQKLVPNSNKQTDKASMLDEVIDYLKQLQA  353

Query  696  QVQ  704
            QVQ
Sbjct  354  QVQ  356



>ref|XP_007037472.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY21973.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
Length=366

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 124/222 (56%), Gaps = 53/222 (24%)
 Frame = +3

Query  486   DEDKK-KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
             DED++ +G    S ST+RSRAAAIHN SER+RRD+INQ+M+TLQKLVPN+SKTDKASMLD
Sbjct  155   DEDRETRGETGRSHSTRRSRAAAIHNLSERRRRDRINQKMRTLQKLVPNASKTDKASMLD  214

Query  663   EVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdm  842
             EVIEYLKQLQAQVQMMS  +M  MM PL                  M +   MGMG++D+
Sbjct  215   EVIEYLKQLQAQVQMMSMRSMPQMMVPL-----------GMQQHLQMSLLARMGMGMLDI  263

Query  843   NSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMP-----  1007
             NS+A    +S    +P L+HP+  +                   +P   A  M+P     
Sbjct  264   NSMARFPSQS----LPPLMHPSPVTVPPTF--------------LPPFVAPPMIPTREAA  305

Query  1008  ---------------DPLTAFLASQSQPMTMDAYSRMAALYQ  1088
                            DP  A LA   Q + MD YS+MAALY+
Sbjct  306   QANSDAISNASVPLPDPYCALLA---QSVNMDLYSKMAALYR  344



>ref|XP_008658346.1| PREDICTED: transcription factor UNE10 isoform X3 [Zea mays]
Length=490

 Score =   120 bits (300),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 26/123 (21%)
 Frame = +3

Query  378  GSP--ENTS-----SDKQCTNKSNDDNDHSVCHSRSQRE-IGSDDEDKKKGNG-----KS  518
            GSP  ENTS     SD +C ++            RSQR+ +  DDE+    NG     +S
Sbjct  246  GSPDTENTSIGGGASDSRCFSR------------RSQRDGLCDDDEENVVINGDDGAMRS  293

Query  519  SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK-TDKASMLDEVIEYLKQLQA  695
            S+STKRSRAAA HN+SERKRRD+INQ+MKTLQKLVPNS+K TDKASMLDEVI+YLKQLQA
Sbjct  294  SISTKRSRAAATHNESERKRRDRINQKMKTLQKLVPNSNKQTDKASMLDEVIDYLKQLQA  353

Query  696  QVQ  704
            QVQ
Sbjct  354  QVQ  356



>ref|XP_006581990.1| PREDICTED: transcription factor UNE10-like isoform X1 [Glycine 
max]
Length=402

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +3

Query  444  SVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLV  623
            S CH  S+     DD D K   G+S+ S +RSR AAIHNQSERKRRD+INQ+MK LQ+LV
Sbjct  157  SACHCGSEIRDNQDDRDSKAEVGQSN-SKRRSRTAAIHNQSERKRRDRINQKMKALQRLV  215

Query  624  PNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            PN++KTDKASMLDEVI YLKQLQAQ+QMM+  +M  MM PL
Sbjct  216  PNANKTDKASMLDEVINYLKQLQAQIQMMNMTSMPQMMVPL  256



>gb|KHN06901.1| Transcription factor PIF7 [Glycine soja]
Length=406

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +3

Query  444  SVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLV  623
            S CH  S+     DD D K   G+S+ S +RSR AAIHNQSERKRRD+INQ+MK LQ+LV
Sbjct  161  SACHCGSEIRDNQDDRDSKAEVGQSN-SKRRSRTAAIHNQSERKRRDRINQKMKALQRLV  219

Query  624  PNSSKTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            PN++KTDKASMLDEVI YLKQLQAQ+QMM+  +M  MM PL
Sbjct  220  PNANKTDKASMLDEVINYLKQLQAQIQMMNMTSMPQMMVPL  260



>gb|KHN43754.1| Transcription factor PIF7, partial [Glycine soja]
Length=281

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 97/157 (62%), Gaps = 20/157 (13%)
 Frame = +3

Query  276  MSGSATYGRDSQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCH  455
            +SG A+ G          T+ RD  T   T AS+ S  N  + +          + S CH
Sbjct  112  LSGCASAG---------ATFCRDNDTAMITWASLESGRNLKTIE----------EDSACH  152

Query  456  SRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSS  635
              S+     DD D K   G+S+ S +RSR AAIHNQSERKRRD INQ+MK LQ LVPN++
Sbjct  153  CGSEIRDNQDDRDSKAEVGQSN-SKRRSRTAAIHNQSERKRRDIINQKMKALQGLVPNAN  211

Query  636  KTDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPL  746
            KTDKASMLDEVI YLKQLQAQ+QMM+R ++  MM PL
Sbjct  212  KTDKASMLDEVINYLKQLQAQIQMMNRTSLPQMMVPL  248



>ref|XP_007037470.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007037471.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY21971.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY21972.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=422

 Score =   119 bits (297),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 124/222 (56%), Gaps = 53/222 (24%)
 Frame = +3

Query  486   DEDKK-KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
             DED++ +G    S ST+RSRAAAIHN SER+RRD+INQ+M+TLQKLVPN+SKTDKASMLD
Sbjct  211   DEDRETRGETGRSHSTRRSRAAAIHNLSERRRRDRINQKMRTLQKLVPNASKTDKASMLD  270

Query  663   EVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdm  842
             EVIEYLKQLQAQVQMMS  +M  MM PL                  M +   MGMG++D+
Sbjct  271   EVIEYLKQLQAQVQMMSMRSMPQMMVPL-----------GMQQHLQMSLLARMGMGMLDI  319

Query  843   NSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMP-----  1007
             NS+A    +S    +P L+HP+  +                   +P   A  M+P     
Sbjct  320   NSMARFPSQS----LPPLMHPSPVTVPPTF--------------LPPFVAPPMIPTREAA  361

Query  1008  ---------------DPLTAFLASQSQPMTMDAYSRMAALYQ  1088
                            DP  A LA   Q + MD YS+MAALY+
Sbjct  362   QANSDAISNASVPLPDPYCALLA---QSVNMDLYSKMAALYR  400



>ref|XP_007037473.1| DNA binding protein, putative isoform 4 [Theobroma cacao]
 gb|EOY21974.1| DNA binding protein, putative isoform 4 [Theobroma cacao]
Length=397

 Score =   118 bits (296),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 124/222 (56%), Gaps = 53/222 (24%)
 Frame = +3

Query  486   DEDKK-KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
             DED++ +G    S ST+RSRAAAIHN SER+RRD+INQ+M+TLQKLVPN+SKTDKASMLD
Sbjct  186   DEDRETRGETGRSHSTRRSRAAAIHNLSERRRRDRINQKMRTLQKLVPNASKTDKASMLD  245

Query  663   EVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmgmgmgvmdm  842
             EVIEYLKQLQAQVQMMS  +M  MM PL                  M +   MGMG++D+
Sbjct  246   EVIEYLKQLQAQVQMMSMRSMPQMMVPL-----------GMQQHLQMSLLARMGMGMLDI  294

Query  843   NSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASSMMP-----  1007
             NS+A    +S    +P L+HP+  +                   +P   A  M+P     
Sbjct  295   NSMARFPSQS----LPPLMHPSPVTVPPTF--------------LPPFVAPPMIPTREAA  336

Query  1008  ---------------DPLTAFLASQSQPMTMDAYSRMAALYQ  1088
                            DP  A LA   Q + MD YS+MAALY+
Sbjct  337   QANSDAISNASVPLPDPYCALLA---QSVNMDLYSKMAALYR  375



>ref|XP_009630767.1| PREDICTED: transcription factor UNE10-like isoform X3 [Nicotiana 
tomentosiformis]
Length=431

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 6/107 (6%)
 Frame = +3

Query  384  PENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQ  563
            P    S +   +K+  D D S CH     + GS +  +++   K S S++RSRAA +HNQ
Sbjct  173  PSFDESSRSIKSKTTCDED-SACH-----DGGSQENKEEEHETKGSNSSRRSRAAVVHNQ  226

Query  564  SERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            SER+RRD+INQ+MKTLQ+LVPN+SKTDKASMLDEVI YLKQLQAQVQ
Sbjct  227  SERRRRDRINQKMKTLQRLVPNASKTDKASMLDEVINYLKQLQAQVQ  273



>gb|KDO54570.1| hypothetical protein CISIN_1g026943mg [Citrus sinensis]
Length=230

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 7/102 (7%)
 Frame = +3

Query  399  SDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKR  578
            S K    K+ D++  S  H RS+ +    DED +   G+S  S+KR R AA+HNQSER+R
Sbjct  9    SLKSLKTKTTDED--SASHGRSENQ----DEDHETKTGRSH-SSKRRRTAAVHNQSERRR  61

Query  579  RDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RD+INQ+MK LQKLVPN+SKTDKASMLDEVI+YLKQL+AQVQ
Sbjct  62   RDRINQKMKALQKLVPNASKTDKASMLDEVIDYLKQLKAQVQ  103



>gb|KDP31307.1| hypothetical protein JCGZ_11683 [Jatropha curcas]
Length=422

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +3

Query  432  DNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTL  611
            D D +  H  S+ +   DD+ + +     S S+KRSRAAA+HNQSER+RRD+INQ+MK L
Sbjct  202  DEDSAASHGGSENQ---DDDQETRTETVRSHSSKRSRAAAVHNQSERRRRDRINQKMKAL  258

Query  612  QKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            QKLVPN+SKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  259  QKLVPNASKTDKASMLDEVIEYLKQLQAQVQ  289



>ref|XP_002514702.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF47808.1| DNA binding protein, putative [Ricinus communis]
Length=440

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 12/140 (9%)
 Frame = +3

Query  330  TYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKK-KG  506
            T+ R+  T   T AS  SP  +        K+   ++ S  H  S+ +    DED++ K 
Sbjct  187  TFCRESDTTMMTWASFESPPPSL-------KAKTTDEDSASHGGSENQ----DEDRETKT  235

Query  507  NGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQ  686
                S S++R+RAAA+HNQSER+RRD+INQ+MK LQKLVPN+SKTDKASMLDEVIEYLKQ
Sbjct  236  ETVRSHSSRRTRAAAVHNQSERRRRDRINQKMKALQKLVPNASKTDKASMLDEVIEYLKQ  295

Query  687  LQAQVQmmsrmnmspmmFPL  746
            LQAQVQ MS  NM  MM PL
Sbjct  296  LQAQVQAMSVRNMPQMMMPL  315



>ref|XP_009630765.1| PREDICTED: transcription factor UNE10-like isoform X1 [Nicotiana 
tomentosiformis]
Length=446

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 6/107 (6%)
 Frame = +3

Query  384  PENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQ  563
            P    S +   +K+  D D S CH     + GS +  +++   K S S++RSRAA +HNQ
Sbjct  188  PSFDESSRSIKSKTTCDED-SACH-----DGGSQENKEEEHETKGSNSSRRSRAAVVHNQ  241

Query  564  SERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            SER+RRD+INQ+MKTLQ+LVPN+SKTDKASMLDEVI YLKQLQAQVQ
Sbjct  242  SERRRRDRINQKMKTLQRLVPNASKTDKASMLDEVINYLKQLQAQVQ  288



>ref|XP_008802832.1| PREDICTED: transcription factor UNE10-like [Phoenix dactylifera]
Length=304

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +3

Query  474  IGSDDED--KKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDK  647
            + +D+E   K+    + S ST+RSRAAAIHNQSERKRR++INQ+MKTL KLVPNSSK+DK
Sbjct  16   VCADEEKVMKESAGRRVSASTRRSRAAAIHNQSERKRRNRINQKMKTLHKLVPNSSKSDK  75

Query  648  ASMLDEVIEYLKQLQAQV  701
            ASMLDEVIEYLKQLQAQV
Sbjct  76   ASMLDEVIEYLKQLQAQV  93



>ref|XP_010037189.1| PREDICTED: transcription factor PIF7 [Eucalyptus grandis]
 gb|KCW48869.1| hypothetical protein EUGRSUZ_K02496 [Eucalyptus grandis]
Length=429

 Score =   115 bits (289),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = +3

Query  417  NKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQ  596
            NK+ DD+D S  H  S+  +  DDEDK  G      ST+RSRA+ IHN SER+RRD+INQ
Sbjct  207  NKTTDDDD-SASHGESE-NLDEDDEDK--GEIGPPQSTRRSRASTIHNLSERRRRDRINQ  262

Query  597  RMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +MK LQ+LVP +SKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  263  KMKALQRLVPKASKTDKASMLDEVIEYLKQLQAQVQ  298



>emb|CDP17490.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   116 bits (290),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  483  DDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
            D+E   KG    S S +RSRAAA+HNQSER+RRD+INQ+MK LQKLVPN+SKTDKASMLD
Sbjct  226  DEEQGAKGGIVQSCSARRSRAAAVHNQSERRRRDRINQKMKALQKLVPNASKTDKASMLD  285

Query  663  EVIEYLKQLQAQV  701
            EVIEYLKQLQAQV
Sbjct  286  EVIEYLKQLQAQV  298



>ref|XP_009630766.1| PREDICTED: transcription factor UNE10-like isoform X2 [Nicotiana 
tomentosiformis]
Length=445

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 7/107 (7%)
 Frame = +3

Query  384  PENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQ  563
            P    S +   +K+  D D S CH       G  +  +++   K S S++RSRAA +HNQ
Sbjct  188  PSFDESSRSIKSKTTCDED-SACHD------GGSENKEEEHETKGSNSSRRSRAAVVHNQ  240

Query  564  SERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            SER+RRD+INQ+MKTLQ+LVPN+SKTDKASMLDEVI YLKQLQAQVQ
Sbjct  241  SERRRRDRINQKMKTLQRLVPNASKTDKASMLDEVINYLKQLQAQVQ  287



>ref|XP_006440685.1| hypothetical protein CICLE_v10020323mg [Citrus clementina]
 gb|ESR53925.1| hypothetical protein CICLE_v10020323mg [Citrus clementina]
Length=419

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +3

Query  420  KSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQR  599
            K+   ++ S  H RS+ +    DED +   G+S  S+KR R AA+HNQSER+RRD+INQ+
Sbjct  203  KTKTTDEDSASHGRSENQ----DEDHETKTGRSH-SSKRRRTAAVHNQSERRRRDRINQK  257

Query  600  MKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            MK LQKLVPN+SKTDKASMLDEVI+YLKQL+AQVQ
Sbjct  258  MKALQKLVPNASKTDKASMLDEVIDYLKQLKAQVQ  292



>ref|XP_006477612.1| PREDICTED: transcription factor PIF7-like [Citrus sinensis]
Length=419

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +3

Query  420  KSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQR  599
            K+   ++ S  H RS+ +    DED +   G+S  S+KR R AA+HNQSER+RRD+IN++
Sbjct  203  KTKTTDEDSASHGRSENQ----DEDHETKTGRSH-SSKRRRTAAVHNQSERRRRDRINEK  257

Query  600  MKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            MK LQ+LVPN+SKTDKASMLDEVI+YLKQL+AQVQ
Sbjct  258  MKALQRLVPNASKTDKASMLDEVIDYLKQLKAQVQ  292



>ref|XP_009339115.1| PREDICTED: transcription factor PIF7-like isoform X1 [Pyrus x 
bretschneideri]
Length=398

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 77/122 (63%), Gaps = 8/122 (7%)
 Frame = +3

Query  339  RDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKS  518
            RD  T   T  S  SP +         K+    + S CH   Q+      E  K G    
Sbjct  144  RDNDTTMSTLVSFESPPSL--------KTKSIEEDSACHGGLQKNRDDGRETTKGGKPSR  195

Query  519  SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQ  698
            S ST+  RAAA+HNQSERKRRD+INQ+MK LQ+LVPN+SKT+KASMLDEVI+YL+QLQAQ
Sbjct  196  SHSTRPRRAAAVHNQSERKRRDRINQKMKALQRLVPNASKTNKASMLDEVIKYLQQLQAQ  255

Query  699  VQ  704
            VQ
Sbjct  256  VQ  257



>ref|XP_008239975.1| PREDICTED: transcription factor PIF7 [Prunus mume]
Length=426

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  483  DDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
            DD  +   +G+S  ST+  RAAA+HNQSERKRRD+INQ+MK LQ+LVPN+SKTDKASMLD
Sbjct  180  DDGQETTKDGESGRSTRPKRAAAVHNQSERKRRDRINQKMKALQRLVPNASKTDKASMLD  239

Query  663  EVIEYLKQLQAQVQ  704
            EVI+YL+QLQAQVQ
Sbjct  240  EVIKYLEQLQAQVQ  253



>ref|XP_004242180.1| PREDICTED: transcription factor UNE10-like [Solanum lycopersicum]
Length=414

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 74/90 (82%), Gaps = 7/90 (8%)
 Frame = +3

Query  435  NDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQ  614
            N+ S CH       GS+++++++   KSS  +KRSR AA+HNQSER+RRD+IN++MK LQ
Sbjct  169  NEDSACHG------GSENKEEER-ETKSSNPSKRSRRAAVHNQSERRRRDRINEKMKALQ  221

Query  615  KLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            KLVPN+SKT+KASML+EVI+YLKQLQAQ+Q
Sbjct  222  KLVPNASKTNKASMLEEVIKYLKQLQAQIQ  251



>ref|XP_011087345.1| PREDICTED: transcription factor UNE10-like [Sesamum indicum]
Length=238

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +3

Query  543  AAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            AAAIHNQSER+RRD+IN++MKTLQKLVPN+SKTDKASMLDEVIEYLKQLQAQVQ
Sbjct  18   AAAIHNQSERRRRDRINEKMKTLQKLVPNASKTDKASMLDEVIEYLKQLQAQVQ  71



>ref|XP_009801833.1| PREDICTED: transcription factor PIF7 [Nicotiana sylvestris]
Length=443

 Score =   110 bits (275),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 6/90 (7%)
 Frame = +3

Query  435  NDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQ  614
            N+ S CH      I   +  +++   K S + +RSR AA+HNQSER+RRD+IN++MK LQ
Sbjct  189  NEDSACH------IAGLENKEEERETKGSNTLRRSRTAAVHNQSERRRRDRINEKMKALQ  242

Query  615  KLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            KLVPN+SKTDKASMLDEVI+YLKQLQAQ+Q
Sbjct  243  KLVPNASKTDKASMLDEVIKYLKQLQAQIQ  272



>ref|XP_007210132.1| hypothetical protein PRUPE_ppa022963mg [Prunus persica]
 gb|EMJ11331.1| hypothetical protein PRUPE_ppa022963mg [Prunus persica]
Length=429

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  489  EDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEV  668
            E  K G    S ST+  RAAA+HNQSERKRRD+INQ+MK LQ+LVPN+SKTDKASMLDEV
Sbjct  184  ETTKDGESGRSRSTRPKRAAAVHNQSERKRRDRINQKMKALQRLVPNASKTDKASMLDEV  243

Query  669  IEYLKQLQAQVQ  704
            I+YL+QLQAQVQ
Sbjct  244  IKYLEQLQAQVQ  255



>ref|XP_008374594.1| PREDICTED: transcription factor PIF7-like [Malus domestica]
Length=399

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 78/123 (63%), Gaps = 11/123 (9%)
 Frame = +3

Query  339  RDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHS-RSQREIGSDDEDKKKGNGK  515
            RD  T   T  S  SP +         K+    + S CH     R+ G   E  K G   
Sbjct  144  RDNDTTMSTLVSFESPPSL--------KTKSIEEDSACHGGLKNRDDGR--ETTKGGKSS  193

Query  516  SSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQA  695
             S ST+  RAAA+HNQSERKRRD+INQ+MK LQ+LVPN+SKTDKASMLDEVI+YL+QLQA
Sbjct  194  RSHSTRPRRAAAVHNQSERKRRDRINQKMKALQRLVPNASKTDKASMLDEVIKYLQQLQA  253

Query  696  QVQ  704
            QVQ
Sbjct  254  QVQ  256



>ref|XP_003517013.2| PREDICTED: transcription factor UNE10-like [Glycine max]
Length=183

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +3

Query  513  KSSVSTKRSRA-AAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
            +SS S KR +A + +HNQSER+RRDKINQRMK LQKLVPNSSKTDKASMLDEVI+Y+KQL
Sbjct  7    RSSGSNKRIKANSVVHNQSERRRRDKINQRMKELQKLVPNSSKTDKASMLDEVIQYMKQL  66

Query  690  QAQVQ  704
            QAQVQ
Sbjct  67   QAQVQ  71



>ref|XP_008367556.1| PREDICTED: transcription factor UNE10-like [Malus domestica]
Length=371

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +3

Query  483  DDEDKKKGNGKS-SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASML  659
            D  +  KG G S S ST+  RAAA+HNQSERKRRD INQ++K LQ+LVPN+SKTDKASML
Sbjct  155  DGRETTKGGGSSRSHSTRPRRAAAVHNQSERKRRDLINQKIKALQRLVPNASKTDKASML  214

Query  660  DEVIEYLKQLQAQVQ  704
            DEVI+YL+QLQAQVQ
Sbjct  215  DEVIKYLQQLQAQVQ  229



>ref|XP_009595347.1| PREDICTED: transcription factor PIF7-like [Nicotiana tomentosiformis]
Length=446

 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 6/90 (7%)
 Frame = +3

Query  435  NDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQ  614
            N+ S CH      I   +  + +   K+  +  RSR AA+HNQSER+RRD+IN++MK LQ
Sbjct  189  NEDSACH------IAGLENKETERETKAHNTLGRSRTAAVHNQSERRRRDRINEKMKALQ  242

Query  615  KLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            KLVPN+SKTDKASMLDEVI+YLKQLQAQ+Q
Sbjct  243  KLVPNASKTDKASMLDEVIKYLKQLQAQIQ  272



>gb|KHG21647.1| Transcription factor UNE10 -like protein [Gossypium arboreum]
Length=412

 Score =   107 bits (266),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  483  DDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLD  662
            D+E + +G    S +T+RSRA+AIHN SER+RR +I Q+M TLQKLVPN+SKTDKASMLD
Sbjct  197  DEEQETRGETDRSQATRRSRASAIHNLSERRRRHRIKQKMNTLQKLVPNASKTDKASMLD  256

Query  663  EVIEYLKQLQAQVQ  704
            EVIEYLKQLQ QV+
Sbjct  257  EVIEYLKQLQTQVE  270



>ref|XP_008393195.1| PREDICTED: transcription factor PIF7-like [Malus domestica]
Length=402

 Score =   106 bits (265),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +3

Query  483  DDEDKKKGNGKS-SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASML  659
            D  +  KG G S S ST+  RAAA+HNQSERKRRD INQ++K LQ+LVPN+SKTDKASML
Sbjct  186  DGRETTKGGGSSRSHSTRPRRAAAVHNQSERKRRDLINQKIKALQRLVPNASKTDKASML  245

Query  660  DEVIEYLKQLQAQVQ  704
            DEVI+YL+QLQAQVQ
Sbjct  246  DEVIKYLQQLQAQVQ  260



>ref|XP_006408930.1| hypothetical protein EUTSA_v10001974mg [Eutrema salsugineum]
 gb|ESQ50383.1| hypothetical protein EUTSA_v10001974mg [Eutrema salsugineum]
Length=478

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +3

Query  459  RSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            R +RE   D E+ K+G G S+ STKRSRAA +HN SERKRRD+IN+RMK LQ+L+P  +K
Sbjct  270  RKEREAIDDSEETKQGRG-STTSTKRSRAAQVHNLSERKRRDRINERMKALQELIPRCNK  328

Query  639  TDKASMLDEVIEYLKQLQAQVQ  704
            +DKASMLDE IEY+K LQ Q+Q
Sbjct  329  SDKASMLDEAIEYMKSLQLQIQ  350



>ref|XP_009339116.1| PREDICTED: transcription factor PIF7-like isoform X2 [Pyrus x 
bretschneideri]
Length=397

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 78/123 (63%), Gaps = 11/123 (9%)
 Frame = +3

Query  339  RDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHS-RSQREIGSDDEDKKKGNGK  515
            RD  T   T  S  SP +         K+    + S CH     R+ G   E  K G   
Sbjct  144  RDNDTTMSTLVSFESPPSL--------KTKSIEEDSACHGGLKNRDDGR--ETTKGGKPS  193

Query  516  SSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQA  695
             S ST+  RAAA+HNQSERKRRD+INQ+MK LQ+LVPN+SKT+KASMLDEVI+YL+QLQA
Sbjct  194  RSHSTRPRRAAAVHNQSERKRRDRINQKMKALQRLVPNASKTNKASMLDEVIKYLQQLQA  253

Query  696  QVQ  704
            QVQ
Sbjct  254  QVQ  256



>ref|XP_007204562.1| hypothetical protein PRUPE_ppa014897mg, partial [Prunus persica]
 gb|EMJ05761.1| hypothetical protein PRUPE_ppa014897mg, partial [Prunus persica]
Length=283

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 5/109 (5%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+P  +SS    +    D+ D   C S    E   ++   K G G+SS  +KRSRAA +H
Sbjct  109  GNPNVSSSSFGASENETDEYD---CESEEGLEALVEEAAGKPGCGRSS--SKRSRAAEVH  163

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  164  NMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  212



>ref|XP_009338700.1| PREDICTED: transcription factor PIF7-like isoform X2 [Pyrus x 
bretschneideri]
Length=405

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +3

Query  483  DDEDKKKGNGKSSVS--TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
            DD  K    GKSS S  T+  RAAA+HNQSERKRRD INQ++K LQ+LVPN+SKTDKASM
Sbjct  186  DDGRKTTKGGKSSRSHSTRPGRAAAVHNQSERKRRDLINQKIKALQRLVPNASKTDKASM  245

Query  657  LDEVIEYLKQLQAQVQ  704
            LDEVI+YL+QLQAQVQ
Sbjct  246  LDEVIKYLQQLQAQVQ  261



>ref|XP_009338693.1| PREDICTED: transcription factor PIF7-like isoform X1 [Pyrus x 
bretschneideri]
Length=406

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +3

Query  483  DDEDKKKGNGKSSVS--TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
            DD  K    GKSS S  T+  RAAA+HNQSERKRRD INQ++K LQ+LVPN+SKTDKASM
Sbjct  187  DDGRKTTKGGKSSRSHSTRPGRAAAVHNQSERKRRDLINQKIKALQRLVPNASKTDKASM  246

Query  657  LDEVIEYLKQLQAQVQ  704
            LDEVI+YL+QLQAQVQ
Sbjct  247  LDEVIKYLQQLQAQVQ  262



>ref|XP_008241481.1| PREDICTED: transcription factor SPATULA isoform X3 [Prunus mume]
Length=337

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 5/109 (5%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+P  +SS    +    D+ D   C S    E   ++   K G G+SS  +KRSRAA +H
Sbjct  109  GNPNVSSSSFGASENETDEYD---CESEEGLEALVEEAAGKPGCGRSS--SKRSRAAEVH  163

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  164  NMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  212



>gb|ADG56590.1| ALCATRAZ/SPATULA-like protein [Prunus persica]
Length=386

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 5/109 (5%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+P  +SS    +    D+ D   C S    E   ++   K G G+SS  +KRSRAA +H
Sbjct  109  GNPNVSSSSFGASENETDEYD---CESEEGLEALVEEAAGKPGCGRSS--SKRSRAAEVH  163

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  164  NMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  212



>gb|KHN49105.1| Transcription factor UNE10 [Glycine soja]
Length=409

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 109/162 (67%), Gaps = 6/162 (4%)
 Frame = +3

Query  639   TDKASMLDEVIEYLKQLQAQVQmmsrmnmspmmFPLamqqqlqmsmmapaaaaamgmnmg  818
             TDKASMLDEVIEYLKQLQAQVQMM+R+NMS MM PL MQQQLQMSMM+P           
Sbjct  253   TDKASMLDEVIEYLKQLQAQVQMMNRINMSSMMLPLTMQQQLQMSMMSPMGMGLGMGMGM  312

Query  819   mgmgvmdmNSVAAAAGRSNIPGIPGLLHpaaasaaaaafmpmaaWWENSLDRMPTAAASS  998
                  MDMNS+     R+NIPGIP +LHP+A    AA++   AA      DR+     +S
Sbjct  313   GMGMGMDMNSM----NRANIPGIPPVLHPSAFMPMAASWDAAAAAAAGGGDRL-QGTPAS  367

Query  999   MMPDPLTAFLASQSQPMTMDAYSRMAALYQQFQQAP-GGTKN  1121
             +MPDPL+     QSQPMTMDAYSR+AA+YQQ  Q P  G+KN
Sbjct  368   VMPDPLSTIFGCQSQPMTMDAYSRLAAMYQQLHQPPTSGSKN  409


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 80/153 (52%), Gaps = 19/153 (12%)
 Frame = +3

Query  3    VPWFDHHgggagdnpaaaaaSVTVTMDALVPCannnnsntntpaataRVAGFSGLVGSCS  182
            VPWFD H             + T+TMDALVPC+N             +  G     G+C 
Sbjct  117  VPWFDPHAAATTTTTT----TNTMTMDALVPCSNREQG---------KKKGMEPGPGTCM  163

Query  183  GAGAATREASLARVGGAAAHDWSNRGADQMSMSGSATYGRDSQQVTIETTYDRDLGTEAY  362
              G +TR  S     GA  H+ S R  DQ S+SGSAT+GRDS+ VT++T  DR+ G  A+
Sbjct  164  -VGCSTRVGSCCGGKGAKGHEASGR--DQ-SVSGSATFGRDSKHVTLDTC-DREFGV-AF  217

Query  363  TSASMGSPENTSSDKQCTNKSNDDNDHSVCHSR  461
            TS S+ S ENTS  K CT  +  +   SV HS+
Sbjct  218  TSTSINSLENTSYAKHCTKTTTIEEHDSVSHSK  250



>ref|XP_001766358.1| predicted protein [Physcomitrella patens]
 gb|EDQ68686.1| predicted protein [Physcomitrella patens]
Length=81

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +3

Query  495  KKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIE  674
            KK   G+ S + KRSRAA +HNQSER+RRD+IN++M+ LQ+L+PNS+KTDKASMLDE IE
Sbjct  9    KKPVTGRGS-TAKRSRAAEVHNQSERRRRDRINEKMRALQELIPNSNKTDKASMLDEAIE  67

Query  675  YLKQLQAQVQ  704
            YLK LQ Q+Q
Sbjct  68   YLKMLQLQLQ  77



>ref|XP_009109363.1| PREDICTED: transcription factor SPATULA-like [Brassica rapa]
 emb|CDY44048.1| BnaA08g15580D [Brassica napus]
Length=341

 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ D   C S    E+  DDE       KS  S+KR RAA +HN SE+KRR +IN++M
Sbjct  130  SGNETDEYDCESEEGVEVVFDDELL----CKSRTSSKRCRAAEVHNLSEKKRRSRINEKM  185

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  186  KALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  219



>ref|XP_008241480.1| PREDICTED: transcription factor SPATULA isoform X2 [Prunus mume]
Length=399

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 8/117 (7%)
 Frame = +3

Query  363  TSASM---GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
            +SAS+   G+P  +SS    +    D+ D   C S    E   ++   K G G+SS  +K
Sbjct  101  SSASLMPAGNPNVSSSSFGASENETDEYD---CESEEGLEALVEEAAGKPGCGRSS--SK  155

Query  534  RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  156  RSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  212



>ref|XP_010688822.1| PREDICTED: transcription factor ALC-like [Beta vulgaris subsp. 
vulgaris]
Length=281

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +3

Query  480  SDDEDK-KKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
            S+DE + K  +G+SS  +KR+RAA +HN SE++RR +IN++MK LQKL+PNSSKTDKASM
Sbjct  92   SEDETRVKSASGRSS--SKRTRAAEVHNMSEKRRRQRINEKMKALQKLIPNSSKTDKASM  149

Query  657  LDEVIEYLKQLQAQVQ  704
            LDE I+YLKQLQ QVQ
Sbjct  150  LDEAIDYLKQLQLQVQ  165



>ref|XP_002981138.1| hypothetical protein SELMODRAFT_114141, partial [Selaginella 
moellendorffii]
 gb|EFJ17839.1| hypothetical protein SELMODRAFT_114141, partial [Selaginella 
moellendorffii]
Length=85

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SER+RRD+IN++MK LQ+L+PNS+KTDKASMLDE IEYLK LQ Q+Q
Sbjct  15   SSKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQ  74



>ref|XP_008241478.1| PREDICTED: transcription factor SPATULA isoform X1 [Prunus mume]
Length=417

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 5/109 (5%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+P  +SS    +    D+ D   C S    E   ++   K G G+SS  +KRSRAA +H
Sbjct  109  GNPNVSSSSFGASENETDEYD---CESEEGLEALVEEAAGKPGCGRSS--SKRSRAAEVH  163

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  164  NMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  212



>ref|XP_002982619.1| hypothetical protein SELMODRAFT_116654, partial [Selaginella 
moellendorffii]
 gb|EFJ16372.1| hypothetical protein SELMODRAFT_116654, partial [Selaginella 
moellendorffii]
Length=85

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SER+RRD+IN++MK LQ+L+PNS+KTDKASMLDE IEYLK LQ Q+Q
Sbjct  15   SSKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQ  74



>ref|XP_002984591.1| hypothetical protein SELMODRAFT_29179, partial [Selaginella moellendorffii]
 gb|EFJ14236.1| hypothetical protein SELMODRAFT_29179, partial [Selaginella moellendorffii]
Length=64

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  528  TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +KRSRAA +HN SERKRRD+IN+RMK LQ+L+PNS+KTDKASMLDE IEYLK LQ Q+Q
Sbjct  4    SKRSRAAEVHNLSERKRRDRINERMKALQELIPNSNKTDKASMLDEAIEYLKLLQHQLQ  62



>ref|XP_006589101.1| PREDICTED: transcription factor PIF3-like [Glycine max]
Length=691

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+ + +    Q   +   D D S CHS    E  +    KK   G+    +KRSRAA +H
Sbjct  409  GTDQGSEEPNQNLKRKRKDTDDSECHSEDVEEESAGA--KKTAGGRGGAGSKRSRAAEVH  466

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SERKRRD+IN++M+ LQ+L+PN +K DKASMLDE IEYLK LQ QVQ
Sbjct  467  NLSERKRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQ  515



>gb|KHN24194.1| Transcription factor PIF3 [Glycine soja]
Length=691

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+ + +    Q   +   D D S CHS    E  +    KK   G+    +KRSRAA +H
Sbjct  409  GTDQGSEEPNQNLKRKRKDTDDSECHSEDVEEESAGA--KKTAGGRGGAGSKRSRAAEVH  466

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SERKRRD+IN++M+ LQ+L+PN +K DKASMLDE IEYLK LQ QVQ
Sbjct  467  NLSERKRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQ  515



>ref|XP_004301128.1| PREDICTED: uncharacterized protein LOC101303618 [Fragaria vesca 
subsp. vesca]
Length=315

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 12/99 (12%)
 Frame = +3

Query  420  KSNDDNDHSVCHSRSQREIGSDDEDKK----KGNGKSSVSTKRSRAAAIHNQSERKRRDK  587
            KSNDD+  S CH       G +++D +    KG+  S   ++  R AAIHNQSERKRRD+
Sbjct  74   KSNDDD--STCHE------GLENQDVERETTKGHESSRSRSRPRRVAAIHNQSERKRRDR  125

Query  588  INQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            INQ+MK LQ+LVPN++KTDKASMLDEVI YL+ LQAQVQ
Sbjct  126  INQKMKALQRLVPNANKTDKASMLDEVIRYLELLQAQVQ  164



>ref|XP_002978656.1| hypothetical protein SELMODRAFT_39143, partial [Selaginella moellendorffii]
 gb|EFJ20103.1| hypothetical protein SELMODRAFT_39143, partial [Selaginella moellendorffii]
Length=66

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  528  TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +KRSRAA +HN SERKRRD+IN+RMK LQ+L+PNS+KTDKASMLDE IEYLK LQ Q+Q
Sbjct  4    SKRSRAAEVHNLSERKRRDRINERMKALQELIPNSNKTDKASMLDEAIEYLKLLQHQLQ  62



>ref|XP_001772223.1| predicted protein [Physcomitrella patens]
 gb|EDQ63036.1| predicted protein [Physcomitrella patens]
Length=78

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +3

Query  495  KKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIE  674
            KK   G+ S + KRSRAA +HNQSER+RRD+IN++M+ LQ+L+PNS+KTDKASML+E IE
Sbjct  9    KKPVTGRGS-TAKRSRAAEVHNQSERRRRDRINEKMRALQELIPNSNKTDKASMLEEAIE  67

Query  675  YLKQLQAQVQ  704
            YLK LQ Q+Q
Sbjct  68   YLKMLQLQLQ  77



>ref|XP_007224914.1| hypothetical protein PRUPE_ppa021918mg [Prunus persica]
 gb|EMJ26113.1| hypothetical protein PRUPE_ppa021918mg [Prunus persica]
Length=330

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 9/90 (10%)
 Frame = +3

Query  462  SQREIGSDDEDKKKGNGKSSVS---------TKRSRAAAIHNQSERKRRDKINQRMKTLQ  614
            S+ ++G    D +KG+ +S V          +KRSRAA +HN SE++RR +IN++MK LQ
Sbjct  129  SENDLGDFSYDSEKGHDRSEVPLNPAPPRSLSKRSRAAEVHNMSEKRRRSRINEKMKALQ  188

Query  615  KLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  189  NLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  218



>ref|XP_010258171.1| PREDICTED: transcription factor UNE10-like [Nelumbo nucifera]
Length=386

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +3

Query  519  SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQ  698
            S+STK+ R A +HNQSER+RRD+INQ+MK LQKLVPNSSKTDKAS+LDEVIEY+KQLQAQ
Sbjct  182  SLSTKK-RDATVHNQSERRRRDRINQKMKALQKLVPNSSKTDKASVLDEVIEYMKQLQAQ  240

Query  699  VQ  704
            +Q
Sbjct  241  IQ  242



>ref|XP_001764602.1| predicted protein [Physcomitrella patens]
 gb|EDQ70584.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   105 bits (261),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +3

Query  414  TNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKIN  593
            T + + + +   C S    +   D + K    G+ S +TKRSRAA +HNQSER+RRD+IN
Sbjct  554  TKRKSSEREEPECQSEDMEDESVDTKQKPATTGRVS-TTKRSRAAEVHNQSERRRRDRIN  612

Query  594  QRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            ++M+ LQ+L+PNS+KTDKASMLDE IEYLK LQ Q+Q
Sbjct  613  EKMRALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQ  649



>dbj|BAF00716.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=407

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 21/155 (14%)
 Frame = +3

Query  258  GADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA-YTSASMGSPENTSSDKQCTNKSNDD  434
            G D  +++G   Y R  + V +        GT +   S S   PE T+ D +        
Sbjct  128  GTDSSAVAGGGAYNRKGKAVAMTAPAIEITGTSSSVVSKSEIEPEKTNVDDR--------  179

Query  435  NDHSVCHSRSQREIGSDDE-----DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQR  599
                    R +RE  + DE     ++ K    S+ STKRSRAA +HN SERKRRD+IN+R
Sbjct  180  -------KRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINER  232

Query  600  MKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            MK LQ+L+P  +K+DKASMLDE IEY+K LQ Q+Q
Sbjct  233  MKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQ  267



>ref|XP_008461998.1| PREDICTED: transcription factor PIF1 [Cucumis melo]
 ref|XP_008461999.1| PREDICTED: transcription factor PIF1 [Cucumis melo]
Length=532

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 102/193 (53%), Gaps = 21/193 (11%)
 Frame = +3

Query  159  SGLVGSC--SGAGAATREASLAR------VGGAAAHDWSNRGADQM---SMSGSATYGRD  305
            S +V SC     G  +R + +AR      V G        RG D +   S+ G  T  ++
Sbjct  188  STVVDSCDTPSVGPESRASQMARRKLVEVVNGGGVRYEIARGGDGVRGPSVGGDGTGEKE  247

Query  306  SQQVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSD  485
                 +  T      + +   A    P+    D++   ++ DD +   CHS    +I  +
Sbjct  248  MMTCEMSVTSSPGGSSASAEPAC---PKLAVDDRKRKGRALDDTE---CHSE---DIEYE  298

Query  486  DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
              D KK   + S STKRSRAA +HN SER+RRD+IN++MK LQ+L+P  +KTDKASMLDE
Sbjct  299  SADPKK-QLRGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCNKTDKASMLDE  357

Query  666  VIEYLKQLQAQVQ  704
             IEYLK LQ QVQ
Sbjct  358  AIEYLKTLQLQVQ  370



>ref|NP_849996.1| transcription factor PIF1 [Arabidopsis thaliana]
 gb|ABM06045.1| At2g20180 [Arabidopsis thaliana]
 gb|AEC06978.1| transcription factor PIF1 [Arabidopsis thaliana]
Length=407

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 21/155 (14%)
 Frame = +3

Query  258  GADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA-YTSASMGSPENTSSDKQCTNKSNDD  434
            G D  +++G   Y R  + V +        GT +   S S   PE T+ D +        
Sbjct  128  GTDSSAVAGGGAYNRKGKAVAMTAPAIEITGTSSSVVSKSEIEPEKTNVDDR--------  179

Query  435  NDHSVCHSRSQREIGSDDE-----DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQR  599
                    R +RE  + DE     ++ K    S+ STKRSRAA +HN SERKRRD+IN+R
Sbjct  180  -------KRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINER  232

Query  600  MKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            MK LQ+L+P  +K+DKASMLDE IEY+K LQ Q+Q
Sbjct  233  MKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQ  267



>ref|XP_009771454.1| PREDICTED: transcription factor UNE10-like isoform X2 [Nicotiana 
sylvestris]
Length=406

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 7/107 (7%)
 Frame = +3

Query  384  PENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQ  563
            P    S +   +K++ D D S CH       G  +  +++   K S S++RSRAA +HNQ
Sbjct  147  PSFDESSRSIKSKTSCDED-SACHD------GGSENKEEEHETKRSNSSRRSRAAVVHNQ  199

Query  564  SERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            SER+RRD+INQ+MK LQ+LVPN+SKTDKASMLDEVI YLKQLQAQVQ
Sbjct  200  SERRRRDRINQKMKALQRLVPNASKTDKASMLDEVINYLKQLQAQVQ  246



>ref|XP_004495811.1| PREDICTED: transcription factor PIF3-like isoform X1 [Cicer arietinum]
Length=733

 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 13/136 (10%)
 Frame = +3

Query  312  QVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDE  491
            Q T+E   +  + + +  S + G+   +    Q   + + D + S CHS        D E
Sbjct  397  QTTVEKGVEVAVASSSVCSGN-GADRGSDDPNQNLKRKSRDTEDSECHSE-------DVE  448

Query  492  D-----KKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
            D     KK  +G+  + +KRSRAA +HN SER+RRD+IN++M+ LQ+L+PN +K DKASM
Sbjct  449  DESVVVKKGASGRGVIGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASM  508

Query  657  LDEVIEYLKQLQAQVQ  704
            LDE IEYLK LQ QVQ
Sbjct  509  LDEAIEYLKTLQLQVQ  524



>ref|XP_004495812.1| PREDICTED: transcription factor PIF3-like isoform X2 [Cicer arietinum]
Length=723

 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 13/136 (10%)
 Frame = +3

Query  312  QVTIETTYDRDLGTEAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDE  491
            Q T+E   +  + + +  S + G+   +    Q   + + D + S CHS        D E
Sbjct  397  QTTVEKGVEVAVASSSVCSGN-GADRGSDDPNQNLKRKSRDTEDSECHSE-------DVE  448

Query  492  D-----KKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASM  656
            D     KK  +G+  + +KRSRAA +HN SER+RRD+IN++M+ LQ+L+PN +K DKASM
Sbjct  449  DESVVVKKGASGRGVIGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASM  508

Query  657  LDEVIEYLKQLQAQVQ  704
            LDE IEYLK LQ QVQ
Sbjct  509  LDEAIEYLKTLQLQVQ  524



>ref|XP_007047305.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX91462.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
Length=335

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  432  DNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTL  611
            +++   CH +   E   D+   K    +SS  +KRSRAA +HN SE++RR +IN++MK L
Sbjct  115  ESEFESCHKQEGLEALVDEAPSKPAPPRSS--SKRSRAAEVHNLSEKRRRSRINEKMKAL  172

Query  612  QKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            Q L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  173  QNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  203



>ref|XP_008447346.1| PREDICTED: transcription factor PIF1-like isoform X2 [Cucumis 
melo]
Length=379

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++   K  DD+D+ +C+S +  E  S D  K+    + S STKRSRAA +HN SER+RR
Sbjct  270  DRKRKGKETDDSDY-LCYS-TDVEFESTDAKKQV---RGSTSTKRSRAAEVHNLSERRRR  324

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++MK LQ+L+P  +K DKASMLDE IEYLK LQ QVQ
Sbjct  325  DRINEKMKALQELIPRCNKADKASMLDEAIEYLKTLQLQVQ  365



>gb|KHN26204.1| Transcription factor PIF3 [Glycine soja]
Length=722

 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+ + +    Q   +   D D S CHS    E  +    KK   G+    +KRSRAA +H
Sbjct  408  GADQGSDEPNQNLKRKTKDTDDSECHSEDVEEESAGA--KKTAGGRGGAGSKRSRAAEVH  465

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SER+RRD+IN++M+ LQ+L+PN +K DKASMLDE IEYLK LQ QVQ
Sbjct  466  NLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQ  514



>ref|XP_008447345.1| PREDICTED: transcription factor PIF1-like isoform X1 [Cucumis 
melo]
Length=518

 Score =   103 bits (256),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++   K  DD+D+ +C+S +  E  S D  K+    + S STKRSRAA +HN SER+RR
Sbjct  270  DRKRKGKETDDSDY-LCYS-TDVEFESTDAKKQV---RGSTSTKRSRAAEVHNLSERRRR  324

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++MK LQ+L+P  +K DKASMLDE IEYLK LQ QVQ
Sbjct  325  DRINEKMKALQELIPRCNKADKASMLDEAIEYLKTLQLQVQ  365



>ref|XP_008382659.1| PREDICTED: transcription factor PIF1-like [Malus domestica]
Length=529

 Score =   103 bits (257),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 5/83 (6%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKSSV-----STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSS  635
            EI S+D + +  NGK  V     STKRSRAA +HN SER+RRD+IN++MK LQ+L+P  +
Sbjct  289  EIQSEDVEFESANGKKQVRGSTSSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCN  348

Query  636  KTDKASMLDEVIEYLKQLQAQVQ  704
            K+DKASMLDE IEYLK LQ QVQ
Sbjct  349  KSDKASMLDEAIEYLKSLQLQVQ  371



>ref|XP_006605776.1| PREDICTED: transcription factor PIF3-like [Glycine max]
Length=722

 Score =   103 bits (258),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +3

Query  378  GSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIH  557
            G+ + +    Q   +   D D S CHS    E  +    KK   G+    +KRSRAA +H
Sbjct  408  GADQGSDEPNQNLKRKTKDTDDSECHSEDVEEESAGA--KKTAGGQGGAGSKRSRAAEVH  465

Query  558  NQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N SER+RRD+IN++M+ LQ+L+PN +K DKASMLDE IEYLK LQ QVQ
Sbjct  466  NLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQ  514



>ref|XP_009407100.1| PREDICTED: transcription factor PIF1-like [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 13/106 (12%)
 Frame = +3

Query  420  KSNDDNDHSVCHSRSQREIGSDD-----------EDKKKGNGKSSVSTKRSRAAAIHNQS  566
            ++ D      C  R QR++   +           E KK   G  S+ST+RSRAA +HN S
Sbjct  204  RTGDQGGSGQCQKRKQRDVQVAEYQSEEAEFESVEAKKAAQG--SISTRRSRAAEVHNLS  261

Query  567  ERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            ER+RRD+IN++MK LQ+L+P+ +KTDKASMLDE IEYLK LQ QVQ
Sbjct  262  ERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQ  307



>gb|EYU42383.1| hypothetical protein MIMGU_mgv1a020754mg [Erythranthe guttata]
Length=307

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (76%), Gaps = 4/86 (5%)
 Frame = +3

Query  447  VCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVP  626
             C  ++ R    DD  KK   GK   S  +SRAAA+H+QSE+KRR+KINQRM+ LQKLVP
Sbjct  139  FCSCKTNR----DDGGKKGEYGKPLNSKGKSRAAAMHSQSEKKRREKINQRMQILQKLVP  194

Query  627  NSSKTDKASMLDEVIEYLKQLQAQVQ  704
            N +K D+AS+LD+VIEY+KQLQ+QV+
Sbjct  195  NCNKIDRASILDDVIEYIKQLQSQVE  220



>ref|NP_179608.2| transcription factor PIF1 [Arabidopsis thaliana]
 ref|NP_001189559.1| transcription factor PIF1 [Arabidopsis thaliana]
 sp|Q8GZM7.1|PIF1_ARATH RecName: Full=Transcription factor PIF1; AltName: Full=Basic 
helix-loop-helix protein 15; Short=AtbHLH15; Short=bHLH 15; 
AltName: Full=Protein PHY-INTERACTING FACTOR 1; AltName: Full=Protein 
PHYTOCHROME INTERACTING FACTOR 3-LIKE 5; AltName: 
Full=Transcription factor EN 101; AltName: Full=bHLH transcription 
factor bHLH015 [Arabidopsis thaliana]
 gb|AAN78308.1| putative bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAC56979.1| PIF3 like basic Helix Loop Helix protein [Arabidopsis thaliana]
 gb|AEC06977.1| transcription factor PIF1 [Arabidopsis thaliana]
 gb|AEC06979.1| transcription factor PIF1 [Arabidopsis thaliana]
Length=478

 Score =   102 bits (255),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 21/155 (14%)
 Frame = +3

Query  258  GADQMSMSGSATYGRDSQQVTIETTYDRDLGTEA-YTSASMGSPENTSSDKQCTNKSNDD  434
            G D  +++G   Y R  + V +        GT +   S S   PE T+ D +        
Sbjct  199  GTDSSAVAGGGAYNRKGKAVAMTAPAIEITGTSSSVVSKSEIEPEKTNVDDR--------  250

Query  435  NDHSVCHSRSQREIGSDDE-----DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQR  599
                    R +RE  + DE     ++ K    S+ STKRSRAA +HN SERKRRD+IN+R
Sbjct  251  -------KRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINER  303

Query  600  MKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            MK LQ+L+P  +K+DKASMLDE IEY+K LQ Q+Q
Sbjct  304  MKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQ  338



>ref|NP_001056902.2| Os06g0164400 [Oryza sativa Japonica Group]
 dbj|BAF18816.2| Os06g0164400, partial [Oryza sativa Japonica Group]
Length=188

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  528  TKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +KRSRAA +HN SE++RR KIN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  22   SKRSRAAEVHNLSEKRRRSKINEKMKALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  80



>ref|XP_007160865.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
 gb|ESW32859.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
Length=287

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA  HN SE++RR +IN++MK LQKL+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  109  SSKRSRAAEFHNLSEKRRRSRINEKMKALQKLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  168



>gb|KDO84120.1| hypothetical protein CISIN_1g0227822mg, partial [Citrus sinensis]
Length=160

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 10/87 (11%)
 Frame = +3

Query  474  IGSDDEDKKKG----------NGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLV  623
            + SD  D +KG            ++  S+KRSRAA +HN SE++RR +IN+++K LQ L+
Sbjct  74   VDSDTNDSEKGPDALEVPSNDTVRTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLI  133

Query  624  PNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  134  PNSNKTDKASMLDEAIEYLKQLQLQVQ  160



>ref|XP_010093617.1| Transcription factor SPATULA [Morus notabilis]
 gb|EXB54378.1| Transcription factor SPATULA [Morus notabilis]
Length=377

 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = +3

Query  360  YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRS  539
            Y+ A+  +  N SS       S ++ND   C S    E   ++   K  N ++S  +KRS
Sbjct  63   YSVAAKATAVNVSSSS--LGASENENDEYDCESEEGHEALLEEIPTKTLNARTS--SKRS  118

Query  540  RAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RA+ +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  119  RASEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  173



>ref|XP_008367660.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Malus 
domestica]
Length=346

 Score =   100 bits (250),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDEVIEYLKQLQ QVQ
Sbjct  155  SSKRSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEVIEYLKQLQLQVQ  214



>ref|XP_007160864.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
 gb|ESW32858.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
Length=288

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA  HN SE++RR +IN++MK LQKL+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  110  SSKRSRAAEFHNLSEKRRRSRINEKMKALQKLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  169



>gb|KDP41706.1| hypothetical protein JCGZ_16113 [Jatropha curcas]
Length=330

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKA  650
            E G++  D      +   S+KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKA
Sbjct  121  EKGAEVSDMPSETARPRTSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKA  180

Query  651  SMLDEVIEYLKQLQAQVQ  704
            SMLDE IEYLKQLQ QVQ
Sbjct  181  SMLDEAIEYLKQLQLQVQ  198



>ref|XP_008367659.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Malus 
domestica]
Length=347

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDEVIEYLKQLQ QVQ
Sbjct  156  SSKRSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEVIEYLKQLQLQVQ  215



>ref|XP_008453232.1| PREDICTED: transcription factor UNE10 [Cucumis melo]
Length=361

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = +3

Query  477  GSDDEDKKKGNGKSSVSTKRSRAAAI-HNQSERKRRDKINQRMKTLQKLVPNSSKTDKAS  653
            GS++E   KG    S S +++R AAI HNQ ER+RRD+INQ+MK LQKLVPN SKTD+AS
Sbjct  151  GSEEEYNMKGKMGGSCSNRQTRTAAINHNQYERRRRDRINQKMKDLQKLVPNGSKTDRAS  210

Query  654  MLDEVIEYLKQLQAQVQ  704
            +LD+ I+YLKQLQAQVQ
Sbjct  211  LLDDTIQYLKQLQAQVQ  227



>gb|AAD24380.1| unknown protein [Arabidopsis thaliana]
Length=490

 Score =   102 bits (255),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 101/193 (52%), Gaps = 24/193 (12%)
 Frame = +3

Query  153  GFSGLVGSCSGAGAATREASLARVGGAAAHDWSNR---GADQMSMSGSATYGRDSQQVTI  323
            G SG + S +    +T+ +  A    AA+     R   G D  +++G   Y R  + V +
Sbjct  161  GESGPLLSKAVVRESTQVSPSATPSAAASESGLTRRTDGTDSSAVAGGGAYNRKGKAVAM  220

Query  324  ETTYDRDLGTEA-YTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDE---  491
                    GT +   S S   PE T+ D +                R +RE  + DE   
Sbjct  221  TAPAIEITGTSSSVVSKSEIEPEKTNVDDR---------------KRKEREATTTDETES  265

Query  492  --DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
              ++ K    S+ STKRSRAA +HN SERKRRD+IN+RMK LQ+L+P  +K+DKASMLDE
Sbjct  266  RSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSDKASMLDE  325

Query  666  VIEYLKQLQAQVQ  704
             IEY+K LQ Q+Q
Sbjct  326  AIEYMKSLQLQIQ  338



>ref|XP_009771453.1| PREDICTED: transcription factor UNE10-like isoform X1 [Nicotiana 
sylvestris]
Length=442

 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 7/107 (7%)
 Frame = +3

Query  384  PENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQ  563
            P    S +   +K++ D D S CH       G  +  +++   K S S++RSRAA +HNQ
Sbjct  183  PSFDESSRSIKSKTSCDED-SACHD------GGSENKEEEHETKRSNSSRRSRAAVVHNQ  235

Query  564  SERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            SER+RRD+INQ+MK LQ+LVPN+SKTDKASMLDEVI YLKQLQAQVQ
Sbjct  236  SERRRRDRINQKMKALQRLVPNASKTDKASMLDEVINYLKQLQAQVQ  282



>ref|XP_009359830.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Pyrus 
x bretschneideri]
Length=325

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDEVIEYLKQLQ QVQ
Sbjct  159  SSKRSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEVIEYLKQLQLQVQ  218



>ref|XP_008338329.1| PREDICTED: transcription factor SPATULA [Malus domestica]
 ref|XP_008338330.1| PREDICTED: transcription factor SPATULA [Malus domestica]
 ref|XP_008361401.1| PREDICTED: transcription factor SPATULA-like [Malus domestica]
 ref|XP_008361402.1| PREDICTED: transcription factor SPATULA-like [Malus domestica]
Length=373

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = +3

Query  357  AYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKR  536
            A+ SA  G+P  +SS    +    D+ D   C S    E   +    K G G+SS  +KR
Sbjct  98   AFVSA--GNPNVSSSSLGASENEADEYD---CESEEGLEAFVE---AKSGGGRSS--SKR  147

Query  537  SRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            SRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  148  SRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  203



>gb|AHK05707.1| bHLH transcription factor SPT [Brassica oleracea var. capitata]
Length=353

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ D   C S    E   DDE       KS  S+KR RAA +HN SE++RR +IN++M
Sbjct  137  SGNETDGYDCESEEGVEAVVDDELL----CKSRTSSKRCRAAEVHNLSEKRRRSRINEKM  192

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  193  KALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  226



>gb|KDO84121.1| hypothetical protein CISIN_1g0227822mg, partial [Citrus sinensis]
Length=159

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  513  KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
            ++  S+KRSRAA +HN SE++RR +IN+++K LQ L+PNS+KTDKASMLDE IEYLKQLQ
Sbjct  96   RTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKASMLDEAIEYLKQLQ  155

Query  693  AQVQ  704
             QVQ
Sbjct  156  LQVQ  159



>ref|XP_009359822.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Pyrus 
x bretschneideri]
Length=350

 Score =   100 bits (249),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDEVIEYLKQLQ QVQ
Sbjct  159  SSKRSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEVIEYLKQLQLQVQ  218



>gb|KGN58326.1| hypothetical protein Csa_3G622450 [Cucumis sativus]
Length=539

 Score =   102 bits (255),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++   K  DD+D+ +C+S +  E  S D  K+    + S STKRSRAA +HN SER+RR
Sbjct  270  DRKRKGKETDDSDY-LCYS-TDVEFESTDAKKQV---RGSTSTKRSRAAEVHNLSERRRR  324

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++MK LQ+L+P  +K DKASMLDE IEYLK LQ QVQ
Sbjct  325  DRINEKMKALQELIPRCNKADKASMLDEAIEYLKTLQLQVQ  365



>ref|XP_004142005.1| PREDICTED: uncharacterized protein LOC101217594 [Cucumis sativus]
Length=406

 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +3

Query  426  NDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMK  605
            +++ND   C S    E    +E   K N +SS  +KRSRAA +HN SE++RR +IN++MK
Sbjct  139  HNENDEFDCESEEGLE-ALVEELPTKPNPRSS--SKRSRAAEVHNLSEKRRRSRINEKMK  195

Query  606  TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  196  ALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  228



>gb|AES59419.2| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=267

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  441  HSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKL  620
            H    S +Q + GS+    K      S S+KRSRAA  HN SE++RR KIN+++K LQ L
Sbjct  59   HFTSSSSAQNDEGSELPSSKAAPPPRS-SSKRSRAAEFHNLSEKRRRSKINEKLKALQNL  117

Query  621  VPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  118  IPNSNKTDKASMLDEAIEYLKQLQLQVQ  145



>ref|XP_010444695.1| PREDICTED: transcription factor ALC-like [Camelina sativa]
Length=198

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +3

Query  471  EIGSDDE--DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTD  644
            E G D+   D K+  G+   S KR+  A  HN SE++RR KIN++MK LQKL+PNS+KTD
Sbjct  59   ETGQDNYAFDNKRNGGRQKNSLKRNIDAHFHNLSEKRRRSKINEKMKALQKLIPNSNKTD  118

Query  645  KASMLDEVIEYLKQLQAQVQ  704
            KASMLDE IEYLKQLQ QVQ
Sbjct  119  KASMLDEAIEYLKQLQLQVQ  138



>ref|XP_009367270.1| PREDICTED: transcription factor SPATULA-like [Pyrus x bretschneideri]
Length=381

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = +3

Query  492  DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
            + ++G G+SS  +KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE I
Sbjct  122  EARRGGGRSS--SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAI  179

Query  672  EYLKQLQAQVQ  704
            EYLKQLQ QVQ
Sbjct  180  EYLKQLQLQVQ  190



>gb|KHG00584.1| Transcription factor SPATULA -like protein [Gossypium arboreum]
Length=387

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +3

Query  429  DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT  608
            +D D   C S    E   D+   K    +SS  +KRSRAA +HN SE++RR +IN++MK 
Sbjct  100  NDTDEYDCESEEGIEALVDEAPPKPAPPRSS--SKRSRAAEVHNLSEKRRRSRINEKMKA  157

Query  609  LQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  158  LQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  189



>emb|CDX69281.1| BnaC01g01720D [Brassica napus]
Length=349

 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ D   C S    E   DDE   K    S  S+KR RAA +HN SE++RR +IN++M
Sbjct  140  SGNETDEYDCESEEGVEAVVDDELPSK----SRNSSKRCRAAEVHNLSEKRRRSRINEKM  195

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  196  KALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  229



>ref|XP_010416217.1| PREDICTED: transcription factor PIF1-like isoform X2 [Camelina 
sativa]
Length=530

 Score =   102 bits (254),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKA  650
            E  +D+E+ K+G G    STKRSRAA +HN SERKRRD+IN+RMK LQ+L+P  +K+DKA
Sbjct  314  ECRNDNEETKQGRG----STKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSDKA  369

Query  651  SMLDEVIEYLKQLQAQVQ  704
            SMLDE IEY+K LQ Q+Q
Sbjct  370  SMLDEAIEYMKSLQLQIQ  387



>ref|XP_009410364.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=345

 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKA  650
            EI   +E  K    ++S S+KR+RAA +HN SE++RR +IN++MK LQ L+PNSSKTDKA
Sbjct  78   EIEVSEEPPKLAPARTS-SSKRNRAAEVHNLSEKRRRSRINEKMKALQSLIPNSSKTDKA  136

Query  651  SMLDEVIEYLKQLQAQVQ  704
            SMLDE IEYLKQLQ QVQ
Sbjct  137  SMLDEAIEYLKQLQLQVQ  154



>ref|XP_007047304.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX91461.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=451

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  450  CHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPN  629
            CH +   E   D+   K    +SS  +KRSRAA +HN SE++RR +IN++MK LQ L+PN
Sbjct  176  CHKQEGLEALVDEAPSKPAPPRSS--SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPN  233

Query  630  SSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  234  SNKTDKASMLDEAIEYLKQLQLQVQ  258



>ref|XP_007144439.1| hypothetical protein PHAVU_007G156200g [Phaseolus vulgaris]
 gb|ESW16433.1| hypothetical protein PHAVU_007G156200g [Phaseolus vulgaris]
Length=517

 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +3

Query  471  EIGSDDED----KKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            E  S+D D    + K +G+ S STKRSRAA +HN SER+RRD+IN++MK LQ+L+P  +K
Sbjct  267  EFQSEDVDFESPEAKKHGRGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCNK  326

Query  639  TDKASMLDEVIEYLKQLQAQVQ  704
            +DKASMLDE IEYLK LQ QVQ
Sbjct  327  SDKASMLDEAIEYLKSLQLQVQ  348



>emb|CDX75629.1| BnaA01g00730D [Brassica napus]
Length=346

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ D   C S    E   DDE   K    S  S+KR RAA +HN SE++RR +IN++M
Sbjct  142  SGNETDEYDCESEEGVEAVVDDELPSK----SRNSSKRCRAAEVHNLSEKRRRSRINEKM  197

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  198  KALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  231



>gb|EPS62617.1| hypothetical protein M569_12173, partial [Genlisea aurea]
Length=83

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SE++RR +IN+++K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  9    SSKRSRAAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  68



>ref|XP_004157205.1| PREDICTED: uncharacterized protein LOC101227644 [Cucumis sativus]
 gb|KGN48536.1| hypothetical protein Csa_6G491000 [Cucumis sativus]
Length=415

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +3

Query  426  NDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMK  605
            +++ND   C S    E    +E   K N +SS  +KRSRAA +HN SE++RR +IN++MK
Sbjct  139  HNENDEFDCESEEGLE-ALVEELPTKPNPRSS--SKRSRAAEVHNLSEKRRRSRINEKMK  195

Query  606  TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  196  ALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  228



>emb|CDY22448.1| BnaC03g61610D [Brassica napus]
Length=352

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +3

Query  429  DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT  608
            ++ D   C S    E   DDE       KS  S+KR RAA +HN SE++RR +IN++MK 
Sbjct  139  NETDEYDCESEEGVEAVVDDELL----CKSRTSSKRCRAAEVHNLSEKRRRSRINEKMKA  194

Query  609  LQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  195  LQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  226



>ref|XP_006282286.1| hypothetical protein CARUB_v10028570mg [Capsella rubella]
 gb|EOA15184.1| hypothetical protein CARUB_v10028570mg [Capsella rubella]
Length=200

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  489  EDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEV  668
            E+K+ G G+   S KR+  A  HN SE+KRR KIN++MK LQKL+PNS+KTDKASMLDE 
Sbjct  67   ENKRNG-GRQKNSLKRNMDAHFHNLSEKKRRSKINEKMKALQKLIPNSNKTDKASMLDEA  125

Query  669  IEYLKQLQAQVQ  704
            IEYLKQLQ QVQ
Sbjct  126  IEYLKQLQLQVQ  137



>ref|XP_003589168.1| Transcription factor SPATULA [Medicago truncatula]
Length=287

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  441  HSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKL  620
            H    S +Q + GS+    K      S S+KRSRAA  HN SE++RR KIN+++K LQ L
Sbjct  59   HFTSSSSAQNDEGSELPSSKAAPPPRS-SSKRSRAAEFHNLSEKRRRSKINEKLKALQNL  117

Query  621  VPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  118  IPNSNKTDKASMLDEAIEYLKQLQLQVQ  145



>ref|XP_002983759.1| hypothetical protein SELMODRAFT_118904, partial [Selaginella 
moellendorffii]
 gb|EFJ15255.1| hypothetical protein SELMODRAFT_118904, partial [Selaginella 
moellendorffii]
Length=89

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  510  GKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQL  689
             K +   KRSRAA +HN SER+RRD+IN++M+ LQ+L+PNS+KTDKASMLDE IEYLK L
Sbjct  7    KKPATRPKRSRAAEVHNLSERRRRDRINEKMRALQELIPNSNKTDKASMLDEAIEYLKML  66

Query  690  QAQVQ  704
            Q Q+Q
Sbjct  67   QLQLQ  71



>ref|XP_001764406.1| predicted protein [Physcomitrella patens]
 gb|EDQ70673.1| predicted protein [Physcomitrella patens]
Length=1015

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = +3

Query  393  TSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSER  572
            TS+ ++C+ +   +     C S    +   D + K    G+ S +TKRSRAA +HNQSER
Sbjct  691  TSNKRKCSEREETE-----CQSEDGEDESVDTKHKPITTGRGS-TTKRSRAAEVHNQSER  744

Query  573  KRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            +RRD+IN++M+ LQ+L+PNS+KTDKASMLDE I+YLK LQ Q+Q
Sbjct  745  RRRDRINEKMRALQELIPNSNKTDKASMLDEAIDYLKILQLQLQ  788



>ref|XP_006656678.1| PREDICTED: transcription factor SPATULA-like [Oryza brachyantha]
Length=217

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  522  VSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            ++ KRSRAA +HN SE++RR KIN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QV
Sbjct  1    MACKRSRAAEVHNLSEKRRRSKINEKMKALQSLIPNSNKTDKASMLDEAIEYLKQLQLQV  60

Query  702  Q  704
            Q
Sbjct  61   Q  61



>ref|XP_011083103.1| PREDICTED: transcription factor PIF1 [Sesamum indicum]
Length=520

 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 9/102 (9%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRS-QREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKR  578
            D++   +  DDN+   C S   + E G   E KK+G G  S STKRSRAA +HN SER+R
Sbjct  274  DRKRKAREADDNE---CQSEDIEVEAG---EAKKQGRG--STSTKRSRAAEVHNLSERRR  325

Query  579  RDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RD+IN++MK LQ+L+P  +K+DKASMLDE IEYLK LQ QVQ
Sbjct  326  RDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQ  367



>ref|XP_006283961.1| hypothetical protein CARUB_v10005083mg [Capsella rubella]
 gb|EOA16859.1| hypothetical protein CARUB_v10005083mg [Capsella rubella]
Length=369

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  486  DEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDE  665
            DE     +G S  S+KR RAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE
Sbjct  174  DEAPSSKSGPSRTSSKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDE  233

Query  666  VIEYLKQLQAQVQ  704
             IEYLKQLQ QVQ
Sbjct  234  AIEYLKQLQLQVQ  246



>ref|XP_009138272.1| PREDICTED: transcription factor SPATULA [Brassica rapa]
Length=354

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ D   C S    E   DDE   K    S  S+KR RAA +HN SE++RR +IN++M
Sbjct  143  SGNETDEYDCESEEGVEAVVDDELPSK----SRNSSKRCRAAEVHNLSEKRRRSRINEKM  198

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  199  KALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  232



>ref|XP_007201708.1| hypothetical protein PRUPE_ppa004070mg [Prunus persica]
 gb|EMJ02907.1| hypothetical protein PRUPE_ppa004070mg [Prunus persica]
Length=531

 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKS----SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            E  S+D + +  NGK     S STKRSRAA +HN SER+RRD+IN++MK LQ+L+P  +K
Sbjct  295  EFQSEDVEFESANGKKQARGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCNK  354

Query  639  TDKASMLDEVIEYLKQLQAQVQ  704
            +DKASMLDE IEYLK LQ QVQ
Sbjct  355  SDKASMLDEAIEYLKSLQLQVQ  376



>emb|CDY05725.1| BnaC07g00780D [Brassica napus]
Length=507

 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 8/112 (7%)
 Frame = +3

Query  387  ENTSSDKQCTNKSNDDNDHSVCHSRSQRE---IGSDD---EDKKKGNGKSSVSTKRSRAA  548
            EN  +     +KS  +   ++   R ++E   +GS +   E+ K+G G SS  TKRSRAA
Sbjct  253  ENLGASSSVASKSEIEPLETIVDERKRKEREEVGSTECRNEEAKQGRGSSS--TKRSRAA  310

Query  549  AIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             +HN SERKRRD+IN+RMK LQ+L+P  +K+DKASMLDE IEY+K LQ Q+Q
Sbjct  311  EVHNLSERKRRDRINERMKALQELIPCCNKSDKASMLDEAIEYMKSLQLQIQ  362



>ref|XP_010548419.1| PREDICTED: transcription factor SPATULA-like [Tarenaya hassleriana]
 ref|XP_010548420.1| PREDICTED: transcription factor SPATULA-like [Tarenaya hassleriana]
Length=243

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ D   C S+   E+  D+   K    +SS   KRSRAA IHN SE++RR +IN++M
Sbjct  114  SGNETDDYDCESKEGMEVVVDELPAKPAPPRSSC--KRSRAAEIHNLSEKRRRSRINEKM  171

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQV  701
            K LQ L+PNS+KTDKASMLDE IEYL+QLQ Q+
Sbjct  172  KALQNLIPNSNKTDKASMLDEAIEYLQQLQVQM  204



>gb|ACG39275.1| hypothetical protein [Zea mays]
Length=282

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +3

Query  444  SVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLV  623
            +VC S  Q  +GS + D  +    +    KRSRAA +HN SE++RR +IN++MK LQ L+
Sbjct  18   TVCESEVQDALGSSESDPAR---PARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLI  74

Query  624  PNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            PNSSKTDKASMLD+ IEYLK LQ QVQ
Sbjct  75   PNSSKTDKASMLDDAIEYLKHLQLQVQ  101



>ref|XP_008235752.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor PIF1-like 
[Prunus mume]
Length=450

 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKS----SVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            E  S+D + +  NGK     S STKRSRAA +HN SER+RRD+IN++MK LQ+L+P  +K
Sbjct  214  EFQSEDVEFESANGKKKARGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCNK  273

Query  639  TDKASMLDEVIEYLKQLQAQVQ  704
            +DKASMLDE IEYLK LQ QVQ
Sbjct  274  SDKASMLDEAIEYLKSLQLQVQ  295



>gb|EEC78487.1| hypothetical protein OsI_18387 [Oryza sativa Indica Group]
Length=289

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++  N  +  N+ S   S SQ E+  DDE        ++ S+KRSR A +HN SER+RR
Sbjct  73   DRRQLNWRDSHNNQSAEWSASQDELDLDDELAGVHRRSAARSSKRSRTAEVHNLSERRRR  132

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++M+ LQ+L+PN +K DKASML+E IEYLK LQ QVQ
Sbjct  133  DRINEKMRALQELIPNCNKIDKASMLEEAIEYLKTLQLQVQ  173



>ref|XP_004499048.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Cicer 
arietinum]
Length=261

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  501  KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  680
            KG      S+KR RAA  HN SE++RR KIN++MK LQ L+PNS+KTDKASMLDE I+YL
Sbjct  76   KGTSPPRSSSKRGRAAEFHNLSEKRRRSKINEKMKALQNLIPNSNKTDKASMLDEAIDYL  135

Query  681  KQLQAQVQ  704
            KQLQ QVQ
Sbjct  136  KQLQLQVQ  143



>ref|XP_004499049.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Cicer 
arietinum]
Length=233

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  501  KGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYL  680
            KG      S+KR RAA  HN SE++RR KIN++MK LQ L+PNS+KTDKASMLDE I+YL
Sbjct  76   KGTSPPRSSSKRGRAAEFHNLSEKRRRSKINEKMKALQNLIPNSNKTDKASMLDEAIDYL  135

Query  681  KQLQAQVQ  704
            KQLQ QVQ
Sbjct  136  KQLQLQVQ  143



>dbj|BAL63287.1| basic helix-loop-helix protein APG [Oryza sativa Japonica Group]
Length=432

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++  N  +  N+ S   S SQ E+  DDE        ++ S+KRSR A +HN SER+RR
Sbjct  289  DRRQLNWRDSHNNQSAEWSASQDELDLDDELAGVHRRSAARSSKRSRTAEVHNLSERRRR  348

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++M+ LQ+L+PN +K DKASML+E IEYLK LQ QVQ
Sbjct  349  DRINEKMRALQELIPNCNKIDKASMLEEAIEYLKTLQLQVQ  389



>ref|XP_008440296.1| PREDICTED: transcription factor SPATULA [Cucumis melo]
Length=415

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +3

Query  426  NDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMK  605
            +++ND   C S    E    +E   K N +SS  +KRSRAA +HN SE++RR +IN++MK
Sbjct  139  HNENDEFDCESEEGLE-ALVEELPTKPNPRSS--SKRSRAAEVHNLSEKRRRSRINEKMK  195

Query  606  TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  196  ALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  228



>ref|XP_008776593.1| PREDICTED: transcription factor PIF4-like isoform X2 [Phoenix 
dactylifera]
Length=520

 Score =   101 bits (251),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = +3

Query  354  EAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
            EA  ++S G     +  +  +N+S+      V  S  Q E    +  +     + S ST+
Sbjct  272  EATVTSSSGCSFGRTGQQTASNQSHKRKGRDVEESECQSEEAEYESGEANKPAQQSTSTR  331

Query  534  RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RSRAA +HN SER+RRD+IN++MK LQ+L+P+ +KTDKASMLDE IEYLK LQ QVQ
Sbjct  332  RSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQ  388



>ref|XP_008776592.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
Length=525

 Score =   101 bits (251),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = +3

Query  354  EAYTSASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTK  533
            EA  ++S G     +  +  +N+S+      V  S  Q E    +  +     + S ST+
Sbjct  272  EATVTSSSGCSFGRTGQQTASNQSHKRKGRDVEESECQSEEAEYESGEANKPAQQSTSTR  331

Query  534  RSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RSRAA +HN SER+RRD+IN++MK LQ+L+P+ +KTDKASMLDE IEYLK LQ QVQ
Sbjct  332  RSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQ  388



>ref|XP_006473301.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Citrus 
sinensis]
Length=292

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 10/87 (11%)
 Frame = +3

Query  474  IGSDDEDKKKG----------NGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLV  623
            + SD  D +KG            ++  S+KRSRAA +HN SE++RR +IN+++K LQ L+
Sbjct  74   VDSDTNDSEKGPDALEVPSNDTVRTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLI  133

Query  624  PNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  134  PNSNKTDKASMLDEAIEYLKQLQLQVQ  160



>ref|XP_010489088.1| PREDICTED: transcription factor PIF1-like [Camelina sativa]
Length=629

 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKA  650
            E  +++E+ K+G G    STKRSRAA +HN SERKRRD+IN+RMK LQ+L+P  +K+DKA
Sbjct  415  ECRNENEETKQGRG----STKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSDKA  470

Query  651  SMLDEVIEYLKQLQAQVQ  704
            SMLDE IEY+K LQ Q+Q
Sbjct  471  SMLDEAIEYMKSLQLQIQ  488



>emb|CCE46185.1| bHLH transcription factor [Amborella trichopoda]
Length=445

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  369  ASMGSPENTSSDKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAA  548
            +S+G   +   D +   K    ND  +     + E G +  ++      S  STKRSRAA
Sbjct  127  SSIGDQSSPRRDSEPCKKKKAHNDTDLDDLDCESEEGQEPSEEMSKPAPSRSSTKRSRAA  186

Query  549  AIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  187  EVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  238



>gb|EEE62266.1| hypothetical protein OsJ_17053 [Oryza sativa Japonica Group]
Length=404

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++  N  +  N+ S   S SQ E+  DDE        ++ S+KRSR A +HN SER+RR
Sbjct  168  DRRQLNWRDSHNNQSAEWSASQDELDLDDELAGVHRRSAARSSKRSRTAEVHNLSERRRR  227

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++M+ LQ+L+PN +K DKASML+E IEYLK LQ QVQ
Sbjct  228  DRINEKMRALQELIPNCNKIDKASMLEEAIEYLKTLQLQVQ  268



>ref|XP_002523613.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38808.1| conserved hypothetical protein [Ricinus communis]
Length=406

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +3

Query  423  SNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRM  602
            S ++ DH  C   S+  + +  E+ +        S+KRSRAA +HN SE++RR +IN++M
Sbjct  123  SENETDHE-CDCESEEGLEALIEEVQTKAAPPRSSSKRSRAAEVHNLSEKRRRSRINEKM  181

Query  603  KTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            K LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  182  KALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  215



>ref|XP_010432081.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Camelina 
sativa]
Length=369

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = +3

Query  429  DDNDHSVCHSRSQREIGSDDEDKKKGNGKSS-VSTKRSRAAAIHNQSERKRRDKINQRMK  605
            ++ D   C S    E   D+    K  G  S  S+KR RAA +HN SE++RR +IN++MK
Sbjct  154  NETDEYDCESEEGGEAVVDEAPSSKSGGPPSRTSSKRCRAAEVHNLSEKRRRSRINEKMK  213

Query  606  TLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
             LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  214  ALQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  246



>ref|XP_002510190.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52377.1| conserved hypothetical protein [Ricinus communis]
Length=312

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  120  SSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  179



>ref|NP_001054593.1| Os05g0139100 [Oryza sativa Japonica Group]
 sp|Q6AT90.1|APG_ORYSJ RecName: Full=Transcription factor APG; AltName: Full=Basic helix-loop-helix 
protein 106; Short=OsbHLH106; AltName: Full=Protein 
ANTAGONIST OF PGL1; AltName: Full=bHLH transcription 
factor bHLH106 [Oryza sativa Japonica Group]
 gb|AAT77368.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAU10768.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF16507.1| Os05g0139100 [Oryza sativa Japonica Group]
Length=505

 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  402  DKQCTNKSNDDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRR  581
            D++  N  +  N+ S   S SQ E+  DDE        ++ S+KRSR A +HN SER+RR
Sbjct  289  DRRQLNWRDSHNNQSAEWSASQDELDLDDELAGVHRRSAARSSKRSRTAEVHNLSERRRR  348

Query  582  DKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            D+IN++M+ LQ+L+PN +K DKASML+E IEYLK LQ QVQ
Sbjct  349  DRINEKMRALQELIPNCNKIDKASMLEEAIEYLKTLQLQVQ  389



>ref|XP_008340273.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Malus 
domestica]
Length=373

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = +3

Query  492  DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
            + + G G+SS  +KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE I
Sbjct  122  EARPGGGRSS--SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAI  179

Query  672  EYLKQLQAQVQ  704
            EYLKQLQ QVQ
Sbjct  180  EYLKQLQLQVQ  190



>gb|KHN48974.1| Transcription factor PIF1 [Glycine soja]
Length=255

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = +3

Query  471  EIGSDDEDKKKGNGKSSV----STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSK  638
            E  S+D D +    K  V    STKRSRAA +HN SER+RRD+IN++MK LQ+L+P  +K
Sbjct  15   EFQSEDVDFESPEAKKQVHGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCNK  74

Query  639  TDKASMLDEVIEYLKQLQAQVQ  704
            +DKASMLDE IEYLK LQ QVQ
Sbjct  75   SDKASMLDEAIEYLKSLQLQVQ  96



>ref|XP_010112171.1| Transcription factor SPATULA [Morus notabilis]
 gb|EXC32837.1| Transcription factor SPATULA [Morus notabilis]
Length=350

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            S+KRSRAA IHN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  173  SSKRSRAAEIHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  232



>ref|XP_009366017.1| PREDICTED: transcription factor PIF3-like isoform X2 [Pyrus x 
bretschneideri]
Length=604

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 8/103 (8%)
 Frame = +3

Query  420  KSNDDNDHSV---CHSRSQREIGSDD-EDK----KKGNGKSSVSTKRSRAAAIHNQSERK  575
            + +DD  H++   C    + E  SDD ED+    KKG       +KRSRAA +HN SER+
Sbjct  298  RGSDDPPHALKRKCRETDESECHSDDVEDESVGVKKGVHARGTGSKRSRAAEVHNLSERR  357

Query  576  RRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            RRD+IN++M+ LQ+L+PN +K DKASMLDE IEYLK LQ QVQ
Sbjct  358  RRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQ  400



>ref|XP_008340258.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Malus 
domestica]
Length=382

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = +3

Query  492  DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
            + + G G+SS  +KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE I
Sbjct  122  EARPGGGRSS--SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAI  179

Query  672  EYLKQLQAQVQ  704
            EYLKQLQ QVQ
Sbjct  180  EYLKQLQLQVQ  190



>ref|XP_006473302.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Citrus 
sinensis]
Length=291

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  513  KSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQ  692
            ++  S+KRSRAA +HN SE++RR +IN+++K LQ L+PNS+KTDKASMLDE IEYLKQLQ
Sbjct  96   RTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKASMLDEAIEYLKQLQ  155

Query  693  AQVQ  704
             QVQ
Sbjct  156  LQVQ  159



>ref|XP_008340265.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Malus 
domestica]
Length=380

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = +3

Query  492  DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVI  671
            + + G G+SS  +KRSRAA +HN SE++RR +IN++MK LQ L+PNS+KTDKASMLDE I
Sbjct  122  EARPGGGRSS--SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAI  179

Query  672  EYLKQLQAQVQ  704
            EYLKQLQ QVQ
Sbjct  180  EYLKQLQLQVQ  190



>dbj|BAD43719.1| putative bHLH transcription factor (bHLH073/ALCATRAZ) [Arabidopsis 
thaliana]
Length=210

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +3

Query  471  EIGSDDE--DKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTD  644
            E G D    + K+   K   S KRS  A  HN SE+KRR KIN++MK LQKL+PNS+KTD
Sbjct  68   ETGQDKYAFEHKRSGAKQRNSLKRSIDAQFHNLSEKKRRSKINEKMKALQKLIPNSNKTD  127

Query  645  KASMLDEVIEYLKQLQAQVQ  704
            KASMLDE IEYLKQLQ QVQ
Sbjct  128  KASMLDEAIEYLKQLQLQVQ  147



>gb|KFK30312.1| hypothetical protein AALP_AA7G245600 [Arabis alpina]
Length=351

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +3

Query  429  DDNDHSVCHSRSQREIGSDDEDKKKGNGKSSVSTKRSRAAAIHNQSERKRRDKINQRMKT  608
            ++ D   C S    E   D+   K G  ++S  +KR RAA +HN SE++RR +IN++MK 
Sbjct  140  NETDEYDCESEEGVEAVVDEPSSKSGPSRNS--SKRCRAAEVHNLSEKRRRSRINEKMKA  197

Query  609  LQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            LQ L+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  198  LQSLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  229



>ref|XP_006339939.1| PREDICTED: transcription factor SPATULA-like [Solanum tuberosum]
Length=376

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  525  STKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVQ  704
            ++KRSRAA +HN SE++RR +IN++MK LQKL+PNS+KTDKASMLDE IEYLKQLQ QVQ
Sbjct  142  TSKRSRAAEVHNLSEKRRRSRINEKMKALQKLIPNSNKTDKASMLDEAIEYLKQLQLQVQ  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4286445245352