BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7829_g1_i1 len=1480 path=[1458:0-1118 2577:1119-1479]

Length=1480
                                                                      Score     E

ref|XP_006348207.1|  PREDICTED: putative pectate lyase 2-like           597   0.0      
ref|XP_009598821.1|  PREDICTED: putative pectate lyase 2                596   0.0      
ref|XP_004233784.1|  PREDICTED: probable pectate lyase 16               594   0.0      
ref|XP_009781427.1|  PREDICTED: putative pectate lyase 2                592   0.0      
gb|EYU33881.1|  hypothetical protein MIMGU_mgv1a008057mg                587   0.0      
ref|XP_011087039.1|  PREDICTED: putative pectate lyase 2                582   0.0      
ref|XP_011096153.1|  PREDICTED: putative pectate lyase 2                581   0.0      
gb|EYU27758.1|  hypothetical protein MIMGU_mgv1a024530mg                575   0.0      
ref|XP_006449769.1|  hypothetical protein CICLE_v10017878mg             576   0.0      
ref|XP_004153041.1|  PREDICTED: putative pectate lyase 2-like           573   0.0      
ref|XP_004164879.1|  PREDICTED: putative pectate lyase 2-like           580   0.0      
ref|XP_008440763.1|  PREDICTED: putative pectate lyase 2                572   0.0      
ref|XP_004145189.1|  PREDICTED: putative pectate lyase 2-like           580   0.0      
ref|XP_006467400.1|  PREDICTED: putative pectate lyase 2-like           572   0.0      
ref|XP_007026137.1|  Root hair specific 14                              572   0.0      
gb|KDO78309.1|  hypothetical protein CISIN_1g047672mg                   571   0.0      
emb|CDP04429.1|  unnamed protein product                                568   0.0      
emb|CAN60346.1|  hypothetical protein VITISV_001795                     568   0.0      Vitis vinifera
ref|XP_002263615.2|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    568   0.0      Vitis vinifera
ref|XP_007214229.1|  hypothetical protein PRUPE_ppa025559mg             566   0.0      
ref|XP_010052872.1|  PREDICTED: putative pectate lyase 2                565   0.0      
ref|XP_011008017.1|  PREDICTED: putative pectate lyase 2                562   0.0      
ref|XP_008224700.1|  PREDICTED: putative pectate lyase 2                561   0.0      
gb|KCW77003.1|  hypothetical protein EUGRSUZ_D01352                     559   0.0      
ref|XP_006587976.1|  PREDICTED: probable pectate lyase 16-like          559   0.0      
ref|XP_009598823.1|  PREDICTED: probable pectate lyase 16               559   0.0      
ref|XP_009352643.1|  PREDICTED: putative pectate lyase 2                557   0.0      
ref|XP_002518442.1|  Pectate lyase precursor, putative                  557   0.0      Ricinus communis
ref|XP_003547262.1|  PREDICTED: probable pectate lyase 16-like          556   0.0      
ref|NP_193939.1|  root hair specific 14                                 556   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099179.1|  hypothetical protein L484_014178                   555   0.0      
ref|XP_010448941.1|  PREDICTED: probable pectate lyase 16               555   0.0      
gb|AFK47751.1|  unknown                                                 554   0.0      
ref|XP_010439369.1|  PREDICTED: probable pectate lyase 16               554   0.0      
ref|XP_007147702.1|  hypothetical protein PHAVU_006G147500g             554   0.0      
gb|KDP20714.1|  hypothetical protein JCGZ_21185                         553   0.0      
ref|XP_010434085.1|  PREDICTED: probable pectate lyase 16               553   0.0      
ref|XP_006286235.1|  hypothetical protein CARUB_v10007804mg             552   0.0      
gb|KHN40868.1|  Putative pectate lyase 2                                557   0.0      
ref|XP_010529455.1|  PREDICTED: probable pectate lyase 16               552   0.0      
ref|XP_008371166.1|  PREDICTED: putative pectate lyase 2                551   0.0      
ref|XP_002867795.1|  pectate lyase family protein                       551   0.0      
ref|XP_004293313.1|  PREDICTED: putative pectate lyase 2-like           549   0.0      
ref|XP_004233785.1|  PREDICTED: probable pectate lyase 16               550   0.0      
ref|XP_003610466.1|  hypothetical protein MTR_4g132460                  549   0.0      
ref|XP_009801395.1|  PREDICTED: probable pectate lyase 16               549   0.0      
ref|XP_011015442.1|  PREDICTED: probable pectate lyase 16               548   0.0      
ref|NP_193940.1|  putative pectate lyase 17                             547   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383883.1|  pectate lyase 4 precursor family protein           547   0.0      
ref|XP_006303602.1|  hypothetical protein CARUB_v10011187mg             547   0.0      
ref|XP_011046965.1|  PREDICTED: probable pectate lyase 16               547   0.0      
ref|XP_011087037.1|  PREDICTED: probable pectate lyase 16               545   0.0      
ref|XP_006389575.1|  hypothetical protein POPTR_0021s00250g             545   0.0      
ref|XP_009135558.1|  PREDICTED: probable pectate lyase 16               545   0.0      
ref|NP_172656.1|  putative pectate lyase                                544   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317132.1|  hypothetical protein POPTR_0011s00240g             544   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009108544.1|  PREDICTED: probable pectate lyase 16               543   0.0      
ref|XP_010476139.1|  PREDICTED: putative pectate lyase 2 isoform X2     542   0.0      
ref|XP_010458609.1|  PREDICTED: putative pectate lyase 2                542   0.0      
ref|XP_003550482.1|  PREDICTED: putative pectate lyase 2-like           542   0.0      
ref|XP_007147703.1|  hypothetical protein PHAVU_006G147600g             541   0.0      
ref|XP_004155676.1|  PREDICTED: putative pectate lyase 2-like           541   0.0      
ref|XP_010476138.1|  PREDICTED: putative pectate lyase 2 isoform X1     540   0.0      
ref|XP_002892663.1|  hypothetical protein ARALYDRAFT_312221             539   0.0      
ref|XP_008440030.1|  PREDICTED: putative pectate lyase 2                539   0.0      
gb|AAC17625.1|  Similar to style development-specific protein 961...    539   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU33883.1|  hypothetical protein MIMGU_mgv1a007737mg                538   0.0      
gb|KFK29603.1|  hypothetical protein AALP_AA7G155700                    536   0.0      
ref|XP_009357592.1|  PREDICTED: putative pectate lyase 2                536   0.0      
emb|CDX79122.1|  BnaA01g11890D                                          536   0.0      
ref|XP_010493521.1|  PREDICTED: putative pectate lyase 2                534   0.0      
emb|CDX76388.1|  BnaA08g10120D                                          533   0.0      
gb|KEH36910.1|  pectate lyase family protein                            532   0.0      
ref|XP_002518441.1|  Pectate lyase precursor, putative                  530   0.0      Ricinus communis
ref|XP_004507669.1|  PREDICTED: putative pectate lyase 2-like           531   0.0      
emb|CDY27438.1|  BnaC03g64780D                                          531   0.0      
emb|CDP04430.1|  unnamed protein product                                530   0.0      
ref|XP_006348206.1|  PREDICTED: putative pectate lyase 17-like          525   0.0      
ref|XP_009148627.1|  PREDICTED: putative pectate lyase 2                522   7e-180   
ref|XP_006377128.1|  hypothetical protein POPTR_0011s002501g            518   4e-179   
ref|XP_004486178.1|  PREDICTED: probable pectate lyase 16-like          516   3e-178   
ref|XP_004134978.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    512   2e-176   
emb|CBI23207.3|  unnamed protein product                                509   2e-175   
ref|XP_007153980.1|  hypothetical protein PHAVU_003G081000g             509   8e-175   
ref|XP_006389576.1|  hypothetical protein POPTR_0021s00260g             507   4e-174   
ref|XP_010533796.1|  PREDICTED: putative pectate lyase 2                501   6e-172   
emb|CDX98091.1|  BnaA06g08420D                                          494   5e-169   
ref|XP_009148628.1|  PREDICTED: putative pectate lyase 2                494   5e-169   
emb|CDY30041.1|  BnaC05g09790D                                          492   2e-168   
emb|CDY30040.1|  BnaC05g09800D                                          471   4e-160   
ref|XP_008776910.1|  PREDICTED: putative pectate lyase 2 isoform X1     470   2e-159   
ref|XP_010478421.1|  PREDICTED: probable pectate lyase 4                468   5e-159   
ref|XP_010499566.1|  PREDICTED: probable pectate lyase 4                466   6e-158   
ref|XP_002893613.1|  predicted protein                                  465   7e-158   
ref|XP_010460825.1|  PREDICTED: probable pectate lyase 4                464   2e-157   
emb|CDX98092.1|  BnaA06g08430D                                          462   7e-157   
ref|XP_006285121.1|  hypothetical protein CARUB_v10006459mg             460   1e-155   
emb|CDX82902.1|  BnaC01g13520D                                          451   1e-152   
ref|NP_174324.1|  probable pectate lyase 4                              447   6e-151   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28424.1|  unknown                                                 447   8e-151   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43457.1|  hypothetical protein AALP_AA1G127700                    446   3e-150   
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           445   2e-149   
ref|XP_010100325.1|  hypothetical protein L484_027633                   442   3e-148   
ref|XP_002966799.1|  hypothetical protein SELMODRAFT_85792              437   3e-147   
emb|CDY56220.1|  BnaAnng14170D                                          438   1e-146   
ref|XP_002964286.1|  hypothetical protein SELMODRAFT_81909              434   4e-146   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                436   9e-146   
ref|XP_002982255.1|  hypothetical protein SELMODRAFT_421674             436   1e-145   
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                436   1e-145   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                435   2e-145   
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                435   2e-145   
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                434   2e-145   
emb|CDY01846.1|  BnaC06g28860D                                          434   3e-145   
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                433   1e-144   
emb|CAN76500.1|  hypothetical protein VITISV_004734                     433   1e-144   Vitis vinifera
ref|XP_002966181.1|  hypothetical protein SELMODRAFT_407495             432   3e-144   
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                431   4e-144   
gb|KHG22755.1|  hypothetical protein F383_29653                         431   1e-143   
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g             429   3e-143   
gb|AEX93472.1|  nodulation pectate lyase                                429   4e-143   
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           429   4e-143   
gb|AFD54064.1|  nodulation pectate lyase mutant                         428   7e-143   
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      427   1e-142   
ref|XP_010102919.1|  hypothetical protein L484_018936                   427   2e-142   
ref|XP_002885608.1|  pectate lyase family protein                       429   3e-142   
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                427   3e-142   
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                427   3e-142   
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          426   4e-142   
ref|XP_009136724.1|  PREDICTED: probable pectate lyase 4                426   5e-142   
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                426   5e-142   
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                426   6e-142   
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             426   6e-142   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          426   8e-142   
ref|XP_003618787.1|  Pectate lyase                                      425   1e-141   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    426   1e-141   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           425   1e-141   
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               425   1e-141   
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               425   2e-141   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                424   3e-141   
gb|AFK44189.1|  unknown                                                 424   5e-141   
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     424   5e-141   
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                423   7e-141   
emb|CDP13269.1|  unnamed protein product                                423   8e-141   
ref|NP_189065.2|  putative pectate lyase 9                              424   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     424   1e-140   
ref|NP_001147553.1|  pectate lyase 8                                    425   1e-140   Zea mays [maize]
ref|XP_006347419.1|  PREDICTED: probable pectate lyase 18-like          423   1e-140   
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                424   1e-140   
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                423   1e-140   
gb|EPS69872.1|  hypothetical protein M569_04891                         422   1e-140   
ref|XP_003608909.1|  Pectate lyase                                      422   1e-140   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                422   2e-140   
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                422   2e-140   
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               422   2e-140   
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               422   2e-140   
gb|ABR18471.1|  unknown                                                 425   2e-140   Picea sitchensis
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          422   2e-140   
ref|XP_002866540.1|  pectate lyase                                      422   3e-140   
gb|AAF19195.1|AF206319_1  pectate lyase 1                               422   3e-140   Musa acuminata [banana]
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           421   3e-140   
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             421   5e-140   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    422   7e-140   
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                421   7e-140   
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                420   1e-139   
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             420   1e-139   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    420   1e-139   
ref|NP_001141589.1|  uncharacterized protein LOC100273705               422   1e-139   Zea mays [maize]
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              422   1e-139   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    420   2e-139   
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           421   2e-139   
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         419   2e-139   
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   421   2e-139   
emb|CDY03964.1|  BnaC02g36790D                                          419   3e-139   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               419   3e-139   
ref|XP_009625069.1|  PREDICTED: putative pectate lyase 2                418   3e-139   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    421   3e-139   
emb|CDY11033.1|  BnaA03g46920D                                          419   4e-139   
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               419   4e-139   
gb|AGC94753.1|  putative pectate lyase                                  419   5e-139   
gb|KHN34377.1|  Putative pectate lyase 22                               419   5e-139   
dbj|BAB10560.1|  pectate lyase                                          419   5e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     419   6e-139   
emb|CDY41506.1|  BnaA06g22590D                                          419   6e-139   
ref|NP_568967.1|  putative pectate lyase 22                             419   7e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    422   7e-139   
dbj|BAK06362.1|  predicted protein                                      420   9e-139   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               418   9e-139   
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     419   9e-139   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          418   9e-139   
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               418   1e-138   
emb|CDX92652.1|  BnaC07g39100D                                          418   1e-138   
ref|XP_002526952.1|  Pectate lyase precursor, putative                  417   1e-138   Ricinus communis
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                419   1e-138   
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     419   1e-138   
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     419   2e-138   
ref|XP_010671109.1|  PREDICTED: probable pectate lyase 5                417   2e-138   
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     417   2e-138   
gb|AAG28907.1|AC008113_23  F12A21.12                                    416   3e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             417   3e-138   
emb|CDY48132.1|  BnaCnng15740D                                          417   3e-138   
gb|AEN70985.1|  pectate lyase                                           417   3e-138   
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               417   3e-138   
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     418   3e-138   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               417   3e-138   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               417   4e-138   
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    416   4e-138   
emb|CDP04431.1|  unnamed protein product                                416   4e-138   
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                418   4e-138   
emb|CDY16732.1|  BnaA09g06500D                                          417   4e-138   
emb|CDY65626.1|  BnaC03g74840D                                          418   4e-138   
gb|EEE60442.1|  hypothetical protein OsJ_13660                          417   4e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    419   4e-138   
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               416   5e-138   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                416   5e-138   
gb|ADB90475.1|  pectate lyase                                           416   5e-138   Gossypium herbaceum [Arabian cotton]
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     417   5e-138   
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    414   5e-138   
gb|KHG19997.1|  hypothetical protein F383_02891                         416   6e-138   
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             416   6e-138   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               416   6e-138   
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     416   6e-138   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               416   8e-138   
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     417   8e-138   
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     415   9e-138   
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                416   1e-137   
emb|CAE02420.2|  OSJNBa0095E20.8                                        417   1e-137   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB59066.1|  pectate lyase                                          415   1e-137   Salix gilgiana
gb|EEC76710.1|  hypothetical protein OsI_14719                          417   1e-137   Oryza sativa Indica Group [Indian rice]
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                416   1e-137   
gb|AEN70981.1|  pectate lyase                                           415   1e-137   
ref|NP_564906.1|  putative pectate lyase 5                              415   2e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               414   2e-137   
gb|AEN70964.1|  pectate lyase                                           415   2e-137   
gb|AEN70963.1|  pectate lyase                                           415   2e-137   
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         414   2e-137   
gb|AAK66161.1|  pectate lyase                                           413   2e-137   Fragaria x ananassa
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                414   2e-137   
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     417   2e-137   
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          414   3e-137   
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             423   3e-137   
ref|XP_002887143.1|  pectate lyase family protein                       414   3e-137   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          415   4e-137   
dbj|BAI94495.1|  pectate lyase                                          414   4e-137   
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   414   4e-137   
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                416   4e-137   
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     415   4e-137   
gb|AEN70984.1|  pectate lyase                                           414   4e-137   
gb|AAF19196.1|AF206320_1  pectate lyase 2                               416   4e-137   Musa acuminata [banana]
ref|XP_010106682.1|  hypothetical protein L484_004616                   413   5e-137   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     415   5e-137   
gb|ADB90479.1|  pectate lyase                                           414   5e-137   Gossypium barbadense [Egyptian cotton]
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     415   5e-137   
gb|AEN70977.1|  pectate lyase                                           413   6e-137   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             414   7e-137   
ref|NP_001280201.1|  probable pectate lyase 18 precursor                413   8e-137   
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                412   8e-137   
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    413   9e-137   
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               413   9e-137   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     416   9e-137   
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   412   1e-136   
gb|KHG22990.1|  hypothetical protein F383_28754                         412   1e-136   
ref|XP_002297822.1|  pectate lyase family protein                       414   1e-136   Populus trichocarpa [western balsam poplar]
gb|ADB90476.1|  pectate lyase                                           413   1e-136   Gossypium raimondii
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             412   1e-136   
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          414   1e-136   
emb|CAA63496.1|  pectate lyase                                          412   1e-136   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                414   1e-136   
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                414   1e-136   
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                414   1e-136   
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like           412   1e-136   
ref|XP_002870357.1|  pectate lyase family protein                       415   1e-136   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                414   1e-136   
ref|XP_001785953.1|  predicted protein                                  411   2e-136   
ref|NP_001052103.1|  Os04g0137100                                       415   2e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          414   2e-136   
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                413   2e-136   
ref|NP_001289258.1|  probable pectate lyase 18 precursor                412   2e-136   
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             412   2e-136   
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             414   2e-136   
gb|ADB90477.1|  pectate lyase                                           412   2e-136   
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                      412   2e-136   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         413   2e-136   
gb|AAY85180.1|  pectate lyase                                           412   2e-136   
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                412   2e-136   
ref|XP_011097759.1|  PREDICTED: probable pectate lyase 22               411   2e-136   
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like           412   2e-136   
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             412   2e-136   
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               413   3e-136   
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                413   3e-136   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                412   4e-136   
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           412   4e-136   
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               410   4e-136   
ref|XP_007163701.1|  hypothetical protein PHAVU_001G256900g             413   4e-136   
gb|AAM67091.1|  putative pectate lyase                                  411   4e-136   
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     412   4e-136   
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                413   5e-136   
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                412   5e-136   
ref|XP_010067211.1|  PREDICTED: probable pectate lyase 13 isoform X2    411   5e-136   
gb|AEN70965.1|  pectate lyase                                           411   6e-136   
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                412   6e-136   
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                412   8e-136   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          412   8e-136   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           413   8e-136   
gb|ADB90478.1|  pectate lyase                                           410   9e-136   
ref|NP_567409.1|  probable pectate lyase 15                             412   9e-136   
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     412   9e-136   
gb|AEN70968.1|  pectate lyase                                           410   9e-136   
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    412   1e-135   
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                411   1e-135   
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                412   1e-135   
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    412   1e-135   
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             409   1e-135   
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               412   1e-135   
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    412   1e-135   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          411   1e-135   
emb|CDY53564.1|  BnaC04g55760D                                          412   1e-135   
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    412   1e-135   
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                411   1e-135   
ref|NP_001190720.1|  probable pectate lyase 15                          411   1e-135   
ref|XP_003601871.1|  Pectate lyase                                      409   1e-135   
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             410   2e-135   
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               409   2e-135   
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                410   2e-135   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     411   2e-135   
gb|KHN05801.1|  Putative pectate lyase 22                               409   2e-135   
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                410   2e-135   
ref|NP_001280839.1|  probable pectate lyase 18 precursor                409   2e-135   
gb|KHG06252.1|  hypothetical protein F383_10745                         410   2e-135   
gb|EPS70363.1|  hypothetical protein M569_04396                         407   2e-135   
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          410   3e-135   
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  408   3e-135   
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          410   3e-135   
gb|KHG30349.1|  hypothetical protein F383_15991                         412   3e-135   
emb|CBI33346.3|  unnamed protein product                                409   4e-135   
emb|CDY03419.1|  BnaC01g16630D                                          409   4e-135   
emb|CDO99404.1|  unnamed protein product                                410   4e-135   
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     407   4e-135   
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             412   5e-135   
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                410   5e-135   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           410   5e-135   
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          408   5e-135   
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                410   5e-135   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     409   6e-135   
ref|XP_010067210.1|  PREDICTED: probable pectate lyase 5 isoform X1     411   7e-135   
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                410   7e-135   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             409   8e-135   
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               409   9e-135   
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     409   9e-135   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                409   9e-135   
emb|CDY01151.1|  BnaA04g06680D                                          409   1e-134   
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     409   1e-134   
emb|CDY66697.1|  BnaAnng22760D                                          409   1e-134   
emb|CDY18738.1|  BnaC08g08780D                                          410   1e-134   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                407   1e-134   
dbj|BAF43573.1|  pectate lyase                                          408   1e-134   
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             409   1e-134   
emb|CDP13719.1|  unnamed protein product                                407   1e-134   
gb|EPS68938.1|  hypothetical protein M569_05827                         406   2e-134   
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              408   2e-134   
ref|XP_010109687.1|  hypothetical protein L484_015172                   408   2e-134   
emb|CDY24847.1|  BnaA08g14630D                                          407   2e-134   
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              406   2e-134   
emb|CDP03845.1|  unnamed protein product                                408   2e-134   
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   406   3e-134   
ref|XP_003638513.1|  Pectate lyase                                      406   3e-134   
gb|EPS60822.1|  hypothetical protein M569_13978                         405   3e-134   
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                407   3e-134   
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                408   3e-134   
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like          406   3e-134   
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              408   3e-134   
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like           406   3e-134   
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                407   3e-134   
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    405   4e-134   
dbj|BAF43572.1|  pectate lyase                                          406   4e-134   
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          406   4e-134   
ref|XP_006604001.1|  PREDICTED: pectate lyase-like                      406   4e-134   
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    407   4e-134   
gb|EMT28700.1|  hypothetical protein F775_17439                         405   4e-134   
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               405   4e-134   
ref|NP_001268051.1|  pectate lyase precursor                            405   5e-134   
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                407   5e-134   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             407   6e-134   
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               405   6e-134   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                407   7e-134   
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               407   8e-134   
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5                405   8e-134   
emb|CDX89799.1|  BnaA10g02830D                                          406   8e-134   
emb|CDY19932.1|  BnaA09g03190D                                          405   8e-134   
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                405   8e-134   
ref|NP_563715.1|  putative pectate lyase 1                              406   9e-134   
emb|CDP16631.1|  unnamed protein product                                405   9e-134   
emb|CDX77470.1|  BnaA07g06080D                                          407   9e-134   
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                406   1e-133   
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                406   1e-133   
ref|XP_009614673.1|  PREDICTED: probable pectate lyase 13 isoform X2    408   1e-133   
emb|CDX86615.1|  BnaC08g00880D                                          405   1e-133   
emb|CDY56668.1|  BnaCnng30870D                                          405   1e-133   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                405   1e-133   
ref|XP_009614672.1|  PREDICTED: probable pectate lyase 13 isoform X1    408   1e-133   
ref|XP_002892236.1|  pectate lyase family protein                       405   2e-133   
ref|XP_006830637.1|  hypothetical protein AMTR_s00120p00111300          410   2e-133   
ref|XP_009778382.1|  PREDICTED: probable pectate lyase 12 isoform X2    406   2e-133   
ref|XP_004173339.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    405   2e-133   
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                405   2e-133   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                405   2e-133   
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                405   2e-133   
ref|XP_004173516.1|  PREDICTED: probable pectate lyase 12-like          403   2e-133   
ref|XP_004150371.1|  PREDICTED: probable pectate lyase 12-like          407   2e-133   
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                405   2e-133   
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               404   2e-133   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          405   2e-133   
ref|XP_002521130.1|  Pectate lyase precursor, putative                  405   2e-133   
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                405   2e-133   
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           404   2e-133   
ref|XP_002884619.1|  pectate lyase family protein                       404   3e-133   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                405   3e-133   
ref|NP_187357.1|  putative pectate lyase 8                              404   3e-133   
ref|XP_002265729.1|  PREDICTED: probable pectate lyase 22               404   3e-133   
ref|XP_008456538.1|  PREDICTED: probable pectate lyase 12               407   3e-133   
emb|CDY08948.1|  BnaC08g11780D                                          404   3e-133   
ref|XP_002522747.1|  Pectate lyase precursor, putative                  403   4e-133   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               403   4e-133   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                405   4e-133   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                404   5e-133   
ref|XP_009761366.1|  PREDICTED: probable pectate lyase 13 isoform X2    406   5e-133   
ref|XP_009761365.1|  PREDICTED: probable pectate lyase 13 isoform X1    406   6e-133   
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                403   6e-133   
ref|XP_009627088.1|  PREDICTED: probable pectate lyase 5                406   6e-133   
ref|XP_009778380.1|  PREDICTED: probable pectate lyase 5 isoform X1     406   7e-133   
gb|AFK32131.1|  pectate lyase                                           401   7e-133   
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               404   8e-133   
emb|CDY61137.1|  BnaC05g48970D                                          404   8e-133   
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                404   9e-133   
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    402   9e-133   
ref|XP_006361698.1|  PREDICTED: probable pectate lyase 13-like is...    405   1e-132   
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         404   1e-132   
ref|XP_002515037.1|  Pectate lyase precursor, putative                  402   1e-132   
gb|KHF99208.1|  hypothetical protein F383_08934                         404   1e-132   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    403   1e-132   
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                402   1e-132   
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                402   1e-132   
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                404   1e-132   
ref|XP_003524720.1|  PREDICTED: pectate lyase-like                      402   1e-132   
ref|XP_002875382.1|  predicted protein                                  402   1e-132   
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     404   1e-132   
gb|ACB12931.1|  pectate lyase 1-27                                      404   2e-132   
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                403   2e-132   
ref|XP_002304700.1|  pectate lyase family protein                       404   2e-132   
ref|XP_006361699.1|  PREDICTED: probable pectate lyase 13-like is...    402   2e-132   
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          403   3e-132   
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                    401   3e-132   
gb|EEC67092.1|  hypothetical protein OsI_33884                          404   4e-132   
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          402   4e-132   
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11               401   5e-132   
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                402   5e-132   
ref|XP_002300069.1|  pectate lyase family protein                       400   5e-132   
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    401   5e-132   
gb|AAM61584.1|  putative pectate lyase                                  401   6e-132   
gb|KEH41255.1|  pectate lyase family protein                            402   6e-132   
gb|AES72123.2|  pectate lyase family protein                            400   6e-132   
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           400   6e-132   
gb|AAK54283.1|AC034258_1  putative pectate lyase                        402   6e-132   
gb|AAP54096.1|  pectate lyase 12 precursor, putative, expressed         402   7e-132   
ref|NP_001064761.2|  Os10g0457200                                       402   7e-132   
ref|XP_007044917.1|  Pectate lyase family protein                       400   7e-132   
gb|ABR17909.1|  unknown                                                 401   7e-132   
ref|XP_003601872.1|  Pectate lyase                                      401   7e-132   
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           401   7e-132   
emb|CDX83690.1|  BnaC07g24300D                                          400   8e-132   
gb|EPS58104.1|  pectate lyase                                           398   1e-131   
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   400   1e-131   
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               400   1e-131   
ref|XP_003622996.1|  Pectate lyase 1-27                                 401   1e-131   
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             402   1e-131   
ref|XP_010916796.1|  PREDICTED: putative pectate lyase 2                399   2e-131   
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                      399   2e-131   
gb|AAX88800.1|  ripening-related pectate lyase                          400   2e-131   
ref|XP_010933176.1|  PREDICTED: probable pectate lyase 5                402   2e-131   
gb|KHN24117.1|  Putative pectate lyase 5                                398   2e-131   
gb|KEH44276.1|  pectate lyase family protein                            400   2e-131   
gb|KGN52235.1|  hypothetical protein Csa_5G622520                       403   2e-131   
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             401   2e-131   
emb|CDP08806.1|  unnamed protein product                                396   2e-131   
dbj|BAA95715.1|  pectate lyase-like protein                             399   2e-131   
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     400   2e-131   
ref|XP_002321242.2|  pectate lyase family protein                       397   2e-131   
gb|AFZ78654.1|  pectate lyase                                           400   3e-131   
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                400   3e-131   
gb|ABK25017.1|  unknown                                                 400   3e-131   
gb|ABR17766.1|  unknown                                                 399   3e-131   
ref|XP_008446817.1|  PREDICTED: probable pectate lyase 18               402   3e-131   
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             399   4e-131   
ref|NP_189376.1|  putative pectate lyase 11                             399   4e-131   
emb|CAC80136.1|  pectate lyase II enzyme                                400   4e-131   
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                399   4e-131   
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         398   4e-131   
gb|KDP39272.1|  hypothetical protein JCGZ_01029                         399   4e-131   
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               399   5e-131   
ref|XP_008233253.1|  PREDICTED: probable pectate lyase 5                401   5e-131   
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    397   5e-131   



>ref|XP_006348207.1| PREDICTED: putative pectate lyase 2-like [Solanum tuberosum]
Length=381

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/364 (77%), Positives = 314/364 (86%), Gaps = 6/364 (2%)
 Frame = -3

Query  1400  FVPTLN-AAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTD  1224
             + P+ N A +    +MNVIDSCWRAKSNW  NR ALADC VG+GK A+GGK G  YVVT+
Sbjct  23    YAPSKNYAPSTTKKTMNVIDSCWRAKSNWDKNRYALADCAVGYGKAAIGGKNGAIYVVTN  82

Query  1223  PSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGP  1044
             PSD+P NPKPGTLRYGAIQS PLWI+F KDMVITLKNELM+NS+KTIDGRGA VEIA GP
Sbjct  83    PSDDPVNPKPGTLRYGAIQSKPLWIIFNKDMVITLKNELMINSYKTIDGRGAEVEIAYGP  142

Query  1043  CITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCY  864
             CITIQ V+++IIHGIS+HDCKPGK G VRD+P HAG R G+DGD I IF ++++WIDHCY
Sbjct  143   CITIQHVSHVIIHGISIHDCKPGKKGIVRDSPVHAGHRNGADGDGIDIFQSTHVWIDHCY  202

Query  863   LARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLI  684
             LAR  DGLIDVIH ST +TISNNYFTQHDKVMLFGHNDNN+EDK MKVTVAFN+FGPGLI
Sbjct  203   LARCTDGLIDVIHASTGVTISNNYFTQHDKVMLFGHNDNNIEDKVMKVTVAFNYFGPGLI  262

Query  683   ERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG  504
             ERMPRVRLGYAHVANNRY  WLMYAIGGSANPTIFSEGNYF+A   S+S QVTKRE K G
Sbjct  263   ERMPRVRLGYAHVANNRYEKWLMYAIGGSANPTIFSEGNYFLA---SKSTQVTKRESKNG  319

Query  503   WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYS  324
             W NWKWRSSKDKFLNGAYF+PSGYG+  PYY+K+QSFPVADGS VP+LTADAGPLRC  +
Sbjct  320   WQNWKWRSSKDKFLNGAYFIPSGYGTTNPYYSKAQSFPVADGSMVPSLTADAGPLRC--T  377

Query  323   SSKC  312
             S KC
Sbjct  378   SYKC  381



>ref|XP_009598821.1| PREDICTED: putative pectate lyase 2 [Nicotiana tomentosiformis]
Length=381

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/356 (79%), Positives = 309/356 (87%), Gaps = 5/356 (1%)
 Frame = -3

Query  1379  AADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNP  1200
             A +   +MNVIDSCWR KSNWA NRRALADC VG+GK A+GGK+G  YVVT+P D+P NP
Sbjct  31    APNTKKTMNVIDSCWRTKSNWAKNRRALADCAVGYGKAAIGGKFGAIYVVTNPLDDPVNP  90

Query  1199  KPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVT  1020
             KPGTLRYG IQS PLWI FAK+MVITLKNELM+NS+KTIDGRGA VEIA GPCITI  V+
Sbjct  91    KPGTLRYGVIQSKPLWITFAKNMVITLKNELMINSYKTIDGRGAKVEIAYGPCITIAHVS  150

Query  1019  NIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGL  840
             ++IIHGIS+HDCKPGK G VRD+P HAG R G+DGD I IF +S+IWIDHCYLAR  DGL
Sbjct  151   HVIIHGISIHDCKPGKKGIVRDSPVHAGHRGGADGDGIDIFQSSHIWIDHCYLARCTDGL  210

Query  839   IDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRL  660
             IDVIH STA+TISNNYFTQHDKVMLFGHNDNN+EDK MKVTVAFN+FGPGLIERMPRVRL
Sbjct  211   IDVIHASTAVTISNNYFTQHDKVMLFGHNDNNIEDKVMKVTVAFNYFGPGLIERMPRVRL  270

Query  659   GYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRS  480
             GYAHVANNRY  WLMYAIGGSANPTIFSEGNYFMA    +S QVTKRE K GW NWKWRS
Sbjct  271   GYAHVANNRYEKWLMYAIGGSANPTIFSEGNYFMA---YKSTQVTKREAKNGWKNWKWRS  327

Query  479   SKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             SKDKF+NGAYF+PSGYGS  PYY+K+QSFPVADGS VP+LTADAGPLRC  +S KC
Sbjct  328   SKDKFMNGAYFIPSGYGSTNPYYSKAQSFPVADGSMVPSLTADAGPLRC--TSYKC  381



>ref|XP_004233784.1| PREDICTED: probable pectate lyase 16 [Solanum lycopersicum]
Length=382

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 313/365 (86%), Gaps = 7/365 (2%)
 Frame = -3

Query  1400  FVPTLNAAADKAT--SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVT  1227
             + P+ N  A   T  +MNVIDSCWRAKSNWA NR ALADC VG+GK A+GGK G  YVVT
Sbjct  23    YAPSKNYYAPSTTKKTMNVIDSCWRAKSNWAKNRYALADCAVGYGKAAIGGKNGAIYVVT  82

Query  1226  DPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANG  1047
             +PSD+P NPKPGTLRYG IQS PLWI+F KDMVITLKNELM+NS+KTIDGRGA VEIA G
Sbjct  83    NPSDDPVNPKPGTLRYGVIQSKPLWIIFNKDMVITLKNELMINSYKTIDGRGAKVEIAYG  142

Query  1046  PCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHC  867
             PCITIQ V+++IIHGIS+HDCKPGK G VRD+P HAG R G+DGD I IF ++++WIDHC
Sbjct  143   PCITIQRVSHVIIHGISIHDCKPGKRGIVRDSPVHAGHRNGADGDGIDIFQSTHVWIDHC  202

Query  866   YLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGL  687
             YLAR  DGLIDVIH ST +TISNNYFTQHDKVMLFGHNDNN EDK MKVTVAFN+FGPGL
Sbjct  203   YLARCTDGLIDVIHASTGVTISNNYFTQHDKVMLFGHNDNNKEDKIMKVTVAFNYFGPGL  262

Query  686   IERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKK  507
             IERMPRVRLGYAHVANNRY  WLMYAIGGSANPTIFSEGNYF+A   S+S QVTKRE K 
Sbjct  263   IERMPRVRLGYAHVANNRYEKWLMYAIGGSANPTIFSEGNYFLA---SKSTQVTKRESKN  319

Query  506   GWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSY  327
             GW NWKWRSSKDKFLNGAYF+PSGYG+  PYY+K+QSFPVADGS VP+LTADAGPLRC  
Sbjct  320   GWQNWKWRSSKDKFLNGAYFIPSGYGTTNPYYSKAQSFPVADGSMVPSLTADAGPLRC--  377

Query  326   SSSKC  312
             +S KC
Sbjct  378   TSYKC  382



>ref|XP_009781427.1| PREDICTED: putative pectate lyase 2 [Nicotiana sylvestris]
Length=383

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/350 (80%), Positives = 305/350 (87%), Gaps = 5/350 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             + NVIDSCWR KSNWA NRRALADC VG+GK A+GGK G  YVVT+PSD+P NPKPGTLR
Sbjct  39    TTNVIDSCWRTKSNWAKNRRALADCAVGYGKAAIGGKLGAIYVVTNPSDDPVNPKPGTLR  98

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YG IQS PLWI FAK+MVITLKNELM+NS+KTIDGRGA VEIA GPCITI  V+++IIHG
Sbjct  99    YGVIQSKPLWITFAKNMVITLKNELMINSYKTIDGRGAKVEIAYGPCITIAHVSHVIIHG  158

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGK G VRD+P HAG R G+DGD I IF +S+IWIDHCYLAR  DGLIDVIH 
Sbjct  159   ISIHDCKPGKKGIVRDSPVHAGHRGGADGDGIDIFHSSHIWIDHCYLARCTDGLIDVIHA  218

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             STA+TISNNYFTQHDKVMLFGHNDNN EDK MKVTVAFN+FGPGLIERMPRVRLGYAHVA
Sbjct  219   STAVTISNNYFTQHDKVMLFGHNDNNKEDKIMKVTVAFNYFGPGLIERMPRVRLGYAHVA  278

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  WLMYAIGGSANPTIFSEGNYFMA    +S QVTKRE K GW NWKWRSSKDKF+
Sbjct  279   NNRYEKWLMYAIGGSANPTIFSEGNYFMA---YKSTQVTKREAKNGWKNWKWRSSKDKFM  335

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGAYF+PSGYGS  PYY+K+QSFPVADGS VP+LTADAGPLRC  +S KC
Sbjct  336   NGAYFIPSGYGSTNPYYSKAQSFPVADGSMVPSLTADAGPLRC--TSYKC  383



>gb|EYU33881.1| hypothetical protein MIMGU_mgv1a008057mg [Erythranthe guttata]
Length=386

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/373 (74%), Positives = 315/373 (84%), Gaps = 3/373 (1%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGK  1269
             + + +II+  L+ I+    T +   +K   +N IDSCWR+KSNWASNR+ALADC VGFGK
Sbjct  12    IPSLIIILSTLVLIVDSSSTPSTYYNKV--LNPIDSCWRSKSNWASNRQALADCAVGFGK  69

Query  1268  DAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHK  1089
             +A+GGKYG+ YVVTDPSDNP  PKPGTLRYGAIQ  PLWI FA+ MVI L NELMVNS+K
Sbjct  70    NAIGGKYGSIYVVTDPSDNPETPKPGTLRYGAIQDKPLWITFARSMVIELGNELMVNSYK  129

Query  1088  TIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDA  909
             TIDGRG  VEIANGPCIT+Q V ++IIHGIS+HDCKPG SG VR++PTH G RRGSDGD 
Sbjct  130   TIDGRGVKVEIANGPCITLQYVKHVIIHGISVHDCKPGNSGIVRNSPTHMGHRRGSDGDG  189

Query  908   ISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKA  729
             I IF++S+IW+DHCYLAR  DGLIDVIH ST+ITISNNYFTQHDKVMLFGH DNN+EDK+
Sbjct  190   IDIFASSDIWVDHCYLARCTDGLIDVIHASTSITISNNYFTQHDKVMLFGHEDNNLEDKS  249

Query  728   MKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPN  549
             +KVTV FNHFGPGL++RMPRVRLGYAHVANNRY  W MYAIGGSANPTIFSEGNYFMAPN
Sbjct  250   IKVTVVFNHFGPGLVQRMPRVRLGYAHVANNRYEQWEMYAIGGSANPTIFSEGNYFMAPN  309

Query  548   KSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRV  369
                 KQVTKRE   GW+NWKWRSS+DKF NGAYFVPSGYGSCAP YT +QSFPVADG+  
Sbjct  310   NPGIKQVTKRET-SGWNNWKWRSSRDKFFNGAYFVPSGYGSCAPGYTGAQSFPVADGAMA  368

Query  368   PALTADAGPLRCS  330
             PALTA+AGPL C+
Sbjct  369   PALTANAGPLSCT  381



>ref|XP_011087039.1| PREDICTED: putative pectate lyase 2 [Sesamum indicum]
Length=387

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/380 (74%), Positives = 315/380 (83%), Gaps = 3/380 (1%)
 Frame = -3

Query  1454  LAMAAAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGF  1275
             L +A  +      L +  + P  N+ + K   MN IDSCWRA S WAS+RRALADC VGF
Sbjct  9     LTLALVLACTSTTLVLGSYNPPPNSYSKKI--MNPIDSCWRANSMWASDRRALADCVVGF  66

Query  1274  GKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNS  1095
             GKDAVGGKYG TYVVTDPSD+P +PKPGTLRYGAIQ  PLWI+FA+ MVI LKNELM+NS
Sbjct  67    GKDAVGGKYGATYVVTDPSDDPESPKPGTLRYGAIQEKPLWIIFARSMVIRLKNELMMNS  126

Query  1094  HKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDG  915
             +KTIDGRGA VEIA GPCITIQ V+++IIHGIS+HDCKPG  G VRD+P H G RRGSDG
Sbjct  127   YKTIDGRGAKVEIAYGPCITIQHVSHVIIHGISIHDCKPGNQGIVRDSPIHMGHRRGSDG  186

Query  914   DAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVED  735
             DAI IF++++IWIDHCYLAR  DGLIDVIH STAITISNNYF+QHDKVMLFGH+DNN+ED
Sbjct  187   DAIDIFASTDIWIDHCYLARCTDGLIDVIHASTAITISNNYFSQHDKVMLFGHDDNNLED  246

Query  734   KAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMA  555
             K++KVTV FNHFGPGL +   RVRLGYAHVANNRY  W MYAIGGSA+PTIFSEGNYFMA
Sbjct  247   KSIKVTVVFNHFGPGLFDVSSRVRLGYAHVANNRYDQWEMYAIGGSADPTIFSEGNYFMA  306

Query  554   PNKSESKQVTKREV-KKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADG  378
             PN  + KQVTKREV   GW NWKWRSS+DKF NGAYFVPSGYGSCAP YTK+QSF VADG
Sbjct  307   PNSPDIKQVTKREVTSSGWKNWKWRSSRDKFFNGAYFVPSGYGSCAPGYTKAQSFNVADG  366

Query  377   SRVPALTADAGPLRCSYSSS  318
             S VPALTADAGPL C+ S +
Sbjct  367   SMVPALTADAGPLGCTASKA  386



>ref|XP_011096153.1| PREDICTED: putative pectate lyase 2 [Sesamum indicum]
Length=387

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/343 (78%), Positives = 303/343 (88%), Gaps = 0/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWRAKSNWA+NRRALADC VGFGK+A+GGK+G TY+VTD SD+P  PKPGTLRY
Sbjct  40    MNPIDSCWRAKSNWATNRRALADCAVGFGKNAIGGKFGATYMVTDASDDPVKPKPGTLRY  99

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQS PLWI+FAK MVITLKNELM+NS+KTIDGRGA VEIA GPCITIQ V+++IIHGI
Sbjct  100   GVIQSKPLWIVFAKSMVITLKNELMINSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGI  159

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG V+D+P H G RRGSDGDAI IF +S++WIDHC  AR  DGLIDVIHGS
Sbjct  160   SVHDCKPGKSGLVQDSPIHKGHRRGSDGDAIDIFDSSDVWIDHCSFARCYDGLIDVIHGS  219

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+F+ HDKVMLFGH+DNN+EDK +KVTVAFN FGPGL++RMPRVRLGYAHVAN
Sbjct  220   TAITISNNFFSHHDKVMLFGHDDNNLEDKKIKVTVAFNRFGPGLVQRMPRVRLGYAHVAN  279

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSA+PTIFSEGNYF+APN  + KQVTKRE K GW NWKWRSS+DKF+N
Sbjct  280   NRYDQWEMYAIGGSADPTIFSEGNYFVAPNNPDVKQVTKRETKNGWKNWKWRSSRDKFIN  339

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             GAYFVPSGYG+ AP YTK QSF VADG+ VPALT+DAGPL C+
Sbjct  340   GAYFVPSGYGTTAPGYTKIQSFKVADGAMVPALTSDAGPLSCT  382



>gb|EYU27758.1| hypothetical protein MIMGU_mgv1a024530mg [Erythranthe guttata]
Length=348

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/343 (77%), Positives = 302/343 (88%), Gaps = 0/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR+K NWA+NR+ALADC VGFGK+A+GGKYG  YVVTDPSD+  NPKPGTLRY
Sbjct  1     MNPIDSCWRSKPNWAANRQALADCAVGFGKNAIGGKYGAIYVVTDPSDDAANPKPGTLRY  60

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQS PLWI FA+ MVI LKNELM+NS+KTIDGRGA VEIA GPCITI  V+++IIHGI
Sbjct  61    GVIQSKPLWITFARSMVIRLKNELMINSYKTIDGRGAKVEIAYGPCITIAHVSHVIIHGI  120

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPG SG VRD+PTHAG RRGSDGD I +F+++++WIDHC+L+   DGLIDVIH S
Sbjct  121   SVHDCKPGYSGVVRDSPTHAGHRRGSDGDGIDVFASTDVWIDHCFLSNCYDGLIDVIHAS  180

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             T ITISNN+FT HDKVMLFGH+D+NVED+ MKVTV FNHFGPGL++RMPRVRLGYAHVAN
Sbjct  181   TGITISNNFFTNHDKVMLFGHDDSNVEDRVMKVTVVFNHFGPGLVQRMPRVRLGYAHVAN  240

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY+ W MYAIGGSANPTIFSEGNYFMAPN++E KQVTKREVK GW NWKWR+S+D+F+N
Sbjct  241   NRYSQWEMYAIGGSANPTIFSEGNYFMAPNRAEIKQVTKREVKNGWQNWKWRTSRDRFMN  300

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             GAYFV SGYG+ A  YTK+QSF VADGS VPALT+DAGPL C+
Sbjct  301   GAYFVTSGYGTTATGYTKTQSFQVADGSMVPALTSDAGPLTCA  343



>ref|XP_006449769.1| hypothetical protein CICLE_v10017878mg [Citrus clementina]
 gb|ESR63009.1| hypothetical protein CICLE_v10017878mg [Citrus clementina]
Length=389

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/342 (79%), Positives = 297/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNVIDSCWRAKSNWA NR+ALADC VGFGK  +GGKYG  YVVTDPSD+P NPK GTLRY
Sbjct  42    MNVIDSCWRAKSNWAVNRKALADCVVGFGKGTLGGKYGAIYVVTDPSDDPINPKLGTLRY  101

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVI LKNEL++NS KTIDGRGA VEIANGPCITIQGV+++IIHGI
Sbjct  102   GVIQTNPLWIIFAKDMVIRLKNELIMNSFKTIDGRGAKVEIANGPCITIQGVSHVIIHGI  161

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +P H GRR GSDGDAI IF++S +W+DHCYLARAADGLIDVIH S
Sbjct  162   SIHDCKPGKSGQVRSSPDHVGRRGGSDGDAIDIFASSYVWVDHCYLARAADGLIDVIHAS  221

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYF QHDKVML GHND    DK MKVT+AFNHFGPGLIERMPRVR+GYAHVAN
Sbjct  222   TAVTISNNYFEQHDKVMLLGHNDQFTADKIMKVTIAFNHFGPGLIERMPRVRIGYAHVAN  281

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSANPTIFSEGNYFMA N   +K+VTKRE   GW +WKWR+SKD FLN
Sbjct  282   NRYEDWKMYAIGGSANPTIFSEGNYFMASNDQNTKEVTKRESYGGWKSWKWRTSKDVFLN  341

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYFVPSGYGSCAP Y+++QSF VA G+ VPALTA+AGPL C
Sbjct  342   GAYFVPSGYGSCAPNYSRAQSFVVAPGAMVPALTANAGPLSC  383



>ref|XP_004153041.1| PREDICTED: putative pectate lyase 2-like [Cucumis sativus]
 gb|KGN64489.1| hypothetical protein Csa_1G059200 [Cucumis sativus]
Length=381

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/346 (76%), Positives = 298/346 (86%), Gaps = 0/346 (0%)
 Frame = -3

Query  1370  KATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPG  1191
             +  +MNVIDSCWR  SNWA NR+ALADC VG+GKDA+GGK+G  Y VTDPSDNP NPK G
Sbjct  30    QKKNMNVIDSCWRQTSNWAKNRKALADCAVGYGKDAIGGKFGTIYTVTDPSDNPSNPKYG  89

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLRYG IQ  PLWI+F KDMVI LKNELMVNS KTIDGRGA VEIA GPCIT+QGV+++I
Sbjct  90    TLRYGVIQDKPLWIVFGKDMVIVLKNELMVNSFKTIDGRGAKVEIAYGPCITVQGVSHVI  149

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             IHGIS+HDCKPGK+G VRDT +H G+R+GSDGDAI++F +S++WIDHCYLAR  DGLIDV
Sbjct  150   IHGISIHDCKPGKAGLVRDTVSHIGKRKGSDGDAIAVFGSSHVWIDHCYLARCTDGLIDV  209

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             IH ST++TISNNYF+QHDKVML GHND   +DK M+VT+ FN FG GLIERMPRVR GYA
Sbjct  210   IHASTSVTISNNYFSQHDKVMLLGHNDGFTDDKIMRVTIVFNRFGAGLIERMPRVRFGYA  269

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKD  471
             HVANNRY  W MYAIGGSANPTIFSEGNYF+AP  S +KQVTKREV  GW NWKWRSS+D
Sbjct  270   HVANNRYDEWKMYAIGGSANPTIFSEGNYFVAPQNSYAKQVTKREVNNGWKNWKWRSSRD  329

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              FLNGAYFVPSG+GSC+P YTK+QSFPVA GS VPALTA++GPLRC
Sbjct  330   VFLNGAYFVPSGWGSCSPIYTKAQSFPVAPGSMVPALTANSGPLRC  375



>ref|XP_004164879.1| PREDICTED: putative pectate lyase 2-like [Cucumis sativus]
Length=588

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/343 (77%), Positives = 297/343 (87%), Gaps = 0/343 (0%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             +MNVIDSCWR  SNWA NR+ALADC VG+GKDA+GGK+G  Y VTDPSDNP NPK GTLR
Sbjct  240   TMNVIDSCWRQTSNWAKNRKALADCAVGYGKDAIGGKFGTIYTVTDPSDNPSNPKYGTLR  299

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YG IQ  PLWI+F KDMVI LKNELMVNS KTIDGRGA VEIA GPCIT+QGV+++IIHG
Sbjct  300   YGVIQDKPLWIVFGKDMVIVLKNELMVNSFKTIDGRGAKVEIAYGPCITVQGVSHVIIHG  359

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGK+G VRDT +H G+R+GSDGDAI++F +S++WIDHCYLAR  DGLIDVIH 
Sbjct  360   ISIHDCKPGKAGLVRDTVSHIGKRKGSDGDAIAVFGSSHVWIDHCYLARCTDGLIDVIHA  419

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             ST++TISNNYF+QHDKVML GHND   +DK M+VT+ FN FG GLIERMPRVR GYAHVA
Sbjct  420   STSVTISNNYFSQHDKVMLLGHNDGFTDDKIMRVTIVFNRFGAGLIERMPRVRFGYAHVA  479

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  W MYAIGGSANPTIFSEGNYF+AP  S +KQVTKREV  GW NWKWRSS+D FL
Sbjct  480   NNRYDEWKMYAIGGSANPTIFSEGNYFVAPQNSNAKQVTKREVNNGWKNWKWRSSRDVFL  539

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFVPSG+GSC+P YTK+QSFPVA GS VPALTA++GPLRC
Sbjct  540   NGAYFVPSGWGSCSPIYTKAQSFPVAPGSMVPALTANSGPLRC  582



>ref|XP_008440763.1| PREDICTED: putative pectate lyase 2 [Cucumis melo]
Length=381

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/343 (77%), Positives = 296/343 (86%), Gaps = 0/343 (0%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             +MNVIDSCWR  SNWA NR+ALADC VG+GKDA+GGK+G  Y VTDPSDNP NPK GTLR
Sbjct  33    NMNVIDSCWRQTSNWAKNRKALADCAVGYGKDAIGGKFGTIYTVTDPSDNPSNPKYGTLR  92

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YG IQ  PLWI+F KDMVI LKNELMVNS KTIDGRGA VEIA GPCIT+QGV+++IIHG
Sbjct  93    YGVIQDKPLWIVFGKDMVIVLKNELMVNSFKTIDGRGAKVEIAYGPCITVQGVSHVIIHG  152

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGKSG VRDT +H G+R+GSDGDAI++F +S++WIDHCYLAR  DGLIDVIH 
Sbjct  153   ISIHDCKPGKSGLVRDTVSHVGKRKGSDGDAIAVFGSSHVWIDHCYLARCTDGLIDVIHA  212

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             ST++TISNNYF+QHDKVML GHND   +DK M+VT+ FN FG GLIERMPRVR GYAHVA
Sbjct  213   STSVTISNNYFSQHDKVMLLGHNDGFTDDKIMRVTIVFNRFGAGLIERMPRVRFGYAHVA  272

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  W MYAIGGSANPTIFSEGNYF+A   S +KQVTKREV  GW NWKWRSS+D FL
Sbjct  273   NNRYDEWKMYAIGGSANPTIFSEGNYFVASQNSYAKQVTKREVNNGWKNWKWRSSRDVFL  332

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFVPSG+GSC+P YTK+QSFPVA GS VPALTA+AGPLRC
Sbjct  333   NGAYFVPSGWGSCSPIYTKAQSFPVAPGSMVPALTANAGPLRC  375



>ref|XP_004145189.1| PREDICTED: putative pectate lyase 2-like [Cucumis sativus]
Length=622

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/343 (77%), Positives = 297/343 (87%), Gaps = 0/343 (0%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             +MNVIDSCWR  SNWA NR+ALADC VG+GKDA+GGK+G  Y VTDPSDNP NPK GTLR
Sbjct  274   TMNVIDSCWRQTSNWAKNRKALADCAVGYGKDAIGGKFGTIYTVTDPSDNPSNPKYGTLR  333

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YG IQ  PLWI+F KDMVI LKNELMVNS KTIDGRGA VEIA GPCIT+QGV+++IIHG
Sbjct  334   YGVIQDKPLWIVFGKDMVIVLKNELMVNSFKTIDGRGAKVEIAYGPCITVQGVSHVIIHG  393

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGK+G VRDT +H G+R+GSDGDAI++F +S++WIDHCYLAR  DGLIDVIH 
Sbjct  394   ISIHDCKPGKAGLVRDTVSHIGKRKGSDGDAIAVFGSSHVWIDHCYLARCTDGLIDVIHA  453

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             ST++TISNNYF+QHDKVML GHND   +DK M+VT+ FN FG GLIERMPRVR GYAHVA
Sbjct  454   STSVTISNNYFSQHDKVMLLGHNDGFTDDKIMRVTIVFNRFGAGLIERMPRVRFGYAHVA  513

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  W MYAIGGSANPTIFSEGNYF+AP  S +KQVTKREV  GW NWKWRSS+D FL
Sbjct  514   NNRYDEWKMYAIGGSANPTIFSEGNYFVAPQNSYAKQVTKREVNNGWKNWKWRSSRDVFL  573

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFVPSG+GSC+P YTK+QSFPVA GS VPALTA++GPLRC
Sbjct  574   NGAYFVPSGWGSCSPIYTKAQSFPVAPGSMVPALTANSGPLRC  616



>ref|XP_006467400.1| PREDICTED: putative pectate lyase 2-like [Citrus sinensis]
Length=389

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/342 (78%), Positives = 295/342 (86%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNVIDSCWRAKSNWA NR+AL DC VGFGK  +GGKYG  YVVTDPSD+P NPK GTLRY
Sbjct  42    MNVIDSCWRAKSNWAVNRKALTDCVVGFGKGTLGGKYGAIYVVTDPSDDPVNPKLGTLRY  101

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVI LKNEL++NS KTIDGRGA VEIANGPCITIQGV+++IIHGI
Sbjct  102   GVIQTKPLWIIFAKDMVIRLKNELIMNSFKTIDGRGAKVEIANGPCITIQGVSHVIIHGI  161

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +P H GRR GSDGDAI IF++S +W+DHCYLARAADGLIDVIH S
Sbjct  162   SIHDCKPGKSGQVRSSPDHVGRRGGSDGDAIDIFASSYVWVDHCYLARAADGLIDVIHAS  221

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNN F QHDKVML GHND    DK MKVT+AFNHFGPGLIERMPRVR+GYAHVAN
Sbjct  222   TAVTISNNCFEQHDKVMLLGHNDQFTADKIMKVTIAFNHFGPGLIERMPRVRIGYAHVAN  281

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSANPTIFSEGNYFMA N   +K+VTKRE   GW +WKWR+SKD FLN
Sbjct  282   NRYEDWKMYAIGGSANPTIFSEGNYFMASNDQNTKEVTKRESYGGWKSWKWRTSKDVFLN  341

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYFVPSGYGSCAP Y+++QSF VA G+ VPALTA+AGPL C
Sbjct  342   GAYFVPSGYGSCAPNYSRAQSFVVAPGAMVPALTANAGPLSC  383



>ref|XP_007026137.1| Root hair specific 14 [Theobroma cacao]
 gb|EOY28759.1| Root hair specific 14 [Theobroma cacao]
Length=405

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/401 (70%), Positives = 317/401 (79%), Gaps = 21/401 (5%)
 Frame = -3

Query  1478  LSQFISSNLAMAAAV--IIIMPLLGIMGFVPTLNAA-----------ADKATS------M  1356
             +SQ    N AMAA++   ++   L +  F  T  AA           AD   S      M
Sbjct  1     MSQIAQPNSAMAASLTSFVLFSFL-LSNFALTSQAAYSLEGYTSKPLADYVPSVAPKKVM  59

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             NVIDSCWR +SNWA+NRRALADC VGFGK A+GGKYG  YVVT+P DNP NP PGTLRYG
Sbjct  60    NVIDSCWRTRSNWATNRRALADCAVGFGKAAIGGKYGAIYVVTNPYDNPINPAPGTLRYG  119

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ++PLWI+FA+DMVITLKNEL+VNS KTIDGRGA VEIA GPCIT+QGVTN+IIHGIS
Sbjct  120   VIQTSPLWIIFARDMVITLKNELIVNSFKTIDGRGAKVEIAYGPCITVQGVTNVIIHGIS  179

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             ++DCKPGK+G VR +PTH G+R G DGDAISIF++SNIW+DHCYLAR+ADGLIDVI  ST
Sbjct  180   IYDCKPGKAGMVRSSPTHVGKRGGCDGDAISIFASSNIWVDHCYLARSADGLIDVIRAST  239

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             A+TISNNYFTQHDKVML GH+D    DK MKVTVAFN FG GLIERMPRVR+GYAHVANN
Sbjct  240   AVTISNNYFTQHDKVMLLGHSDKFTADKVMKVTVAFNRFGEGLIERMPRVRIGYAHVANN  299

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNG  456
             RY  W MYAIGGSANPTIFSEGNYF+AP+ S SK+VTKRE    W NW W+SSKD F NG
Sbjct  300   RYDEWKMYAIGGSANPTIFSEGNYFIAPDNSASKEVTKREASN-WRNWTWQSSKDVFKNG  358

Query  455   AYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             AYFVPSGYGSCAP YT++QSF  A G  VPALT+DAGPLRC
Sbjct  359   AYFVPSGYGSCAPRYTRAQSFKAAPGYMVPALTSDAGPLRC  399



>gb|KDO78309.1| hypothetical protein CISIN_1g047672mg [Citrus sinensis]
Length=389

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/342 (78%), Positives = 295/342 (86%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNVIDSCWRAKSNWA NR+AL DC VGFGK  +GGKYG  YVVTDPSD+P NPK GTLRY
Sbjct  42    MNVIDSCWRAKSNWAVNRKALTDCVVGFGKGTLGGKYGAIYVVTDPSDDPVNPKLGTLRY  101

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVI LKNEL++NS KTIDGRGA VEIANGPCITIQGV+++IIHGI
Sbjct  102   GVIQTKPLWIIFAKDMVIRLKNELIMNSFKTIDGRGAKVEIANGPCITIQGVSHVIIHGI  161

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +P H GRR GSDGDAI IF++S +W+DHCYLARAADGLIDVIH S
Sbjct  162   SIHDCKPGKSGQVRSSPDHVGRRGGSDGDAIDIFASSYVWVDHCYLARAADGLIDVIHAS  221

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNN F QHDKVML GHND    DK MKVT+AFNHFGPGLIERMPRVR+GYAHVAN
Sbjct  222   TAVTISNNCFEQHDKVMLLGHNDQFTADKIMKVTIAFNHFGPGLIERMPRVRIGYAHVAN  281

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSANPTIFSEGNYFMA N   +K+VTKRE   GW +WKWR+SKD FLN
Sbjct  282   NRYEDWKMYAIGGSANPTIFSEGNYFMASNDQNTKEVTKRESYGGWKSWKWRTSKDVFLN  341

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYFVPSGYGSCAP Y+++QSF VA G+ VPALTA+AGPL C
Sbjct  342   GAYFVPSGYGSCAPNYSRAQSFVVAPGAMVPALTANAGPLSC  383



>emb|CDP04429.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/343 (78%), Positives = 305/343 (89%), Gaps = 0/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN+IDSCWR++SNWA NRRALADC +GFGK+A+GGKYG TY+VTDPSDNPG+PK GTLR+
Sbjct  1     MNIIDSCWRSRSNWADNRRALADCAIGFGKNAIGGKYGATYIVTDPSDNPGHPKSGTLRH  60

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G +Q+ PLWI+FA+DMVITLKNEL+VNS KTIDGRG  VEIA GPCITIQ V+++IIHG+
Sbjct  61    GVVQTKPLWIIFARDMVITLKNELIVNSFKTIDGRGVKVEIAYGPCITIQHVSHVIIHGV  120

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK+G V+ + TH GRR GSDGD I IF +S IWIDHC+LAR +DGLIDVIH S
Sbjct  121   SIHDCKPGKAGIVQSSSTHTGRRGGSDGDGIDIFDSSYIWIDHCFLARCSDGLIDVIHAS  180

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFTQHDKVMLFGHND N ED A+KVTVAFNHFGPGL++RMPRVRLGYAHVAN
Sbjct  181   TAITISNNYFTQHDKVMLFGHNDKNTEDNAIKVTVAFNHFGPGLVQRMPRVRLGYAHVAN  240

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSANPTIFSEGNYFMAP+  ++KQVTKRE K GW NWKWRSSKDKF+N
Sbjct  241   NRYDRWEMYAIGGSANPTIFSEGNYFMAPDSPDAKQVTKREAKNGWKNWKWRSSKDKFMN  300

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             GAYFV SGYG+C+P Y + Q+FPVADGS VPALTADAGPLRC+
Sbjct  301   GAYFVQSGYGNCSPGYNRYQNFPVADGSLVPALTADAGPLRCT  343



>emb|CAN60346.1| hypothetical protein VITISV_001795 [Vitis vinifera]
Length=397

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/343 (77%), Positives = 297/343 (87%), Gaps = 0/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR K+NWASNRRALADC VGFGK A+GGKYG  YVVT PSD+P NPKPGTLRY
Sbjct  50    MNPIDSCWRRKANWASNRRALADCAVGFGKGAMGGKYGAMYVVTTPSDDPVNPKPGTLRY  109

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCITIQGV+++IIHGI
Sbjct  110   GVIQTKPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITIQGVSHVIIHGI  169

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR T  H G R GSDGDAISIF++S++WIDHCYLA   DGLIDVIH S
Sbjct  170   SIHDCKPGKSGLVRSTTMHVGHRLGSDGDAISIFTSSHVWIDHCYLASCTDGLIDVIHAS  229

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYF+ HDKVMLFGH+D+   DK M VTVAFNHFG GL++RMPRVR GYAH+AN
Sbjct  230   TAITISNNYFSHHDKVMLFGHDDHFTADKVMSVTVAFNHFGTGLVQRMPRVRFGYAHLAN  289

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             N+Y  W MYAIGGSANPTI SEGN+F AP+ + +K+VTKREVK GW NWKWRSSKDKF+N
Sbjct  290   NKYDEWEMYAIGGSANPTILSEGNHFTAPDNANTKEVTKREVKSGWKNWKWRSSKDKFVN  349

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             GAYFV SG+GSCAP Y++SQ+F VADGS VPALT+DAGPL CS
Sbjct  350   GAYFVQSGWGSCAPLYSRSQAFSVADGSMVPALTSDAGPLGCS  392



>ref|XP_002263615.2| PREDICTED: LOW QUALITY PROTEIN: putative pectate lyase 2 [Vitis 
vinifera]
Length=397

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/343 (77%), Positives = 297/343 (87%), Gaps = 0/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR K+NWASNRRALADC VGFGK A+GGKYG  YVVT PSD+P NPKPGTLRY
Sbjct  50    MNPIDSCWRRKANWASNRRALADCAVGFGKGAMGGKYGAMYVVTTPSDDPVNPKPGTLRY  109

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCITIQGV+++IIHGI
Sbjct  110   GVIQTKPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITIQGVSHVIIHGI  169

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR T  H G R GSDGDAISIF++S++WIDHCYLA   DGLIDVIH S
Sbjct  170   SIHDCKPGKSGLVRSTTMHVGHRLGSDGDAISIFTSSHVWIDHCYLASCTDGLIDVIHAS  229

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYF+ HDKVMLFGH+D+   DK M VTVAFNHFG GL++RMPRVR GYAH+AN
Sbjct  230   TAITISNNYFSHHDKVMLFGHDDHFTADKVMSVTVAFNHFGTGLVQRMPRVRFGYAHLAN  289

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             N+Y  W MYAIGGSANPTI SEGN+F AP+ + +K+VTKREVK GW NWKWRSSKDKF+N
Sbjct  290   NKYDEWEMYAIGGSANPTILSEGNHFTAPDNANTKEVTKREVKSGWKNWKWRSSKDKFVN  349

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             GAYFV SG+GSCAP Y++SQ+F VADGS VPALT+DAGPL CS
Sbjct  350   GAYFVXSGWGSCAPLYSRSQAFSVADGSMVPALTSDAGPLGCS  392



>ref|XP_007214229.1| hypothetical protein PRUPE_ppa025559mg [Prunus persica]
 gb|EMJ15428.1| hypothetical protein PRUPE_ppa025559mg [Prunus persica]
Length=385

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/344 (76%), Positives = 298/344 (87%), Gaps = 0/344 (0%)
 Frame = -3

Query  1364  TSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTL  1185
             T+MNV+DSCWR+KSNWA NRRALA+C VGFG+DAVGGKYG+TYVVT   D+P NPKPG+L
Sbjct  36    TTMNVVDSCWRSKSNWAINRRALANCAVGFGQDAVGGKYGSTYVVTTSYDDPINPKPGSL  95

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RYG IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCIT+QGV+++IIH
Sbjct  96    RYGVIQTQPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITVQGVSHVIIH  155

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GIS+HDCKPGK G VR TPTH G RRG DGDAISIF++S++W+DHC+LAR++DGLIDV H
Sbjct  156   GISIHDCKPGKGGNVRSTPTHVGHRRGCDGDAISIFASSHVWVDHCFLARSSDGLIDVTH  215

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
              STA+TI+NNYF+QHDKVML GHNDN   DK MKVT+AFN FG GLIERMPRVR GYAHV
Sbjct  216   ASTAVTITNNYFSQHDKVMLLGHNDNFSADKGMKVTIAFNRFGAGLIERMPRVRFGYAHV  275

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKF  465
             ANNRY  W MYA+GGSANPTIFSEGNYF+AP  + +KQVTKRE    W+NWKWRSSKD F
Sbjct  276   ANNRYDEWKMYAVGGSANPTIFSEGNYFIAPETAYAKQVTKRESGGRWNNWKWRSSKDMF  335

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              NGA+FV SGYGSC P Y+K+QSF V DGS VPALT+ AGPLRC
Sbjct  336   KNGAFFVQSGYGSCYPLYSKTQSFKVLDGSMVPALTSSAGPLRC  379



>ref|XP_010052872.1| PREDICTED: putative pectate lyase 2 [Eucalyptus grandis]
Length=386

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/383 (70%), Positives = 311/383 (81%), Gaps = 10/383 (3%)
 Frame = -3

Query  1454  LAMAAAVIIIMPLLGIMGFVPTLNAAADKATS-------MNVIDSCWRAKSNWASNRRAL  1296
             +A  A  +++  LL +   +P+L A  D +T        MNVIDSCWR+   WA+NRRAL
Sbjct  1     MAYLAPFLVLSCLLTLP--LPSLQAYYDSSTPYYSYKKPMNVIDSCWRSNPKWAANRRAL  58

Query  1295  ADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLK  1116
             ADC VGFG +A+GGKYG+ YVVT P D+P NPKPG LRYGAIQ  PLWI FA+DM ITLK
Sbjct  59    ADCAVGFGSNAIGGKYGSIYVVTSPLDDPVNPKPGMLRYGAIQDKPLWITFARDMKITLK  118

Query  1115  NELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAG  936
             NELMVNS+KTIDGRGA VEIANGPCIT+Q V+++I+HGIS+HDCKPGKSG VRD+PTHAG
Sbjct  119   NELMVNSYKTIDGRGAKVEIANGPCITLQYVSHVILHGISIHDCKPGKSGIVRDSPTHAG  178

Query  935   RRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGH  756
             RR+GSDGDAIS+F++S+IW+DHC+LAR  DGLIDVI  STA+TISNNYF QHDKVML GH
Sbjct  179   RRQGSDGDAISVFASSHIWVDHCFLARCTDGLIDVIRASTAVTISNNYFQQHDKVMLLGH  238

Query  755   NDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFS  576
             ND    DK M+VTV FN FG GLIERMPRVR GYAHVANN+Y  W MYAIGGSANPTIFS
Sbjct  239   NDKYTADKVMRVTVVFNRFGSGLIERMPRVRFGYAHVANNQYDEWRMYAIGGSANPTIFS  298

Query  575   EGNYFMAPNKSESKQVTKREVKKG-WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQ  399
             EGNYF+A N   SKQVTKRE K G W +WKWRSS+D F NGAYFV SGYGSCAP Y+ +Q
Sbjct  299   EGNYFLASNNPVSKQVTKRETKSGDWKSWKWRSSRDLFENGAYFVQSGYGSCAPLYSGTQ  358

Query  398   SFPVADGSRVPALTADAGPLRCS  330
             SF VADGS+VPALT++AGPL C+
Sbjct  359   SFAVADGSKVPALTSNAGPLSCT  381



>ref|XP_011008017.1| PREDICTED: putative pectate lyase 2 [Populus euphratica]
Length=391

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/343 (78%), Positives = 295/343 (86%), Gaps = 1/343 (0%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             S+N IDSCWRAKSNWA+NRRALADC VGFG+ A+GGKYG  YVVT P+D+P NPKPG LR
Sbjct  44    SLNTIDSCWRAKSNWANNRRALADCAVGFGRGAMGGKYGAIYVVTTPNDDPVNPKPGMLR  103

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YGAIQS PLWI+FAK+MVI LKNEL++NS+KTIDGRGA VEIA GPCITIQGV+++IIHG
Sbjct  104   YGAIQSKPLWIVFAKNMVIRLKNELIMNSYKTIDGRGAKVEIAYGPCITIQGVSHVIIHG  163

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGKSG V  TPTH G+R GSDGDAI+IF++SN+WIDHCYLAR  DGLIDVI G
Sbjct  164   ISIHDCKPGKSGRVISTPTHVGKRGGSDGDAIAIFASSNVWIDHCYLARCTDGLIDVIRG  223

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             ST+ITISNNYF+QHDKVML GHND    DK MKVT+AFN FG GLIERMPRVR GYAHVA
Sbjct  224   STSITISNNYFSQHDKVMLLGHNDRYKADKVMKVTIAFNRFGSGLIERMPRVRFGYAHVA  283

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  W MYAIGGSANPTIFSEGNYF A N   SKQVTKRE K GW NWKWRSSKD F+
Sbjct  284   NNRYDEWQMYAIGGSANPTIFSEGNYFYARN-GNSKQVTKREAKNGWKNWKWRSSKDVFM  342

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFV SGYGSCAP Y+K+QSF VA GS VPALT+ AGPL C
Sbjct  343   NGAYFVQSGYGSCAPVYSKTQSFTVAPGSLVPALTSGAGPLNC  385



>ref|XP_008224700.1| PREDICTED: putative pectate lyase 2 [Prunus mume]
 ref|XP_008224702.1| PREDICTED: putative pectate lyase 2 [Prunus mume]
Length=385

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/344 (74%), Positives = 298/344 (87%), Gaps = 0/344 (0%)
 Frame = -3

Query  1364  TSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTL  1185
             T+MNV+DSCWR+KSNWA NRRALA+C VGFG+D VGGKYG+TY+VT+  D+P NP+PG+L
Sbjct  36    TTMNVVDSCWRSKSNWAINRRALANCAVGFGQDTVGGKYGSTYIVTNSYDDPINPQPGSL  95

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RYG IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCIT+QGV+++IIH
Sbjct  96    RYGVIQTQPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITVQGVSHVIIH  155

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GIS+HDCKPGK G VR TPTH G RRG DGD ISIF++S++W+DHC+LAR++DGLIDV H
Sbjct  156   GISIHDCKPGKGGNVRSTPTHVGHRRGCDGDGISIFASSHVWVDHCFLARSSDGLIDVTH  215

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
              STA+TI+NNYF+QHDKVML GHNDN   DK MKVT+AFN FG GLIERMPRVR GYAHV
Sbjct  216   ASTAVTITNNYFSQHDKVMLLGHNDNFSADKGMKVTIAFNRFGAGLIERMPRVRFGYAHV  275

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKF  465
             ANNRY  W MYA+GGSANPTIFSEGNYF+AP+ + +KQVTKRE    W+NWKWRSS+D F
Sbjct  276   ANNRYDEWKMYAVGGSANPTIFSEGNYFIAPDTAYAKQVTKRESGGRWNNWKWRSSRDVF  335

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              NGA+FV SGYGSC P Y+K+QSF V DGS VPALT+ AGPLRC
Sbjct  336   KNGAFFVQSGYGSCYPLYSKTQSFKVLDGSMVPALTSSAGPLRC  379



>gb|KCW77003.1| hypothetical protein EUGRSUZ_D01352 [Eucalyptus grandis]
Length=349

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/344 (76%), Positives = 294/344 (85%), Gaps = 1/344 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNVIDSCWR+   WA+NRRALADC VGFG +A+GGKYG+ YVVT P D+P NPKPG LRY
Sbjct  1     MNVIDSCWRSNPKWAANRRALADCAVGFGSNAIGGKYGSIYVVTSPLDDPVNPKPGMLRY  60

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ  PLWI FA+DM ITLKNELMVNS+KTIDGRGA VEIANGPCIT+Q V+++I+HGI
Sbjct  61    GAIQDKPLWITFARDMKITLKNELMVNSYKTIDGRGAKVEIANGPCITLQYVSHVILHGI  120

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VRD+PTHAGRR+GSDGDAIS+F++S+IW+DHC+LAR  DGLIDVI  S
Sbjct  121   SIHDCKPGKSGIVRDSPTHAGRRQGSDGDAISVFASSHIWVDHCFLARCTDGLIDVIRAS  180

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYF QHDKVML GHND    DK M+VTV FN FG GLIERMPRVR GYAHVAN
Sbjct  181   TAVTISNNYFQQHDKVMLLGHNDKYTADKVMRVTVVFNRFGSGLIERMPRVRFGYAHVAN  240

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG-WSNWKWRSSKDKFL  462
             N+Y  W MYAIGGSANPTIFSEGNYF+A N   SKQVTKRE K G W +WKWRSS+D F 
Sbjct  241   NQYDEWRMYAIGGSANPTIFSEGNYFLASNNPVSKQVTKRETKSGDWKSWKWRSSRDLFE  300

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             NGAYFV SGYGSCAP Y+ +QSF VADGS+VPALT++AGPL C+
Sbjct  301   NGAYFVQSGYGSCAPLYSGTQSFAVADGSKVPALTSNAGPLSCT  344



>ref|XP_006587976.1| PREDICTED: probable pectate lyase 16-like [Glycine max]
Length=397

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/352 (72%), Positives = 291/352 (83%), Gaps = 0/352 (0%)
 Frame = -3

Query  1388  LNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNP  1209
             +N   +    MN IDSCWRAK+NWASNR+ALADC +GFGK+A+GGK+G+ Y VTDPSD+P
Sbjct  40    INKTPEDVVIMNTIDSCWRAKTNWASNRKALADCAIGFGKEAIGGKFGDIYEVTDPSDDP  99

Query  1208  GNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQ  1029
              +PKPGTLRYGAIQ+ PLWI FAKDMVI LKNELMVNS+KTIDGRGA VEIANG CITIQ
Sbjct  100   VDPKPGTLRYGAIQTEPLWITFAKDMVIRLKNELMVNSYKTIDGRGAKVEIANGACITIQ  159

Query  1028  GVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAA  849
             GV ++I+HGIS+HDC+PGK G VR +P H G R GSDGDAISIF++SN+WIDHC+LAR  
Sbjct  160   GVCHVIVHGISIHDCEPGKGGMVRSSPEHVGYREGSDGDAISIFASSNVWIDHCFLARCT  219

Query  848   DGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPR  669
             DGLIDVIH STA+TISNNYFTQHDKVML GH+D    DK M+VTVAFN F  GLIERMPR
Sbjct  220   DGLIDVIHASTAVTISNNYFTQHDKVMLLGHSDEYTADKVMRVTVAFNRFASGLIERMPR  279

Query  668   VRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWK  489
             VR GYAHV NN Y  WLMYAIGGSA+PTIFSEGNYF A N S +KQVTKRE  + W+NWK
Sbjct  280   VRFGYAHVVNNLYDEWLMYAIGGSADPTIFSEGNYFTASNDSAAKQVTKRESSEKWNNWK  339

Query  488   WRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             WRS +D+F+NGAYFVPSGYGSC P Y+ +QSF  A  S VP LT +AGPL C
Sbjct  340   WRSFRDEFINGAYFVPSGYGSCTPIYSAAQSFIAAQASMVPLLTLNAGPLNC  391



>ref|XP_009598823.1| PREDICTED: probable pectate lyase 16 [Nicotiana tomentosiformis]
Length=399

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/343 (74%), Positives = 294/343 (86%), Gaps = 1/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +NVIDSCWR   +W+SNR+ALADC +GFG +A+GGKYG+ YVVTDPSD+P NP+PGTLRY
Sbjct  51    LNVIDSCWRLNHDWSSNRKALADCAIGFGSNAIGGKYGDIYVVTDPSDDPANPEPGTLRY  110

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQS PLWI+F +DMV+TLKNELMVNSHKTIDGRGA VEI+NGPCIT+  VTN+IIHGI
Sbjct  111   GVIQSEPLWIIFKRDMVLTLKNELMVNSHKTIDGRGAKVEISNGPCITLDYVTNVIIHGI  170

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +P H G R GSDGDAIS+F + N+WIDHCYLARA DGL+DVIH S
Sbjct  171   SIHDCKPGKKGMVRSSPEHVGERLGSDGDAISVFGSLNVWIDHCYLARATDGLLDVIHAS  230

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT+HDKVML GHND    D++MKVTV FNHFG  L++RMPRVR GYAHVAN
Sbjct  231   TAVTISNNYFTEHDKVMLLGHNDQYTADRSMKVTVVFNHFGRELVQRMPRVRYGYAHVAN  290

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV-KKGWSNWKWRSSKDKFL  462
             N Y  WLMYAIGGSA+PTIFSEGNYF+AP+K+ +K+VTKRE  +KGW +WKWRSSKD FL
Sbjct  291   NYYDQWLMYAIGGSADPTIFSEGNYFIAPDKAYNKEVTKRETEEKGWKSWKWRSSKDVFL  350

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYF PSGYGS AP YT+ QSF VA GS  P+LT+DAGPL+C
Sbjct  351   NGAYFNPSGYGSIAPKYTRGQSFIVAQGSLTPSLTSDAGPLQC  393



>ref|XP_009352643.1| PREDICTED: putative pectate lyase 2 [Pyrus x bretschneideri]
Length=382

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/342 (74%), Positives = 296/342 (87%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNV+DSCWR KSNWA+NRRALADC VGFGKDA+GGKYG TYVVT  +D+P NPKPG+LRY
Sbjct  35    MNVVDSCWRTKSNWATNRRALADCAVGFGKDALGGKYGRTYVVTTSNDDPVNPKPGSLRY  94

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCIT+QG++++IIHGI
Sbjct  95    GVIQTQPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITVQGISHVIIHGI  154

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR TPTH G+RRG DGDAI++F++S++WIDHC+LAR+ADGL+DV H S
Sbjct  155   SIHDCKPGKGGNVRSTPTHIGKRRGCDGDAIAVFASSHVWIDHCFLARSADGLLDVTHAS  214

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TI+NNYF+QHDKVML GHNDN   DK M+VT+AFN FG GL+ERMPRVR GYAHVAN
Sbjct  215   TAVTITNNYFSQHDKVMLLGHNDNFSADKNMRVTIAFNRFGAGLVERMPRVRFGYAHVAN  274

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYA+GGSANPTIFSEGNYF+AP  S +KQVTKRE    W+NWKWRSS D F N
Sbjct  275   NRYDEWKMYAVGGSANPTIFSEGNYFIAPETSYAKQVTKREAGGSWNNWKWRSSGDVFKN  334

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GA+FV SGYGSC P Y++ QSF V+ G+ VPALT++AGPLRC
Sbjct  335   GAFFVQSGYGSCYPLYSRKQSFKVSPGAMVPALTSNAGPLRC  376



>ref|XP_002518442.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF43829.1| Pectate lyase precursor, putative [Ricinus communis]
Length=393

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/342 (75%), Positives = 288/342 (84%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
              N +DSCWR   NWA+NR +LADC VGFGK A+GGK+G  YVVT P D+P NPKPGTLRY
Sbjct  43    FNTVDSCWRTNPNWATNRHSLADCAVGFGKAAIGGKFGAIYVVTTPFDDPANPKPGTLRY  102

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVITLKNEL+VNS KTIDGRGA VEI+NGPCITIQGV+++IIHGI
Sbjct  103   GVIQTKPLWIIFAKDMVITLKNELIVNSFKTIDGRGAKVEISNGPCITIQGVSHVIIHGI  162

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +PTH G+R GSDGDAI IF++SN+WIDHCY+A   DGLIDVIH S
Sbjct  163   SIHDCKPGKSGMVRSSPTHVGQRSGSDGDAIVIFASSNVWIDHCYIAHGTDGLIDVIHAS  222

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             T +TISNNYF  HDKVML GHND    DK MKVT+AFNHFG GLIERMPRVR GYAHVAN
Sbjct  223   TGVTISNNYFADHDKVMLLGHNDGYSADKIMKVTIAFNHFGSGLIERMPRVRFGYAHVAN  282

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSA+PTIFSEGNYF+AP+   SKQVTKRE K GW NWKWRSSKD F+N
Sbjct  283   NRYDEWKMYAIGGSADPTIFSEGNYFIAPDVYSSKQVTKREAKSGWKNWKWRSSKDVFMN  342

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYF+ SGYGS  P Y+++QSFPVA G  VPALT+DAGPLRC
Sbjct  343   GAYFLQSGYGSIIPPYSRTQSFPVAPGLLVPALTSDAGPLRC  384



>ref|XP_003547262.1| PREDICTED: probable pectate lyase 16-like [Glycine max]
 gb|KHN33006.1| Putative pectate lyase 2 [Glycine soja]
Length=373

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/362 (72%), Positives = 300/362 (83%), Gaps = 1/362 (0%)
 Frame = -3

Query  1418  LLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             LL +  F+  L  + + A  +N IDSCWRAKSNWASNR+ALA+CG+GFGKD++GGKYG+ 
Sbjct  7     LLLLSCFILHLAYSTESAV-LNKIDSCWRAKSNWASNRQALANCGIGFGKDSIGGKYGSI  65

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             Y VTDPSD+P +PKPGTLRYG IQ+ PLWI+FAKDMVI L NEL++NS+KTIDGRGA VE
Sbjct  66    YKVTDPSDDPISPKPGTLRYGVIQTQPLWIIFAKDMVIRLDNELIMNSYKTIDGRGAKVE  125

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IANGPCITIQGV+++IIHGIS+HDCKP K+G VR TP+H G RRGSDGD ISIF++SNIW
Sbjct  126   IANGPCITIQGVSHVIIHGISIHDCKPSKAGLVRSTPSHLGHRRGSDGDGISIFASSNIW  185

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHC+LAR ADGLIDVIH ST+ITISNNYFTQHDKVML GH+D    DK MKVT+AFN F
Sbjct  186   IDHCFLARCADGLIDVIHASTSITISNNYFTQHDKVMLLGHSDEYTADKKMKVTIAFNRF  245

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
               GLIERMPRVR GYAHV NN+Y GW MYAIGGS+NPTI SEGNY++APN   +KQVTKR
Sbjct  246   ASGLIERMPRVRFGYAHVVNNKYDGWKMYAIGGSSNPTILSEGNYYVAPNNPATKQVTKR  305

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             E+K    NWKWRSSKD FLNGAYFVPSGYGSC P Y+ +Q F     S VPA+T +AGPL
Sbjct  306   EMKGKLKNWKWRSSKDAFLNGAYFVPSGYGSCDPNYSPTQYFTAVPASLVPAITLNAGPL  365

Query  338   RC  333
              C
Sbjct  366   TC  367



>ref|NP_193939.1| root hair specific 14 [Arabidopsis thaliana]
 sp|O65456.1|PLY16_ARATH RecName: Full=Probable pectate lyase 16; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA18111.1| pectate lyase like protein [Arabidopsis thaliana]
 emb|CAB79163.1| pectate lyase like protein [Arabidopsis thaliana]
 gb|AEE84547.1| root hair specific 14 [Arabidopsis thaliana]
Length=394

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/363 (73%), Positives = 303/363 (83%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTL-NAAADKATS-MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ PT+ N   +K  + MN +DSCWR KS+WA+NR+ LADC VGFG   +GGK GN 
Sbjct  26    GYYGYTPTVANYLPEKPQNIMNPVDSCWRLKSDWAANRKDLADCVVGFGSSTLGGKKGNL  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+P DN  NP+PG+LRYG IQ+ PLWI FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNPYDNAQNPQPGSLRYGVIQAKPLWITFAKDMVITLENELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGK G VR +PTH G R+GSDGDAI+IF +SNIW
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRSSPTHVGHRKGSDGDAIAIFGSSNIW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLA   DGLIDVIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLASCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHNDDFVQDVKMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKEVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+SKD F NGAYFVPSGYGS +  Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSISLPYSSAQRFTVAPGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>ref|XP_010099179.1| hypothetical protein L484_014178 [Morus notabilis]
 gb|EXB77051.1| hypothetical protein L484_014178 [Morus notabilis]
Length=376

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/343 (75%), Positives = 297/343 (87%), Gaps = 1/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNVIDSCWR KS+WA+NR+ALA+C  G+GKDA+GGKYG  Y VT+PSD+P NPKPGTLRY
Sbjct  28    MNVIDSCWRGKSSWANNRQALANCAKGYGKDALGGKYGRIYTVTNPSDDPVNPKPGTLRY  87

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVI LKNEL+VNS+KTIDGRGA VEIA GPCIT+QGV+++IIHGI
Sbjct  88    GVIQTKPLWIVFAKDMVIKLKNELIVNSYKTIDGRGANVEIAYGPCITVQGVSHVIIHGI  147

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR + TH G R G DGDAISIF++S++WIDHC+L+R++DGLIDVIH S
Sbjct  148   SIHDCKPGKPGMVRSSLTHVGNRGGCDGDAISIFASSHVWIDHCFLSRSSDGLIDVIHAS  207

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNN+F+QHDKVML GH+D    DK MKVT+AFN FGPGLIERMPRVR GYAHVAN
Sbjct  208   TAVTISNNFFSQHDKVMLLGHSDKFTADKTMKVTIAFNRFGPGLIERMPRVRFGYAHVAN  267

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE-VKKGWSNWKWRSSKDKFL  462
             NRY  W MYA+GGSANPTIFSEGNYF+AP  S +K+VTKRE V KGW NWKWRSSKD F 
Sbjct  268   NRYDQWKMYAVGGSANPTIFSEGNYFVAPTNSGAKEVTKREAVNKGWKNWKWRSSKDVFQ  327

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFV SG+G+C PYYT SQSFPVA GS VPALT++AGPL C
Sbjct  328   NGAYFVQSGWGTCYPYYTPSQSFPVAQGSMVPALTSNAGPLPC  370



>ref|XP_010448941.1| PREDICTED: probable pectate lyase 16 [Camelina sativa]
Length=394

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/363 (73%), Positives = 302/363 (83%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTL-NAAADKATS-MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ PT+ N   +K  + MN +DSCWR KS+WA+NR+ALADC VGFG   +GGK GN 
Sbjct  26    GYYGYNPTVANYLPEKPQNVMNPVDSCWRLKSDWAANRKALADCVVGFGSSTLGGKKGNL  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+ +DN  NP+PG+LRYG IQ  PLWI FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNTNDNAQNPQPGSLRYGVIQEKPLWITFAKDMVITLENELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGK G VR + TH G R+GSDGDAI+IFS+SNIW
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRSSTTHVGHRKGSDGDAIAIFSSSNIW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLAR  DGLIDVIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLARCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHNDDFVQDVNMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SKQVTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKQVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+S D F NGAYFVPSGYGS    Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSNDVFKNGAYFVPSGYGSIGLPYSSAQRFTVASGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>gb|AFK47751.1| unknown [Lotus japonicus]
Length=392

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/346 (74%), Positives = 288/346 (83%), Gaps = 0/346 (0%)
 Frame = -3

Query  1370  KATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPG  1191
             K   +NVIDSCWRAKSNWASNR+ALADC +GFGK A+GGKYG  YVV D SDNP NPKPG
Sbjct  41    KKPFLNVIDSCWRAKSNWASNRKALADCAIGFGKSAIGGKYGAIYVVIDSSDNPANPKPG  100

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLRYGAIQ+ PLWI+FA+DMVITL NEL++NS+KTIDGRGA V I NGPCITIQGV ++I
Sbjct  101   TLRYGAIQTQPLWIIFARDMVITLGNELIMNSYKTIDGRGAKVVIGNGPCITIQGVGHVI  160

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             +HGIS+HDCKPGKSG VR +  H G RRGSDGD ISIF++SN+WIDHC+LAR  DGLID+
Sbjct  161   VHGISIHDCKPGKSGLVRSSVDHVGHRRGSDGDGISIFASSNVWIDHCFLARCTDGLIDI  220

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             +H STAITISNNYFTQHDKVML GHND    DK M+VT+AFN F  GLIERMPRVR GYA
Sbjct  221   VHASTAITISNNYFTQHDKVMLLGHNDKYTADKIMRVTIAFNRFASGLIERMPRVRFGYA  280

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKD  471
             HV NN+Y  W MYAIGGSANPTI SEGNYF+APN   +KQVTKRE+ +   NWKWRSSKD
Sbjct  281   HVVNNKYEEWKMYAIGGSANPTILSEGNYFIAPNNPNAKQVTKRELNENGKNWKWRSSKD  340

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              F+NGAYFVPSGYGSCAP YT +QSF VA  S VPA+T +AGP  C
Sbjct  341   VFVNGAYFVPSGYGSCAPNYTPAQSFAVAPASTVPAITLNAGPTTC  386



>ref|XP_010439369.1| PREDICTED: probable pectate lyase 16 [Camelina sativa]
Length=394

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/363 (73%), Positives = 302/363 (83%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTL-NAAADKATS-MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ PT+ N   +K  + MN +DSCWR KS+WA+NR+ALADC VGFG   +GGK GN 
Sbjct  26    GYYGYNPTVANYLPEKPQNVMNPVDSCWRLKSDWAANRKALADCVVGFGSSTLGGKKGNL  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+ +DN  NP+PG+LRYG IQ  PLWI FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNTNDNAQNPQPGSLRYGVIQEKPLWITFAKDMVITLENELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGK G VR + TH G R+GSDGDAI+IFS+SNIW
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRSSTTHVGHRKGSDGDAIAIFSSSNIW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLAR  DGLIDVIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLARCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHNDDFVQDVNMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SKQVTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKQVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+S D F NGAYFVPSGYGS    Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSNDVFKNGAYFVPSGYGSIGLPYSSAQRFTVAPGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>ref|XP_007147702.1| hypothetical protein PHAVU_006G147500g [Phaseolus vulgaris]
 gb|ESW19696.1| hypothetical protein PHAVU_006G147500g [Phaseolus vulgaris]
Length=398

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 287/342 (84%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWRAK+NWASNR++LADC +GFGKDA+GGK+G+ Y VTDPSD+P +PKPGTLRY
Sbjct  51    MNTIDSCWRAKTNWASNRQSLADCAIGFGKDAIGGKFGDVYEVTDPSDDPVDPKPGTLRY  110

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ+ PLWI F KDMVITLKNELM+NS+KTIDGRGA VEIANG CITIQGV+++IIHGI
Sbjct  111   GAIQTEPLWITFGKDMVITLKNELMLNSYKTIDGRGAKVEIANGACITIQGVSHVIIHGI  170

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKPG  G VR TP H G R GSDGDAISIF++SN+WIDHC+LAR+ DGLIDVIH S
Sbjct  171   GIHDCKPGVGGMVRSTPEHVGYREGSDGDAISIFASSNVWIDHCFLARSTDGLIDVIHAS  230

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT HDKVML GH+D    DK MKVTVAFN F   LIERMPRVR GYAHV N
Sbjct  231   TAVTISNNYFTHHDKVMLLGHSDEYSADKVMKVTVAFNRFASDLIERMPRVRFGYAHVVN  290

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W+MYAIGGSANPTIFSEGNYF A + S +KQVTKRE  +GW+NWKWRS  D+FLN
Sbjct  291   NRYDEWVMYAIGGSANPTIFSEGNYFTASDDSAAKQVTKRESSEGWNNWKWRSFGDEFLN  350

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYFVPSGYGSC P Y+ +Q+F  A  S VP LT +AGPL C
Sbjct  351   GAYFVPSGYGSCTPLYSDAQTFIAAKASMVPFLTLNAGPLNC  392



>gb|KDP20714.1| hypothetical protein JCGZ_21185 [Jatropha curcas]
Length=390

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/342 (74%), Positives = 288/342 (84%), Gaps = 1/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
              N IDSCWR   NW+SNR+ALADC VGFG+ A+GGKYG+ YVVT P D+P NPKPGTLRY
Sbjct  44    FNTIDSCWRTDPNWSSNRQALADCAVGFGQAAMGGKYGDIYVVTTPEDDPINPKPGTLRY  103

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQS PLWI F +DMVITL+NEL+VNS KTIDGRGA VEIANGPC+TI+GV ++I+HGI
Sbjct  104   GAIQSEPLWITFNEDMVITLENELIVNSFKTIDGRGAKVEIANGPCLTIEGVNHVIVHGI  163

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +PTH G R GSDGDAI++F++SNIWIDHCYLA   DGLIDVIH S
Sbjct  164   SIHDCKPGKRGLVRSSPTHVGERLGSDGDAIAVFASSNIWIDHCYLASCTDGLIDVIHAS  223

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYF+QHDKVML GHND    DK MK TV FNHFG GL++RMPRVR GYAHVAN
Sbjct  224   TAVTISNNYFSQHDKVMLLGHNDEYTADKVMKTTVIFNHFGTGLVQRMPRVRFGYAHVAN  283

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSA+PTIFSEGNYF+A + S +K+VTKRE   GW NWKWR+SKD F+N
Sbjct  284   NRYDEWQMYAIGGSADPTIFSEGNYFIASD-SNAKEVTKREASGGWKNWKWRTSKDVFMN  342

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYF+PSGYGSCAP Y+  QSFPVA GS VP+LT+DAGPL C
Sbjct  343   GAYFIPSGYGSCAPVYSLGQSFPVAHGSLVPSLTSDAGPLSC  384



>ref|XP_010434085.1| PREDICTED: probable pectate lyase 16 [Camelina sativa]
Length=394

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/363 (73%), Positives = 301/363 (83%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTL-NAAADKATS-MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ PT+ N   +K  + MN +DSCWR KS+WA+NR+ALADC VGFG    GGK GN 
Sbjct  26    GYYGYNPTVANYLPEKPQNVMNPVDSCWRLKSDWAANRKALADCVVGFGSSTFGGKKGNL  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+ +DN  NP+PG+LRYG IQ  PLWI FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNTNDNAQNPQPGSLRYGVIQDKPLWITFAKDMVITLENELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGK G VR + TH G R+GSDGDAI+IFS+SNIW
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRSSTTHVGHRKGSDGDAIAIFSSSNIW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLAR  DGLIDVIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLARCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHNDDFVQDVNMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SKQVTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKQVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+S D F NGAYFVPSGYGS    Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSNDVFKNGAYFVPSGYGSIGLPYSSAQRFTVAPGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>ref|XP_006286235.1| hypothetical protein CARUB_v10007804mg [Capsella rubella]
 gb|EOA19133.1| hypothetical protein CARUB_v10007804mg [Capsella rubella]
Length=393

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/363 (73%), Positives = 301/363 (83%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTL-NAAADKATS-MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ PT+ N   +K  + MN +D+CWR KS+WA+NR+ LADC VGFG   VGGK GN 
Sbjct  26    GYYGYTPTVANYLPEKPQNVMNPVDACWRLKSDWAANRKDLADCVVGFGSSNVGGKKGNI  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+  DN  NP+PG+LRYG IQ  PLWI FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNSYDNAQNPQPGSLRYGVIQDKPLWITFAKDMVITLENELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGK G VR + TH G R+GSDGDAI+IFS+SNIW
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRSSTTHVGHRKGSDGDAIAIFSSSNIW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLAR  DGLIDVIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLARCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHNDDFVKDVNMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKEVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+SKD F NGAYFVPSGYGS    Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSIGLPYSSAQQFTVAPGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>gb|KHN40868.1| Putative pectate lyase 2 [Glycine soja]
Length=522

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/352 (72%), Positives = 291/352 (83%), Gaps = 0/352 (0%)
 Frame = -3

Query  1388  LNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNP  1209
             +N   +    MN IDSCWRAK+NWASNR+ALADC +GFGK+A+GGK+G+ Y VTDPSD+P
Sbjct  165   INKTPEDVVIMNTIDSCWRAKTNWASNRKALADCAIGFGKEAIGGKFGDIYEVTDPSDDP  224

Query  1208  GNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQ  1029
              +PKPGTLRYGAIQ+ PLWI FAKDM I LKNELMVNS+KTIDGRGA VEIANG CITIQ
Sbjct  225   VDPKPGTLRYGAIQTEPLWITFAKDMDIRLKNELMVNSYKTIDGRGAKVEIANGACITIQ  284

Query  1028  GVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAA  849
             GV+++I+HGIS+HDC+PGK G VR +P H G R GSDGDAISIF++SN+WIDHC+LAR  
Sbjct  285   GVSHVIVHGISIHDCEPGKGGMVRSSPEHVGYREGSDGDAISIFASSNVWIDHCFLARCT  344

Query  848   DGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPR  669
             DGLIDVIH STA+TISNNYFTQHDKVML GH+D    DK M+VTVAFN F  GLIERMPR
Sbjct  345   DGLIDVIHASTAVTISNNYFTQHDKVMLLGHSDEYTADKVMRVTVAFNRFASGLIERMPR  404

Query  668   VRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWK  489
             VR GYAHV NN Y  WLMYAIGGSA+PTIFSEGNYF A N S +KQVTKRE  + W+NWK
Sbjct  405   VRFGYAHVVNNLYDEWLMYAIGGSADPTIFSEGNYFTASNDSAAKQVTKRESSEKWNNWK  464

Query  488   WRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             WRS +D+F+NGAYFVPSGYGSC P Y+ +QSF  A  S VP LT +AGPL C
Sbjct  465   WRSFRDEFINGAYFVPSGYGSCTPIYSAAQSFIAAQASMVPLLTLNAGPLNC  516



>ref|XP_010529455.1| PREDICTED: probable pectate lyase 16 [Tarenaya hassleriana]
Length=400

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/369 (71%), Positives = 301/369 (82%), Gaps = 3/369 (1%)
 Frame = -3

Query  1412  GIMGFVPTLN--AAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ P+++    A   + MN IDSCWR K +WA+NR+ LADC VGFG  A+GGK G  
Sbjct  32    GYYGYTPSVSDYLPATPRSVMNPIDSCWRLKPDWATNRQDLADCAVGFGSSALGGKNGKI  91

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+PSD+  NPKPGTLRYGAIQ  PLWI+FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  92    YVVTNPSDDAQNPKPGTLRYGAIQDKPLWIIFAKDMVITLENELMVNSYKTIDGRGAKVE  151

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             I  GPC+TIQ V+++I+HGIS+HDCKPGKSG VR + TH G R+GSDGDAIS+F++S+IW
Sbjct  152   ITYGPCLTIQDVSHVIVHGISIHDCKPGKSGLVRSSTTHIGHRQGSDGDAISVFASSDIW  211

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLA  ADGLIDVIH ST +TISNNYFTQHDKVML GH D+  +D  MKVTVAFNHF
Sbjct  212   IDHCYLASCADGLIDVIHASTRVTISNNYFTQHDKVMLLGHRDSFTQDVNMKVTVAFNHF  271

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGLIERMPRVR GYAHVANNRY  WLMYAIGGSANPTIFSEGNYF+AP+   SK+VTKR
Sbjct  272   GPGLIERMPRVRRGYAHVANNRYDQWLMYAIGGSANPTIFSEGNYFIAPDNHNSKEVTKR  331

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW NWKWR+SKD F NGA+F+PSGYG+  P YT  Q FPVA G+ VP+LT+D+GPL
Sbjct  332   EVKGGWQNWKWRTSKDVFKNGAFFIPSGYGTIVPLYTGPQRFPVAPGNMVPSLTSDSGPL  391

Query  338   RCSYSSSKC  312
              C Y    C
Sbjct  392   SC-YRGRPC  399



>ref|XP_008371166.1| PREDICTED: putative pectate lyase 2 [Malus domestica]
Length=388

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 311/382 (81%), Gaps = 10/382 (3%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFV-PTLNA-AADKATS--------MNVIDSCWRAKSNWASNRRA  1299
             MA+   +++ LL  + ++ PT  A + D  T+        MNV+DSCWR KSNWA+NRRA
Sbjct  1     MASLAPLVLFLLCFLTYIAPTFQAYSPDYYTTPNITLKNIMNVVDSCWRTKSNWATNRRA  60

Query  1298  LADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITL  1119
             LADC VG+GKDA+GGKYG TYVVT  +D+  NPKPG+LRYG IQ+ PLWI+FAKDMVITL
Sbjct  61    LADCAVGYGKDALGGKYGRTYVVTTSNDDSVNPKPGSLRYGVIQTQPLWIVFAKDMVITL  120

Query  1118  KNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHA  939
             KNEL++NS KTIDGRGA VEIA GPCIT+QGV+++IIHGIS+HDCKPGK G VR TPTH 
Sbjct  121   KNELIMNSFKTIDGRGAKVEIAYGPCITVQGVSHVIIHGISIHDCKPGKGGNVRSTPTHI  180

Query  938   GRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFG  759
             G+RRG DGDAI++F++S++WIDHC+LAR+ADGL+DV H STA+TI+NNYF+QHDKVML G
Sbjct  181   GKRRGCDGDAIAVFASSHVWIDHCFLARSADGLLDVTHASTAVTITNNYFSQHDKVMLLG  240

Query  758   HNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIF  579
             HNDN   DK M+VT+AFN FG GL+ERMPRVR GYAH+ANNRY  W MYA+GGSANPTIF
Sbjct  241   HNDNFSADKNMRVTIAFNRFGAGLVERMPRVRFGYAHLANNRYDEWKMYAVGGSANPTIF  300

Query  578   SEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQ  399
             SEGNYF+AP  S +KQVTK E    W+NWKWRSS D F NGA+FV SGYG+C P Y++ Q
Sbjct  301   SEGNYFIAPETSYAKQVTKXEAGGSWNNWKWRSSGDVFKNGAFFVQSGYGNCYPLYSRKQ  360

Query  398   SFPVADGSRVPALTADAGPLRC  333
             SF V  G+ VPALT++AGPLRC
Sbjct  361   SFKVFPGAMVPALTSNAGPLRC  382



>ref|XP_002867795.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44054.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/363 (72%), Positives = 302/363 (83%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTL-NAAADKATS-MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ PT+ N   +K  + MN +DSCWR KS+WA NR+ LA+C VGFG   +GGK G  
Sbjct  26    GYYGYTPTVANYLPEKPQNIMNPVDSCWRLKSDWAVNRKDLANCVVGFGSSTLGGKKGKL  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+P+DN  NP+PG+LRYG IQ+ PLWI FAKDMVITL+NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNPNDNAQNPQPGSLRYGVIQAKPLWITFAKDMVITLENELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGK G VR +PTH G R+GSDGDAI+IF +SN+W
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRSSPTHVGHRQGSDGDAIAIFGSSNVW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLA   DGLIDVIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLASCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHNDDFVQDVNMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKEVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+SKD F NGAYFVPSGYGS +  Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSISLPYSSAQRFTVAPGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>ref|XP_004293313.1| PREDICTED: putative pectate lyase 2-like [Fragaria vesca subsp. 
vesca]
Length=385

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/361 (71%), Positives = 296/361 (82%), Gaps = 7/361 (2%)
 Frame = -3

Query  1394  PTLNAAAD-------KATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTY  1236
             PTL AA         K T+ NV+DSCWR+  NWA NR+ALA+C VGFGKDA+GGKYG  Y
Sbjct  19    PTLEAAYSPSYSKNPKPTTKNVVDSCWRSNPNWARNRQALANCAVGFGKDAIGGKYGRIY  78

Query  1235  VVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEI  1056
             VVT  SD+P NPKPGTLRYG IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEI
Sbjct  79    VVTTSSDDPINPKPGTLRYGVIQTQPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEI  138

Query  1055  ANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWI  876
             A GPCIT+QGV+++IIHGIS+HDCKPGKSG VR T  H G R GSDGD+ISIF++S++W+
Sbjct  139   AYGPCITVQGVSHVIIHGISIHDCKPGKSGMVRSTLNHVGHRLGSDGDSISIFASSHVWV  198

Query  875   DHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFG  696
             DHC+L+R ADGL+D+ H STA+T++NNYF+QHDKVML GHND    DK MKVT+AFN FG
Sbjct  199   DHCFLSRGADGLVDITHASTAVTVTNNYFSQHDKVMLLGHNDKFTADKIMKVTIAFNRFG  258

Query  695   PGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE  516
              GLIERMPRVR GYAHVANNRY  W MYAIGGSANPTIFSEGNYF+AP   ++KQVTKRE
Sbjct  259   AGLIERMPRVRFGYAHVANNRYDEWKMYAIGGSANPTIFSEGNYFIAPTNPDAKQVTKRE  318

Query  515   VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLR  336
                GW NWKWRSSKD   NGAYF+ SG+GSC P YT++Q F V+ GS VPALT++AGPLR
Sbjct  319   AYGGWKNWKWRSSKDVLQNGAYFIQSGWGSCYPMYTRTQKFKVSPGSMVPALTSNAGPLR  378

Query  335   C  333
             C
Sbjct  379   C  379



>ref|XP_004233785.1| PREDICTED: probable pectate lyase 16 [Solanum lycopersicum]
Length=402

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/357 (70%), Positives = 298/357 (83%), Gaps = 1/357 (0%)
 Frame = -3

Query  1400  FVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP  1221
             F P+ +    K   +NVIDSCWR K +W+SNR+ALADC +GFG   +GGKYG+ Y+V D 
Sbjct  40    FFPSYDPQPHKNGLLNVIDSCWRWKGDWSSNRKALADCAIGFGSSTIGGKYGDIYIVNDS  99

Query  1220  SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPC  1041
             SD+P NPKPGTLRYGAIQS PLWI+F +DMV+TL+NELMVNS+KTIDGRGA VEI+NGPC
Sbjct  100   SDDPINPKPGTLRYGAIQSEPLWIIFKRDMVLTLENELMVNSYKTIDGRGAKVEISNGPC  159

Query  1040  ITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYL  861
             IT+  VTN+IIHGIS+HDCKPGK G VR +P H G R GSDGDAIS+F++SN+WIDHCYL
Sbjct  160   ITLDYVTNVIIHGISIHDCKPGKKGMVRSSPEHVGERSGSDGDAISVFTSSNVWIDHCYL  219

Query  860   ARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIE  681
             ARA DGL+DVIH STA+TISNNYFT+HDKVML GHND    D+ MKVTV +NHFG  L++
Sbjct  220   ARATDGLLDVIHASTAVTISNNYFTEHDKVMLLGHNDEYTADRNMKVTVVYNHFGRELVQ  279

Query  680   RMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV-KKG  504
             RMPRVR GYAHVANN Y  WLMYAIGGSA+PTIFSEGNYF+AP+K+ +K+VTKRE  +KG
Sbjct  280   RMPRVRHGYAHVANNYYDQWLMYAIGGSADPTIFSEGNYFIAPDKAYNKEVTKRETEEKG  339

Query  503   WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             W +WKWRSS D F+NGAYF+PSGYGS AP YT+ QSF VA G+  P+LT++AGPL+C
Sbjct  340   WKSWKWRSSNDMFMNGAYFLPSGYGSIAPKYTRGQSFIVAHGAFTPSLTSNAGPLQC  396



>ref|XP_003610466.1| hypothetical protein MTR_4g132460 [Medicago truncatula]
 ref|XP_003619284.1| hypothetical protein MTR_6g045700 [Medicago truncatula]
 gb|AES92663.1| pectate lyase family protein [Medicago truncatula]
Length=385

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/342 (73%), Positives = 286/342 (84%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWRAK NWA NR+ALADC +GFGKD++GGKYG  Y+VTD SD+P NPKPGTLRY
Sbjct  38    LNKIDSCWRAKPNWALNRKALADCAIGFGKDSIGGKYGAIYIVTDSSDDPANPKPGTLRY  97

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ+ PLWI+F ++MV+TLKNEL++NS+KTIDGRG  VEI NGPCITIQGV+++IIHGI
Sbjct  98    GAIQTKPLWIIFERNMVLTLKNELIMNSYKTIDGRGVKVEIGNGPCITIQGVSHVIIHGI  157

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKP K+G VR TP H GRRRG+DGDAISIF++SNIWIDHC+LAR+ DGLID+IH S
Sbjct  158   SIHDCKPSKAGLVRSTPDHVGRRRGADGDAISIFASSNIWIDHCFLARSTDGLIDIIHAS  217

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFTQHDKVML GHND    DK MKVT+ FN FG GLIERMPRVR GYAHV N
Sbjct  218   TAITISNNYFTQHDKVMLLGHNDEYTADKIMKVTIVFNRFGSGLIERMPRVRFGYAHVVN  277

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             N+Y  W MYAIGGSANPTI SEGN++ APN    KQ+TKRE K  W +WKWRSSKD F N
Sbjct  278   NKYDQWQMYAIGGSANPTILSEGNFYNAPNDHTKKQITKRESKGNWKSWKWRSSKDYFSN  337

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYF+PSGYGSCAP YT +QSF    G  VPA+T +AGPL C
Sbjct  338   GAYFIPSGYGSCAPNYTPAQSFVAVPGYMVPAITLNAGPLSC  379



>ref|XP_009801395.1| PREDICTED: probable pectate lyase 16 [Nicotiana sylvestris]
Length=399

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/347 (73%), Positives = 291/347 (84%), Gaps = 2/347 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +NVIDSCWR   +WASNR+AL+DC +GFG +A+GGKYG+ YVVTDPSD+P NP+PGTLRY
Sbjct  52    LNVIDSCWRLNDDWASNRKALSDCAIGFGSNAIGGKYGDIYVVTDPSDDPVNPEPGTLRY  111

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQS PLWI+F KDMV+TLKNELMVNSHKTIDGRGA +EI+NGPCIT+  VTN+IIHGI
Sbjct  112   GVIQSEPLWIIFKKDMVLTLKNELMVNSHKTIDGRGAKIEISNGPCITLDYVTNVIIHGI  171

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKP K G VR +P H G R GSDGDAIS+F +SN+WIDHCYLARA DGL+DV H S
Sbjct  172   SIHDCKPSKKGMVRSSPEHVGERLGSDGDAISVFGSSNVWIDHCYLARATDGLLDVTHAS  231

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT+HDKVML GHND    D++MKVTV FNHFG  L++RMPRVR GYAHVAN
Sbjct  232   TAVTISNNYFTEHDKVMLLGHNDEYTADRSMKVTVVFNHFGRELVQRMPRVRFGYAHVAN  291

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKK-GWSNWKWRSSKDKFL  462
             N Y  WLMYAIGGSA+PTIFSEGNYF+AP+ S  K+VTKRE  + GW +WKWRSSKD F+
Sbjct  292   NYYDQWLMYAIGGSADPTIFSEGNYFIAPD-SYDKEVTKRETHEGGWKSWKWRSSKDVFV  350

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
             NGAYF PSGYGS AP YT+ QSF VA GS  P+LT+DAGPL+C  S 
Sbjct  351   NGAYFNPSGYGSIAPKYTRGQSFIVAQGSLTPSLTSDAGPLQCVVSE  397



>ref|XP_011015442.1| PREDICTED: probable pectate lyase 16 [Populus euphratica]
Length=392

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/342 (73%), Positives = 288/342 (84%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR +S+WA+NRRALADC VGFG  A+GGKYG TYVVT P D+P NPKPGTLRY
Sbjct  45    LNTIDSCWRTESDWATNRRALADCAVGFGHAAIGGKYGKTYVVTTPDDDPINPKPGTLRY  104

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAI++ PLWI+FA+DMVITL+NELM+NS+KTIDGRGA VEI  GPC+ I+ V+++IIHGI
Sbjct  105   GAIRTEPLWIIFARDMVITLENELMINSYKTIDGRGANVEITGGPCLKIEHVSHVIIHGI  164

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +PTH G RRG+DGDAI+I ++SNIWIDHCYLAR  DGLIDVIH S
Sbjct  165   SIHDCKPGKKGLVRSSPTHVGERRGADGDAIAISASSNIWIDHCYLARCMDGLIDVIHAS  224

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT+HDKVML GHND   ED+ MKVTV FNHFGP L +RMPRVR GYAHVAN
Sbjct  225   TAVTISNNYFTEHDKVMLLGHNDKYTEDQVMKVTVVFNHFGPKLNQRMPRVRFGYAHVAN  284

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSA  TIFSEGNYF+AP+ S +K+VTKREV  GW NWKWRSSKD F+N
Sbjct  285   NRYDKWQMYAIGGSAGSTIFSEGNYFIAPDISYAKEVTKREVYGGWKNWKWRSSKDVFMN  344

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              AYFV SGYG CAP Y+K+QSF  + G+  PALT+DAGPL C
Sbjct  345   DAYFVQSGYGRCAPRYSKAQSFTASPGAMAPALTSDAGPLNC  386



>ref|NP_193940.1| putative pectate lyase 17 [Arabidopsis thaliana]
 sp|O65457.1|PLY17_ARATH RecName: Full=Putative pectate lyase 17; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA18112.1| pectate lyase like protein [Arabidopsis thaliana]
 emb|CAB79164.1| pectate lyase like protein [Arabidopsis thaliana]
 gb|AEE84548.1| putative pectate lyase 17 [Arabidopsis thaliana]
Length=394

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/363 (72%), Positives = 294/363 (81%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTLNA--AADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ P      A +    MN +DSCWR KS+W  NR  LADC VGFG   +GGK GN 
Sbjct  26    GYYGYSPAAAPYPAEEPQNIMNPVDSCWRLKSDWDVNREDLADCAVGFGSSTLGGKKGNI  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+P DN  NP PG+LRYG IQ+ PLWI FAKDMVITL NELMVNS+KTIDGRGA VE
Sbjct  86    YVVTNPYDNAQNPHPGSLRYGVIQAKPLWITFAKDMVITLANELMVNSYKTIDGRGAKVE  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPGKSG VR +PTH G R+GSDGDAI+IF +SN+W
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGKSGKVRSSPTHVGHRKGSDGDAITIFGSSNVW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLA   DGLIDVIH STAITISNNYFTQHDKVML GHNDN V+D  MKVTVAFNHF
Sbjct  206   IDHCYLASCTDGLIDVIHASTAITISNNYFTQHDKVMLLGHNDNFVKDVKMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSYSKEVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+S D F NGA+FVPSGYGS    Y+ +Q F VA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSNDVFKNGAFFVPSGYGSIPLPYSSAQRFTVAPGNLVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>ref|XP_006383883.1| pectate lyase 4 precursor family protein [Populus trichocarpa]
 gb|ERP61680.1| pectate lyase 4 precursor family protein [Populus trichocarpa]
Length=392

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/342 (73%), Positives = 289/342 (85%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR +S+WA+NRRALADC VGFG+ A+GGK G TYVVT P D+P NPKPGTLRY
Sbjct  45    LNTIDSCWRTESDWATNRRALADCAVGFGQAAIGGKCGKTYVVTTPDDDPTNPKPGTLRY  104

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAI++ PLWI+FA+DMVITL+NELM+NS+KTIDGRGA VEI  GPC+ I+ V+++IIHGI
Sbjct  105   GAIRTEPLWIIFARDMVITLENELMINSYKTIDGRGANVEITGGPCLKIEYVSHVIIHGI  164

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +PTH G RRG+DGDAI+I ++SNIWIDHCYLAR  DGLIDVIH +
Sbjct  165   SIHDCKPGKRGLVRSSPTHVGERRGADGDAIAISASSNIWIDHCYLARCMDGLIDVIHAT  224

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT+HDKVML GHND   ED+ MKVTV FNHFGP L +RMPRVR GYAHVAN
Sbjct  225   TAVTISNNYFTEHDKVMLLGHNDKYTEDQVMKVTVVFNHFGPKLNQRMPRVRFGYAHVAN  284

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSA  TIFSEGNYF+AP+ S +K+VTKREV  GW NWKWRSSKD F+N
Sbjct  285   NRYDKWQMYAIGGSAGSTIFSEGNYFIAPDISYAKEVTKREVYGGWKNWKWRSSKDVFMN  344

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              AYFV SGYG CAP Y+K+QSF V+ G+  PALT+DAGPL C
Sbjct  345   DAYFVQSGYGRCAPRYSKAQSFTVSPGAMAPALTSDAGPLSC  386



>ref|XP_006303602.1| hypothetical protein CARUB_v10011187mg [Capsella rubella]
 gb|EOA36500.1| hypothetical protein CARUB_v10011187mg [Capsella rubella]
Length=385

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/389 (67%), Positives = 309/389 (79%), Gaps = 7/389 (2%)
 Frame = -3

Query  1475  SQFISSNLAMAAAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRAL  1296
             S F++ +L +AA    ++      G+  T+        S+N IDSCWR    WA NRRAL
Sbjct  3     SLFLTVSLLLAAFSSSLVEAAYSNGYTYTI-----PKLSLNPIDSCWRRNPGWAYNRRAL  57

Query  1295  ADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLK  1116
             ADC VGFGK AVGGKYG+ YVVT+P+D+P NP+PGTLR+  IQ+ PLWI FA+DMVI L+
Sbjct  58    ADCAVGFGKAAVGGKYGSVYVVTNPTDDPENPRPGTLRHAVIQAKPLWITFARDMVIVLQ  117

Query  1115  NELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAG  936
             NEL++NS+KTIDGRGA VEIA GPCITIQ V+++IIHGIS+HDCKPGKSG VR +PTH G
Sbjct  118   NELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGISIHDCKPGKSGRVRSSPTHIG  177

Query  935   RRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGH  756
              R+GSDGDAI+IF +S+IWIDHC+ +R  DGLIDV+H STA+TISNNYFTQHDKVML GH
Sbjct  178   NRKGSDGDAIAIFDSSHIWIDHCHFSRCQDGLIDVLHASTAVTISNNYFTQHDKVMLLGH  237

Query  755   NDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFS  576
             NDNNVEDK M+VT+AFNHFGPGLIERMPRVR GYAHVANNRY  W MYAIGGSA+PTIFS
Sbjct  238   NDNNVEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSADPTIFS  297

Query  575   EGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQ  399
             EGNYF+AP+ S  KQVTKR +    W  WKWR+SKD F NGAYFVPSGYG+  P Y +++
Sbjct  298   EGNYFVAPDDSSKKQVTKRIDSGYDWRRWKWRTSKDVFKNGAYFVPSGYGTVTPLYKRAE  357

Query  398   SFPVADGSRVPALTADAGPLRCSYSSSKC  312
              FPV+ GS VP+LT+ AGPLRC YS   C
Sbjct  358   WFPVSHGSLVPSLTSSAGPLRC-YSGRIC  385



>ref|XP_011046965.1| PREDICTED: probable pectate lyase 16 [Populus euphratica]
Length=392

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/342 (73%), Positives = 288/342 (84%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR +S+WA+NRRALADC VGFG+ A+GGKYG TYVVT P D+P NPKPGTLRY
Sbjct  45    LNTIDSCWRTESDWATNRRALADCAVGFGQAAIGGKYGKTYVVTTPDDDPINPKPGTLRY  104

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAI++ PLWI+FA+DMVITL+NELM+NS+KTIDGRGA VEI  GPC+ I+ V+++IIHGI
Sbjct  105   GAIRTEPLWIIFARDMVITLENELMINSYKTIDGRGANVEITGGPCLKIEHVSHVIIHGI  164

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +P H G RRG+DGDAI+I ++SNIWIDHCYLAR  DGLIDVIH S
Sbjct  165   SIHDCKPGKKGLVRSSPRHVGERRGADGDAIAISASSNIWIDHCYLARCMDGLIDVIHAS  224

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT+HDKVML GHND   ED+ MKVTV FNHFGP L +RMPRVR GYAHVAN
Sbjct  225   TAVTISNNYFTEHDKVMLLGHNDKYTEDQVMKVTVVFNHFGPKLNQRMPRVRFGYAHVAN  284

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W MYAIGGSA  TIFSEGNYF+AP+ S +K+VTKREV  GW NWKWRSSKD F+N
Sbjct  285   NRYDKWQMYAIGGSAGSTIFSEGNYFIAPDISYAKEVTKREVYGGWKNWKWRSSKDVFMN  344

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              AYFV SGYG CAP Y+K+QSF  + G+  PALT+DAGPL C
Sbjct  345   DAYFVQSGYGRCAPRYSKAQSFTASPGAMAPALTSDAGPLNC  386



>ref|XP_011087037.1| PREDICTED: probable pectate lyase 16 [Sesamum indicum]
Length=370

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/342 (73%), Positives = 285/342 (83%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR+  NW SNR+ALADC VGFG +A+GGK G  YVVTDPSD+P NPK GTLRY
Sbjct  23    MNKIDSCWRSDPNWESNRKALADCAVGFGSNAMGGKNGAIYVVTDPSDDPVNPKQGTLRY  82

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ+ PLWI+F +DMVITLKNELMVNS+KTIDGRGA VEI+NGPCITI GV+++IIHGI
Sbjct  83    GAIQTQPLWIIFERDMVITLKNELMVNSYKTIDGRGARVEISNGPCITIDGVSHVIIHGI  142

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK+G VR TP H G R GSDGDAIS+F++SN+WIDHCYLAR  DGL+D+IH S
Sbjct  143   SIHDCKPGKAGMVRSTPEHVGERLGSDGDAISVFTSSNVWIDHCYLARCTDGLVDIIHAS  202

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
               +T+SNNYFTQHDKVML GH D    D+ MKVTVAFNHFGPGL++RMPRVR GYAHVAN
Sbjct  203   NLVTVSNNYFTQHDKVMLLGHRDGYTADRIMKVTVAFNHFGPGLVQRMPRVRYGYAHVAN  262

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  W+MYAIGGSA+PTI SEGNYF A N   +KQVTKRE   GW +WKWRS+KD F+N
Sbjct  263   NRYDQWIMYAIGGSADPTILSEGNYFFASNDPYAKQVTKRETHDGWKSWKWRSTKDVFVN  322

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYFVPSG+GSCAP Y   Q F  A GS VPALT+DAGPL C
Sbjct  323   GAYFVPSGWGSCAPNYATPQYFGAAPGSLVPALTSDAGPLLC  364



>ref|XP_006389575.1| hypothetical protein POPTR_0021s00250g [Populus trichocarpa]
 gb|ERP48489.1| hypothetical protein POPTR_0021s00250g [Populus trichocarpa]
Length=393

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/343 (75%), Positives = 293/343 (85%), Gaps = 1/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR +SNWA++RRALADC VGFG+ A+GGKYG TYVVT P D+P +PKPGTLRY
Sbjct  45    LNTIDSCWRTESNWATDRRALADCAVGFGQAAIGGKYGKTYVVTTPDDDPTDPKPGTLRY  104

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ+ PLWI F KDMVI L+NELM+NS KTIDGRG+ VEI +GPC+ I+GV+++IIHGI
Sbjct  105   GAIQTEPLWITFDKDMVIKLENELMINSFKTIDGRGSNVEITDGPCLKIEGVSHVIIHGI  164

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +PTH G+RRG+DGDAISIF++SNIWIDHCYLAR  DGLIDVIH S
Sbjct  165   SIHDCKPGKRGLVRSSPTHVGQRRGADGDAISIFASSNIWIDHCYLARCIDGLIDVIHAS  224

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYF QHDKVML GHND    DK MKVTVAFNHFGPGLIERMPRVR GYAHVAN
Sbjct  225   TAVTISNNYFAQHDKVMLLGHNDEYTADKVMKVTVAFNHFGPGLIERMPRVRFGYAHVAN  284

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWR-SSKDKFL  462
             NRY  W MYAIGGSA  TIFSEGNYF+AP+ S +K+VTKRE   GW NWKWR SSKD F+
Sbjct  285   NRYDEWQMYAIGGSAGSTIFSEGNYFIAPDISYAKEVTKREADGGWKNWKWRSSSKDVFM  344

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFVPSGYGSCAP Y+++QSF V  G+ VP+LT+DAGPL C
Sbjct  345   NGAYFVPSGYGSCAPLYSEAQSFVVFPGTMVPSLTSDAGPLSC  387



>ref|XP_009135558.1| PREDICTED: probable pectate lyase 16 [Brassica rapa]
Length=393

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 306/387 (79%), Gaps = 7/387 (2%)
 Frame = -3

Query  1454  LAMAAAVIIIMPLLGIM-----GFVPTLNAAADKATS-MNVIDSCWRAKSNWASNRRALA  1293
             L ++  + +   L+G +     G+ P  +   +K  + MN +DSCWR KS+W +NR+ LA
Sbjct  7     LCLSVTLFLCQSLVGAINNGYYGYNPVASYLPEKPQNIMNPVDSCWRLKSDWTANRKDLA  66

Query  1292  DCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKN  1113
             DC VGFG  A+GGK GN YVVT+P+DN  NP+PG+LRYG IQ  PLWI FAKDMV+TL+N
Sbjct  67    DCAVGFGSSALGGKKGNIYVVTNPNDNAANPQPGSLRYGVIQDKPLWITFAKDMVLTLEN  126

Query  1112  ELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGR  933
             ELMVNS+KTIDGRG  VEIA GPCITIQ VTN+I+HGIS+H CKPGK G VR + TH G 
Sbjct  127   ELMVNSYKTIDGRGTKVEIAYGPCITIQEVTNVIVHGISIHHCKPGKYGMVRSSTTHVGH  186

Query  932   RRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHN  753
             R+GSDGDAI+I  +SNIWIDHCYLA   DGLIDVIH ST ITISNNYFTQHDKVML GHN
Sbjct  187   RKGSDGDAIAISGSSNIWIDHCYLASCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHN  246

Query  752   DNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSE  573
             D+ V+D  MKVTVAFNHFGPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSE
Sbjct  247   DDFVQDVKMKVTVAFNHFGPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSE  306

Query  572   GNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSF  393
             GNYF+A + S SK+VTKREVK GW+NW+WR+SKD F NGAYFVPSGYGS A  Y+ +Q F
Sbjct  307   GNYFIASDNSNSKEVTKREVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSVALPYSSAQRF  366

Query  392   PVADGSRVPALTADAGPLRCSYSSSKC  312
             PVA G+ VP+LTA AGPL C Y +  C
Sbjct  367   PVAPGNLVPSLTAGAGPLNC-YRNRPC  392



>ref|NP_172656.1| putative pectate lyase [Arabidopsis thaliana]
 sp|O65388.2|PLY2_ARATH RecName: Full=Putative pectate lyase 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE28815.1| putative pectate lyase [Arabidopsis thaliana]
Length=384

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/385 (68%), Positives = 302/385 (78%), Gaps = 7/385 (2%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADKATSM-----NVIDSCWRAKSNWASNRRALADCG  1284
             MA+  + I+ LL        + AA     ++     N IDSCWR    WASNRRALADC 
Sbjct  1     MASLFLTIISLLFAAFSSSVVEAAYSNGYTIPKLLPNPIDSCWRRNPYWASNRRALADCA  60

Query  1283  VGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELM  1104
             VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLRY  IQS PLWI FA+DMVI L+NEL+
Sbjct  61    VGFGKSAVGGKYGSIYVVTNPSDDPENPRPGTLRYAVIQSKPLWITFARDMVIVLRNELI  120

Query  1103  VNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRG  924
             +NS+KTIDGRGA VEIA GPCITIQ V+++IIHGIS+HDCKPGKSG VR +PTH G R+G
Sbjct  121   MNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGISIHDCKPGKSGRVRSSPTHVGSRKG  180

Query  923   SDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNN  744
             SDGDAI+IF +S+IWIDHC+ +R  DGLIDV+H STA+TISNNYFTQHDKVML GHNDNN
Sbjct  181   SDGDAIAIFDSSHIWIDHCFFSRCQDGLIDVLHASTAVTISNNYFTQHDKVMLLGHNDNN  240

Query  743   VEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNY  564
             VEDK M+VT+AFNHFGPGLIERMPRVR GYAHVANNRY  W MYAIGGSA+PTIFSEGNY
Sbjct  241   VEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSADPTIFSEGNY  300

Query  563   FMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPV  387
             F+A +    KQVTKR +    W  WKWR+SKD F NGAYFVPSGYG+  P Y +++ FPV
Sbjct  301   FVASDDPSKKQVTKRIDSGYDWKRWKWRTSKDVFKNGAYFVPSGYGTVTPLYGRAERFPV  360

Query  386   ADGSRVPALTADAGPLRCSYSSSKC  312
             + GS VP LT+ AGPL C YS   C
Sbjct  361   SHGSLVPLLTSSAGPLHC-YSGRIC  384



>ref|XP_002317132.1| hypothetical protein POPTR_0011s00240g [Populus trichocarpa]
 gb|EEE97744.1| hypothetical protein POPTR_0011s00240g [Populus trichocarpa]
Length=393

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/343 (75%), Positives = 294/343 (86%), Gaps = 1/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR +SNWA++RRALADC VGFG+ A+GGKYG TYVVT P D+P +PKPGTLRY
Sbjct  45    LNTIDSCWRTESNWATDRRALADCAVGFGQAAIGGKYGKTYVVTTPDDDPTDPKPGTLRY  104

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ+ PLWI+F KDMVI L+NELM+NS KTIDGRG+ VEI +GPC+ I+GV+++IIHGI
Sbjct  105   GAIQTEPLWIIFDKDMVIKLENELMINSFKTIDGRGSNVEITDGPCLKIEGVSHVIIHGI  164

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR +PTH G+RRG+DGDAISIF++S+IWIDHCYLAR  DGLIDVIH S
Sbjct  165   SIHDCKPGKRGLVRSSPTHVGQRRGADGDAISIFASSHIWIDHCYLARCIDGLIDVIHAS  224

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYF QHDKVML GHND    DK MKVTVAFNHFGPGLIERMPRVR GYAHVAN
Sbjct  225   TAVTISNNYFAQHDKVMLLGHNDEYTADKVMKVTVAFNHFGPGLIERMPRVRFGYAHVAN  284

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWR-SSKDKFL  462
             NRY  W MYAIGGSA  TIFSEGNYF+AP+ S +K+VTKRE   GW NWKWR SSKD F+
Sbjct  285   NRYDEWQMYAIGGSAGSTIFSEGNYFIAPDISYAKEVTKREADGGWKNWKWRSSSKDVFM  344

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFVPSGYGSCAP Y+++QSF V  G+ VP+LT+DAGPL C
Sbjct  345   NGAYFVPSGYGSCAPLYSEAQSFVVFPGTMVPSLTSDAGPLTC  387



>ref|XP_009108544.1| PREDICTED: probable pectate lyase 16 [Brassica rapa]
Length=394

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/384 (68%), Positives = 304/384 (79%), Gaps = 7/384 (2%)
 Frame = -3

Query  1460  SNLAMAAAVIIIMPLL-----GIMGFVPTLNAAADKATS--MNVIDSCWRAKSNWASNRR  1302
             SN+ +  A+ +   L+     G  G+ P++ +   +     MN +DSCWR  S+W++NR+
Sbjct  5     SNICLFVALFLCQSLVLAVNNGYYGYNPSVASYLPEKPQNIMNPVDSCWRHNSDWSANRK  64

Query  1301  ALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVIT  1122
              LADC VGFG  A+GGK GN YVVT+P+DN  NPKPG+LRYG IQ  PLWI FAKDMVIT
Sbjct  65    DLADCAVGFGSSALGGKKGNLYVVTNPNDNAANPKPGSLRYGVIQDKPLWITFAKDMVIT  124

Query  1121  LKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTH  942
             L+NELMVNS+KTIDGRGA VEIA GPCITIQ VTN+I+HGIS+HDCKP K G VR + TH
Sbjct  125   LENELMVNSYKTIDGRGAKVEIAYGPCITIQQVTNVIVHGISIHDCKPAKYGMVRSSTTH  184

Query  941   AGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLF  762
              G R+GSDGDAI+I  +SNIWIDHCYLA   DGLIDVIH ST ITISNNYFTQH KVML 
Sbjct  185   VGHRKGSDGDAIAISGSSNIWIDHCYLASCTDGLIDVIHASTGITISNNYFTQHVKVMLL  244

Query  761   GHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTI  582
             GHNDN V+D  MKVTVAFNHFGPGL+ERMPRVR G AHVANNRY  W+MYAIGGSA+PTI
Sbjct  245   GHNDNFVQDVNMKVTVAFNHFGPGLVERMPRVRRGCAHVANNRYDKWIMYAIGGSADPTI  304

Query  581   FSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKS  402
             FSEGNYF+A +KS SK+VTKREVK GW+NW+WR+SKD F NGAYFVPSGYGS    Y+ +
Sbjct  305   FSEGNYFIASDKSNSKEVTKREVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSVDLPYSSA  364

Query  401   QSFPVADGSRVPALTADAGPLRCS  330
             Q F VA G+ VP+LTADAGPL C+
Sbjct  365   QRFTVAPGNMVPSLTADAGPLNCN  388



>ref|XP_010476139.1| PREDICTED: putative pectate lyase 2 isoform X2 [Camelina sativa]
Length=385

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 292/350 (83%), Gaps = 2/350 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   +WA NRRALADC VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLR+
Sbjct  37    LNPIDSCWRRNPSWAYNRRALADCAVGFGKAAVGGKYGSIYVVTNPSDDPENPRPGTLRH  96

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQS PLWI FA+DMVI L+NEL++NS+KTIDGRGA VEIA GPCITIQ V+++IIHGI
Sbjct  97    AVIQSKPLWITFARDMVIVLRNELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGI  156

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +PTH G R+GSDGDAI+IF +S+IWIDHCY +R  DGLIDV+H S
Sbjct  157   SIHDCKPGKSGRVRSSPTHIGNRKGSDGDAIAIFDSSHIWIDHCYFSRCQDGLIDVLHAS  216

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFTQHDKVML GHNDNNVEDK M+VT+AFNHFGPGLIERMPRVR GYAHVAN
Sbjct  217   TAVTISNNYFTQHDKVMLLGHNDNNVEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVAN  276

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFL  462
             NRY  W MYAIGGSA+PTIFSEGNYF+A +    KQVTKR +    W+ WKWR+SKD F 
Sbjct  277   NRYEKWQMYAIGGSADPTIFSEGNYFVASDDLSKKQVTKRIDSGYDWTRWKWRTSKDVFK  336

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGAYFVPSGYG+  P Y +++ FPV+ GS  P+LT+ +GPLRC YS   C
Sbjct  337   NGAYFVPSGYGTVTPLYRRAEWFPVSHGSLAPSLTSSSGPLRC-YSGRIC  385



>ref|XP_010458609.1| PREDICTED: putative pectate lyase 2 [Camelina sativa]
Length=385

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 292/350 (83%), Gaps = 2/350 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   +WA NRRALADC VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLR+
Sbjct  37    LNPIDSCWRRNPSWAYNRRALADCAVGFGKAAVGGKYGSIYVVTNPSDDPENPRPGTLRH  96

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQS PLWI F++DMVI L+NEL++NS+KTIDGRGA VEIA GPCITIQ V+++IIHGI
Sbjct  97    AVIQSKPLWITFSRDMVIVLRNELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGI  156

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +PTH G R+GSDGDAI+IF +S+IWIDHCY +R  DGLIDV+H S
Sbjct  157   SIHDCKPGKSGRVRSSPTHIGSRKGSDGDAIAIFDSSHIWIDHCYFSRCQDGLIDVLHAS  216

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFTQHDKVML GHNDNNVEDK M+VT+AFNHFGPGLIERMPRVR GYAHVAN
Sbjct  217   TAVTISNNYFTQHDKVMLLGHNDNNVEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVAN  276

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFL  462
             NRY  W MYAIGGSA+PTIFSEGNYF+A +    KQVTKR +    W+ WKWR+SKD F 
Sbjct  277   NRYEKWQMYAIGGSADPTIFSEGNYFVASDDFSKKQVTKRIDSGYDWTRWKWRTSKDVFK  336

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGAYFVPSGYG+  P Y +++ FPV+ GS  P+LT+ AGPLRC YS   C
Sbjct  337   NGAYFVPSGYGTVTPLYRRAEWFPVSHGSLAPSLTSSAGPLRC-YSGRIC  385



>ref|XP_003550482.1| PREDICTED: putative pectate lyase 2-like [Glycine max]
Length=398

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/346 (73%), Positives = 282/346 (82%), Gaps = 0/346 (0%)
 Frame = -3

Query  1370  KATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPG  1191
             K   +NVIDSCWR K NWASNR+ALADC +GFGKDA GGKYG  Y V DPSD+P NPKPG
Sbjct  47    KKALLNVIDSCWRTKPNWASNRQALADCAIGFGKDATGGKYGAIYRVKDPSDDPVNPKPG  106

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLRYGAIQ+ PLWI+F KDMVI LKNEL++NS+KTIDGRGA VEI +GPCITIQGV+++I
Sbjct  107   TLRYGAIQTEPLWIIFDKDMVIRLKNELIMNSYKTIDGRGAKVEITDGPCITIQGVSHVI  166

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             IHGI++HDCKP K G VR TP H G R GSDGDAISIF +SNIWIDHC+LAR+ DGLIDV
Sbjct  167   IHGINIHDCKPAKPGLVRSTPDHVGHRLGSDGDAISIFDSSNIWIDHCFLARSTDGLIDV  226

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             IH STAI ISNNYFTQHDKVML GHND    DK M+VT+AFN F  GL ERMPRVR GYA
Sbjct  227   IHASTAIAISNNYFTQHDKVMLLGHNDQYTADKIMRVTIAFNRFASGLTERMPRVRFGYA  286

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKD  471
             HV NN+Y  W MYAIGGSANPTI SEGN ++APN   +KQVTKRE K+ W +WKWRSSKD
Sbjct  287   HVVNNKYDEWKMYAIGGSANPTILSEGNLYVAPNDPNAKQVTKREGKENWKSWKWRSSKD  346

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              FLNGAYFVPSG+GSCAP Y+ +QSF  A    VPA+T +AGP  C
Sbjct  347   LFLNGAYFVPSGFGSCAPNYSPTQSFSAAPAYLVPAMTLNAGPTNC  392



>ref|XP_007147703.1| hypothetical protein PHAVU_006G147600g [Phaseolus vulgaris]
 gb|ESW19697.1| hypothetical protein PHAVU_006G147600g [Phaseolus vulgaris]
Length=372

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/352 (71%), Positives = 289/352 (82%), Gaps = 0/352 (0%)
 Frame = -3

Query  1388  LNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNP  1209
             L A++ ++  +N IDSC  AKSNWASNR+ALADC +GFGKDA+GGKYG  Y VTDPSD+P
Sbjct  15    LLASSSQSAVLNKIDSCRLAKSNWASNRQALADCVIGFGKDAIGGKYGAIYKVTDPSDDP  74

Query  1208  GNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQ  1029
              +PKPGTLRYG +Q+ PLWI+FAKDM I LKNEL++NS+KTIDGRGA VEI NGPCITIQ
Sbjct  75    ISPKPGTLRYGVVQTQPLWIIFAKDMTIKLKNELIMNSYKTIDGRGAKVEITNGPCITIQ  134

Query  1028  GVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAA  849
             GV+++IIHGIS+HDCKP K+G V  TP+H G R+GSDGD ISIF++SN+WIDHC+ AR  
Sbjct  135   GVSHVIIHGISIHDCKPSKAGLVMSTPSHVGHRQGSDGDGISIFASSNVWIDHCFFARCF  194

Query  848   DGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPR  669
             DGLIDVIH STAITISNNYFTQHDKVML GH+D    DK MKVT+AFN F  GLIERMPR
Sbjct  195   DGLIDVIHASTAITISNNYFTQHDKVMLLGHSDVYTADKIMKVTIAFNRFASGLIERMPR  254

Query  668   VRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWK  489
             VR GYAHV NN+Y  W MYAIGGS+NPTI SE NY++APN   SKQVTKRE+K    +WK
Sbjct  255   VRFGYAHVVNNKYDAWKMYAIGGSSNPTILSEANYYVAPNDPASKQVTKREMKGKLKSWK  314

Query  488   WRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             WRSSKD FLNGAYFVPSGYGSC P Y+ SQSF  A  S VPA+T +AGPL C
Sbjct  315   WRSSKDAFLNGAYFVPSGYGSCDPNYSPSQSFTAAPASLVPAITLNAGPLTC  366



>ref|XP_004155676.1| PREDICTED: putative pectate lyase 2-like [Cucumis sativus]
Length=380

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/344 (73%), Positives = 292/344 (85%), Gaps = 1/344 (0%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             S+N ID+CWR   NWA+NRRALADC VGFG DA+GGK+G+ YVVTDPSD+P  P+PGTLR
Sbjct  31    SLNPIDACWRNNRNWAANRRALADCAVGFGSDALGGKFGSIYVVTDPSDDPEYPEPGTLR  90

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             +G IQ  PLWI+FA+DMVITLK ELMVNS+KTIDGRGA VEI+NGPCITIQ V+++IIHG
Sbjct  91    FGVIQMQPLWIVFARDMVITLKRELMVNSYKTIDGRGANVEISNGPCITIQNVSHVIIHG  150

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGK G VR + TH G R+ SDGDAISIFS+S+IWIDHCYLAR  DGLIDVIH 
Sbjct  151   ISIHDCKPGKPGRVRSSVTHCGDRQQSDGDAISIFSSSHIWIDHCYLARCTDGLIDVIHA  210

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             STA+TISNNYF+QHDKV+L GHND   +D+ M+VTVAFN FG GL++RMPRVR GYAHVA
Sbjct  211   STAVTISNNYFSQHDKVILLGHNDEFRDDRIMRVTVAFNRFGAGLVQRMPRVRFGYAHVA  270

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV-KKGWSNWKWRSSKDKF  465
             NN Y  W MYA+GGSA+PTIFS+GNYFMAPN   SKQVTKREV + GW +WKWRSS D F
Sbjct  271   NNWYNKWEMYAMGGSADPTIFSQGNYFMAPNDPFSKQVTKREVYESGWKSWKWRSSNDVF  330

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             +NGAYF+P+G+GSC P+YT++Q+FPVA GS  P LT  AGPLRC
Sbjct  331   MNGAYFIPTGWGSCTPFYTQAQAFPVAHGSLAPLLTIAAGPLRC  374



>ref|XP_010476138.1| PREDICTED: putative pectate lyase 2 isoform X1 [Camelina sativa]
Length=385

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 291/350 (83%), Gaps = 2/350 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   +WA NRRALADC VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLR+
Sbjct  37    LNPIDSCWRRNPSWAYNRRALADCAVGFGKAAVGGKYGSIYVVTNPSDDPENPRPGTLRH  96

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQS PLWI FA+DMVI L+NEL++NS+KTIDGRGA VEIA GPCITIQ V+++IIHGI
Sbjct  97    AVIQSKPLWITFARDMVIVLRNELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGI  156

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +PTH G R+GSDGDAI+IF +S+IWIDHCY +R  DGLIDV+H S
Sbjct  157   SIHDCKPGKSGRVRSSPTHIGNRKGSDGDAIAIFDSSHIWIDHCYFSRCQDGLIDVLHAS  216

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFTQHDKVML GHNDNN EDK M+VT+AFNHFGPGLIERMPRVR GYAHVAN
Sbjct  217   TAVTISNNYFTQHDKVMLLGHNDNNXEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVAN  276

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFL  462
             NRY  W MYAIGGSA+PTIFSEGNYF+A +    KQVTKR +    W+ WKWR+SKD F 
Sbjct  277   NRYEKWQMYAIGGSADPTIFSEGNYFVASDDLSKKQVTKRIDSGYDWTRWKWRTSKDVFK  336

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGAYFVPSGYG+  P Y +++ FPV+ GS  P+LT+ +GPLRC YS   C
Sbjct  337   NGAYFVPSGYGTVTPLYRRAEWFPVSHGSLAPSLTSSSGPLRC-YSGRIC  385



>ref|XP_002892663.1| hypothetical protein ARALYDRAFT_312221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68922.1| hypothetical protein ARALYDRAFT_312221 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 291/350 (83%), Gaps = 2/350 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   +WA NRR+LADC VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLR+
Sbjct  35    LNPIDSCWRRNPSWAFNRRSLADCAVGFGKSAVGGKYGSIYVVTNPSDDPENPRPGTLRH  94

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQS PLWI FA+DMVI L+NEL++NS+KTIDGRGA VEIA GPCITIQ V+++IIHGI
Sbjct  95    AVIQSKPLWITFARDMVIVLRNELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGI  154

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +PTH G R+GSDGDAI+IF +S+IWIDHCY +R  DGLIDV+H S
Sbjct  155   SIHDCKPGKSGRVRSSPTHVGSRKGSDGDAIAIFDSSHIWIDHCYFSRCQDGLIDVLHAS  214

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFTQHDKVML GHNDNNVEDK M+VT+AFNHFGPGLIERMPRVR GYAHVAN
Sbjct  215   TAVTISNNYFTQHDKVMLLGHNDNNVEDKNMRVTIAFNHFGPGLIERMPRVRRGYAHVAN  274

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFL  462
             NRY  W MYAIGGSA+PTIFSEGNYF+A +    KQVTKR +    W  WKWR+SKD F 
Sbjct  275   NRYEKWQMYAIGGSADPTIFSEGNYFVASDDPSKKQVTKRIDSGYDWRRWKWRTSKDVFK  334

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGAYFVPSGYG+  P Y +++ FPV+ GS VP+LT+ AGPL C YS   C
Sbjct  335   NGAYFVPSGYGTVTPLYGRAEWFPVSHGSLVPSLTSSAGPLHC-YSGRIC  383



>ref|XP_008440030.1| PREDICTED: putative pectate lyase 2 [Cucumis melo]
Length=382

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/355 (71%), Positives = 292/355 (82%), Gaps = 1/355 (0%)
 Frame = -3

Query  1394  PTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD  1215
             P  N   DK  S+N ID+CWR   NWA+NRRALADC VGFG DA+GGK+G+ YVVTDPSD
Sbjct  22    PKPNNYYDKPISLNPIDACWRNNPNWAANRRALADCAVGFGSDALGGKFGSIYVVTDPSD  81

Query  1214  NPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCIT  1035
             +P  P+PGTLR+G IQ  PLWI+FA+DM ITLK ELMVNS KTIDGRGA VEI+NGPC+T
Sbjct  82    DPEYPEPGTLRFGVIQLKPLWIVFARDMAITLKRELMVNSFKTIDGRGAKVEISNGPCVT  141

Query  1034  IQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLAR  855
             IQ V+++IIHGIS+HDCKPGK G VR T TH G R+ SDGDAISIFS+S+IWIDHCYLAR
Sbjct  142   IQNVSHVIIHGISIHDCKPGKPGRVRSTVTHCGDRQESDGDAISIFSSSHIWIDHCYLAR  201

Query  854   AADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERM  675
               DGLIDVIH STA+TISNNYF+QHDKV+L GHND   +D+ M+VTVAFN FG GL++RM
Sbjct  202   CTDGLIDVIHASTAVTISNNYFSQHDKVILLGHNDEFRDDRIMRVTVAFNRFGAGLVQRM  261

Query  674   PRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV-KKGWS  498
             PRVR GYAHVANN Y  W MYA+GGSA+PTIFS+GNYFMAP+   SKQVTKREV + GW 
Sbjct  262   PRVRFGYAHVANNWYNKWEMYAMGGSADPTIFSQGNYFMAPDDPFSKQVTKREVYESGWK  321

Query  497   NWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              WKWRSS D F+NGAYF+P+G+GSC P+YT++Q+FPVA GS  P LT  AGPL C
Sbjct  322   TWKWRSSNDVFMNGAYFIPTGWGSCTPFYTRAQAFPVAHGSLAPLLTIAAGPLPC  376



>gb|AAC17625.1| Similar to style development-specific protein 9612 precursor 
gb|X55193 and pectate lyase P59 precursor gb|X15499 from Lycopersicon 
esculentum [Arabidopsis thaliana]
Length=390

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/391 (66%), Positives = 302/391 (77%), Gaps = 13/391 (3%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADKATSM-----NVIDSCWRAKSNWASNRRALADCG  1284
             MA+  + I+ LL        + AA     ++     N IDSCWR    WASNRRALADC 
Sbjct  1     MASLFLTIISLLFAAFSSSVVEAAYSNGYTIPKLLPNPIDSCWRRNPYWASNRRALADCA  60

Query  1283  VGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELM  1104
             VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLRY  IQS PLWI FA+DMVI L+NEL+
Sbjct  61    VGFGKSAVGGKYGSIYVVTNPSDDPENPRPGTLRYAVIQSKPLWITFARDMVIVLRNELI  120

Query  1103  VNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRG  924
             +NS+KTIDGRGA VEIA GPCITIQ V+++IIHGIS+HDCKPGKSG VR +PTH G R+G
Sbjct  121   MNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGISIHDCKPGKSGRVRSSPTHVGSRKG  180

Query  923   SDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNN  744
             SDGDAI+IF +S+IWIDHC+ +R  DGLIDV+H STA+TISNNYFTQHDKVML GHNDNN
Sbjct  181   SDGDAIAIFDSSHIWIDHCFFSRCQDGLIDVLHASTAVTISNNYFTQHDKVMLLGHNDNN  240

Query  743   VEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNY  564
             VEDK M+VT+AFNHFGPGLIERMPRVR GYAHVANNRY  W MYAIGGSA+PTIFSEGNY
Sbjct  241   VEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSADPTIFSEGNY  300

Query  563   FMAPNKSESKQVTK-----REVKKG--WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTK  405
             F+A +    KQV+      + +  G  W  WKWR+SKD F NGAYFVPSGYG+  P Y +
Sbjct  301   FVASDDPSKKQVSSFKIVTKRIDSGYDWKRWKWRTSKDVFKNGAYFVPSGYGTVTPLYGR  360

Query  404   SQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             ++ FPV+ GS VP LT+ AGPL C YS   C
Sbjct  361   AERFPVSHGSLVPLLTSSAGPLHC-YSGRIC  390



>gb|EYU33883.1| hypothetical protein MIMGU_mgv1a007737mg [Erythranthe guttata]
Length=396

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/343 (73%), Positives = 283/343 (83%), Gaps = 1/343 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR+  NWASNR+ALADC +GFG  A GGKYG  Y+VTDPSD+P NPKPGTLRY
Sbjct  48    MNQIDSCWRSNPNWASNRQALADCAIGFGSSATGGKYGPIYIVTDPSDDPINPKPGTLRY  107

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ+ PLWI F  DM ITL+NELMVNS+KTIDGRGA VEI+NGPCI+I GV ++IIHGI
Sbjct  108   GAIQTQPLWITFQGDMSITLENELMVNSYKTIDGRGARVEISNGPCISIDGVNHVIIHGI  167

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPG+ G VR +P H G R G DGDAISIFS+SN+W+DHCYLARAADGL+DV HGS
Sbjct  168   SIHDCKPGRPGMVRSSPDHVGHRLGCDGDAISIFSSSNVWVDHCYLARAADGLVDVTHGS  227

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
               +T+SNNYFTQHDKVML GHND    DK+MKVTV FNHFGP L++R+PRVR GYAHVAN
Sbjct  228   NFVTVSNNYFTQHDKVMLLGHNDAFTADKSMKVTVVFNHFGPRLVQRLPRVRHGYAHVAN  287

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVK-KGWSNWKWRSSKDKFL  462
             N+Y  WLMYAIGGSA+PTI SE NYF+A N + +KQVTKRE    GW +WKWRS+ D FL
Sbjct  288   NKYDQWLMYAIGGSADPTILSENNYFLASNDATAKQVTKRETTPNGWKSWKWRSTGDIFL  347

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFVPSGYGS AP Y KSQSF  A  S VPALT+DAGPL C
Sbjct  348   NGAYFVPSGYGSTAPNYLKSQSFVAASASFVPALTSDAGPLFC  390



>gb|KFK29603.1| hypothetical protein AALP_AA7G155700 [Arabis alpina]
Length=394

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/363 (70%), Positives = 291/363 (80%), Gaps = 2/363 (1%)
 Frame = -3

Query  1412  GIMGFVPTLNAAADKATS--MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNT  1239
             G  G+ P++ +   +     MN +D+CWR   +WA+NR+ LADC VGFG    GGK G  
Sbjct  26    GYYGYNPSVASYLPEKPQNIMNPVDTCWRLNPDWAANRKDLADCAVGFGSSTFGGKKGKI  85

Query  1238  YVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVE  1059
             YVVT+PSDN  NP+PG+LRYG IQ  PLWI FAKDMVITL+NELMVNSHKTIDGRGA V 
Sbjct  86    YVVTNPSDNAQNPQPGSLRYGVIQDKPLWITFAKDMVITLENELMVNSHKTIDGRGAKVG  145

Query  1058  IANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIW  879
             IA GPCITIQ VTN+I+HGIS+HDCKPG+ G VR +  H G R+GSDGD I++FS+SNIW
Sbjct  146   IAYGPCITIQDVTNVIVHGISIHDCKPGRYGMVRSSTNHVGHRKGSDGDGIAVFSSSNIW  205

Query  878   IDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHF  699
             IDHCYLA   DGLIDVIH ST ITISNNYFTQH KVML GHND+ V+D  MKVTVAFNHF
Sbjct  206   IDHCYLASCTDGLIDVIHASTGITISNNYFTQHVKVMLLGHNDDFVKDVNMKVTVAFNHF  265

Query  698   GPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR  519
             GPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKR
Sbjct  266   GPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDKSNSKEVTKR  325

Query  518   EVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
             EVK GW+NW+WR+SKD F NGAYFVPSGYGS    Y   Q FPVA G+ VP+LTADAGPL
Sbjct  326   EVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSITLPYNSDQRFPVAAGNMVPSLTADAGPL  385

Query  338   RCS  330
              C+
Sbjct  386   NCN  388



>ref|XP_009357592.1| PREDICTED: putative pectate lyase 2 [Pyrus x bretschneideri]
Length=388

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/342 (72%), Positives = 288/342 (84%), Gaps = 0/342 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MNV+DSCWR KSNWA+NRRALA+C VGFGKDA+GGKYG TYVVT   D+P NP PG+LRY
Sbjct  41    MNVVDSCWRTKSNWATNRRALANCAVGFGKDALGGKYGGTYVVTTSDDDPVNPAPGSLRY  100

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCIT+QG +++IIHG+
Sbjct  101   GVIQTQPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITVQGDSHVIIHGL  160

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK G VR TPTH G+R GSDGDAIS+F++S++WIDHC+LAR+ DGL+DV H S
Sbjct  161   SIHDCKPGKGGNVRSTPTHVGQRLGSDGDAISVFASSHVWIDHCFLARSTDGLLDVTHAS  220

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TI+NNYF+QHDKV + GHNDN  EDK M+VT+AFN FG GL ERMPRVR GYAHVAN
Sbjct  221   TAVTITNNYFSQHDKVSIIGHNDNFSEDKNMRVTIAFNRFGAGLTERMPRVRFGYAHVAN  280

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             N Y  W MYA+GGSANPTIFSEGNYF+AP    +KQVTKRE    W+NWKWRSS D   N
Sbjct  281   NLYKEWKMYAVGGSANPTIFSEGNYFIAPETPFAKQVTKREAGDSWNNWKWRSSGDVLKN  340

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GA+FV SGYGSC P Y+++QSF V+ G+ VPALT++AGPL C
Sbjct  341   GAFFVQSGYGSCYPLYSRTQSFKVSPGAMVPALTSNAGPLGC  382



>emb|CDX79122.1| BnaA01g11890D [Brassica napus]
Length=401

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/357 (71%), Positives = 291/357 (82%), Gaps = 9/357 (3%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN +DSCWR KS+W +NR+ LADC VGFG  A+GGK G+ YVVT+P+DN  NP+PG+LRY
Sbjct  45    MNPVDSCWRLKSDWTANRKDLADCAVGFGSSALGGKKGSIYVVTNPNDNAANPQPGSLRY  104

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI FAKDMV+TL+NELMVNS+KTIDGRGA VEIA GPCITIQ VTN+I+HGI
Sbjct  105   GVIQDKPLWITFAKDMVLTLENELMVNSYKTIDGRGAKVEIAYGPCITIQEVTNVIVHGI  164

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLID-----  834
             S+H CKPGK G VR + TH G R+GSDGDAI+I  +SNIWIDHCYLA   DGLID     
Sbjct  165   SIHHCKPGKYGMVRSSTTHVGHRKGSDGDAIAISGSSNIWIDHCYLASCTDGLIDLPMLT  224

Query  833   ---VIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVR  663
                VIH ST ITISNNYFTQHDKVML GHND+ V+D  MKVTVAFNHFGPGL+ERMPRVR
Sbjct  225   SLDVIHASTGITISNNYFTQHDKVMLLGHNDDFVQDVKMKVTVAFNHFGPGLVERMPRVR  284

Query  662   LGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWR  483
              GYAHVANNRY  W+MYAIGGSA+PTIFSEGNYF+A + S SK+VTKREVK GW+NW+WR
Sbjct  285   RGYAHVANNRYDKWIMYAIGGSADPTIFSEGNYFIASDNSNSKEVTKREVKGGWNNWRWR  344

Query  482   SSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +SKD F NGAYFVPSGYGS A  Y+ +Q FPVA G+ VP+LTA AGPL C Y +  C
Sbjct  345   TSKDVFKNGAYFVPSGYGSVALPYSSAQRFPVAPGNLVPSLTAGAGPLNC-YRNRPC  400



>ref|XP_010493521.1| PREDICTED: putative pectate lyase 2 [Camelina sativa]
Length=383

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 290/350 (83%), Gaps = 4/350 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   +WA NRRALADC VGFGK AVGGKYG+ YVVT+PSD+P NP+PGTLR+
Sbjct  37    LNPIDSCWRRNPSWAYNRRALADCAVGFGKAAVGGKYGSIYVVTNPSDDPENPRPGTLRH  96

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQS PLWI FA+DMVI L+NEL++NS+KTIDGRGA VEIA GPCITIQ V+++IIHGI
Sbjct  97    AVIQSKPLWITFARDMVIVLRNELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHVIIHGI  156

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR +PTH G R+GSDGDAI+IF +S+IWIDHCY +R  DGLIDV+H S
Sbjct  157   SIHDCKPGKSGRVRSSPTHIGNRKGSDGDAIAIFDSSHIWIDHCYFSRCQDGLIDVLHAS  216

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFTQHDKVML GHNDNNVEDK M+VT+AFNHFGPGLIERMPRVR GYAHVAN
Sbjct  217   TAVTISNNYFTQHDKVMLLGHNDNNVEDKIMRVTIAFNHFGPGLIERMPRVRRGYAHVAN  276

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFL  462
             NRY  W MYAIGGSA+PTIFSEGNYF+A +    KQVTKR +    W+ WKWR+SKD F 
Sbjct  277   NRYEKWQMYAIGGSADPTIFSEGNYFVASDDLSKKQVTKRIDSGYDWTRWKWRTSKDVFK  336

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NG  FVPSGYG+  P Y +++ FPV+ GS  P+LT+ AGPLRC YS   C
Sbjct  337   NG--FVPSGYGTVTPLYRRAEWFPVSHGSLAPSLTSSAGPLRC-YSGRIC  383



>emb|CDX76388.1| BnaA08g10120D [Brassica napus]
Length=408

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/398 (66%), Positives = 304/398 (76%), Gaps = 21/398 (5%)
 Frame = -3

Query  1460  SNLAMAAAVIIIMPLL-----GIMGFVPTLNAAADKATS--MNVIDSCWRAKSNWASNRR  1302
             SN+ +  A+ +   L+     G  G+ P++ +   +     MN +DSCWR  S+W++NR+
Sbjct  5     SNICLFVALFLCQSLVLAVNNGYYGYNPSVASYLPEKPQNIMNPVDSCWRHNSDWSANRK  64

Query  1301  ALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVIT  1122
              LADC VGFG  A+GGK GN YVVT+P+DN  NPKPG+LRYG IQ  PLWI FAKDMVIT
Sbjct  65    DLADCAVGFGSSALGGKKGNLYVVTNPNDNAANPKPGSLRYGVIQDKPLWITFAKDMVIT  124

Query  1121  LKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTH  942
             L+NELMVNS+KTIDGRGA VEIA GPCITIQ VTN+I+HGIS+HDCKP K G VR + TH
Sbjct  125   LENELMVNSYKTIDGRGAKVEIAYGPCITIQQVTNVIVHGISIHDCKPAKYGMVRSSTTH  184

Query  941   AGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLF  762
              G R+GSDGDAI+I  +SNIWIDHCYLA   DGLIDVIH ST ITISNNYFTQH KVML 
Sbjct  185   VGHRKGSDGDAIAISGSSNIWIDHCYLASCTDGLIDVIHASTGITISNNYFTQHVKVMLL  244

Query  761   GHNDNNVEDKAMKVTVAFNHFGPGLIERMP--------------RVRLGYAHVANNRYTG  624
             GHNDN V+D  MKVTVAFNHFGPGL+ERMP              RVR G AHVANNRY  
Sbjct  245   GHNDNFVQDVNMKVTVAFNHFGPGLVERMPRQVIYNHLRKTLACRVRRGCAHVANNRYDK  304

Query  623   WLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFV  444
             W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKREVK GW+NW+WR+SKD F NGAYFV
Sbjct  305   WIMYAIGGSADPTIFSEGNYFIASDKSNSKEVTKREVKGGWNNWRWRTSKDVFKNGAYFV  364

Query  443   PSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             PSGYGS    Y+ +Q F VA G+ VP+LTADAGPL C+
Sbjct  365   PSGYGSVDLPYSSAQRFTVAPGNMVPSLTADAGPLNCN  402



>gb|KEH36910.1| pectate lyase family protein [Medicago truncatula]
Length=409

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/355 (69%), Positives = 281/355 (79%), Gaps = 1/355 (0%)
 Frame = -3

Query  1397  VPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPS  1218
             +P  N   + A  MN IDSCWR+ SNW SNR++LADC +GFGKDA+GGKYG  Y VTDPS
Sbjct  50    IPNSNTPQNVAV-MNTIDSCWRSNSNWVSNRQSLADCAIGFGKDAIGGKYGEIYEVTDPS  108

Query  1217  DNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCI  1038
             D+P NPK GTLRYG IQ+ P+WI+F+ DMVI LKNEL+VNS+KTIDGRGA VEI NGPCI
Sbjct  109   DDPINPKKGTLRYGVIQAEPVWIIFSNDMVIKLKNELIVNSYKTIDGRGAKVEIGNGPCI  168

Query  1037  TIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLA  858
             TIQGV+++I+HGIS+HDCKP   G VR +  H G R+GSDGD IS+F++SNIWIDHCYLA
Sbjct  169   TIQGVSHVIVHGISIHDCKPSNPGMVRSSIEHVGYRQGSDGDGISVFASSNIWIDHCYLA  228

Query  857   RAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIER  678
             R  DGL DV H ST +TISNNYFTQHDKVML GHND+   D+ MKVTVAFN F  GLIER
Sbjct  229   RCTDGLTDVTHASTLVTISNNYFTQHDKVMLLGHNDDYSADRVMKVTVAFNRFASGLIER  288

Query  677   MPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWS  498
             MPRVR GYAHV NNRY  W+MYAIGGSA+PTIFS+ NYF+A   S +KQVTKRE    W 
Sbjct  289   MPRVRFGYAHVVNNRYDEWIMYAIGGSADPTIFSQANYFIASKNSNAKQVTKRETDGKWK  348

Query  497   NWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NWKWR+  D+FLNGAYFVPSGYGSC P Y+ SQ+F  A  S VP LT +AGPL C
Sbjct  349   NWKWRTYGDEFLNGAYFVPSGYGSCTPLYSSSQNFVAAKASMVPLLTLNAGPLDC  403



>ref|XP_002518441.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF43828.1| Pectate lyase precursor, putative [Ricinus communis]
Length=377

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/357 (71%), Positives = 293/357 (82%), Gaps = 5/357 (1%)
 Frame = -3

Query  1400  FVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP  1221
             ++PT     +  T  N IDSCWR +SNWASNR+ALADC VGFGK  +GGK G+ YVVT P
Sbjct  21    YLPT-----NTETVFNTIDSCWRTESNWASNRQALADCAVGFGKATLGGKDGDIYVVTTP  75

Query  1220  SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPC  1041
              D+P +PKPGTLRYG IQ+ PLWI+F +DMVITL+NELMVNS KTIDGRG+ +EIA+GPC
Sbjct  76    DDDPVDPKPGTLRYGVIQTEPLWIIFDQDMVITLENELMVNSFKTIDGRGSKIEIADGPC  135

Query  1040  ITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYL  861
             +TI+GV+++IIHGIS+HDCKP K G VR + +H G RRGSDGD I +F++SNIWIDHCYL
Sbjct  136   MTIEGVSHVIIHGISIHDCKPSKRGLVRSSASHVGERRGSDGDGIVVFASSNIWIDHCYL  195

Query  860   ARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIE  681
             AR  DGL+DVIH STA+TISNNYF+QHDKVML GHND    D+ MKVTV  NHFGPGL++
Sbjct  196   ARCTDGLLDVIHASTAVTISNNYFSQHDKVMLLGHNDEYSADEVMKVTVVLNHFGPGLVQ  255

Query  680   RMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGW  501
             RMPRVR GYAHVANNRY  W MYAIGGSANPTIFSE NYFMAPN    KQVTKREV  GW
Sbjct  256   RMPRVRYGYAHVANNRYEEWEMYAIGGSANPTIFSECNYFMAPNDPNIKQVTKREVPGGW  315

Query  500   SNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
              NWKWRSS+D F+NGAYFV SGYGSCAP Y++ QSF VA G+ VPALT+DAGPL CS
Sbjct  316   KNWKWRSSRDIFMNGAYFVQSGYGSCAPRYSRDQSFTVAPGTLVPALTSDAGPLTCS  372



>ref|XP_004507669.1| PREDICTED: putative pectate lyase 2-like [Cicer arietinum]
Length=385

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/378 (65%), Positives = 289/378 (76%), Gaps = 1/378 (0%)
 Frame = -3

Query  1466  ISSNLAMAAAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADC  1287
             IS++L   +  ++ + L  ++      N    K   +N IDSCWR K NW+ NR+ALADC
Sbjct  3     ISTSLLTLSCFLLTLSLT-LVNVYSKENYYNIKKPFLNKIDSCWRGKPNWSLNRKALADC  61

Query  1286  GVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNEL  1107
              +GFGKDA+GGKYG  YVV D SD+P NPK GTLRYGAIQ+ PLWI+FAK MVITL+NEL
Sbjct  62    AIGFGKDAIGGKYGEIYVVNDSSDDPSNPKQGTLRYGAIQTKPLWIIFAKSMVITLENEL  121

Query  1106  MVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRR  927
             ++NS+KTIDGRG  VEI NGPCITIQGV+++IIHGI +HDCKP  +G VR +P H G R 
Sbjct  122   IMNSYKTIDGRGVKVEIGNGPCITIQGVSHVIIHGIRIHDCKPSNAGLVRSSPDHVGHRH  181

Query  926   GSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDN  747
             GSDGDAISIF++SN+WIDHC+LA  +DGLID+IH ST+ITISNNYFTQHDKVML GHND 
Sbjct  182   GSDGDAISIFASSNVWIDHCFLASCSDGLIDIIHASTSITISNNYFTQHDKVMLLGHNDR  241

Query  746   NVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGN  567
                DK MKVT+ FN F  GL ERMPRVR GYAHV NN+Y  W MYAIGGSANPTI SEGN
Sbjct  242   YTADKIMKVTIVFNRFASGLTERMPRVRFGYAHVVNNKYDEWKMYAIGGSANPTILSEGN  301

Query  566   YFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPV  387
             +F+ PN   +KQVTKR     W NWKWRSSKD FLNGAYFVPSGYG+CAP Y+ SQSF  
Sbjct  302   FFIGPNDQNAKQVTKRGANGNWKNWKWRSSKDVFLNGAYFVPSGYGTCAPNYSPSQSFVA  361

Query  386   ADGSRVPALTADAGPLRC  333
                  VPA+T +AGPL C
Sbjct  362   VPAYMVPAITLNAGPLTC  379



>emb|CDY27438.1| BnaC03g64780D [Brassica napus]
Length=408

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/398 (66%), Positives = 305/398 (77%), Gaps = 21/398 (5%)
 Frame = -3

Query  1460  SNLAMAAAVIIIMPLL-----GIMGFVPTLNAAADKATS--MNVIDSCWRAKSNWASNRR  1302
             SN+ +  A+ +   L+     G  GF P++ +   +     MN +DSCWR KS+W++NR+
Sbjct  5     SNICVFVALSLCQSLVLAINNGYYGFNPSVASYLPEKPQNIMNPVDSCWRHKSDWSANRK  64

Query  1301  ALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVIT  1122
              LADC VGFG  A+GGK GN YVVT+P+DN  NPKPG+LRYG IQ  PLWI FAKDMVIT
Sbjct  65    DLADCAVGFGSSALGGKKGNIYVVTNPNDNAANPKPGSLRYGVIQDKPLWITFAKDMVIT  124

Query  1121  LKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTH  942
             L+NELMVNS+KTIDGRGA VEIA GPCITIQ VTN+I+HGIS+HDCKP K G VR + TH
Sbjct  125   LENELMVNSYKTIDGRGAKVEIAFGPCITIQQVTNVIVHGISIHDCKPAKYGMVRSSTTH  184

Query  941   AGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLF  762
              G R+GSDGDAI+I  +S+IWIDHC+LA   DGLIDVIH ST ITISNNYFTQH KVML 
Sbjct  185   VGHRKGSDGDAIAISGSSHIWIDHCFLASCTDGLIDVIHASTGITISNNYFTQHVKVMLL  244

Query  761   GHNDNNVEDKAMKVTVAFNHFGPGLIERMP--------------RVRLGYAHVANNRYTG  624
             GHNDN V+D  MKVTVAFNHFGP L+ERMP              RVR GYAHVANNRY  
Sbjct  245   GHNDNFVQDVNMKVTVAFNHFGPRLVERMPRQIIYNHVRKTLACRVRRGYAHVANNRYDK  304

Query  623   WLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFV  444
             W+MYAIGGSA+PTIFSEGNYF+A +KS SK+VTKREVK GW+NW+WR+SKD F NGAYFV
Sbjct  305   WIMYAIGGSADPTIFSEGNYFIASDKSNSKEVTKREVKGGWNNWRWRTSKDVFKNGAYFV  364

Query  443   PSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             PSGYGS    Y+ +Q F VA G+ VP+LTADAGPL C+
Sbjct  365   PSGYGSVDLPYSSAQRFTVAPGNMVPSLTADAGPLNCN  402



>emb|CDP04430.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/349 (70%), Positives = 283/349 (81%), Gaps = 3/349 (1%)
 Frame = -3

Query  1370  KATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPG  1191
             +  +MN+IDSCWR    WASNR+ALADC  GFG  A+GGK G  YVVTD SD+P NPKPG
Sbjct  47    QKKAMNIIDSCWRWNPKWASNRQALADCARGFGNAALGGKNGAIYVVTDTSDDPINPKPG  106

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLRYG  Q  PLWI+F +DMV+ L+NELMVNS+KTIDGRG  VEIANGPCITI+GV+++I
Sbjct  107   TLRYGVTQDKPLWIIFQRDMVLKLENELMVNSYKTIDGRGVKVEIANGPCITIEGVSHVI  166

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             IHGIS+HDCKPGK G VR +  H G R GSDGDAI++F++SNIWIDHCYLAR  DGLID+
Sbjct  167   IHGISIHDCKPGKRGMVRSSLNHVGERTGSDGDAIAVFASSNIWIDHCYLARCTDGLIDI  226

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             IH ST+IT+SNNYFTQHDKVML GH D    DK MKVTVAFNHFGPGL++RMPRVR GYA
Sbjct  227   IHASTSITVSNNYFTQHDKVMLLGHQDGYTADKVMKVTVAFNHFGPGLVQRMPRVRYGYA  286

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG---WSNWKWRS  480
             HVANNRY  WLMYAIGGS+NPTI S GNYF+A    +SKQVTKR+++ G   W NWKWR+
Sbjct  287   HVANNRYDQWLMYAIGGSSNPTILSNGNYFIASKNPDSKQVTKRDIEGGPGVWKNWKWRT  346

Query  479   SKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             SKD FLNGAYFV SG GSC+P Y+ SQ F VA G  VP+LT+DAGPL C
Sbjct  347   SKDVFLNGAYFVQSGLGSCSPLYSASQLFSVASGFLVPSLTSDAGPLNC  395



>ref|XP_006348206.1| PREDICTED: putative pectate lyase 17-like [Solanum tuberosum]
Length=383

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/343 (71%), Positives = 287/343 (84%), Gaps = 15/343 (4%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +NVIDSCWR K +W+SNR+ALADC +GFG   +GGKYG+ Y+VTD SD+P NPKPGTLRY
Sbjct  49    LNVIDSCWRWKGDWSSNRKALADCAIGFGSSTIGGKYGDIYIVTDSSDDPINPKPGTLRY  108

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQS PLWI+F +DMV+TLKNELMVNS+KTIDGRGA VEI+NGPCIT+  VTN+IIHGI
Sbjct  109   GAIQSEPLWIIFRRDMVLTLKNELMVNSYKTIDGRGAKVEISNGPCITLDYVTNVIIHGI  168

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK              +GSDGDAIS+F++SN+WIDHCYLARA DGL+DVIH S
Sbjct  169   SIHDCKPGK--------------KGSDGDAISVFTSSNVWIDHCYLARATDGLLDVIHAS  214

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT+HDKVML GHND    D+ MKVTV +NHFG  L++RMPRVR GYAHVAN
Sbjct  215   TAVTISNNYFTEHDKVMLLGHNDEYTADRKMKVTVVYNHFGRELVQRMPRVRHGYAHVAN  274

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVK-KGWSNWKWRSSKDKFL  462
             N Y  WLMYAIGGSA+PTIFSEGNYF+AP+K+ +K+VTKRE + KGW +WKWRSS D F+
Sbjct  275   NYYDQWLMYAIGGSADPTIFSEGNYFIAPDKAYNKEVTKRETEDKGWKSWKWRSSNDMFM  334

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYF+PSGYGS AP YT+ QSF VA G+  P+LT++AGPL+C
Sbjct  335   NGAYFLPSGYGSIAPKYTRGQSFIVAHGAFTPSLTSNAGPLQC  377



>ref|XP_009148627.1| PREDICTED: putative pectate lyase 2 [Brassica rapa]
Length=385

 Score =   522 bits (1344),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 307/388 (79%), Gaps = 12/388 (3%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAA-------ADKATSMNVIDSCWRAKSNWASNRRALAD  1290
             MA+ ++ +  L   + + P + AA             +N IDSCWR   NWASNRRALAD
Sbjct  1     MASLLLTVSLLFAALSY-PLVEAAYYSNSYYTTPKPLLNPIDSCWRRNPNWASNRRALAD  59

Query  1289  CGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNE  1110
             C VGFGK A+GGKYG+ YVVT+PSDNP NP+PGTLR+  IQS PLWI FA+DMVI L+NE
Sbjct  60    CAVGFGKAAIGGKYGSVYVVTNPSDNPENPRPGTLRHAVIQSKPLWITFARDMVIVLQNE  119

Query  1109  LMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRR  930
             L++NS+KTIDGRGA VEIA G CIT+Q V +IIIHGIS+HDCKPGKSG VR +PTH G R
Sbjct  120   LIMNSYKTIDGRGAKVEIAYGACITVQHVNHIIIHGISIHDCKPGKSGRVRSSPTHIGSR  179

Query  929   RGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHND  750
             +GSDGDAI+IF +S+IWIDHC+ +R  DGLIDV+H STA+TISNNYFTQHDKVML GHND
Sbjct  180   KGSDGDAIAIFDSSHIWIDHCFFSRCQDGLIDVLHASTAVTISNNYFTQHDKVMLLGHND  239

Query  749   NNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEG  570
             NNVED+ M+VT+AFNHFGPGLIERMPRVRLGYAHVANNRY  W MYAIGGSANPTIFSEG
Sbjct  240   NNVEDRIMRVTIAFNHFGPGLIERMPRVRLGYAHVANNRYEKWQMYAIGGSANPTIFSEG  299

Query  569   NYFMAPNKSESKQVTKREVKKGWSN--WKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQS  396
             NYF+A +    KQVTKR ++ G+ +  WKWR+SKD F NGAYFV SGYG+  P Y +++ 
Sbjct  300   NYFVASDDLSKKQVTKR-IESGYDSKRWKWRTSKDVFKNGAYFVQSGYGTVTPLYGRAEW  358

Query  395   FPVADGSRVPALTADAGPLRCSYSSSKC  312
             FPV+ GS VP+LT+ AGPLRC YS   C
Sbjct  359   FPVSHGSLVPSLTSSAGPLRC-YSGRTC  385



>ref|XP_006377128.1| hypothetical protein POPTR_0011s002501g, partial [Populus trichocarpa]
 gb|ERP54925.1| hypothetical protein POPTR_0011s002501g, partial [Populus trichocarpa]
Length=329

 Score =   518 bits (1333),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 250/343 (73%), Positives = 279/343 (81%), Gaps = 21/343 (6%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             ++N IDSCWRA+SNWA+NRRALADC VGFG+ A+GGKYG  YVVT P+D+P NPKPG LR
Sbjct  2     TLNTIDSCWRAQSNWANNRRALADCAVGFGRGAMGGKYGAIYVVTTPNDDPVNPKPGMLR  61

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YGAIQS PLWI+FAKDMVITL+NEL++NS+KTIDGRGA VEIA GPCITIQGV+++IIHG
Sbjct  62    YGAIQSKPLWIVFAKDMVITLRNELIMNSYKTIDGRGAKVEIAYGPCITIQGVSHVIIHG  121

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGKSG V  TPTH G+R GSDGDAI+IF++SN+WIDHCYLAR  DGLID    
Sbjct  122   ISIHDCKPGKSGRVISTPTHVGKRGGSDGDAIAIFASSNVWIDHCYLARCTDGLID----  177

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
                             VML GHND    DK MKVT+AFN FG GLIERMPRVR GYAHVA
Sbjct  178   ----------------VMLLGHNDGYTADKVMKVTIAFNRFGSGLIERMPRVRFGYAHVA  221

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  W MYAIGGSANPTIFSEGNYF+A N   SKQVTKRE K GW+NWKWRSSKD F+
Sbjct  222   NNRYDEWQMYAIGGSANPTIFSEGNYFLARN-GNSKQVTKREAKNGWTNWKWRSSKDVFM  280

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFV SGYGSCAP Y+K+QSF VA GS VPALT+ AGPL C
Sbjct  281   NGAYFVQSGYGSCAPLYSKTQSFTVAPGSLVPALTSGAGPLNC  323



>ref|XP_004486178.1| PREDICTED: probable pectate lyase 16-like [Cicer arietinum]
Length=334

 Score =   516 bits (1328),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 237/343 (69%), Positives = 278/343 (81%), Gaps = 14/343 (4%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR K+NWASNR++LADC +GFGKDA+GGKYG+ Y VTDPSD+P +PK GTLRY
Sbjct  1     MNTIDSCWRKKTNWASNRQSLADCAIGFGKDAIGGKYGDIYEVTDPSDDPISPKQGTLRY  60

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI FA DMVI LKNEL+VNS+KTIDGRGA VEI NGPCITIQGV+++I+HGI
Sbjct  61    GVIQTEPLWITFANDMVIKLKNELIVNSYKTIDGRGAKVEIGNGPCITIQGVSHVIVHGI  120

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPG +G              SDGDAI++F++SN+WIDHC+LA  ADGL+DV H S
Sbjct  121   SVHDCKPGMAG--------------SDGDAITVFASSNVWIDHCFLATCADGLVDVTHAS  166

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+T+SNNYFT+HDKVML GHND+   D+ MKVTV +N F  GLIERMPRVR GYAHV N
Sbjct  167   TAVTVSNNYFTRHDKVMLLGHNDDYSADRIMKVTVVYNRFATGLIERMPRVRYGYAHVVN  226

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             NRY  WLMYAIGGSA+PTIFS+GNYF+A   S++KQVTKRE    W+NWKWRS  D+FLN
Sbjct  227   NRYDEWLMYAIGGSADPTIFSQGNYFLASKNSDAKQVTKRETDGKWNNWKWRSYGDEFLN  286

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             GAYFVPSGYGSCAP Y+ +Q+F  A  S VP LT +AGPL CS
Sbjct  287   GAYFVPSGYGSCAPLYSSAQNFDAAQASMVPLLTLNAGPLDCS  329



>ref|XP_004134978.1| PREDICTED: LOW QUALITY PROTEIN: putative pectate lyase 2-like 
[Cucumis sativus]
Length=368

 Score =   512 bits (1319),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 240/344 (70%), Positives = 282/344 (82%), Gaps = 13/344 (4%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             S+N ID+CWR   NWA+NRRALADC VGFG DA+GGK+G+ YVVTDPSD+P  P+PGTLR
Sbjct  31    SLNPIDACWRNNRNWAANRRALADCAVGFGSDALGGKFGSIYVVTDPSDDPEYPEPGTLR  90

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             +G IQ  PLWI+FA+DMVITLK ELMVNS+KTIDGRGA VEI+NGPCITIQ V+++IIHG
Sbjct  91    FGVIQMQPLWIVFARDMVITLKRELMVNSYKTIDGRGANVEISNGPCITIQNVSHVIIHG  150

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPGK G VR + TH G R+ SDGDAISIFS+S+IWIDHCYL             
Sbjct  151   ISIHDCKPGKPGRVRSSVTHCGDRQQSDGDAISIFSSSHIWIDHCYLX------------  198

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             STA+TISNNYF+QHDKV+L GHND   +D+ M+VTVAFN FG GL++RMPRVR GYAHVA
Sbjct  199   STAVTISNNYFSQHDKVILLGHNDEFRDDRIMRVTVAFNRFGAGLVQRMPRVRFGYAHVA  258

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV-KKGWSNWKWRSSKDKF  465
             NN Y  W MYA+GGSA+PTIFS+GNYFMAPN   SKQVTKREV + GW +WKWRSS D F
Sbjct  259   NNWYNKWEMYAMGGSADPTIFSQGNYFMAPNDPFSKQVTKREVYESGWKSWKWRSSNDVF  318

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             +NGAYF+P+G+GSC P+YT++Q+FPVA GS  P LT  AGPLRC
Sbjct  319   MNGAYFIPTGWGSCTPFYTQAQAFPVAHGSLAPLLTIAAGPLRC  362



>emb|CBI23207.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   509 bits (1310),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 239/317 (75%), Positives = 268/317 (85%), Gaps = 1/317 (0%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             MN IDSCWR K+NWASNRRALADC VGFGK A+GGKYG  YVVT PSD+P NPKPGTLRY
Sbjct  1     MNPIDSCWRRKANWASNRRALADCAVGFGKGAMGGKYGAMYVVTTPSDDPVNPKPGTLRY  60

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ+ PLWI+FAKDMVITLKNEL++NS KTIDGRGA VEIA GPCITIQGV+++IIHGI
Sbjct  61    GVIQTKPLWIVFAKDMVITLKNELIMNSFKTIDGRGAKVEIAYGPCITIQGVSHVIIHGI  120

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGKSG VR T  H G R GSDGDAISIF++S++WIDHCYLA   DGLIDVIH S
Sbjct  121   SIHDCKPGKSGLVRSTTMHVGHRLGSDGDAISIFTSSHVWIDHCYLASCTDGLIDVIHAS  180

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYF+ HDKVMLFGH+D+   DK M VTVAFNHFG GL++RMPRVR GYAH+AN
Sbjct  181   TAITISNNYFSHHDKVMLFGHDDHFTADKVMSVTVAFNHFGTGLVQRMPRVRFGYAHLAN  240

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             N+Y  W MYAIGGSANPTI SEGN+F AP+ + +K+VTKREVK GW NWKWRSSKDKF+N
Sbjct  241   NKYDEWEMYAIGGSANPTILSEGNHFTAPDNANTKEVTKREVKSGWKNWKWRSSKDKFVN  300

Query  458   GAYFVPSGYGSCAPYYT  408
             GAYFV    G   P +T
Sbjct  301   GAYFVHLD-GEAVPRFT  316



>ref|XP_007153980.1| hypothetical protein PHAVU_003G081000g [Phaseolus vulgaris]
 gb|ESW25974.1| hypothetical protein PHAVU_003G081000g [Phaseolus vulgaris]
Length=396

 Score =   509 bits (1312),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 247/347 (71%), Positives = 283/347 (82%), Gaps = 0/347 (0%)
 Frame = -3

Query  1370  KATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPG  1191
             K   +NVIDSCWRAK NW+S+R+ALADC +GFGK+A GGK+G  Y V+DPSD+P NPKPG
Sbjct  45    KKPLLNVIDSCWRAKQNWSSSRQALADCAIGFGKEATGGKHGAIYQVSDPSDDPVNPKPG  104

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLRYGAIQ+ PLWI+F KDMVITLKNEL +NS+KTIDGRGA VEIA+GPCIT+Q V +II
Sbjct  105   TLRYGAIQNEPLWIIFDKDMVITLKNELFMNSYKTIDGRGAKVEIADGPCITLQSVRHII  164

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             IHGIS+HDCKP K G VR TP H G R GSDGDAISIF ++NIWIDHC+LA + DGLIDV
Sbjct  165   IHGISIHDCKPAKPGLVRSTPDHVGHRLGSDGDAISIFHSTNIWIDHCFLACSTDGLIDV  224

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             I  STAITISNNYFTQHDKVML GH+D   +DK MKVT+AFN F  GL ERMPRVR GYA
Sbjct  225   IRASTAITISNNYFTQHDKVMLLGHSDQFTKDKIMKVTIAFNQFASGLTERMPRVRFGYA  284

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKD  471
             HV NN+Y  W MYAIGGSANPTI SEGN ++APN   +KQVTKRE K+ W +WKWRSSKD
Sbjct  285   HVVNNKYDEWKMYAIGGSANPTILSEGNVYVAPNDPNAKQVTKREGKENWKSWKWRSSKD  344

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
              FLN AYFVPSG+GSCAP Y+ +QSF  A    VPA+T +AGP  C+
Sbjct  345   LFLNDAYFVPSGFGSCAPNYSPTQSFAAAPAYMVPAITLNAGPTDCT  391



>ref|XP_006389576.1| hypothetical protein POPTR_0021s00260g [Populus trichocarpa]
 gb|ERP48490.1| hypothetical protein POPTR_0021s00260g [Populus trichocarpa]
Length=370

 Score =   507 bits (1305),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 247/343 (72%), Positives = 277/343 (81%), Gaps = 23/343 (7%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             ++N IDSCWRA+SNWA+NRRALADC VGFG+ A+GGKYG  YVVT P+D+P NPKPG LR
Sbjct  45    TLNTIDSCWRAQSNWANNRRALADCAVGFGRGAMGGKYGAIYVVTTPNDDPVNPKPGMLR  104

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YGAIQS PLWI+FAKDMVITL+NEL++NS+KTIDGRGA VEIA GPCITIQGV+++IIHG
Sbjct  105   YGAIQSKPLWIVFAKDMVITLRNELIMNSYKTIDGRGAKVEIAYGPCITIQGVSHVIIHG  164

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             I            +  TPTH G+R GSDGDAI+IF++SN+WIDHCYLAR  DGLIDVIH 
Sbjct  165   I------------IISTPTHVGKRGGSDGDAIAIFASSNVWIDHCYLARCTDGLIDVIHA  212

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             ST+ITI          VML GHND    DK MKVT+AFN FG GLIERMPRVR GYAHVA
Sbjct  213   STSITI----------VMLLGHNDGYTADKVMKVTIAFNRFGSGLIERMPRVRFGYAHVA  262

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFL  462
             NNRY  W MYAIGGSANPTIFSEGNYF+A N   SKQVTKRE K GW+NWKWRSSKD F+
Sbjct  263   NNRYDEWQMYAIGGSANPTIFSEGNYFLARN-GNSKQVTKREAKNGWTNWKWRSSKDVFM  321

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGAYFV SGYGSCAP Y+K+QSF VA GS VPALT+ AGPL C
Sbjct  322   NGAYFVQSGYGSCAPLYSKTQSFTVAPGSLVPALTSGAGPLNC  364



>ref|XP_010533796.1| PREDICTED: putative pectate lyase 2 [Tarenaya hassleriana]
Length=384

 Score =   501 bits (1291),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 285/344 (83%), Gaps = 4/344 (1%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   NWA+NRRALA+C VGFGK AVGGKYG+ Y+VT+PSD+  NPKPGTLRY
Sbjct  38    LNPIDSCWRRNPNWAANRRALANCAVGFGKAAVGGKYGSIYIVTNPSDDAENPKPGTLRY  97

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI+FA+DMVI LKNEL++NS+KTIDGRGA VEIA GPCITIQ V++IIIHGI
Sbjct  98    GVIQDKPLWIVFARDMVIVLKNELIMNSYKTIDGRGAKVEIAYGPCITIQHVSHIIIHGI  157

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCK G SG VR +P+H GRR+GSDGDAI +F ++N+WIDHCYLAR  DGLIDVIH S
Sbjct  158   SIHDCKRGSSGRVRSSPSHVGRRQGSDGDAIVVFDSTNVWIDHCYLARCQDGLIDVIHAS  217

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFTQHDKVM+ GH D   EDK M+VT+AFN+F PGLIERMPRVR GYAHVAN
Sbjct  218   TAITISNNYFTQHDKVMMLGHEDGYTEDKVMRVTIAFNYFAPGLIERMPRVRRGYAHVAN  277

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKGWSNWKWRSSKDKFL  462
             NRY  W MYAIGGSANPTIFSEGNYF+A +K   KQVTKR +   G  +WKWR+SKD F 
Sbjct  278   NRYDKWKMYAIGGSANPTIFSEGNYFVAYSK---KQVTKRLDGGYGSQSWKWRTSKDVFK  334

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             NGAYFV SGYGS +P Y++ + FPVA GS  P LT+ +GPLRCS
Sbjct  335   NGAYFVQSGYGSISPLYSREEWFPVAHGSLAPFLTSSSGPLRCS  378



>emb|CDX98091.1| BnaA06g08420D [Brassica napus]
Length=371

 Score =   494 bits (1271),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 251/388 (65%), Positives = 297/388 (77%), Gaps = 26/388 (7%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAA-------ADKATSMNVIDSCWRAKSNWASNRRALAD  1290
             MA+ ++ +  L   + + P + AA             +N IDSCWR   NWASNRRALAD
Sbjct  1     MASLLLTVSLLFAALSY-PLVEAAYYSNSYYTTPKPLLNPIDSCWRRNPNWASNRRALAD  59

Query  1289  CGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNE  1110
             C VGFGK A+GGKYG+ YVVT+PSDNP NP+PGTLR+  IQS PLWI FA+DMVI L+NE
Sbjct  60    CAVGFGKAAIGGKYGSVYVVTNPSDNPENPRPGTLRHAVIQSKPLWITFARDMVIVLQNE  119

Query  1109  LMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRR  930
             L++NS+KTIDGRGA VEIA G CIT+Q V +IIIHGIS+HDCKPGK              
Sbjct  120   LIMNSYKTIDGRGAKVEIAYGACITVQHVNHIIIHGISIHDCKPGK--------------  165

Query  929   RGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHND  750
             +GSDGDAI+IF +S+IWIDHC+ +R  DGLIDV+H STA+TISNNYFTQHDKVML GHND
Sbjct  166   KGSDGDAIAIFDSSHIWIDHCFFSRCQDGLIDVLHASTAVTISNNYFTQHDKVMLLGHND  225

Query  749   NNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEG  570
             NNVED+ M+VT+AFNHFGPGLIERMPRVRLGYAHVANNRY  W MYAIGGSANPTIFSEG
Sbjct  226   NNVEDRIMRVTIAFNHFGPGLIERMPRVRLGYAHVANNRYEKWQMYAIGGSANPTIFSEG  285

Query  569   NYFMAPNKSESKQVTKREVKKGWSN--WKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQS  396
             NYF+A +    KQVTKR ++ G+ +  WKWR+SKD F NGAYFV SGYG+  P Y +++ 
Sbjct  286   NYFVASDDPSKKQVTKR-IESGYDSKRWKWRTSKDVFKNGAYFVQSGYGTVTPLYGRAEW  344

Query  395   FPVADGSRVPALTADAGPLRCSYSSSKC  312
             FPV+ GS VP+LT+ AGPLRC YS   C
Sbjct  345   FPVSHGSLVPSLTSSAGPLRC-YSGRTC  371



>ref|XP_009148628.1| PREDICTED: putative pectate lyase 2 [Brassica rapa]
Length=370

 Score =   494 bits (1271),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 242/377 (64%), Positives = 283/377 (75%), Gaps = 8/377 (2%)
 Frame = -3

Query  1442  AAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDA  1263
             A+  +I+ LL  + F P +        S N IDSCWR   NW SNR  LA C VGFGK A
Sbjct  2     ASFFLIVSLLFALFFSPLVE-------SQNPIDSCWRTNPNWESNRPDLAGCAVGFGKYA  54

Query  1262  VGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTI  1083
              GGK G+ YVVT   D+P NP PGTLR+  IQ+ PLWI F +DM I LKNEL++NS+KTI
Sbjct  55    SGGKDGSIYVVTSSEDDPENPIPGTLRHAVIQTEPLWITFERDMGIVLKNELIMNSNKTI  114

Query  1082  DGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAIS  903
             DGRGA VEIA+GPCITIQ V+++IIHGIS+H CKPGKSG VR TPTH GRR GSDGDAIS
Sbjct  115   DGRGAKVEIAHGPCITIQHVSHVIIHGISIHHCKPGKSGLVRSTPTHIGRRGGSDGDAIS  174

Query  902   IFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMK  723
             +F++SN+WIDHCY +++ DGLIDV+ GSTA+TISN+YFTQHDKVML G++DN V D+ MK
Sbjct  175   VFNSSNVWIDHCYFSQSEDGLIDVVLGSTAVTISNSYFTQHDKVMLLGNHDNIVVDENMK  234

Query  722   VTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKS  543
             VT+AFNHFGPGLIER+PRVR G+AHVANNRY  WL YA+GGSA+PTIFSEGNYF+AP+  
Sbjct  235   VTIAFNHFGPGLIERIPRVRRGFAHVANNRYNKWLKYALGGSADPTIFSEGNYFLAPDDP  294

Query  542   ESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPA  363
               KQVTKR       +WKW SSKD FLNGAYF PS  G     Y   + FPV DGS VP 
Sbjct  295   SKKQVTKRLESGNDRSWKWISSKDVFLNGAYFEPSINGKVTQVYEGEEEFPVYDGSLVPN  354

Query  362   LTADAGPLRCSYSSSKC  312
             LT+ AGPL C YS   C
Sbjct  355   LTSAAGPLSC-YSGRIC  370



>emb|CDY30041.1| BnaC05g09790D [Brassica napus]
Length=371

 Score =   492 bits (1267),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/351 (69%), Positives = 284/351 (81%), Gaps = 18/351 (5%)
 Frame = -3

Query  1358  MNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRY  1179
             +N IDSCWR   NWASNRRALADC VGFGK A+GGKYG+ YVVT+PSDNP NP+PGTLR+
Sbjct  37    LNPIDSCWRRNPNWASNRRALADCAVGFGKAAIGGKYGSVYVVTNPSDNPENPRPGTLRH  96

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQS PLWI FA+DMVI L+NEL++NS+KTIDGRGA VEIA G CIT+Q + +IIIHGI
Sbjct  97    AVIQSKPLWITFARDMVIVLQNELIMNSYKTIDGRGAKVEIAYGACITVQHLNHIIIHGI  156

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCKPGK              +GSDGDAI+IF +S+IWIDHC+ +R  DGLIDV+H S
Sbjct  157   SIHDCKPGK--------------KGSDGDAIAIFDSSHIWIDHCFFSRCQDGLIDVLHAS  202

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFTQHDKVML GHNDNNVED+ M+VT+AFNHFGPGLIERMPRVRLGYAH+AN
Sbjct  203   TAVTISNNYFTQHDKVMLLGHNDNNVEDRIMRVTIAFNHFGPGLIERMPRVRLGYAHIAN  262

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSN--WKWRSSKDKF  465
             NRY  W MYAIGGSANPTIFSEGNYF+A +    KQVTKR ++ G+ +  WKWR+SKD F
Sbjct  263   NRYEKWQMYAIGGSANPTIFSEGNYFVASDDPSKKQVTKR-IESGYDSKRWKWRTSKDVF  321

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
              NGAYFV SGYG+  P Y +++ FPV+ GS VP+LT+ AGPLRC YS   C
Sbjct  322   KNGAYFVQSGYGTVTPLYGRAEWFPVSHGSLVPSLTSSAGPLRC-YSGRTC  371



>emb|CDY30040.1| BnaC05g09800D [Brassica napus]
Length=356

 Score =   471 bits (1211),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 234/377 (62%), Positives = 272/377 (72%), Gaps = 22/377 (6%)
 Frame = -3

Query  1442  AAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDA  1263
             A+  +I+ LL  + F P +        S N IDSCWR   NW SNR ALA C VGFGK A
Sbjct  2     ASFFLIVSLLFALFFSPLVE-------SQNPIDSCWRTNPNWESNRPALAGCAVGFGKYA  54

Query  1262  VGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTI  1083
              GGK G+ YVVT   D+P +P PGTLR+  IQ+ PLWI F  DM I LKNEL++NS+KTI
Sbjct  55    AGGKDGSIYVVTSSEDDPESPSPGTLRHAVIQTEPLWITFEHDMGIVLKNELIMNSNKTI  114

Query  1082  DGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAIS  903
             DGRGA VEIANGPCITIQ V+++IIHGIS+H CKPGKSG              SDGDAIS
Sbjct  115   DGRGAKVEIANGPCITIQHVSHVIIHGISIHHCKPGKSG--------------SDGDAIS  160

Query  902   IFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMK  723
             +F++SN+WIDHCY +++ DGLIDV+ GSTA+TISN+YFTQHDKVML GHNDN V D+ MK
Sbjct  161   VFNSSNVWIDHCYFSQSEDGLIDVVLGSTAVTISNSYFTQHDKVMLLGHNDNIVVDENMK  220

Query  722   VTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKS  543
             VT+AFNHFGPGLIER+PRVR G+AHVANNRY  WL YA+GGSA+PTIFSEGNYF+AP+  
Sbjct  221   VTIAFNHFGPGLIERIPRVRRGFAHVANNRYNKWLKYALGGSADPTIFSEGNYFLAPDDP  280

Query  542   ESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPA  363
               KQVTKR       +WKW SSKD FLNGAYF PS  G     Y   + F V DGS VP 
Sbjct  281   SKKQVTKRLESGNDRSWKWISSKDVFLNGAYFEPSSNGKVTQVYEGEEEFSVYDGSLVPN  340

Query  362   LTADAGPLRCSYSSSKC  312
             LT+ AGPL C YS   C
Sbjct  341   LTSSAGPLSC-YSGRIC  356



>ref|XP_008776910.1| PREDICTED: putative pectate lyase 2 isoform X1 [Phoenix dactylifera]
Length=389

 Score =   470 bits (1209),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 229/383 (60%), Positives = 274/383 (72%), Gaps = 12/383 (3%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADKATS-----------MNVIDSCWRAKSNWASNRR  1302
             MA    +   L      VP  +AA+   T+            N ID+CWR+   WASNR+
Sbjct  1     MALLYTLASYLFFCSALVPLFSAASHTTTTGHSPPHLSKKNKNQIDACWRSNPGWASNRK  60

Query  1301  ALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVIT  1122
              LADC VGFGK A+GGK G  Y VTDPSD+  NPKPGTLRYGAI + PLWI+F KDMVI 
Sbjct  61    RLADCAVGFGKGALGGKNGAIYTVTDPSDDAENPKPGTLRYGAILTKPLWIVFKKDMVIK  120

Query  1121  LKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTH  942
             L+NEL +NS KTIDGRGA V IA GPCI I    ++IIHG+ +H C  GK G VR +PTH
Sbjct  121   LENELFMNSFKTIDGRGAKVAIAKGPCIRIHEANHVIIHGLRIHHCTRGKPGMVRRSPTH  180

Query  941   AGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLF  762
                R G DGDAI+IF++S++WIDHC L+ + DGLIDV+HGSTA+TISNN+F+ H+KV+L 
Sbjct  181   VEHRGGQDGDAITIFASSHVWIDHCKLSHSTDGLIDVVHGSTAVTISNNFFSDHNKVLLL  240

Query  761   GHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTI  582
             GH D    DK MKVTV FN FGP L++RMPRVR GYAH+ANNRY GW +YA+GGS+NPTI
Sbjct  241   GHQDGFDADKVMKVTVVFNRFGPHLVQRMPRVRTGYAHIANNRYDGWGIYAVGGSSNPTI  300

Query  581   FSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKS  402
              SEGNY+ AP+  + K+VT+R VK G   W WRSSKD FLNGAYFV SG GS AP Y+ S
Sbjct  301   LSEGNYYRAPDNPKLKEVTRR-VKGGSKKWNWRSSKDYFLNGAYFVQSGSGSSAPGYSPS  359

Query  401   QSFPVADGSRVPALTADAGPLRC  333
             Q F VA GS VP+LTAD+G L C
Sbjct  360   QKFKVAKGSTVPSLTADSGTLSC  382



>ref|XP_010478421.1| PREDICTED: probable pectate lyase 4 [Camelina sativa]
Length=371

 Score =   468 bits (1205),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 232/381 (61%), Positives = 281/381 (74%), Gaps = 23/381 (6%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADKA-------TSMNVIDSCWRAKSNWASNRRALAD  1290
             M + VI I  L  I    P + +A + +        S+N ID+CWR    WA++R+ALA+
Sbjct  1     MDSLVITISLLFAIFA-SPLVESAYNHSNGYTLAKVSLNPIDACWRRNPKWATSRQALAN  59

Query  1289  CGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNE  1110
             C VG+GK A+GGK G  YVVTDPSD+P  PKPGTLRYGA+Q  PLWI FA+DMVI LK+E
Sbjct  60    CAVGYGKAALGGKNGPIYVVTDPSDDPVKPKPGTLRYGAVQPKPLWITFARDMVIVLKSE  119

Query  1109  LMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRR  930
             L VNS+KTIDGRGA VEI NGPC+ ++ V ++IIHGIS+HDCKPG              +
Sbjct  120   LYVNSYKTIDGRGAKVEIGNGPCLRMKLVKHVIIHGISIHDCKPGP-------------K  166

Query  929   RGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHND  750
                DGD I +F +S+IWIDHC+L+R+ DGLIDVI  STA+TISNNYFTQHDKVML GH+D
Sbjct  167   EKLDGDGIRVFQSSHIWIDHCFLSRSQDGLIDVIFLSTAVTISNNYFTQHDKVMLLGHDD  226

Query  749   NNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEG  570
               + DK M+VT+AFN+FGPGLIERMPRVR GYAHVANNRY  W MYAIGGSA+P I+SEG
Sbjct  227   KFMGDKIMRVTIAFNYFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSADPIIYSEG  286

Query  569   NYFMAPNKSESKQVTKREVKKGWS-NWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSF  393
             NYF+AP+K  SKQVTKR      S  WKW +SKD F+NGA+FVPSG G+  P Y   ++F
Sbjct  287   NYFVAPDKRSSKQVTKRMTTGADSKKWKWSTSKDVFMNGAFFVPSG-GAVKPLYKGGEAF  345

Query  392   PVADGSRVPALTADAGPLRCS  330
             PVA GS VP+LT+ AGPLRCS
Sbjct  346   PVAHGSLVPSLTSSAGPLRCS  366



>ref|XP_010499566.1| PREDICTED: probable pectate lyase 4 [Camelina sativa]
Length=371

 Score =   466 bits (1198),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 282/384 (73%), Gaps = 23/384 (6%)
 Frame = -3

Query  1439  AVIIIMPLLGIMGFVPTLNAAADKA-------TSMNVIDSCWRAKSNWASNRRALADCGV  1281
             +++I + LL  +   P + +A +++        S+N ID+CWR    WA++R+ALA C V
Sbjct  3     SIVITISLLFAIFASPLVESAYNRSNGYTLAKISLNPIDACWRRNPKWATSRQALAHCAV  62

Query  1280  GFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMV  1101
             G+GK A+GGK G  YVVTDPSD+P  PKPGTLRY  +Q  PLWI FA+DMVI LK+EL V
Sbjct  63    GYGKAALGGKNGPIYVVTDPSDDPVKPKPGTLRYAVVQPKPLWITFARDMVIVLKSELYV  122

Query  1100  NSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGS  921
             NS+KTIDGRGA VEI NGPCI ++ V ++IIHGIS+HDCKPG              +   
Sbjct  123   NSYKTIDGRGAKVEIGNGPCIRMKLVKHVIIHGISIHDCKPGP-------------KEKL  169

Query  920   DGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNV  741
             DGD I +F +S+IWIDHC+L+R+ DGLIDVI  STA+TISNNYFTQHDKVML GH+D  +
Sbjct  170   DGDGIRVFQSSHIWIDHCFLSRSQDGLIDVIFLSTAVTISNNYFTQHDKVMLLGHDDKFM  229

Query  740   EDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYF  561
              DK M+VT+AFN+FGPGLIERMPRVR GYAHVANNRY  W MYAIGGSA+P I+SEGNYF
Sbjct  230   GDKIMRVTIAFNYFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSADPIIYSEGNYF  289

Query  560   MAPNKSESKQVTKREVKKGWS-NWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVA  384
             +AP+K  SKQVTKR      S  WKW ++KD F+NGA+FVPSG G+  P Y   ++FPVA
Sbjct  290   VAPDKRSSKQVTKRMTTAADSKKWKWSTTKDVFMNGAFFVPSG-GAVKPLYKGGEAFPVA  348

Query  383   DGSRVPALTADAGPLRCSYSSSKC  312
              GS VP+LT+ AGPLRC Y+   C
Sbjct  349   HGSLVPSLTSSAGPLRC-YAGRIC  371



>ref|XP_002893613.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69872.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=368

 Score =   465 bits (1197),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 225/352 (64%), Positives = 268/352 (76%), Gaps = 17/352 (5%)
 Frame = -3

Query  1364  TSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTL  1185
              S+NVID+CWR   NWA+NR+ALA C VG+GK AVGGK+G  YVVT+PSDNP +P PGTL
Sbjct  33    VSLNVIDACWRRNPNWATNRQALAHCAVGYGKAAVGGKHGPIYVVTNPSDNPTSPSPGTL  92

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             R+   Q  PLWI FA+DMVI LK+ELMVNS+KTIDGRGA VEIANGPC+ I+ V+++IIH
Sbjct  93    RFAVTQPKPLWITFARDMVIVLKSELMVNSYKTIDGRGAKVEIANGPCLRIKQVSHVIIH  152

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GIS+HDCKPG               +G DGD I +F ++++WIDHC+ +R  DGLIDVI 
Sbjct  153   GISIHDCKPGS--------------KGWDGDGIRVFQSTHVWIDHCFFSRCQDGLIDVIL  198

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
              STAITISNNYFTQHDKV+L GH+DN + DK M+VT+AFN FGPGLIERMPRVR GYAHV
Sbjct  199   SSTAITISNNYFTQHDKVILLGHDDNYMGDKIMRVTIAFNTFGPGLIERMPRVRRGYAHV  258

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE-VKKGWSNWKWRSSKDK  468
             ANNRY  W MYAIGGSANP IFSEGNYF+AP+K+ +KQVTKR         WKW ++KD 
Sbjct  259   ANNRYEKWQMYAIGGSANPIIFSEGNYFVAPDKASNKQVTKRMGAGPDSKRWKWGTAKDV  318

Query  467   FLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             F+NGA+FVPSG G   P Y   + F VA GS VP+LT+ AGPLRC Y+   C
Sbjct  319   FMNGAFFVPSG-GIVRPLYKAGEGFQVAHGSLVPSLTSSAGPLRC-YAGRIC  368



>ref|XP_010460825.1| PREDICTED: probable pectate lyase 4 [Camelina sativa]
Length=371

 Score =   464 bits (1195),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/387 (60%), Positives = 280/387 (72%), Gaps = 24/387 (6%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADKA-------TSMNVIDSCWRAKSNWASNRRALAD  1290
             M + VI I  L  I    P + +A + +        S+N ID+CWR    WA++R+ALA 
Sbjct  1     MDSLVITISLLFAIFA-SPLVESAYNHSNGYTLAKVSLNPIDACWRRNPKWATSRQALAH  59

Query  1289  CGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNE  1110
             C VG+GK A+GGK G  YVVTDPSD+P  PKPGTLRY  +Q  PLWI FA+DMVI LK+E
Sbjct  60    CAVGYGKAALGGKNGPIYVVTDPSDDPVKPKPGTLRYAVVQPKPLWITFARDMVIVLKSE  119

Query  1109  LMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRR  930
             L VNS+KTIDGRGA VEI NGPCI ++ V ++IIHGIS+HDCKPG              +
Sbjct  120   LYVNSYKTIDGRGAKVEIGNGPCIRMKLVKHVIIHGISIHDCKPGP-------------K  166

Query  929   RGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHND  750
                DGD I +F +S+IWIDHC+L+R+ DGLIDVI  STA+TISNNYFTQHDKVML GH+D
Sbjct  167   EKLDGDGIRVFQSSHIWIDHCFLSRSQDGLIDVIFLSTAVTISNNYFTQHDKVMLLGHDD  226

Query  749   NNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEG  570
               + DK M+VT+AFN+FGPGLIERMPRVR GYAHVANNRY  W MYAIGGSA+P I+SEG
Sbjct  227   KFMGDKIMRVTIAFNYFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSADPIIYSEG  286

Query  569   NYFMAPNKSESKQVTKREVKKGWS-NWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSF  393
             NYF+AP+K  SKQVTKR      S  WKW +SKD F+NGA+FVPSG G+  P Y   ++F
Sbjct  287   NYFVAPDKRSSKQVTKRMTTGADSKKWKWSTSKDVFMNGAFFVPSG-GAVKPLYKGGEAF  345

Query  392   PVADGSRVPALTADAGPLRCSYSSSKC  312
             PVA GS VP+LT+ AGPLRC Y+   C
Sbjct  346   PVAHGSLVPSLTSSAGPLRC-YAGRIC  371



>emb|CDX98092.1| BnaA06g08430D [Brassica napus]
Length=356

 Score =   462 bits (1189),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 230/377 (61%), Positives = 272/377 (72%), Gaps = 22/377 (6%)
 Frame = -3

Query  1442  AAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDA  1263
             A+  + + LL  + F P +        S N IDSCWR   NW SNR  LA C VGFGK A
Sbjct  2     ASFFLTVSLLFALFFSPLVE-------SQNPIDSCWRTNPNWESNRPDLAGCAVGFGKYA  54

Query  1262  VGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTI  1083
              GGK G+ YVVT   D+P NP PGTLR+  IQ+ PLWI F +DM I LKNEL++NS+KTI
Sbjct  55    SGGKDGSIYVVTSSEDDPENPSPGTLRHAVIQTEPLWITFERDMGIVLKNELIMNSNKTI  114

Query  1082  DGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAIS  903
             DGRGA VEIA+GPCITIQ V+++IIHGIS+H CKPGKSG              SDGDAIS
Sbjct  115   DGRGAKVEIAHGPCITIQHVSHVIIHGISIHHCKPGKSG--------------SDGDAIS  160

Query  902   IFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMK  723
             +F++SN+WIDHCY +++ DGLIDV+ GSTA+TISN+YFTQHDKVML G++D+ V D+ MK
Sbjct  161   VFNSSNVWIDHCYFSQSEDGLIDVVLGSTAVTISNSYFTQHDKVMLLGNHDSIVVDENMK  220

Query  722   VTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKS  543
             VT+AFNHFGPGLIER+PRVR G+AHVANNRY  WL YA+GGSA+PTIFSEGNYF+AP+  
Sbjct  221   VTIAFNHFGPGLIERIPRVRRGFAHVANNRYNKWLKYALGGSADPTIFSEGNYFLAPDDP  280

Query  542   ESKQVTKREVKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPA  363
               KQVTKR       +WKW SSKD FLNGAYF PS  G     Y   + FPV DGS VP 
Sbjct  281   SKKQVTKRLESGNDRSWKWISSKDVFLNGAYFEPSINGKVTQVYEGEEEFPVYDGSLVPN  340

Query  362   LTADAGPLRCSYSSSKC  312
             LT+ AGPL C YS   C
Sbjct  341   LTSSAGPLSC-YSGRIC  356



>ref|XP_006285121.1| hypothetical protein CARUB_v10006459mg [Capsella rubella]
 gb|EOA18019.1| hypothetical protein CARUB_v10006459mg [Capsella rubella]
Length=374

 Score =   460 bits (1183),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 223/348 (64%), Positives = 263/348 (76%), Gaps = 22/348 (6%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             ++N ID+CWR    W++NR+ALA C VGFGK A+GGK G  YVVT P D+P  PKPGTLR
Sbjct  38    TLNPIDACWRKNPKWSTNRQALAHCAVGFGKAALGGKAGAIYVVTSPLDDPVKPKPGTLR  97

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             +G IQS PLWI FA+ MVI LK EL VNS+KTIDGRGA VEIANGPC+ ++ V ++IIHG
Sbjct  98    FGVIQSKPLWITFARSMVIVLKVELSVNSYKTIDGRGAKVEIANGPCVRMRLVKHVIIHG  157

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             IS+HDCKPG              + G DGDAI +F +S+IWIDHC+L+R+ DGLIDVI  
Sbjct  158   ISIHDCKPGP-------------KEGPDGDAIRVFQSSHIWIDHCFLSRSQDGLIDVISS  204

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             STA+TISNN FT HDKV+L GH+D    DK MKVTVAFN+FGPGLIERMPRVR GYAHVA
Sbjct  205   STAVTISNNKFTNHDKVILLGHDDKFTGDKVMKVTVAFNYFGPGLIERMPRVRRGYAHVA  264

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-----EVKKGWSNWKWRSS  477
             NNRY  W MYAIGGSA+P IFSEGNYF+AP+   +K+VTKR     E+KK    WKW +S
Sbjct  265   NNRYDKWKMYAIGGSADPIIFSEGNYFVAPDNKNAKEVTKRVGSAAEIKK----WKWGTS  320

Query  476   KDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             KD FLNGA+FVPSG  +  P Y K ++FPVA GS VP+LTA AGPL C
Sbjct  321   KDVFLNGAFFVPSGGPAVKPAYAKGEAFPVAPGSLVPSLTASAGPLNC  368



>emb|CDX82902.1| BnaC01g13520D [Brassica napus]
Length=327

 Score =   451 bits (1159),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 250/315 (79%), Gaps = 6/315 (2%)
 Frame = -3

Query  1454  LAMAAAVIIIMPLL-----GIMGFVPTLNAAADKATS-MNVIDSCWRAKSNWASNRRALA  1293
             L ++  + +   L+     G  G+ P  +   +K  + MN +DSCWR KS+W +NR+ LA
Sbjct  7     LCLSVTLFLCQSLVRAINNGYYGYNPVASYLPEKPQNIMNPVDSCWRLKSDWTANRKDLA  66

Query  1292  DCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKN  1113
             DC VGFG  A+GGK G+ YVVT+P+DN  NP+PG+LRYG IQ  PLWI FAKDMV+TL+N
Sbjct  67    DCAVGFGSSALGGKKGSIYVVTNPNDNAANPQPGSLRYGVIQDKPLWITFAKDMVLTLEN  126

Query  1112  ELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGR  933
             ELMVNS+KTIDGRGA VEIA GPCITIQ VTN+I+HGI +HDCKPGK G VR + TH G 
Sbjct  127   ELMVNSYKTIDGRGAKVEIAYGPCITIQEVTNVIVHGIRIHDCKPGKYGMVRSSTTHVGH  186

Query  932   RRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHN  753
             R+GSDGDAI+I  +SNIWIDHCYLA   DGLIDVIH ST ITISNNYFTQHDKVML GHN
Sbjct  187   RKGSDGDAIAISGSSNIWIDHCYLASCTDGLIDVIHASTGITISNNYFTQHDKVMLLGHN  246

Query  752   DNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSE  573
             D+ V+D  MKVTVAFNHFGPGL+ERMPRVR GYAHVANNRY  W+MYAIGGSA+PTIFSE
Sbjct  247   DDFVQDVKMKVTVAFNHFGPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSADPTIFSE  306

Query  572   GNYFMAPNKSESKQV  528
             GNYF+A + S SK+V
Sbjct  307   GNYFIASDNSNSKEV  321



>ref|NP_174324.1| probable pectate lyase 4 [Arabidopsis thaliana]
 sp|Q9C8G4.1|PLY4_ARATH RecName: Full=Probable pectate lyase 4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51103.1|AC025295_11 pectate lyase, putative [Arabidopsis thaliana]
 gb|ABE65673.1| pectate lyase family protein [Arabidopsis thaliana]
 gb|AEE31208.1| probable pectate lyase 4 [Arabidopsis thaliana]
Length=368

 Score =   447 bits (1151),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 271/378 (72%), Gaps = 22/378 (6%)
 Frame = -3

Query  1448  MAAAVIIIMPLLG-----IMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCG  1284
             MA+ V+I+  LL      ++    + N  A +  S+N ID+CWR    WA+NR+ALA C 
Sbjct  1     MASLVVIVSLLLAAFASPLLETAHSYNVTAPR-VSLNPIDACWRRNPKWATNRQALAHCA  59

Query  1283  VGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELM  1104
             VG+GK A+GGK G  YVVT+PSDNP  P PGTLRY   Q  PLWI FA+DMVI LK++LM
Sbjct  60    VGYGKAAIGGKNGPIYVVTNPSDNPTRPSPGTLRYAVSQPKPLWITFARDMVIVLKSQLM  119

Query  1103  VNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRG  924
             +NS+KTIDGRGA VEIANGPC+ I+ V ++IIHGIS+HDCK   +G              
Sbjct  120   INSYKTIDGRGAKVEIANGPCLRIRQVKHVIIHGISIHDCKADPNGM-------------  166

Query  923   SDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNN  744
              DGD I +F ++++WIDHC+L+R  DGLIDVI  STA+TISNNYFTQHDKVML GH+D+ 
Sbjct  167   -DGDGIRVFQSTHVWIDHCFLSRCHDGLIDVIVSSTAVTISNNYFTQHDKVMLLGHDDSY  225

Query  743   VEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNY  564
             + DK M+VT+AFN FGPGLIERMPRVR GYAHVANNRY  W MYAIGGSANP IFSEGNY
Sbjct  226   MGDKDMRVTIAFNTFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSANPIIFSEGNY  285

Query  563   FMAPNKSESKQVTKREVKKGWSN-WKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPV  387
             F+AP K  SKQVTKR +    S  WKW +S+D F+NGA+F P G     P Y   + F V
Sbjct  286   FVAPEKRSSKQVTKRMMAGPDSKRWKWGTSRDVFMNGAFFGPPGV-IVRPLYKGGEGFRV  344

Query  386   ADGSRVPALTADAGPLRC  333
             A GS VP+LT+ AGPLRC
Sbjct  345   AHGSLVPSLTSSAGPLRC  362



>gb|ABK28424.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   447 bits (1150),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 271/378 (72%), Gaps = 22/378 (6%)
 Frame = -3

Query  1448  MAAAVIIIMPLLG-----IMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCG  1284
             MA+ V+I+  LL      ++    + N  A +  S+N ID+CWR    WA+NR+ALA C 
Sbjct  1     MASLVVIVSLLLAAFASPLLETAHSYNVTAPR-VSLNPIDACWRRNPKWATNRQALAHCA  59

Query  1283  VGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELM  1104
             VG+GK A+GGK G  YVVT+PSDNP  P PGTLRY   Q  PLWI FA+DMVI LK++LM
Sbjct  60    VGYGKAAIGGKNGPIYVVTNPSDNPTRPSPGTLRYAVSQPKPLWITFARDMVIVLKSQLM  119

Query  1103  VNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRG  924
             +NS+KTIDGRGA VEIANGPC+ I+ V ++IIHGIS+HDCK   +G              
Sbjct  120   INSYKTIDGRGAKVEIANGPCLRIRQVKHVIIHGISIHDCKADPNGM-------------  166

Query  923   SDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNN  744
              DGD I +F ++++WIDHC+L+R  DGLIDVI  STA+TISNNYFTQHDKVML GH+D+ 
Sbjct  167   -DGDGIRVFQSTHVWIDHCFLSRCHDGLIDVIVSSTAVTISNNYFTQHDKVMLLGHDDSY  225

Query  743   VEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNY  564
             + DK M+VT+AFN FGPGLIERMPRVR GYAHVANNRY  W MYAIGGSANP IFSEGNY
Sbjct  226   MGDKDMRVTIAFNTFGPGLIERMPRVRRGYAHVANNRYEKWQMYAIGGSANPIIFSEGNY  285

Query  563   FMAPNKSESKQVTKREVKKGWSN-WKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPV  387
             F+AP K  SKQVTKR +    S  WKW +S+D F+NGA+F P G     P Y   + F V
Sbjct  286   FVAPEKRSSKQVTKRMMAGPDSKRWKWGTSRDVFMNGAFFGPPGV-IVRPLYKGGEGFRV  344

Query  386   ADGSRVPALTADAGPLRC  333
             A GS VP+LT+ AGPLRC
Sbjct  345   AHGSLVPSLTSSAGPLRC  362



>gb|KFK43457.1| hypothetical protein AALP_AA1G127700 [Arabis alpina]
Length=370

 Score =   446 bits (1146),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 260/352 (74%), Gaps = 13/352 (4%)
 Frame = -3

Query  1385  NAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG  1206
             N +  +A S+NVID+CWR   NWA+NR+ALA C VGFGK A+GGK G  YVVT P+D+  
Sbjct  27    NGSTLQAASLNVIDACWRRNPNWATNRQALASCAVGFGKAALGGKSGPIYVVTSPADDAK  86

Query  1205  NPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQG  1026
             +PKPGTLR+   Q  PLWI FAKDMVI L+ EL + SHKTIDGRGA VEIANGPC+ +  
Sbjct  87    SPKPGTLRFAVTQPKPLWITFAKDMVIVLQTELQIKSHKTIDGRGAKVEIANGPCVAVYH  146

Query  1025  VTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAAD  846
              TN+IIHGIS+HDCK G+SG            +G +GDAI IF ++++WIDHC L+R  D
Sbjct  147   ATNVIIHGISIHDCKAGRSGG-----------KGWEGDAIRIFQSTHVWIDHCSLSRCND  195

Query  845   GLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRV  666
             GLIDVIH STA+T+SNN  TQH K ML GH+D NV DK MKVTV FN FGPGL  RMPRV
Sbjct  196   GLIDVIHTSTAVTLSNNLLTQHLKAMLLGHSDKNVGDKKMKVTVVFNVFGPGLRGRMPRV  255

Query  665   RLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKW  486
             R GYAHVANNRY  W +YAIGGSANP IFSEGNYF+AP +++ KQVTKR    G ++WKW
Sbjct  256   RHGYAHVANNRYEKWGLYAIGGSANPIIFSEGNYFVAPERADHKQVTKR-FGAGSNSWKW  314

Query  485   RSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
              ++KD F+NGA F P+G  +  P Y   ++F VA GS VP+LT+ AG LRC+
Sbjct  315   GTAKDAFMNGAVFGPAGQ-AVTPMYVGGEAFQVAQGSLVPSLTSSAGALRCT  365



>ref|XP_004489554.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=405

 Score =   445 bits (1144),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 275/388 (71%), Gaps = 12/388 (3%)
 Frame = -3

Query  1469  FISSNLAMAAAVIIIMPLLGIMGFVPTLNAAADK------ATSMNVIDSCWRAKSNWASN  1308
              ++SN   ++AV    P L +     ++N A+ +        + N ID CWR  +NW +N
Sbjct  15    LLTSNFVSSSAVQ--DPELVVQDVQRSINNASRRNLGYLSCGTGNPIDDCWRCDTNWENN  72

Query  1307  RRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRYGAIQSAPLWIMFAKDM  1131
             R+ LADC +GFGKDA+GGK G  Y+VTD SD+ P NPKPGTLRYG+IQ  PLWI+F +DM
Sbjct  73    RQRLADCAIGFGKDAIGGKNGKIYIVTDSSDDDPVNPKPGTLRYGSIQDEPLWIIFKRDM  132

Query  1130  VITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDT  951
             VITLK EL+VNS KTIDGRGA+V IANG CITI  V+NIIIHGI++HDCKP  +  +RD+
Sbjct  133   VITLKQELLVNSFKTIDGRGASVHIANGGCITIHYVSNIIIHGINVHDCKPRGNTNIRDS  192

Query  950   PTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKV  771
             P H G    SDGD ISIF++ +IW+DHC L+   DGLIDVIHGSTAITISNNY T HDKV
Sbjct  193   PEHYGFWTVSDGDGISIFNSKHIWVDHCSLSNCRDGLIDVIHGSTAITISNNYMTHHDKV  252

Query  770   MLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSAN  591
             ML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV NN YT W MYAIGGSAN
Sbjct  253   MLLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAN  312

Query  590   PTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAP  417
             PTI S+GN F+APN   SK+VTK E   +  W+NW WRS  D FLNGA+F  SG G+ + 
Sbjct  313   PTINSQGNRFLAPNNRFSKEVTKYENAPQSEWNNWNWRSEGDLFLNGAFFRQSGAGA-SS  371

Query  416   YYTKSQSFPVADGSRVPALTADAGPLRC  333
              Y ++ S      S V ++T  +G L C
Sbjct  372   IYARASSLSARPSSLVASITTTSGALNC  399



>ref|XP_010100325.1| hypothetical protein L484_027633 [Morus notabilis]
 gb|EXB82459.1| hypothetical protein L484_027633 [Morus notabilis]
Length=406

 Score =   442 bits (1137),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 256/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR  +NW  NR+ LA C +GFGK+AVGG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  59    NPIDDCWRCDANWEKNRQRLAGCAIGFGKNAVGGRDGKIYVVTDAGDHPVNPKPGTLRYG  118

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ  PLWI+F +DMVI LK ELMVNS KTIDGRGA+V IA GPCITIQ VTN+IIHG++
Sbjct  119   VIQEEPLWIIFKRDMVIKLKEELMVNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGLN  178

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P+H G R  SDGD +SIF  S+IW+DHC L+   DGLID IHGST
Sbjct  179   IHDCKQGGNAYVRDSPSHYGWRTLSDGDGVSIFGGSHIWVDHCSLSNCRDGLIDAIHGST  238

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  239   AITISNNYMTHHNKVMLLGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  298

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN  ++K++TK E   +  W  W WRSS D  +
Sbjct  299   DYTHWEMYAIGGSASPTINSQGNRFLAPNNKDNKEITKHEDAAQSEWKKWNWRSSGDLLM  358

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y K+ S      S V  +T+ AG L+C    S+C
Sbjct  359   NGAFFTASGAGA-SSNYAKASSLSARPSSLVSTITSGAGSLKCR-KGSRC  406



>ref|XP_002966799.1| hypothetical protein SELMODRAFT_85792, partial [Selaginella moellendorffii]
 gb|EFJ32826.1| hypothetical protein SELMODRAFT_85792, partial [Selaginella moellendorffii]
Length=350

 Score =   437 bits (1125),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/348 (60%), Positives = 251/348 (72%), Gaps = 3/348 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   +W S+R+ LADC +GFGK+ +GG+ G+ Y VTDPSD+P NP+PG+LRYG
Sbjct  3     NPIDDCWRCDPHWHSHRKRLADCAIGFGKNTIGGRDGDFYTVTDPSDDPVNPRPGSLRYG  62

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+FA+DM I L  EL+VNSHKTIDGRG  V IA G C+T+Q V N+I+HGI 
Sbjct  63    AIQDRPLWIIFARDMTIVLSQELIVNSHKTIDGRGHAVRIAYGGCLTVQYVRNVIVHGIG  122

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +H C+      VR +P H G R  SDGD ISIF + ++WIDHC+LA  ADGLID I GST
Sbjct  123   IHSCRRTGPAMVRSSPGHVGWRTVSDGDGISIFGSRDVWIDHCFLADCADGLIDAIMGST  182

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
              ITISNNYF  H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY H+ NN
Sbjct  183   GITISNNYFRDHNKVMLLGHSDSYTLDKMMQVTIAFNHFGEGLVQRMPRCRYGYFHIVNN  242

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSANPTI S+GN F+AP    SKQVTKRE   ++ W  W WRS  D ++
Sbjct  243   HYTHWRMYAIGGSANPTINSQGNRFVAPADVNSKQVTKREFAGERSWMKWNWRSEGDSYI  302

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             NGAYF PSG GS A  Y K+ S P    + VPA+TA AGPL C +  S
Sbjct  303   NGAYFRPSGAGSAA-VYAKASSLPARPAALVPAMTAFAGPLNCRHHVS  349



>emb|CDY56220.1| BnaAnng14170D [Brassica napus]
Length=406

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTDPSD    NPKPGTLR+
Sbjct  58    NPIDDCWRCDPKWEKNRQRLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRH  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA V IA G CIT+Q VTNIIIHGI
Sbjct  118   AVIQEEPLWIIFARDMVIKLKEELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+  ADGL+DVIHGS
Sbjct  178   SIHDCKKRGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLVDVIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYLTHHDKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W NW WRS  D F
Sbjct  298   NDYTHWKMYAIGGSAAPTINSQGNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLF  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T +AG L C    S+C
Sbjct  358   LNGAFFTPSG-GRASSKYAKASSLSARPSSLVASVTGNAGALSCK-KGSRC  406



>ref|XP_002964286.1| hypothetical protein SELMODRAFT_81909, partial [Selaginella moellendorffii]
 gb|EFJ34619.1| hypothetical protein SELMODRAFT_81909, partial [Selaginella moellendorffii]
Length=350

 Score =   434 bits (1117),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 250/348 (72%), Gaps = 3/348 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   +W S+R+ LADC +GFGK+ +GG+ G+ Y VTD SD+P NP+PG+LRYG
Sbjct  3     NPIDDCWRCDPHWHSHRKRLADCAIGFGKNTIGGRDGDFYTVTDSSDDPVNPRPGSLRYG  62

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+FA+DM I L  EL+VNSHKTIDGRG  V IA G C+T+Q V N+I+HGI 
Sbjct  63    AIQDRPLWIIFARDMTIVLSQELIVNSHKTIDGRGHAVRIAYGGCLTVQYVRNVIVHGIG  122

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +H C+      VR +P H G R  SDGD ISIF + ++WIDHC+LA  ADGLID I GST
Sbjct  123   IHSCRRTGPAMVRSSPGHVGWRTVSDGDGISIFGSRDVWIDHCFLADCADGLIDAIMGST  182

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
              ITISNNYF  H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY H+ NN
Sbjct  183   GITISNNYFRDHNKVMLLGHSDSYTLDKMMQVTIAFNHFGEGLVQRMPRCRYGYFHIVNN  242

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSANPTI S+GN F+AP    SKQVTKRE   ++ W  W WRS  D ++
Sbjct  243   HYTHWRMYAIGGSANPTINSQGNRFVAPADVNSKQVTKREFAGERSWMKWNWRSEGDSYI  302

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             NGAYF PSG GS A  Y K+ S P    + VPA+TA AGPL C +  S
Sbjct  303   NGAYFRPSGAGSAA-VYAKASSLPARPAALVPAMTAFAGPLNCRHHVS  349



>ref|XP_011086701.1| PREDICTED: probable pectate lyase 5 [Sesamum indicum]
Length=401

 Score =   436 bits (1120),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/343 (61%), Positives = 250/343 (73%), Gaps = 3/343 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  D+  NPKPGTLRYG
Sbjct  54    NPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSGDDAVNPKPGTLRYG  113

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ+ PLWI+FA+DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  114   VIQNEPLWIIFARDMVIKLKQELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  173

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGST
Sbjct  174   IHDCKQGGNAYVRDSPEHYGYRTVSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGST  233

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  234   AITISNNYMTHHNKVMLLGHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  293

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA PTI S+GN F+AP++ ++K+VTK E   +  W NW WRS  D  L
Sbjct  294   DYTHWEMYAIGGSAAPTINSQGNRFLAPDRVDNKEVTKHEDAPESQWKNWNWRSEGDLML  353

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGA+F  SG G+ +  Y K+ S      S V ++T  AG L C
Sbjct  354   NGAFFTRSGAGA-SSNYAKASSLSARPSSLVGSMTMGAGSLSC  395



>ref|XP_002982255.1| hypothetical protein SELMODRAFT_421674 [Selaginella moellendorffii]
 gb|EFJ16500.1| hypothetical protein SELMODRAFT_421674 [Selaginella moellendorffii]
Length=420

 Score =   436 bits (1121),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 253/347 (73%), Gaps = 4/347 (1%)
 Frame = -3

Query  1364  TSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGT  1188
             +S N ID CWR  SNW +NR+ LA+C +GFG++A+GGK G  YVVTD SD+ P NPKPGT
Sbjct  69    SSGNPIDDCWRCDSNWHNNRKRLAECAIGFGRNAIGGKNGEIYVVTDSSDDDPVNPKPGT  128

Query  1187  LRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIII  1008
             LRYG IQS PLWI+F +DM I L  EL+VNS+KTIDGRGA VEIA+GPCITIQ V+++I+
Sbjct  129   LRYGVIQSEPLWIIFERDMSIRLSQELIVNSYKTIDGRGANVEIAHGPCITIQYVSHVIV  188

Query  1007  HGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVI  828
             HGI++HDCKPG    VR + TH G R  SDGD ISIF ++NIW+DHC LAR  DGLID I
Sbjct  189   HGIAVHDCKPGGPAMVRSSTTHFGWRTVSDGDGISIFGSNNIWVDHCTLARCTDGLIDAI  248

Query  827   HGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAH  648
               ST ITISNN+F+ HDKVML GHND+   D+AM+VTVA+NHFG GLIERMPR R GY H
Sbjct  249   MASTDITISNNHFSDHDKVMLLGHNDDYTADRAMQVTVAYNHFGQGLIERMPRCRHGYFH  308

Query  647   VANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSK  474
             V NN YT W MYAIGGSANPTI +EGN F A     SK++TKRE  +   W +W WRS  
Sbjct  309   VVNNDYTEWRMYAIGGSANPTINAEGNRFFAGFNENSKEITKREYTEESIWKSWNWRSEG  368

Query  473   DKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             + FLNGAYF+ SG GS    Y K+ S      + V  LT  AG L C
Sbjct  369   NLFLNGAYFITSGAGS-GSVYGKASSLAAKPAAYVGELTLSAGALLC  414



>ref|XP_009586995.1| PREDICTED: probable pectate lyase 5 [Nicotiana tomentosiformis]
Length=404

 Score =   436 bits (1120),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 251/343 (73%), Gaps = 3/343 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  Y+VTD SD+P NPKPGTLRYG
Sbjct  57    NPIDDCWRCDPNWEKNRQRLADCAIGFGKQAIGGRDGKIYIVTDTSDDPVNPKPGTLRYG  116

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  117   AIQDEPLWIIFARDMVIKLKEELILNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  176

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GST
Sbjct  177   IHDCKQGGNAYVRDSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIRGST  236

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  237   AITISNNYMTHHNKVMLLGHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  296

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYA+GGSA+PTI S+GN F+APN   +K+VTK E   +  W NW WRS  D  L
Sbjct  297   DYTHWEMYAVGGSASPTINSQGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLML  356

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGA+F  SG G+ +  Y K+ S      + V ++T +AG L C
Sbjct  357   NGAFFTRSGAGA-SKSYAKASSLSARPSTLVSSITVNAGALGC  398



>gb|EYU30593.1| hypothetical protein MIMGU_mgv1a007569mg [Erythranthe guttata]
Length=403

 Score =   435 bits (1118),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 250/343 (73%), Gaps = 3/343 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   +W  NR+ LADC +GFGK A+GG+ G  Y VTD  D+  NPKPGTLRYG
Sbjct  56    NPIDDCWRCDPDWEKNRKRLADCAIGFGKHAIGGRDGKFYTVTDSGDDAVNPKPGTLRYG  115

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQS PLWI FA+DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTN+I+HG++
Sbjct  116   VIQSEPLWITFARDMVIKLKQELMLNSFKTIDGRGASVHIAGGPCITIQYVTNVIVHGLN  175

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGST
Sbjct  176   IHDCKQGGNAYVRDSPDHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGST  235

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNYFT H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  236   AITISNNYFTHHNKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  295

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+AP+++ +K+VTK E   +  W NW WRS  D  L
Sbjct  296   DYTHWEMYAIGGSASPTINSQGNRFLAPDRANNKEVTKHEDAPQSKWKNWNWRSEGDLLL  355

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGA+F  SG GS +  Y K+ S      S V  +T  AG L C
Sbjct  356   NGAFFTRSGAGS-SSNYAKASSLSARPSSLVGTITVGAGSLGC  397



>ref|XP_009105327.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   435 bits (1118),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTDPSD    NPKPGTLR+
Sbjct  58    NPIDDCWRCDPKWEKNRQRLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRH  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA V IA G CIT+Q VTNIIIHG+
Sbjct  118   AVIQEEPLWIIFARDMVIKLKEELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGV  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+  ADGL+DVIHGS
Sbjct  178   SIHDCKKRGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLVDVIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+   DK M+VT+AFNHF  GL++RMPR R GY HV N
Sbjct  238   TAITISNNYLTHHDKVMLLGHSDSYTRDKNMQVTIAFNHFDEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W NW WRS  D F
Sbjct  298   NDYTHWKMYAIGGSAAPTINSQGNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLF  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T +AG L C    S+C
Sbjct  358   LNGAFFTPSG-GRASSKYAKASSLSARPSSLVASVTGNAGALSCK-KGSRC  406



>ref|XP_008340139.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008361827.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=401

 Score =   434 bits (1117),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 254/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  54    NPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYG  113

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ+ PLWI+F +DM I L  ELM+NS KTIDGRG++V IA GPCITIQ VTNIIIHG++
Sbjct  114   VIQNEPLWIIFQRDMTIKLNEELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLN  173

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGST
Sbjct  174   IHDCKQGGNAYVRDSPEHFGWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGST  233

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             +ITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GLI+RMPR R G  HV NN
Sbjct  234   SITISNNYMTHHNKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLIQRMPRCRHGNFHVVNN  293

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +K WS W WRSS D  L
Sbjct  294   DYTHWEMYAIGGSASPTINSQGNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLL  353

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y+K+ S      S V +LTA AG LRC    S+C
Sbjct  354   NGAFFTASGAGA-STSYSKASSLSARPSSLVSSLTAGAGSLRCK-KGSRC  401



>emb|CDY01846.1| BnaC06g28860D [Brassica napus]
Length=406

 Score =   434 bits (1117),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR    W +NR+ LADC +GFGK A+GG+ G  YVVTDPSD    NPKPGTLR+
Sbjct  58    NPIDDCWRCDPKWENNRQRLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRH  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA   IA G CIT+Q VTNIIIHGI
Sbjct  118   AVIQEEPLWIIFARDMVIKLKEELIMNSFKTIDGRGANAHIAGGACITVQYVTNIIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+   DGL+DVIHGS
Sbjct  178   SIHDCKKRGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCEDGLVDVIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYLTHHDKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W NW WRS  D F
Sbjct  298   NDYTHWGMYAIGGSAAPTINSQGNRFLAPNNKVFKEVTKYEDAPQSKWKNWNWRSEGDLF  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T +AG L C    S+C
Sbjct  358   LNGAFFTPSG-GRASSMYAKASSLSARPSSLVASVTGNAGALSCK-KGSRC  406



>ref|XP_010663062.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI14899.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   433 bits (1113),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 258/353 (73%), Gaps = 5/353 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTL  1185
             S N ID CWR  +NW  NR++LADC +GFGK+A+GGK G  YVVTD SD+   NPKPGTL
Sbjct  53    SGNPIDDCWRCNANWEKNRQSLADCAIGFGKNAIGGKNGKIYVVTDSSDDDVVNPKPGTL  112

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RY  IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIH
Sbjct  113   RYAVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIH  172

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             G+++HDCK G +  VRD+P+H G R  SDGD +SIF  S+IW+DHC L+   DGLID IH
Sbjct  173   GLNIHDCKQGGNTNVRDSPSHYGFRTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIH  232

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV
Sbjct  233   GSTAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHV  292

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSA+PTI S+GN F+APN   SK+VTK E   +  W NW WRS  D
Sbjct  293   VNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFSKEVTKHEDAPESQWKNWNWRSEGD  352

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
               LNGAYF PSG G+ +  Y ++ S      S V ++T  AG L C    S+C
Sbjct  353   LMLNGAYFTPSGAGA-SSSYARASSLGARPSSLVASITGSAGALSCK-KGSRC  403



>emb|CAN76500.1| hypothetical protein VITISV_004734 [Vitis vinifera]
Length=403

 Score =   433 bits (1113),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 258/353 (73%), Gaps = 5/353 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTL  1185
             S N ID CWR  +NW  NR++LADC +GFGK+A+GGK G  YVVTD SD+   NPKPGTL
Sbjct  53    SGNPIDDCWRCNANWEKNRQSLADCAIGFGKNAIGGKNGKIYVVTDSSDDDVVNPKPGTL  112

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RY  IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIH
Sbjct  113   RYAVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIH  172

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             G+++HDCK G +  VRD+P+H G R  SDGD +SIF  S+IW+DHC L+   DGLID IH
Sbjct  173   GLNIHDCKQGGNTNVRDSPSHYGFRTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIH  232

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV
Sbjct  233   GSTAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHV  292

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSA+PTI S+GN F+APN   SK+VTK E   +  W NW WRS  D
Sbjct  293   VNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFSKEVTKHEDAPESQWKNWNWRSEGD  352

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
               LNGAYF PSG G+ +  Y ++ S      S V ++T  AG L C    S+C
Sbjct  353   LMLNGAYFTPSGAGA-SSSYARASSLGARPSSLVASITGSAGALSCK-KGSRC  403



>ref|XP_002966181.1| hypothetical protein SELMODRAFT_407495 [Selaginella moellendorffii]
 gb|EFJ32208.1| hypothetical protein SELMODRAFT_407495 [Selaginella moellendorffii]
Length=420

 Score =   432 bits (1112),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 252/347 (73%), Gaps = 4/347 (1%)
 Frame = -3

Query  1364  TSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGT  1188
             +S N ID CWR   NW +NR+ LA+C +GFG++A+GGK G  YVVTD SD+ P NPKPGT
Sbjct  69    SSGNPIDDCWRCDPNWHNNRKRLAECAIGFGRNAIGGKNGEIYVVTDSSDDDPVNPKPGT  128

Query  1187  LRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIII  1008
             LRYG IQS PLWI+F +DM I L  EL+VNS+KTIDGRGA VEIA+GPCITIQ V+++I+
Sbjct  129   LRYGVIQSEPLWIIFERDMSIRLSQELIVNSYKTIDGRGANVEIAHGPCITIQYVSHVIV  188

Query  1007  HGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVI  828
             HGI++HDCKPG    VR + TH G R  SDGD ISIF ++NIW+DHC LAR  DGLID I
Sbjct  189   HGIAVHDCKPGGPAMVRSSTTHFGWRTVSDGDGISIFGSNNIWVDHCTLARCTDGLIDAI  248

Query  827   HGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAH  648
               ST ITISNN+F+ HDKVML GHND+   D+AM+VTVA+NHFG GL+ERMPR R GY H
Sbjct  249   MASTDITISNNHFSDHDKVMLLGHNDDYTADRAMQVTVAYNHFGQGLVERMPRCRHGYFH  308

Query  647   VANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSK  474
             V NN YT W MYAIGGSANPTI +EGN F A     SK++TKRE  +   W +W WRS  
Sbjct  309   VVNNDYTEWRMYAIGGSANPTINAEGNRFFAGFNENSKEITKREYTEQSIWKSWNWRSEG  368

Query  473   DKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             + F+NGAYF+ SG GS    Y K+ S      + V  LT  AG L C
Sbjct  369   NLFMNGAYFITSGAGS-GSVYGKASSLAAKPAAYVGELTLSAGALLC  414



>ref|XP_009804979.1| PREDICTED: probable pectate lyase 5 [Nicotiana sylvestris]
Length=402

 Score =   431 bits (1109),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 207/343 (60%), Positives = 250/343 (73%), Gaps = 3/343 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  Y+VTD SD+P NPKPGTLRYG
Sbjct  55    NPIDDCWRCDPNWEKNRQMLADCAIGFGKQAIGGRDGKIYIVTDTSDDPVNPKPGTLRYG  114

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ+ PLWI+F +DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  115   AIQNEPLWIIFGRDMVIKLKEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  174

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GST
Sbjct  175   IHDCKQGGNAYVRDSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIRGST  234

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  235   AITISNNYMTHHNKVMLLGHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  294

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYA+GGSA+PTI S+GN F+APN   +K+VTK E   +  W  W WRS  D  L
Sbjct  295   DYTHWEMYAVGGSASPTINSQGNRFLAPNDIFNKEVTKHEDAPESEWKTWNWRSEGDLML  354

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGA+F  SG G+ +  Y K+ S      + V ++T +AG L C
Sbjct  355   NGAFFTRSGAGA-SKSYAKASSLSARPSTLVSSITLNAGALGC  396



>gb|KHG22755.1| hypothetical protein F383_29653 [Gossypium arboreum]
Length=408

 Score =   431 bits (1107),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 253/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GGK+G  YVVTDPSD +P NPKPGTLR+
Sbjct  60    NPIDDCWRCDPQWEKNRQRLADCAIGFGKHAIGGKHGKIYVVTDPSDRDPINPKPGTLRH  119

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
              AIQ  PLWI+FA DMVI LK EL++NS KTIDGRGA V IA GPCITIQ V+N+IIHGI
Sbjct  120   AAIQVQPLWIVFAHDMVIKLKQELLMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGI  179

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCK G +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+   DGL+D I GS
Sbjct  180   SIHDCKRGGNAYVRDSPSHYGWRTISDGDAVSIFGGSHVWVDHCSLSNCTDGLVDAIQGS  239

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG  L++RMPR R GY HV N
Sbjct  240   TAITISNNYMTHHNKVMLLGHSDSYKQDKNMQVTIAFNHFGERLVQRMPRCRHGYFHVVN  299

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+AP+   SK+VTK E   +  W  W WRS  D  
Sbjct  300   NDYTHWEMYAIGGSADPTINSQGNRFVAPDNVNSKEVTKHEDAPQSKWKEWNWRSEGDLM  359

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G+ +  Y K+ S      S V +LTA AG L C    S+C
Sbjct  360   LNGAFFTASGKGTSSS-YAKASSLGARPSSLVNSLTAGAGALVCK-KGSRC  408



>ref|XP_007151585.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
 gb|ESW23579.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
Length=403

 Score =   429 bits (1104),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 249/344 (72%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGKDA+GG+ G  Y VTD  D+   NPKPGTLRY
Sbjct  55    NPIDDCWRCHPNWENNRQRLADCAIGFGKDAIGGRNGRIYEVTDSGDDDAVNPKPGTLRY  114

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
              AIQ  PLWI+F +DMVITLK EL+VNS KTIDGRGA+V IA G CITI  V+N+I+HGI
Sbjct  115   AAIQDEPLWIIFKRDMVITLKQELLVNSFKTIDGRGASVHIAGGGCITIHYVSNVIVHGI  174

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  +RD+P H+G    SDGD +SIF++ ++WIDHC L+   DGLID IHGS
Sbjct  175   HIHDCKPTGNTNIRDSPEHSGFWTQSDGDGVSIFNSKHVWIDHCSLSNCRDGLIDAIHGS  234

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  235   TAITISNNYMTHHDKVMLLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  294

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+APN   SK+VTK E   +  W +W WRS  D F
Sbjct  295   NDYTHWEMYAIGGSANPTINSQGNRFLAPNIRFSKEVTKHEDAPQSEWMSWNWRSEGDMF  354

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF  SG G+ +  Y ++ S      S V ++T  AG L C
Sbjct  355   LNGAYFRQSGAGA-SSIYARASSLSARPSSLVGSMTITAGALTC  397



>gb|AEX93472.1| nodulation pectate lyase [Lotus japonicus]
 gb|AFD54063.1| nodulation pectate lyase [Lotus japonicus]
Length=400

 Score =   429 bits (1103),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 249/343 (73%), Gaps = 3/343 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW +NR+ LA+C +GFG+ A+GG+ G  Y+VTDPSD+  NPKPGTLR+ 
Sbjct  52    NPIDDCWRCDPNWENNRKRLAECAIGFGRHAIGGRDGKFYLVTDPSDHAVNPKPGTLRHA  111

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+F  DMVI L+ +L++NS+KTIDGRGA V IA GPCI +Q  TNIIIHGIS
Sbjct  112   AIQQEPLWIIFKHDMVIKLEMDLVMNSYKTIDGRGANVHIAGGPCIKVQRKTNIIIHGIS  171

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G SG V D+P H   R  SDGD ++I+ +SN+W+DHC L+   DGLIDV+HGST
Sbjct  172   IHDCKRGGSGYVSDSPNHQSWRGRSDGDGVTIYDSSNVWVDHCSLSNCFDGLIDVVHGST  231

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+N EDK M+VT+AFNHFG GL  RMPR R GY HV NN
Sbjct  232   AITISNNYMTHHNKVMLLGHSDSNKEDKKMQVTIAFNHFGEGLGGRMPRCRFGYFHVVNN  291

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKFL  462
              YT W  YAIGGS++PTIFS+GN F+APN  E K++TK     +  W NW WRS  D  L
Sbjct  292   DYTHWQKYAIGGSSSPTIFSQGNRFLAPNDEEHKEITKHFGSSENEWKNWNWRSEGDLML  351

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGA+F PSG G+ +  Y ++ S        V ++TA AG LRC
Sbjct  352   NGAFFSPSGAGATST-YARASSMEARPPMLVASMTAGAGALRC  393



>ref|XP_004501839.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=407

 Score =   429 bits (1103),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/350 (61%), Positives = 253/350 (72%), Gaps = 4/350 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTL  1185
             S N ID CWR  SNW  NR+ LADC +GFGK+A+GG+ G  YVV D SDN   NPKPGTL
Sbjct  57    SGNPIDDCWRCDSNWEKNRQRLADCAIGFGKNAIGGRDGKIYVVNDDSDNDAVNPKPGTL  116

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RY  IQ+ PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTN+IIH
Sbjct  117   RYAVIQNEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIH  176

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GI++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IH
Sbjct  177   GINIHDCKQGGNAMVRDSPGHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIH  236

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAITISNNY T HDKVML GH+D+  ED+ M+VT+AFNHFG GL++RMPR RLGY HV
Sbjct  237   GSTAITISNNYMTHHDKVMLLGHSDSYTEDRNMQVTIAFNHFGEGLVQRMPRCRLGYFHV  296

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSANPTI S+GN F+APN   SK+VTK E   +  W NW WRS  D
Sbjct  297   VNNDYTHWEMYAIGGSANPTINSQGNRFVAPNDRFSKEVTKYEDASESEWKNWNWRSEGD  356

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
               LNGA+F  SG  S +  Y ++ S      S V ++T  AG L C   S
Sbjct  357   LMLNGAFFTASGAES-SSSYARASSLSARPSSLVGSITVAAGTLNCKKGS  405



>gb|AFD54064.1| nodulation pectate lyase mutant [Lotus japonicus]
Length=400

 Score =   428 bits (1101),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 249/343 (73%), Gaps = 3/343 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW +NR+ LA+C +GFG+ A+GG+ G  Y+VTDPSD+  NPKPGTLR+ 
Sbjct  52    NPIDDCWRCDPNWENNRKRLAECAIGFGRHAIGGRDGKFYLVTDPSDHAVNPKPGTLRHA  111

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+F  DMVI L+ +L++NS+KTIDGRGA V IA GPCI +Q  TNIIIHGIS
Sbjct  112   AIQQEPLWIIFKHDMVIKLEMDLVMNSYKTIDGRGANVHIAGGPCIKVQRKTNIIIHGIS  171

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G SG V D+P H   R  SDGD ++I+ +SN+W+DHC L+   DGLIDV+HGST
Sbjct  172   IHDCKRGGSGYVSDSPNHQSWRGRSDGDRVTIYDSSNVWVDHCSLSNCFDGLIDVVHGST  231

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+N EDK M+VT+AFNHFG GL  RMPR R GY HV NN
Sbjct  232   AITISNNYMTHHNKVMLLGHSDSNKEDKKMQVTIAFNHFGEGLGGRMPRCRFGYFHVVNN  291

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKFL  462
              YT W  YAIGGS++PTIFS+GN F+APN  E K++TK     +  W NW WRS  D  L
Sbjct  292   DYTHWQKYAIGGSSSPTIFSQGNRFLAPNDEEHKEITKHFGSSENEWKNWNWRSEGDLML  351

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             NGA+F PSG G+ +  Y ++ S        V ++TA AG LRC
Sbjct  352   NGAFFSPSGAGATST-YARASSMEARPPMLVASMTAGAGALRC  393



>ref|XP_011097349.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=406

 Score =   427 bits (1099),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 245/344 (71%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD   D+P NP+PGTLR+
Sbjct  58    NPIDDCWRCDPNWEQNRQRLADCAIGFGKNAMGGKGGRIYVVTDSGDDDPVNPRPGTLRH  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI L  EL++NSHKTIDGRGA+V IA G CITI  VTN+IIHGI
Sbjct  118   AVIQDGPLWIIFRRDMVIRLNQELVMNSHKTIDGRGASVHIAGGACITIHHVTNVIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC    +G +RD+P H G    SDGD ISIF   +IW+DHC L+   DGLID IHGS
Sbjct  178   HIHDCVKAGNGIIRDSPEHKGWWEVSDGDGISIFGGRDIWVDHCSLSNCNDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT HDKVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYFTHHDKVMLLGHSDEYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI+S+GN F+APN  + KQVTK E   +  W +W WRS  D  
Sbjct  298   NDYTHWEMYAIGGSASPTIYSQGNRFLAPNDRDRKQVTKHEDAPESEWRHWNWRSEGDLM  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF+ SG G+ A  Y ++ S      S V ++T  AG L C
Sbjct  358   LNGAYFLQSGTGAGAT-YARASSLSARPSSLVASITTAAGALNC  400



>ref|XP_010102919.1| hypothetical protein L484_018936 [Morus notabilis]
 gb|EXB94437.1| hypothetical protein L484_018936 [Morus notabilis]
Length=410

 Score =   427 bits (1098),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 255/351 (73%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+AVGG+ G  YVVTD SDN   NPKPGTLRY
Sbjct  62    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAVGGRDGKIYVVTDSSDNDVVNPKPGTLRY  121

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  122   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGL  181

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKPG +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  182   NIHDCKPGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCQDGLIDAIHGS  241

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  242   TAITLSNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  301

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+K  SK+VTK E   +  W NW WRS  D  
Sbjct  302   NDYTHWEMYAIGGSANPTINSQGNRFLAPDKRFSKEVTKHEDAPESEWKNWNWRSEGDLM  361

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y K+ S      + V  +T +AG L C    S+C
Sbjct  362   VNGAFFTASGAGA-SSSYAKASSLGARPSTLVGTITTNAGALSCR-KGSRC  410



>ref|XP_002885608.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61867.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   429 bits (1102),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 251/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N+ID CWR   NW  NR+ LADCG+GFG  A GG+ G+ YVVTDPSD +  NPKPGTLR+
Sbjct  101   NLIDDCWRCDRNWNKNRKHLADCGMGFGSKANGGRNGSYYVVTDPSDEDVVNPKPGTLRH  160

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTID RGA V IANG CITIQ +TN+IIHG+
Sbjct  161   AVIQVEPLWIIFKRDMVIKLKQELIMNSFKTIDARGANVHIANGACITIQFITNVIIHGL  220

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK   + TVR +P+HAG R  +DGDAI+IF +S+IWIDH  L+   DGL+DV+ GS
Sbjct  221   HIHDCKRTGNVTVRSSPSHAGFRGTADGDAINIFGSSHIWIDHNSLSHCTDGLVDVVMGS  280

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+FT HD+VML GH D+  +DK M+VTVA+NHFG GLI+RMPR R GY HV N
Sbjct  281   TAITISNNHFTHHDEVMLLGHKDSYTQDKLMQVTVAYNHFGEGLIQRMPRCRHGYFHVVN  340

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKK--GWSNWKWRSSKDKF  465
             N YT W MYA+GGSANPTI S+GN + APN   +K+VTKR   K   W  W WRS KD  
Sbjct  341   NDYTHWKMYAVGGSANPTINSQGNRYAAPNNRSAKEVTKRLDTKTNEWMKWNWRSEKDLL  400

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             +NGA+F PSG G+ A  Y ++ S P    S V ++TA AG L C
Sbjct  401   VNGAFFTPSGEGASAD-YAQTLSLPAKSASMVDSITASAGALGC  443



>gb|EYU34765.1| hypothetical protein MIMGU_mgv1a023431mg [Erythranthe guttata]
Length=400

 Score =   427 bits (1097),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/344 (61%), Positives = 242/344 (70%), Gaps = 6/344 (2%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW + RR LADC +GFGK AVGG+ G TYVVTD  +D+P NPKPGTLR+
Sbjct  54    NPIDDCWRCDPNWETRRRRLADCAIGFGKKAVGGRDGRTYVVTDSGNDDPVNPKPGTLRH  113

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
              AIQ  PLWI+F  DMVI LK EL+VNSHKTIDGRGATV IA G C+TI   TN+I+HGI
Sbjct  114   AAIQFEPLWIIFRADMVIKLKQELVVNSHKTIDGRGATVHIAGGACVTIHHATNVILHGI  173

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC    +  +RD+P HAG    SDGD ++IF   +IWIDHC L+  ADGLID IHGS
Sbjct  174   HIHDCVKAGNAVIRDSPRHAGWWEESDGDGVAIFGGRDIWIDHCSLSNCADGLIDAIHGS  233

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             T ITISNNYFT HDKVML GHND  V+DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  234   TGITISNNYFTNHDKVMLLGHNDGYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  293

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI+S+GN F+APN    K+VTK E   +  W  W WRS  D  
Sbjct  294   NDYTHWEMYAIGGSASPTIYSQGNRFLAPNLRFRKEVTKHEDAPESEWRRWNWRSEGDLM  353

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF  SG GS    Y ++ S      S V  +T  AG L C
Sbjct  354   LNGAYFQQSGTGST---YARASSLSARPYSLVGTITTSAGALNC  394



>ref|XP_010682362.1| PREDICTED: probable pectate lyase 5 [Beta vulgaris subsp. vulgaris]
Length=404

 Score =   427 bits (1097),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 250/347 (72%), Gaps = 3/347 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR    W  NR+ LADCG+GFGK A+GGK G  YVVT+  D+P NPKPGTLR+G
Sbjct  57    NPIDDCWRCDHKWLKNRQRLADCGIGFGKGAIGGKNGKMYVVTNKGDDPVNPKPGTLRWG  116

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ  PLWI+F  DMVI LK ELMVNS KTIDGRGA + IA GPCITIQ VTN+IIHGI 
Sbjct  117   VIQDKPLWIIFDGDMVIKLKQELMVNSFKTIDGRGANIHIAGGPCITIQYVTNVIIHGIH  176

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCKPG +  VRDTPTH G R  SDGD ISIF  S+IW+DHC L+   DGLID IHGST
Sbjct  177   IHDCKPGGNAMVRDTPTHYGWRTISDGDGISIFGGSHIWVDHCSLSSCTDGLIDAIHGST  236

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  237   AITISNNYMTHHNKVMLLGHSDSLTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  296

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN  ++K+VTKRE   K  W  W WRS  D  L
Sbjct  297   DYTHWEMYAIGGSASPTINSQGNRFLAPNDPDNKEVTKREEWPKSVWKKWNWRSQGDLML  356

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
             NGA+F  SG G+ +  Y ++ S      + V +LT  AG L C  SS
Sbjct  357   NGAFFTSSGAGA-SSSYARASSLNARPSTFVGSLTMSAGVLNCKKSS  402



>ref|XP_006852264.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
 gb|ERN13731.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
Length=409

 Score =   426 bits (1096),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 216/351 (62%), Positives = 256/351 (73%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR   +WA+NR+ LADC +GFGK++VGGK G  Y VTDPSD NP  PKPGTLRY
Sbjct  61    NPIDDCWRCDPDWATNRQRLADCAIGFGKNSVGGKGGEIYTVTDPSDDNPVTPKPGTLRY  120

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM ITLK EL++NS+KTIDGRGA+V IANGPCIT+Q VTNIIIHGI
Sbjct  121   AVIQDEPLWIIFARDMTITLKEELIMNSYKTIDGRGASVHIANGPCITVQYVTNIIIHGI  180

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S+IW+DHC L+   DGLID IHGS
Sbjct  181   HIHDCKQGGNAMVRDSPNHYGWRTLSDGDGVSIFGGSHIWVDHCTLSNCRDGLIDAIHGS  240

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  241   TAITISNNYMTHHDKVMLLGHSDSYAQDKNMQVTIAFNHFGEGLIQRMPRCRFGYFHVVN  300

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+AP+   +K+VTK E   +  W NW WRS  D  
Sbjct  301   NDYTHWEMYAIGGSASPTINSQGNRFLAPDDRFNKEVTKHEDAPESEWKNWNWRSEGDLM  360

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y ++ S      S V  +T  AG L C    S+C
Sbjct  361   LNGAFFTPSGAGASSS-YNRASSLSARPSSLVGGITVSAGALNCK-KGSRC  409



>ref|XP_009136724.1| PREDICTED: probable pectate lyase 4 [Brassica rapa]
 emb|CDX90559.1| BnaA03g42220D [Brassica napus]
Length=389

 Score =   426 bits (1094),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 252/345 (73%), Gaps = 16/345 (5%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             ++N ID+CWR  + W++NR+ALA C VGFGK A+GG  G  YVVT P+D+ G PKPGTLR
Sbjct  55    ALNPIDACWRRDAKWSTNRQALARCAVGFGKGALGGSKGPIYVVTSPADDAGKPKPGTLR  114

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             +GA QS PLWI FA+DMVI L+ EL V SHKTIDGRG  V+I NGPCI+I+  +N+IIHG
Sbjct  115   FGATQSNPLWITFARDMVIRLRTELEVKSHKTIDGRGVKVDIGNGPCISIKRASNVIIHG  174

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             I++HDC+  K               G DGD I +F + N+WIDHC+L+R  DGLIDV+  
Sbjct  175   ITVHDCRLSK---------------GFDGDGIRVFQSRNVWIDHCHLSRCQDGLIDVVTS  219

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             STA+TISNN    H K ML GH+DN++ DK MKVTVAFN FGPGL ERMPRVR GYAHVA
Sbjct  220   STAVTISNNRLINHQKAMLLGHSDNHMADKNMKVTVAFNVFGPGLTERMPRVRRGYAHVA  279

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKK-GWSNWKWRSSKDKF  465
             NN Y  W +YAIGGSA+PTIFSE N+F+AP++ E K+VTKR  K     NWKW ++KD F
Sbjct  280   NNMYNKWNLYAIGGSADPTIFSESNHFVAPDRKEHKEVTKRMDKSPAAKNWKWSTNKDVF  339

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCS  330
             +NGA+F PSG     P Y   + FPVA G++VPALTA AGPLRC+
Sbjct  340   INGAFFTPSGGPGVPPPYAAGERFPVAPGAQVPALTASAGPLRCA  384



>ref|XP_008389758.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   426 bits (1095),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 254/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  55    NPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYG  114

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ+ PLWI+F +DM I LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  115   VIQNEPLWIVFQRDMTIKLKEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  174

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGST
Sbjct  175   IHDCKQGGNAYVRDSPEHFGWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGST  234

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             +ITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R G  HV NN
Sbjct  235   SITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNN  294

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +K WS W WRSS D  L
Sbjct  295   DYTHWEMYAIGGSASPTINSQGNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLL  354

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y K+ S      S V +LTA AG LRC    S+C
Sbjct  355   NGAFFTASGAGA-SSSYAKASSLGARPSSLVSSLTAGAGSLRCK-KGSRC  402



>ref|XP_008350945.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008350949.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   426 bits (1095),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 254/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  55    NPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYG  114

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ+ PLWI+F +DM I LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  115   VIQNEPLWIVFQRDMTIKLKEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  174

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGST
Sbjct  175   IHDCKQGGNAYVRDSPEHFGWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGST  234

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             +ITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R G  HV NN
Sbjct  235   SITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNN  294

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +K WS W WRSS D  L
Sbjct  295   DYTHWEMYAIGGSASPTINSQGNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLL  354

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y K+ S      S V +LTA AG LRC    S+C
Sbjct  355   NGAFFTASGAGA-SSSYAKASSLGARPSSLVSSLTAGAGSLRCK-KGSRC  402



>ref|XP_007222794.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
 gb|EMJ23993.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
Length=401

 Score =   426 bits (1094),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 255/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N +D CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  54    NPMDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYG  113

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ  PLWI+F  DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  114   VIQDQPLWIVFKGDMVIKLKEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  173

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P+H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGST
Sbjct  174   IHDCKQGGNAYVRDSPSHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGST  233

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             +ITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R G  HV NN
Sbjct  234   SITISNNYMTHHNKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNN  293

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K++TK E   +K WS W WRSS D  L
Sbjct  294   DYTHWEMYAIGGSASPTINSQGNRFLAPNDRFNKEITKHEDAPQKEWSKWNWRSSGDLLL  353

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y ++ S      S V +LTA AG L+C    S+C
Sbjct  354   NGAFFTASGAGA-SSSYARASSLGARPSSLVSSLTAGAGSLKCR-KGSRC  401



>ref|XP_004152502.1| PREDICTED: probable pectate lyase 22-like [Cucumis sativus]
 gb|KGN64357.1| hypothetical protein Csa_1G049960 [Cucumis sativus]
Length=413

 Score =   426 bits (1095),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 254/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  SNW  NR+ LADCG+GFGK+A+GG+ G  YVVTD   D+P NPKPGTLRY
Sbjct  65    NPIDDCWRCDSNWEKNRQRLADCGIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRY  124

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  125   AVIQDEPLWIIFARDMVIRLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  184

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  185   NIHDCKQGGNTDVRDSPRHFGFRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  244

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  245   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  304

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN   SK+VTK E   +  W NW WRS  D  
Sbjct  305   NDYTHWEMYAIGGSAAPTINSQGNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLM  364

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGAYF  SG G+ +  Y ++ S      S V  +T +AG L C    S+C
Sbjct  365   LNGAYFTASGAGA-SSSYARASSLGARPSSLVGTITTNAGALNCR-KGSRC  413



>ref|XP_003618787.1| Pectate lyase [Medicago truncatula]
 gb|AES75005.1| pectate lyase family protein [Medicago truncatula]
 gb|AFK34950.1| unknown [Medicago truncatula]
Length=404

 Score =   425 bits (1093),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 250/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGKDA+GGK G  Y+VTD  D+   NPKPGTLRY
Sbjct  56    NPIDDCWRCDPNWENNRQRLADCAIGFGKDAIGGKNGKIYIVTDSGDDDAVNPKPGTLRY  115

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             GAIQ  PLWI+F +DMVI LK EL+VNS+KTIDGRGA+V IANG CITI  V N+IIHGI
Sbjct  116   GAIQDEPLWIIFKRDMVIQLKQELLVNSYKTIDGRGASVHIANGGCITIHYVNNVIIHGI  175

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC P  +  +RD+P H+G    SDGD IS+F++ +IWIDHC L+   DGLIDVIHGS
Sbjct  176   HVHDCVPTGNTNIRDSPEHSGFWTVSDGDGISVFNSQHIWIDHCSLSNCRDGLIDVIHGS  235

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
              AITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  236   NAITISNNYMTHHDKVMLLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  295

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK E   +  +++W WRS  D F
Sbjct  296   NDYTHWEMYAIGGSANPTINSQGNRFLAPDNRFSKEVTKHEDASESEYNSWNWRSEGDLF  355

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGA+F  +G  S +  Y ++ S      S V ++T  +G L C
Sbjct  356   LNGAFFRQTGAES-SSIYARASSLSARPASLVGSITTTSGVLTC  398



>ref|XP_004157771.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 22-like 
[Cucumis sativus]
Length=413

 Score =   426 bits (1094),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 254/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  SNW  NR+ LADCG+GFGK+A+GG+ G  YVVTD   D+P NPKPGTLRY
Sbjct  65    NPIDDCWRCDSNWEKNRQRLADCGIGFGKNAIGGRDGXIYVVTDSGDDDPVNPKPGTLRY  124

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  125   AVIQDEPLWIIFARDMVIRLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  184

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  185   NIHDCKQGGNTDVRDSPRHFGFRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  244

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  245   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  304

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN   SK+VTK E   +  W NW WRS  D  
Sbjct  305   NDYTHWEMYAIGGSAAPTINSQGNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLM  364

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGAYF  SG G+ +  Y ++ S      S V  +T +AG L C    S+C
Sbjct  365   LNGAYFTASGAGA-SSSYARASSLGARPSSLVGTITTNAGALNCR-KGSRC  413



>ref|XP_006341783.1| PREDICTED: probable pectate lyase 5-like [Solanum tuberosum]
Length=401

 Score =   425 bits (1093),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 254/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GGK GN Y+VTD SD+P NPKPGTLRYG
Sbjct  54    NPIDDCWRCDPNWEKNRQRLADCAIGFGKQAIGGKDGNIYIVTDTSDDPVNPKPGTLRYG  113

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+F++DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  114   AIQDEPLWIIFSRDMVIKLKEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  173

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GST
Sbjct  174   IHDCKQGGNAYVRDSPQHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGST  233

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNN+ T H+KVML GH+D    DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  234   AITISNNFMTHHNKVMLLGHSDTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  293

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +  W NW WRS  D  L
Sbjct  294   DYTHWEMYAIGGSASPTINSQGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLML  353

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F+ SG G+ +  Y K+ S      + V ++T +AG L C     KC
Sbjct  354   NGAFFIRSGAGA-SSSYAKASSLSARPSTLVNSITMNAGALGCK-KGKKC  401



>ref|XP_010248740.1| PREDICTED: probable pectate lyase 18 [Nelumbo nucifera]
Length=405

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK AVGG+ G  YVVTD   DNP NPKPGTLR+
Sbjct  57    NPIDDCWRCDPNWEKNRQRLADCAIGFGKQAVGGRDGRIYVVTDSGDDNPVNPKPGTLRF  116

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ V+NIIIHG+
Sbjct  117   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVSNIIIHGL  176

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+PTH G R  SDGD +SIF  S+IW+DHC L+   DGLID IHGS
Sbjct  177   HIHDCKQGGNANVRDSPTHYGWRTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGS  236

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT HDKVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  237   TAITLSNNYFTHHDKVMLLGHSDTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  296

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+AP+   SK+VTK E   +  W +W WRS  D  
Sbjct  297   NDYTHWEMYAIGGSAAPTINSQGNRFLAPDNRFSKEVTKHEDAPESEWRHWNWRSEGDLL  356

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y K+ S      S V ++T  AG L C    S+C
Sbjct  357   LNGAFFTPSGAGA-SSSYAKASSLGARPSSLVGSITTAAGALNCK-KGSRC  405



>ref|XP_009406385.1| PREDICTED: probable pectate lyase 18 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   425 bits (1092),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +WA NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLRY
Sbjct  59    NPIDDCWRCDPDWADNRQRLADCAIGFGKNAIGGRDGEIYVVTDSGDDDPVNPKPGTLRY  118

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NSHKTIDGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  119   AVIQEEPLWIIFKRDMVIQLKEELIMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGV  178

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  179   HIHDCKQGGNAYVRDSPGHYGWRTVSDGDGVSIFGGSHVWVDHCTLSNCHDGLIDAIHGS  238

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY + HDKVML GH+D    DK+M+VT+AFNHFG  L++RMPR R GY HV N
Sbjct  239   TAITISNNYLSHHDKVMLLGHSDELTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVN  298

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN   +K+VTKRE   +  W  W WRS  D+ 
Sbjct  299   NDYTHWEMYAIGGSAAPTINSQGNRFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQM  358

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y K+ S      S V  +T  AG L C    S+C
Sbjct  359   LNGAFFTPSGAGA-SSSYAKASSLGARSSSLVGTITVSAGVLSCK-KGSRC  407



>ref|XP_010320956.1| PREDICTED: probable pectate lyase 5 [Solanum lycopersicum]
Length=401

 Score =   424 bits (1090),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 235/309 (76%), Gaps = 2/309 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GGK G  YVVTD SD+P NPKPGTLRYG
Sbjct  54    NPIDDCWRCDPNWEKNRQRLADCAIGFGKQAIGGKDGKIYVVTDTSDDPVNPKPGTLRYG  113

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
             AIQ  PLWI+F++DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  114   AIQDEPLWIIFSRDMVIKLKEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  173

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GST
Sbjct  174   IHDCKQGGNAYVRDSPQHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGST  233

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  234   AITISNNYMTHHNKVMLLGHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  293

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +  W NW WRS  D  L
Sbjct  294   DYTHWEMYAIGGSASPTINSQGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLML  353

Query  461   NGAYFVPSG  435
             NGA+F+ SG
Sbjct  354   NGAFFIRSG  362



>gb|AFK44189.1| unknown [Medicago truncatula]
Length=407

 Score =   424 bits (1089),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 214/369 (58%), Positives = 254/369 (69%), Gaps = 4/369 (1%)
 Frame = -3

Query  1409  IMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVV  1230
             I G +   N       S N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVV
Sbjct  40    INGSLARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVV  99

Query  1229  TDP-SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIA  1053
             TD   D+P  PKPGTLR+  IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA
Sbjct  100   TDSGDDDPVTPKPGTLRFAVIQDEPLWIIFARDMVIQLKEELIMNSFKTIDGRGASVHIA  159

Query  1052  NGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWID  873
              GPCITIQ VTN+IIHGI +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+D
Sbjct  160   GGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPGHYGWRTVSDGDGVSIFGGSHVWVD  219

Query  872   HCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGP  693
             HC L+   DGLID IHGSTAITISNNY T HDKVML GH+D   +DK M+VT+AFNHFG 
Sbjct  220   HCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDTYTQDKNMQVTIAFNHFGE  279

Query  692   GLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE-  516
             GL++RMPR R GY HV NN YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK+E 
Sbjct  280   GLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFVAPDDRFSKEVTKQED  339

Query  515   -VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
               +  W  W WRS  D  +NGA+F PSG G  +  Y ++ S      S V  +T  AG L
Sbjct  340   APEGEWKGWNWRSEGDLLINGAFFTPSGAGGASSSYARASSLSARPSSLVGTITTGAGVL  399

Query  338   RCSYSSSKC  312
              C    S+C
Sbjct  400   GCK-KGSRC  407



>ref|XP_008804450.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=426

 Score =   424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 257/349 (74%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADCG+GFG++A+GG+ G  YVVTDP  D+P NP+PGTLRY
Sbjct  78    NSIDDCWRCDPEWHRNRKRLADCGIGFGRNAIGGRDGRYYVVTDPGDDDPVNPRPGTLRY  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  138   AVIQDQPLWIVFKRDMVITLKEELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S+IW+DHC L+  ADGLID I GS
Sbjct  198   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITI+NNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  258   TAITITNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR       W +W WRS  D  
Sbjct  318   NDYTHWEMYAIGGSADPTINSQGNRYLAPADPFAKEVTKRVDTDTSEWKSWNWRSEGDLL  377

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGAYF PSG G+ +  Y+++ S      S V ++T DAG L+C  +S 
Sbjct  378   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVASITTDAGVLQCRRNSQ  425



>gb|EYU22243.1| hypothetical protein MIMGU_mgv1a007460mg [Erythranthe guttata]
Length=406

 Score =   423 bits (1088),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 254/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+AVGG+ G  YVVT+  +D+P NPKPGTLR+
Sbjct  58    NPIDDCWRCDPNWEKNRQKLADCAIGFGKNAVGGRDGKIYVVTESGNDDPVNPKPGTLRW  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IANGPCITIQ VTNIIIHGI
Sbjct  118   GVIQEEPLWIIFARDMVIQLKEELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  178   HVHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHVSLSNCKDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYMTHHDKVMLLGHSDSYTQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+AP+   SK+VTK E   +  W NW WRS  D  
Sbjct  298   NDYTHWEMYAIGGSAEPTINSQGNRFLAPDDRFSKEVTKYEDAPESEWKNWNWRSEGDLM  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGAYF PSG  S +  Y K+ S      + + ++T+ +G L C    S+C
Sbjct  358   LNGAYFTPSGARS-SSSYAKASSLGARPSTLISSITSGSGALNCR-KGSRC  406



>emb|CDP13269.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   423 bits (1087),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 252/350 (72%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR++LADC +GFGK AVGG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  53    NPIDDCWRCDPNWEKNRQSLADCAIGFGKHAVGGRDGEIYVVTDNGDHPVNPKPGTLRYG  112

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA V IA GPCITIQ VTNII+HG++
Sbjct  113   VIQDEPLWIIFARDMVIQLKEELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIVHGLN  172

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGST
Sbjct  173   IHDCKQGGNAYVRDSPEHFGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGST  232

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AITISNNY T H+KVML GH+D  ++DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  233   AITISNNYLTHHNKVMLLGHSDTYLQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  292

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA PTI S+GN F+APN   +K+VTK EV  +  W +W WRS  D  L
Sbjct  293   DYTHWEMYAIGGSAAPTINSQGNRFLAPNDIFTKEVTKHEVAPESEWKSWNWRSEGDLML  352

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  +     +  Y+K+ S      S V +LT+ AG L C    S+C
Sbjct  353   NGAFFT-TSGAGASSSYSKAYSLSARPSSLVASLTSGAGSLICR-KGSRC  400



>ref|NP_189065.2| putative pectate lyase 9 [Arabidopsis thaliana]
 sp|Q9LRM5.1|PLY9_ARATH RecName: Full=Probable pectate lyase 9; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01365.1| pectate lyase [Arabidopsis thaliana]
 gb|AEE76877.1| putative pectate lyase 9 [Arabidopsis thaliana]
Length=452

 Score =   424 bits (1091),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 249/344 (72%), Gaps = 5/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N+ID CWR   NW  NR+ LADCG+GFG  A GG+ G+ YVVTD SD+   NPKPGTLR+
Sbjct  104   NLIDDCWRCDRNWNKNRKHLADCGMGFGSKAFGGRNGSYYVVTDHSDDDVVNPKPGTLRH  163

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTID RGA V IANG CITIQ +TN+I+HG+
Sbjct  164   AVIQVEPLWIIFKRDMVIKLKQELIMNSFKTIDARGANVHIANGACITIQNITNVIVHGL  223

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK   + TVR +P+ AG R  +DGDAI+IF +S+IWIDH  L+   DGL+DV++GS
Sbjct  224   HIHDCKRTGNVTVRSSPSQAGFRGTADGDAINIFGSSHIWIDHNSLSNCTDGLVDVVNGS  283

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+FT HD+VML GHND+   DK M+VTVA+NHFG GLI+RMPR R GY HV N
Sbjct  284   TAITISNNHFTHHDEVMLLGHNDSYTRDKMMQVTVAYNHFGEGLIQRMPRCRHGYFHVVN  343

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP    +K+VTKR   KG  W  W WRS KD  
Sbjct  344   NDYTHWKMYAIGGSANPTINSQGNRFAAPKNHSAKEVTKRLDTKGNEWMEWNWRSEKDLL  403

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             +NGA+F PSG G+     +++ S P    S V A+TA AG L C
Sbjct  404   VNGAFFTPSGEGASGD--SQTLSLPAKPASMVDAITASAGALSC  445



>ref|XP_008804449.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=451

 Score =   424 bits (1091),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 257/349 (74%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADCG+GFG++A+GG+ G  YVVTDP  D+P NP+PGTLRY
Sbjct  103   NSIDDCWRCDPEWHRNRKRLADCGIGFGRNAIGGRDGRYYVVTDPGDDDPVNPRPGTLRY  162

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  163   AVIQDQPLWIVFKRDMVITLKEELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  222

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S+IW+DHC L+  ADGLID I GS
Sbjct  223   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGS  282

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITI+NNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  283   TAITITNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  342

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR       W +W WRS  D  
Sbjct  343   NDYTHWEMYAIGGSADPTINSQGNRYLAPADPFAKEVTKRVDTDTSEWKSWNWRSEGDLL  402

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGAYF PSG G+ +  Y+++ S      S V ++T DAG L+C  +S 
Sbjct  403   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVASITTDAGVLQCRRNSQ  450



>ref|NP_001147553.1| pectate lyase 8 [Zea mays]
 gb|ACG27904.1| pectate lyase 8 precursor [Zea mays]
Length=467

 Score =   425 bits (1093),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 253/344 (74%), Gaps = 17/344 (5%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR  S+W SNR+ LADCG+GFG++A+GG+ G  YVVTDPSD+ P NP+ GTLR+
Sbjct  132   NPIDDCWRCDSDWHSNRQRLADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRH  191

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITL+ EL++NS KTIDGRGA V IANG C+TIQ VTN+IIHG+
Sbjct  192   AVIQEEPLWIIFKRDMVITLREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGL  251

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGD +SIF +S++W+DHC L+  ADGLID I GS
Sbjct  252   HIHDCRPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGS  311

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  312   TAITLSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  371

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W +W WRS  D  
Sbjct  372   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLL  431

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ A Y            SR   +T+DAG L C
Sbjct  432   LNGAYFTPSGAGASASY------------SRT--ITSDAGALSC  461



>ref|XP_006347419.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=405

 Score =   423 bits (1087),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 241/317 (76%), Gaps = 3/317 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LA+C +GFGK+AVGG+ G  YVVT+  +D+P NPKPGTLRY
Sbjct  57    NPIDDCWRCDPNWEKNRQRLANCAIGFGKNAVGGRDGKIYVVTNSGNDDPVNPKPGTLRY  116

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGATV IA GPCITIQ VTN+IIHGI
Sbjct  117   GVIQDEPLWIIFARDMVIQLKEELIMNSFKTIDGRGATVHIAGGPCITIQYVTNVIIHGI  176

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VR TP H G R  SDGD +SIF  S+IWIDHC L+   DGLID I GS
Sbjct  177   HIHDCKQGGNAMVRSTPHHYGWRTISDGDGVSIFGGSHIWIDHCSLSNCVDGLIDAIMGS  236

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T+HDKVML GH+D++V+DK M+VT+AFNHFG GL++R+PR R GY HV N
Sbjct  237   TAITISNNYMTKHDKVMLLGHSDSHVQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVN  296

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+A +   SK+VTK E+  +  W NW WRS  D  
Sbjct  297   NDYTHWEMYAIGGSANPTINSQGNRFLASDIRFSKEVTKHEISPESEWKNWNWRSDGDLM  356

Query  464   LNGAYFVPSGYGSCAPY  414
             LNGA+FV SG G+ + Y
Sbjct  357   LNGAFFVKSGAGASSNY  373



>ref|XP_009391056.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   424 bits (1091),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/344 (58%), Positives = 249/344 (72%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NP+PGTLRY
Sbjct  105   NPIDDCWRCDPDWHLNRKTLADCGIGFGRNAIGGRDGEFYVVTDSGDDDPVNPRPGTLRY  164

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               +Q  PLWI F +DMVITL  EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  165   AVVQDDPLWITFERDMVITLDQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  224

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S++W+DHC L+  ADGL+D + GS
Sbjct  225   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLVDAVMGS  284

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+   DK+M+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  285   TAITVSNNYFTHHNEVMLLGHSDSYERDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  344

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR       W NW WRS  D  
Sbjct  345   NDYTHWEMYAIGGSASPTINSQGNRYLAPTNPFAKEVTKRVDTDASLWKNWNWRSEGDLL  404

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y ++ S      S V  LT+DAG L C
Sbjct  405   LNGAYFTPSGAGA-STSYARASSLGAKPSSMVGTLTSDAGALSC  447



>gb|EYU46355.1| hypothetical protein MIMGU_mgv1a007094mg [Erythranthe guttata]
Length=419

 Score =   423 bits (1088),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 249/345 (72%), Gaps = 5/345 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFG++AVGG+ G  YVVTDPSD+   NP+PGTLR+
Sbjct  70    NPIDDCWRCDRNWIRNRKRLADCAIGFGRNAVGGRDGRYYVVTDPSDDDAVNPRPGTLRH  129

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTN+I+HG+
Sbjct  130   AVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIVHGL  189

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD ISIF AS++WIDH  L+  +DGLID I GS
Sbjct  190   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGISIFGASHVWIDHNSLSGCSDGLIDAIMGS  249

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFTQH++VML GH+D+N  DK M+VTVA+NHFG GL +RMPR R GY HV N
Sbjct  250   TAITISNNYFTQHNEVMLLGHSDSNTRDKVMQVTVAYNHFGEGLTQRMPRCRHGYFHVVN  309

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG---WSNWKWRSSKDK  468
             N YT W MYAIGGSANPTI S+GN F+A N   +K+VTKR V      W  W WRS  D 
Sbjct  310   NDYTSWEMYAIGGSANPTINSQGNRFLASNNQFTKEVTKRIVNSDDNQWKEWNWRSEGDL  369

Query  467   FLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              LNGAYF PSG G  +  Y ++ S      S V  LT+DAG L C
Sbjct  370   LLNGAYFTPSG-GGASASYARASSLAAKPSSLVSTLTSDAGVLNC  413



>gb|EPS69872.1| hypothetical protein M569_04891, partial [Genlisea aurea]
Length=401

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/378 (58%), Positives = 266/378 (70%), Gaps = 10/378 (3%)
 Frame = -3

Query  1421  PLLGIMGFVPTLNAAADK-----ATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVG  1257
             P L +  F   +N    K      ++ N ID CWR   +W  NRR LADC +GFGK+A+G
Sbjct  26    PDLVVEEFHQRMNGTRRKLGFLSCSTGNPIDDCWRCDPDWEKNRRKLADCAIGFGKNAIG  85

Query  1256  GKYGNTYVVTDP-SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTID  1080
             G+ GN YVVTD   D+P NPKPGTLR+  IQ  PLWI F++DMVI LK EL++NS KTID
Sbjct  86    GRDGNIYVVTDSGDDDPVNPKPGTLRWAVIQDEPLWITFSRDMVIQLKEELIMNSFKTID  145

Query  1079  GRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISI  900
             GRGA+V I+NGPCIT+Q VTNIIIHGI +HDCKPG +  VRD+P H G R  SDGD +SI
Sbjct  146   GRGASVHISNGPCITVQFVTNIIIHGIHIHDCKPGGNAMVRDSPRHYGWRTISDGDGVSI  205

Query  899   FSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKV  720
             F AS++W+DHC L+  ADGLID IHGSTAITISNNY T HDKVML GH+D  V+D++M+V
Sbjct  206   FGASHVWVDHCSLSSCADGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDAYVQDQSMQV  265

Query  719   TVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSE  540
             T+AFNHFG GL++RMPR R GY HV NN YT W MYAIGGSA PTI S+GN F+AP+   
Sbjct  266   TIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGNRFLAPDDRF  325

Query  539   SKQVTKRE--VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVP  366
              K+VTK E   +  W NW WR+  D  LNGAYF PSG G+ +  Y ++ S      S V 
Sbjct  326   KKEVTKYEDAAESEWKNWNWRTEGDLMLNGAYFTPSGTGASST-YARASSLGARSSSLVG  384

Query  365   ALTADAGPLRCSYSSSKC  312
             ++TA +G L C    S+C
Sbjct  385   SITAGSGVLTCR-KGSRC  401



>ref|XP_003608909.1| Pectate lyase [Medicago truncatula]
 gb|AES91106.1| pectate lyase family protein [Medicago truncatula]
Length=407

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 214/369 (58%), Positives = 253/369 (69%), Gaps = 4/369 (1%)
 Frame = -3

Query  1409  IMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVV  1230
             I G +   N       S N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVV
Sbjct  40    INGSLARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVV  99

Query  1229  TDP-SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIA  1053
             TD   D+P  PKPGTLR+  IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA
Sbjct  100   TDSGDDDPVTPKPGTLRFAVIQDEPLWIIFARDMVIQLKEELIMNSFKTIDGRGASVHIA  159

Query  1052  NGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWID  873
              GPCITIQ VTN+IIHGI +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+D
Sbjct  160   GGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPGHYGWRTVSDGDGVSIFGGSHVWVD  219

Query  872   HCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGP  693
             HC L+   DGLID IHGSTAITISNNY T HDKVML GH+D   +DK M+VT+AFNHFG 
Sbjct  220   HCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDTYTQDKNMQVTIAFNHFGE  279

Query  692   GLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE-  516
             GL++RMPR R GY HV NN YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK E 
Sbjct  280   GLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFVAPDDRFSKEVTKHED  339

Query  515   -VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPL  339
               +  W  W WRS  D  +NGA+F PSG G  +  Y ++ S      S V  +T  AG L
Sbjct  340   APEGEWKGWNWRSEGDLLINGAFFTPSGAGGASSSYARASSLSARPSSLVGTITTGAGVL  399

Query  338   RCSYSSSKC  312
              C    S+C
Sbjct  400   GCK-KGSRC  407



>ref|XP_010250930.1| PREDICTED: probable pectate lyase 5 [Nelumbo nucifera]
Length=406

 Score =   422 bits (1086),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD   D+P NPKPGTLRY
Sbjct  58    NPIDDCWRCDPNWEKNRQRLADCAIGFGKQAIGGRDGRIYVVTDSGDDDPVNPKPGTLRY  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ V NIIIHG+
Sbjct  118   AVIQDEPLWIIFARDMVIQLKEELLMNSFKTIDGRGASVHIAGGPCITIQYVNNIIIHGL  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD ISIF  S++W+DHC L+   DGLID IHGS
Sbjct  178   NIHDCKQGGNANVRDSPEHYGWRTISDGDGISIFGGSHVWVDHCSLSNCHDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYMTHHDKVMLLGHSDTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+AP+   SK+VTK E   +  W NW WRS  D  
Sbjct  298   NDYTHWEMYAIGGSASPTINSQGNRFVAPDDRFSKEVTKHEDAPESEWKNWNWRSEGDLM  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F PSG G+ +  Y K+ S      S V ++T  AG L C    S+C
Sbjct  358   MNGAFFTPSGAGA-SSSYAKASSLGARPSSLVGSITMSAGALGCK-KGSRC  406



>ref|XP_008221954.1| PREDICTED: probable pectate lyase 5 [Prunus mume]
Length=401

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 255/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  D+P NPKPGTLRYG
Sbjct  54    NPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYG  113

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ  PLWI+F  DMVI LK ELM+NS KTIDGRGA+V IA GPCITIQ VTNIIIHG++
Sbjct  114   VIQDQPLWIVFKGDMVIKLKEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLN  173

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +  VRD+P+H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGST
Sbjct  174   IHDCKQGGNAYVRDSPSHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGST  233

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             +ITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R G  HV NN
Sbjct  234   SITISNNYMTHHNKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNN  293

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+APN   +K++TK E   +K WS W WRSS D  L
Sbjct  294   DYTHWEMYAIGGSASPTINSQGNRFLAPNDRFNKEITKHEDAPQKEWSKWNWRSSGDLLL  353

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y ++ S      S V +LTA AG L+C    S+C
Sbjct  354   NGAFFTSSGAGA-SSSYARASSLGARPSSLVSSLTAGAGSLKCR-KGSRC  401



>ref|XP_008439105.1| PREDICTED: probable pectate lyase 22 [Cucumis melo]
Length=411

 Score =   422 bits (1086),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 255/351 (73%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  SNW  NR+ LADCG+GFGK+A+GG+ G  YVVTD   D+P NPKPGTLRY
Sbjct  63    NPIDDCWRCDSNWEKNRQRLADCGIGFGKNAIGGRDGKIYVVTDAGDDDPVNPKPGTLRY  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMVIRLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKPG +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  183   NIHDCKPGGNTDVRDSPRHFGFRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN   SK+VTK E   +  W NW WRS  D  
Sbjct  303   NDYTHWEMYAIGGSAAPTINSQGNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G+ +  Y ++ S      S V  +T +AG L C    S+C
Sbjct  363   LNGAFFTSSGAGA-SSSYARASSLGARPSSLVGTITTNAGALNCR-KGSRC  411



>ref|XP_011086987.1| PREDICTED: probable pectate lyase 22 [Sesamum indicum]
Length=404

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD   D+P NPKPGTLRY
Sbjct  56    NPIDDCWRCDPNWEENRQKLADCAIGFGKNAIGGKDGEIYVVTDSGDDDPVNPKPGTLRY  115

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IANGPCITIQ VTNIIIHG+
Sbjct  116   AVIQDQPLWIIFARDMVIQLKEELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGV  175

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  176   HIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  235

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  236   TAITISNNYMTHHNKVMLLGHSDLYPQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  295

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN   +K+VTK E   +  W NW WRS  D  
Sbjct  296   NDYTHWEMYAIGGSAAPTINSQGNRFLAPNDRFNKEVTKYEDAAESEWKNWNWRSEGDLM  355

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G+ +  Y K+ S      S + ++TA +G L C    S+C
Sbjct  356   LNGAFFTASGAGA-SSSYAKASSLGARPSSLITSITAASGALNCR-KGSRC  404



>gb|ABR18471.1| unknown [Picea sitchensis]
Length=490

 Score =   425 bits (1093),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 246/350 (70%), Gaps = 4/350 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR + NW  NR+ LADC +GFG+DA+GGK G  YVVTD SD    NPKPGTLR+
Sbjct  93    NPIDDCWRCEPNWQMNRQRLADCAIGFGRDAIGGKNGRYYVVTDSSDEDAVNPKPGTLRH  152

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F  DMVI LK ELM+NS KTIDGRGA V IA+G CITIQ VTNIIIHG+
Sbjct  153   AVIQDEPLWIIFQSDMVIQLKEELMMNSFKTIDGRGADVHIAHGACITIQFVTNIIIHGV  212

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDC    +  VR+TP H G R  SDGD ISIF    IWIDHC L+   DGLID I GS
Sbjct  213   SIHDCFQAGNAMVRNTPEHYGWRTVSDGDGISIFGGRYIWIDHCSLSNCKDGLIDAIMGS  272

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT HDKVML GH+D+ V D  M+VT+AFN+FG GL++RMPR R GY H+ N
Sbjct  273   TAITISNNYFTHHDKVMLLGHSDSYVGDAIMQVTIAFNYFGEGLMQRMPRCRHGYFHIVN  332

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N Y+ W MYAIGGSANPTI SEGN F+AP+ + +KQVTKR   V + W  W WRS+ D  
Sbjct  333   NHYSHWEMYAIGGSANPTINSEGNRFIAPDNANAKQVTKRLNAVDEEWMRWNWRSAGDLM  392

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSK  315
             +NGA+FVPSG G+    Y  + S        V  +T DAG L+    SS+
Sbjct  393   VNGAFFVPSGAGT-GNNYALASSVGAKSAFLVKTITEDAGVLQSRTHSSR  441



>ref|XP_004515847.1| PREDICTED: probable pectate lyase 22-like [Cicer arietinum]
Length=411

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/353 (60%), Positives = 250/353 (71%), Gaps = 4/353 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTD-PSDNPGNPKPGTL  1185
             S N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD   D+P NPKPGTL
Sbjct  60    SGNPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVVTDSKDDDPVNPKPGTL  119

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RY  IQ  PLWI+F +DMVI LK EL++NS KTIDGRGA+V IANGPCITIQ VTN+IIH
Sbjct  120   RYAVIQDEPLWIIFERDMVIQLKEELIMNSFKTIDGRGASVHIANGPCITIQYVTNVIIH  179

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GI++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IH
Sbjct  180   GINIHDCKQGGNAMVRDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIH  239

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAITISNNY T HDKVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV
Sbjct  240   GSTAITISNNYMTHHDKVMLLGHSDTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHV  299

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSANPTI S+GN F+APN   SK+VTK E   +  W  W WR+  D
Sbjct  300   VNNDYTHWEMYAIGGSANPTINSQGNRFVAPNDRFSKEVTKHEDAAENEWKGWNWRTEGD  359

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
               +NGA+F  SG G  +  Y ++ S      S V  +T  AG L C    S+C
Sbjct  360   LMVNGAFFTSSGAGGSSSSYARASSLSARPSSLVGTITTTAGALNCR-KGSRC  411



>ref|XP_002866540.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42799.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   422 bits (1085),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/349 (60%), Positives = 253/349 (72%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR + +W +NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  60    NPIDDCWRCEKDWENNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  119

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  120   AVIQDEPLWIIFKRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  179

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  180   HIHDCKQGGNTYVRDSPEHYGYRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  239

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D  V+DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  240   TAITISNNYLTHHNKVMLLGHSDTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  299

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S SK+VTK E   +  W NW WRS  D  
Sbjct  300   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSSSKEVTKHEDAPENEWRNWNWRSEGDLM  359

Query  464   LNGAYFVPSGYG-SCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
             LNGA+F  SG G + +  Y+K+ S      S V  +T  +G L C   S
Sbjct  360   LNGAFFTYSGAGPTKSSSYSKASSLAARPSSHVGEITIASGALSCKRGS  408



>gb|AAF19195.1|AF206319_1 pectate lyase 1 [Musa acuminata AAA Group]
Length=407

 Score =   422 bits (1084),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +WA NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPK GTLRY
Sbjct  59    NPIDDCWRCDPDWADNRQRLADCAIGFGKNAIGGRDGEIYVVTDSGDDDPVNPKTGTLRY  118

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NSHKTIDGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  119   AVIQEEPLWIIFKRDMVIQLKEELIMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGV  178

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  179   HIHDCKQGGNAYVRDSPGHYGWRTVSDGDGVSIFGGSHVWVDHCTLSNCHDGLIDAIHGS  238

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY + HDKVML GH+D    DK+M+VT+AFNHFG  L++RMPR R GY HV N
Sbjct  239   TAITISNNYLSHHDKVMLLGHSDELTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVN  298

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN   +K+VTKRE   +  W  W WRS  D+ 
Sbjct  299   NDYTHWEMYAIGGSAAPTINSQGNRFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQM  358

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y K+ S      S V  +T  AG L C    S+C
Sbjct  359   LNGAFFTPSGAGA-SSSYAKASSLGARSSSLVGTITVSAGVLSCK-KGSRC  407



>ref|XP_004310004.1| PREDICTED: probable pectate lyase 5-like [Fragaria vesca subsp. 
vesca]
Length=402

 Score =   421 bits (1083),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 252/352 (72%), Gaps = 4/352 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLR  1182
             S N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTD  D+P NPKPGTLR
Sbjct  53    SGNPIDDCWRCDPKWEQNRQRLADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLR  112

Query  1181  YGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHG  1002
             YG IQ  PLWI+F  DM I LK ELM+NS KTIDGRGA V IA GPCITIQ VTNIIIHG
Sbjct  113   YGVIQDEPLWIIFKGDMTIKLKEELMMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHG  172

Query  1001  ISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHG  822
             +++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHG
Sbjct  173   LNIHDCKQGGNAYVRDSPGHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHG  232

Query  821   STAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVA  642
             STAITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R G  HV 
Sbjct  233   STAITISNNYMTHHNKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVV  292

Query  641   NNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDK  468
             NN YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +K WS W WRSS D 
Sbjct  293   NNDYTHWEMYAIGGSASPTINSQGNRFLAPNDRFNKEVTKHEDAPQKDWSKWNWRSSGDL  352

Query  467   FLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
              LNGA+F  SG G+ +  Y K+ S      S V ++TA AG L+C    S+C
Sbjct  353   MLNGAFFTASGAGA-SSSYAKASSLGARPSSLVSSITAGAGSLKCK-KGSRC  402



>ref|XP_007137977.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
 gb|ESW09971.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
Length=410

 Score =   421 bits (1083),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 208/350 (59%), Positives = 251/350 (72%), Gaps = 4/350 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTL  1185
             S N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVV D   D+P NPKPGTL
Sbjct  58    SGNPIDDCWRCDPNWEQNRQRLADCAIGFGKNAIGGRDGKIYVVDDAGDDDPVNPKPGTL  117

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             R+  IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCIT+Q VTN+IIH
Sbjct  118   RHAVIQDEPLWIIFARDMVIQLKEELLMNSFKTIDGRGASVHIAGGPCITVQYVTNVIIH  177

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GI +HDCK G +  VR +P H G R  SDGD +SIF  S++W+DHC L+   DGLID IH
Sbjct  178   GIHLHDCKQGGNAMVRSSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIH  237

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR RLGY HV
Sbjct  238   GSTAITISNNYMTHHDKVMLLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHV  297

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSANPTI S+GN F+AP+   SK+VTKRE   +  W  W WRS  D
Sbjct  298   VNNDYTHWEMYAIGGSANPTINSQGNRFVAPDDRFSKEVTKREEAAESEWQGWNWRSEGD  357

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
               +NGA+F  SG G+ +  Y ++ S      S V ++T  AG L C  +S
Sbjct  358   LLVNGAFFTASGAGA-SSSYARASSLSARPSSLVASITTGAGALSCKKAS  406



>ref|XP_004975048.1| PREDICTED: probable pectate lyase 15-like isoform X3 [Setaria 
italica]
Length=440

 Score =   422 bits (1085),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 256/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+   NP+ GTLRY
Sbjct  92    NPIDDCWRCDQDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPRKGTLRY  151

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V I+ G CITIQ V+N+IIHG+
Sbjct  152   GVIQDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGANVHISGGACITIQYVSNVIIHGL  211

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  212   HIHDCKPTGNAMVRSSPSHYGWRTIADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  271

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  272   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  331

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W +W WRS  D  
Sbjct  332   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTVWQSWNWRSEGDLL  391

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V ++T+DAG L C
Sbjct  392   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVGSITSDAGALSC  434



>ref|XP_011080166.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=405

 Score =   421 bits (1081),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 249/345 (72%), Gaps = 5/345 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR   NW  +RR LADC +GFG++AVGG+ G  YVVTDPSD+ P NP+PGTLR+
Sbjct  56    NPIDDCWRCDRNWIRHRRRLADCAIGFGRNAVGGRDGRYYVVTDPSDDDPVNPRPGTLRH  115

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG C+TIQ VTNIIIHG+
Sbjct  116   AVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACLTIQFVTNIIIHGL  175

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD ISIF +S+IWIDH  L+  +DGLID I GS
Sbjct  176   HIHDCKPTGNAMVRSSPSHYGWRTRADGDGISIFGSSHIWIDHNSLSSCSDGLIDAIMGS  235

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYF+ H++VML GH+D+   DK M+VTVA+NHFG GL +RMPR R GY HV N
Sbjct  236   TAITISNNYFSHHNEVMLLGHSDSYSRDKVMQVTVAYNHFGEGLTQRMPRCRHGYFHVVN  295

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG---WSNWKWRSSKDK  468
             N YT W MYAIGGSANPTI S+GN F+APN   +K++TKR V      W  W WRS  D 
Sbjct  296   NDYTSWGMYAIGGSANPTINSQGNRFLAPNNPFAKEITKRIVNADDHRWKGWNWRSEGDL  355

Query  467   FLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
              LNGAYF PSG G+ A Y   S     +  S V  LTA+AG L C
Sbjct  356   LLNGAYFTPSGRGAAANYARASSLAAKS-SSLVATLTAEAGVLHC  399



>ref|XP_011029589.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/351 (60%), Positives = 255/351 (73%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  54    NPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDPGNDDPVNPKPGTLRY  113

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  114   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  173

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P+H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  174   NIHDCKQGGNAYVRDSPSHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  233

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  234   TAITISNNYLTHHNKVMLLGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  293

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N Y+ W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +  W  W WRS  D  
Sbjct  294   NDYSHWKMYAIGGSADPTINSQGNRFLAPNDRFNKEVTKHEDAPQSEWKGWNWRSEGDLL  353

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G+ +  Y K+ S      S V ++TA AG L C    S+C
Sbjct  354   LNGAFFTASGAGA-SSSYAKASSLGARPSSLVSSITAGAGSLVCK-KGSRC  402



>ref|XP_007155507.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
 gb|ESW27501.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
Length=406

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD SD+    PKPGTLRY
Sbjct  58    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVVTDSSDDDAVTPKPGTLRY  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IANGPCITIQ VTN+IIHGI
Sbjct  118   AVIQEEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  178   NIHDCKQGGNAMVRDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+AP+   SK+VTK E   +  W  W WRS  D  
Sbjct  298   NDYTHWEMYAIGGSAEPTINSQGNRFVAPDDRFSKEVTKHEDAPESEWKGWNWRSEGDLL  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y ++ S      S V ++T +AG L C    S+C
Sbjct  358   VNGAFFTASGAGA-SSSYARASSLSARPSSLVGSITTNAGALTCR-KGSRC  406



>gb|KFK41187.1| hypothetical protein AALP_AA2G097000 [Arabis alpina]
Length=406

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/351 (60%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTDPSD    NPKPGTLR+
Sbjct  58    NPIDDCWRCDPKWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDPSDKDAVNPKPGTLRH  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRG +V IA G CIT+Q VTNIIIHGI
Sbjct  118   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGTSVHIAGGACITVQYVTNIIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             S+HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+  ADGLID IHGS
Sbjct  178   SIHDCKRKGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYLTHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W +W WRS  D F
Sbjct  298   NDYTHWHMYAIGGSAAPTINSQGNRFLAPNDRVFKEVTKYEDTPQSKWKHWNWRSEGDLF  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T++AG L C    S+C
Sbjct  358   LNGAFFTPSG-GGASSSYAKASSLSARPSSLVASVTSNAGALVCR-KGSRC  406



>ref|NP_001141589.1| uncharacterized protein LOC100273705 [Zea mays]
 gb|ACF86672.1| unknown [Zea mays]
 gb|AFW57904.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=466

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 254/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR  S+W +NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+ P NP+ GTLRY
Sbjct  118   NPIDDCWRCDSDWHNNRKRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDPVNPRKGTLRY  177

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ +TN+IIHG+
Sbjct  178   AVIQEEPLWIIFKRDMVITLKEELIMNSFKTIDGRGANVHIANGACITIQYITNVIIHGL  237

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S++W+DHC L+  ADGLID I GS
Sbjct  238   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGS  297

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  298   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  357

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR       W  W WRS  D  
Sbjct  358   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAHTVWKRWNWRSEGDLL  417

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V  +T DAG L C
Sbjct  418   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVGTITLDAGALSC  460



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 257/344 (75%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR  S+W SNR+ LADCG+GFG++A+GG+ G  YVVTDPSD+ P NP+ GTLR+
Sbjct  131   NPIDDCWRCDSDWHSNRQRLADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRH  190

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITL+ EL++NS KTIDGRGA V IANG C+TIQ VTN+IIHG+
Sbjct  191   AVIQEEPLWIIFKRDMVITLREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGL  250

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGD +SIF +S++W+DHC L+  ADGLID I GS
Sbjct  251   HIHDCRPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGS  310

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  311   TAITLSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  370

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W +W WRS  D  
Sbjct  371   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLL  430

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V  +T+DAG L C
Sbjct  431   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVGTITSDAGALSC  473



>gb|KFK28033.1| hypothetical protein AALP_AA8G463100 [Arabis alpina]
Length=411

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 236/312 (76%), Gaps = 3/312 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  61    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  120

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  121   AVIQDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  180

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  181   HIHDCKQGGNTYVRDSPEHYGYRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  240

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  241   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  300

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ SESK+VTK E   +  WS+W WRS  D  
Sbjct  301   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSESKEVTKHEDAPEDEWSHWNWRSEGDLL  360

Query  464   LNGAYFVPSGYG  429
             LNGA+F  SG G
Sbjct  361   LNGAFFRLSGAG  372



>ref|XP_006480190.1| PREDICTED: probable pectate lyase 8-like [Citrus sinensis]
Length=447

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 250/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR  S W   R+ LADC +GFG++AVGG+ G  YVV+DP D+   NPKPGTLR+
Sbjct  99    NPIDDCWRCDSRWYLRRKRLADCAIGFGRNAVGGRDGRYYVVSDPGDDDAVNPKPGTLRH  158

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRG  V IANG CITIQ +TN+IIHGI
Sbjct  159   AVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGI  218

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKP  +  VR +P+H G R  +DGDAISIF +S+IWIDH  L+  ADGLID I GS
Sbjct  219   NIHDCKPTGNAMVRSSPSHYGWRTMADGDAISIFGSSHIWIDHNSLSNCADGLIDAIMGS  278

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  279   TAITVSNNYFTHHNEVMLLGHSDSYTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  338

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W+MYAIGGSANPTI S+GN ++AP  + +K+VTKR       W  W WRS  D  
Sbjct  339   NDYTHWVMYAIGGSANPTINSQGNRYLAPENTFAKEVTKRVDTSTAVWRGWNWRSEGDML  398

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG GS A  Y ++ S      S V  LT++AG LRC
Sbjct  399   LNGAYFTPSGAGSGAS-YARASSLGAKSSSSVGTLTSNAGALRC  441



>gb|KDP46367.1| hypothetical protein JCGZ_10207 [Jatropha curcas]
Length=403

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADC +GFGK+A+GG+ G  YVVTD SD    NPKPGTLR+
Sbjct  55    NPIDDCWRCDPSWERNRQRLADCAIGFGKNAIGGRNGRIYVVTDTSDEDAVNPKPGTLRH  114

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS+KTIDGRGA+V IA GPCITI   TNIIIHG+
Sbjct  115   AVIQDEPLWIIFQRDMVIRLKQELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGL  174

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +G +RD+P H+G    SDGD ISIFS+ +IW+DHC L+   DGLID IHGS
Sbjct  175   HIHDCKRGGNGNIRDSPHHSGWWTQSDGDGISIFSSKHIWVDHCSLSNCQDGLIDAIHGS  234

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITIS+N+ T HDKVML GH+D+  +DK M++T+AFNHFG GL++RMPR R GY HV N
Sbjct  235   TAITISSNFMTHHDKVMLLGHSDSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVN  294

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+APN    K+VTK E   +  W +W WRS  D F
Sbjct  295   NDYTHWEMYAIGGSASPTINSQGNRFLAPNDRSKKEVTKHEHAPESEWMHWNWRSEGDLF  354

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G+ +  Y ++ S      + V ++T  AG L C    S+C
Sbjct  355   LNGAFFRRSGAGASSS-YGRAFSLSARPSTLVDSMTRTAGALSCR-RGSRC  403



>gb|KDO65869.1| hypothetical protein CISIN_1g013239mg [Citrus sinensis]
Length=447

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 250/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR  S W   R+ LADC +GFG++A+GG+ G  YVV+DP D+   NPKPGTLR+
Sbjct  99    NPIDDCWRCDSRWYLRRKRLADCAIGFGRNAIGGRDGRYYVVSDPGDDDAVNPKPGTLRH  158

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRG  V IANG CITIQ +TN+IIHGI
Sbjct  159   AVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGI  218

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKP  +  VR +P+H G R  +DGDAISIF +S+IWIDH  L+  ADGLID I GS
Sbjct  219   NIHDCKPTGNAMVRSSPSHYGWRTMADGDAISIFGSSHIWIDHNSLSNCADGLIDAIMGS  278

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  279   TAITVSNNYFTHHNEVMLLGHSDSYTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  338

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W+MYAIGGSANPTI S+GN ++AP  + +K+VTKR       W  W WRS  D  
Sbjct  339   NDYTHWVMYAIGGSANPTINSQGNRYLAPENTFAKEVTKRVDTSTAVWRGWNWRSEGDML  398

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG GS A  Y ++ S      S V  LT++AG LRC
Sbjct  399   LNGAYFTPSGAGSGAS-YARASSLGAKSSSSVGTLTSNAGALRC  441



>emb|CDY03964.1| BnaC02g36790D [Brassica napus]
Length=412

 Score =   419 bits (1078),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 245/344 (71%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPS-DNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK A+GG+ G  YVVTDP+ D+P NP+PGTLR+
Sbjct  64    NPIDDCWRCDPNWETNRQRLADCAIGFGKHAIGGRSGRIYVVTDPANDDPVNPRPGTLRH  123

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
                Q  PLWI+F +DMVI LK EL++ S KTIDGRG++V I +GPCI I   TNII+HGI
Sbjct  124   AVTQEEPLWIIFKRDMVIRLKKELIITSFKTIDGRGSSVHITDGPCIKIHYATNIIVHGI  183

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKPG +G +RD P H G    SDGDA+++F   ++WIDHC  +   DGLID IHGS
Sbjct  184   NIHDCKPGSAGMIRDGPRHTGWWVKSDGDAVALFGGRHVWIDHCSFSNCDDGLIDAIHGS  243

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  244   TAITISNNHMTHHDKVMLLGHHDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  303

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTIFS+GN F+APN   +K+VTK E   +  W +W WRS  D  
Sbjct  304   NDYTHWEMYAIGGSASPTIFSQGNRFLAPNTRFNKEVTKHEDAPESKWRHWNWRSEGDIL  363

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF  SG  S +  Y ++ S      S V ++T  AG L C
Sbjct  364   LNGAYFRQSGARSSST-YARASSLSARPSSLVGSITTTAGTLSC  406



>ref|XP_009628975.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=407

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 252/351 (72%), Gaps = 4/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  58    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ+ PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHGI
Sbjct  118   AVIQTEPLWIIFARDMVIQLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VR +P+H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  178   HVHDCKQGGNAMVRSSPSHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCKDGLIDAIMGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T HDKVML GH+D+ V+DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNFMTHHDKVMLLGHSDSYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+AP+   SK+VTK E   +  W NW WR+  D  
Sbjct  298   NDYTHWEMYAIGGSASPTINSQGNRFLAPDIRFSKEVTKHEDAPESEWKNWNWRTEGDLM  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGAYF  SG G+ +  Y K+ S      S V  L + +G L C    S+C
Sbjct  358   LNGAYFTQSGAGAKSSSYAKASSLSARPSSLVSNLVSGSGALNCR-KGSRC  407



>ref|XP_009625069.1| PREDICTED: putative pectate lyase 2 [Nicotiana tomentosiformis]
Length=376

 Score =   418 bits (1074),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 257/351 (73%), Gaps = 2/351 (1%)
 Frame = -3

Query  1379  AADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNP  1200
             +   A ++N IDSCWR+  NW+SNR+ALADC  GFG  A+GGK G  YVV D  D+P NP
Sbjct  19    SCSNAKTLNPIDSCWRSDPNWSSNRQALADCAKGFGSGALGGKGGAIYVVNDTDDDPVNP  78

Query  1199  KPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVT  1020
             KPGTLRYG IQ+ PLWI+F KDM+I L+NEL++NS KTIDGRGA VEI  GPCI+I  + 
Sbjct  79    KPGTLRYGVIQTEPLWIIFEKDMLINLRNELIINSFKTIDGRGAKVEIGLGPCISIDVIK  138

Query  1019  NIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGL  840
             N+IIHG+ +  C     G VR +PT    R G+DG+AI I ++SN+WIDHC+L RA +GL
Sbjct  139   NVIIHGVKIDICLRAPEGNVRISPTEVVFRPGTDGNAIIIRNSSNVWIDHCFLGRATEGL  198

Query  839   IDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRL  660
             +D+I  S  IT+SNN F +H+ VM  G+ D   +DK M VT+AFNHFGP L +R+PR+R 
Sbjct  199   LDIIFTSYDITVSNNIFFKHNWVMTLGNIDGFYQDKIMNVTIAFNHFGPYLNDRIPRIRY  258

Query  659   GYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKW  486
             GY H+ANN Y  W ++AI GS+ PTIFSEGNYF+A N    K+VT RE  +   W+ W W
Sbjct  259   GYVHIANNYYEPWGLHAISGSSEPTIFSEGNYFIASNNVTLKEVTHREYALPTVWAQWNW  318

Query  485   RSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             +SSKDKFLNGA+F  SG G+  P YT  QSFPVADGS+VP+LT+DAGPL+C
Sbjct  319   KSSKDKFLNGAFFNASGTGNPTPNYTSPQSFPVADGSQVPSLTSDAGPLQC  369



>ref|XP_004975047.1| PREDICTED: probable pectate lyase 15-like isoform X2 [Setaria 
italica]
Length=473

 Score =   421 bits (1083),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 256/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+   NP+ GTLRY
Sbjct  125   NPIDDCWRCDQDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPRKGTLRY  184

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V I+ G CITIQ V+N+IIHG+
Sbjct  185   GVIQDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGANVHISGGACITIQYVSNVIIHGL  244

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  245   HIHDCKPTGNAMVRSSPSHYGWRTIADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  304

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  305   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  364

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W +W WRS  D  
Sbjct  365   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTVWQSWNWRSEGDLL  424

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V ++T+DAG L C
Sbjct  425   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVGSITSDAGALSC  467



>emb|CDY11033.1| BnaA03g46920D [Brassica napus]
Length=406

 Score =   419 bits (1076),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 248/355 (70%), Gaps = 5/355 (1%)
 Frame = -3

Query  1367  ATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPG  1191
              T+ N ID CWR   +W S+R  LADC +GFGK+A+GG+ G  YVVTD  +D+P  PKPG
Sbjct  54    CTTGNPIDDCWRCDPHWESHRHRLADCAIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPG  113

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLR+  +Q  PLWI+F +DM I LK EL++NS KTIDGRGA+V IA GPC+TIQ VTNII
Sbjct  114   TLRHAVVQDEPLWIIFQRDMTIRLKEELIMNSFKTIDGRGASVHIAGGPCVTIQYVTNII  173

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             IHG+ +HDCK G +  VR +P H G R  SDGD +SIF  S++W+DHC L+   DGLID 
Sbjct  174   IHGVHIHDCKRGGNAMVRSSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDA  233

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             I GSTAIT+SNNY T HDKVML GH+D    DK M+VT+AFNHFG GL++RMPR R GY 
Sbjct  234   IMGSTAITLSNNYMTHHDKVMLLGHSDTYARDKNMQVTIAFNHFGEGLVQRMPRCRHGYF  293

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSS  477
             HV NN YT W MYAIGGSANPTI S+GN F+APN   SK+VTK E   +  W  W WRSS
Sbjct  294   HVVNNDYTHWEMYAIGGSANPTINSQGNRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSS  353

Query  476   KDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
              D  LNGA+F PSG G+ +  Y K+ S      S V  LT  +G L C    S+C
Sbjct  354   GDLLLNGAFFTPSG-GAQSSSYAKASSLGAKPSSLVGPLTVGSGALNCR-KGSRC  406



>ref|XP_010545988.1| PREDICTED: probable pectate lyase 22 [Tarenaya hassleriana]
Length=412

 Score =   419 bits (1077),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 247/349 (71%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK+A+GG+ G  YVVTDPSD +P NPKPGTLRY
Sbjct  64    NPIDDCWRCDPEWEKNRQRLADCAIGFGKNAIGGRDGKLYVVTDPSDSDPVNPKPGTLRY  123

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK ELM+NS KTIDGRGA+V IA GPCITIQ VTN+IIHG+
Sbjct  124   AVIQDEPLWIIFNRDMTIQLKEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGV  183

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  184   HIHDCKQGGNAMVRDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  243

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  244   TAITISNNHMTHHNKVMLLGHSDTYAQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  303

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+ N F+APN + SK+VTK E   +  W NW WRS  D F
Sbjct  304   NDYTHWEMYAIGGSAAPTINSQANRFLAPNIAFSKEVTKHEDAPENEWKNWNWRSEGDLF  363

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGA+F  SG    +  Y+K+ S      SRV  +T  AG L C   SS
Sbjct  364   LNGAFFRASG-KDVSSSYSKASSLSAQPSSRVGDITTTAGALNCKKGSS  411



>gb|AGC94753.1| putative pectate lyase [Euphorbia lathyris]
Length=404

 Score =   419 bits (1076),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 253/353 (72%), Gaps = 5/353 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTD-PSDNPGNPKPGTL  1185
             S N ID CWR   NW  NR+ LADC +GFGK A+GG+ G  YVVTD  +D+P  PKPGTL
Sbjct  54    SGNPIDDCWRCDPNWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSQNDDPVTPKPGTL  113

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             R+  IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA+V IA GPCITIQ VTN+IIH
Sbjct  114   RHAVIQEEPLWIIFERDMVITLKEELIMNSFKTIDGRGASVHIAEGPCITIQYVTNVIIH  173

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             GI++HDCK G +  VRD+P H G R  SDGD ISIF  S++WIDHC LA   DGLID IH
Sbjct  174   GINIHDCKSGGNAYVRDSPGHYGWRTISDGDGISIFGGSHVWIDHCSLANCNDGLIDAIH  233

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAITISNNY T H+KVML GH+D  ++DK M+VT+AFNHFG GL++RMPR R GY HV
Sbjct  234   GSTAITISNNYMTHHNKVMLLGHSDTFLQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHV  293

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKD  471
              NN Y+ W MYAIGGSANPTI S+GN F+APN   +K+VTK E   +  W NW WRS  D
Sbjct  294   VNNDYSHWEMYAIGGSANPTINSQGNRFLAPNDRFNKEVTKHEEAGEDEWKNWNWRSEGD  353

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
               LNGA+F  SG  + +  Y K+ S      S V ++TA AG L C    S+C
Sbjct  354   LLLNGAFFTKSGAAA-SSSYAKASSLGARPSSLVNSITAAAGALLCK-KGSRC  404



>gb|KHN34377.1| Putative pectate lyase 22 [Glycine soja]
Length=406

 Score =   419 bits (1076),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD   D+P  PKPGTLRY
Sbjct  58    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRY  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTN+IIHGI
Sbjct  118   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  178   NIHDCKQGGNAMVRDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK E   +  W  W WRS  D  
Sbjct  298   NDYTHWEMYAIGGSANPTINSQGNRFVAPDDRFSKEVTKHEDAAESEWKGWNWRSEGDLL  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y ++ S      S V ++T  AG L C    S+C
Sbjct  358   VNGAFFTASGAGA-SSSYARASSLSARPSSLVGSITTGAGALTCR-KGSRC  406



>dbj|BAB10560.1| pectate lyase [Arabidopsis thaliana]
Length=410

 Score =   419 bits (1076),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/351 (58%), Positives = 249/351 (71%), Gaps = 10/351 (3%)
 Frame = -3

Query  1451  AMAAAVIIIMPLLGIMGFVPTLNAAADK-------ATSMNVIDSCWRAKSNWASNRRALA  1293
             A+A+++ +  P L +      +N +  +         S N ID CWR   +W  NR+ LA
Sbjct  21    ALASSLPVSDPELVVEEVHRKINESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLA  80

Query  1292  DCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLK  1116
             DCG+GFGK+A+GG+ G  YVVTDP +D+P NP+PGTLRY  IQ  PLWI+F +DM I LK
Sbjct  81    DCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFKRDMTIQLK  140

Query  1115  NELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAG  936
              EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+ +HDCK G +  VRD+P H G
Sbjct  141   EELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYG  200

Query  935   RRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGH  756
              R  SDGD +SIF  S++W+DHC L+   DGLID I GSTAITISNNY T H+KVML GH
Sbjct  201   YRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGH  260

Query  755   NDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFS  576
             +D   +DK M+VT+AFNHFG GL++RMPR R GY HV NN YT W MYAIGGSANPTI S
Sbjct  261   SDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINS  320

Query  575   EGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFLNGAYFVPSGYG  429
             +GN F+AP+ S SK+VTK E   +  W NW WRS  D  LNGA+F  SG G
Sbjct  321   QGNRFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSEGDLLLNGAFFTYSGAG  371



>ref|XP_010239620.1| PREDICTED: probable pectate lyase 8 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   419 bits (1077),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/349 (58%), Positives = 256/349 (73%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  S+W +NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NPK GTLRY
Sbjct  76    NPIDDCWRCDSDWHNNRQRLADCGIGFGRNAIGGRDGKLYVVTDAGDDDPVNPKEGTLRY  135

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  136   AVIQDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  195

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF +S++W+DHC L+  ADGL+D I GS
Sbjct  196   HIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHVWVDHCSLSNCADGLVDAIMGS  255

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ ++DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  256   TAITVSNNYFTHHNEVMLLGHSDSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  315

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  316   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTTWKGWNWRSEGDLL  375

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGA+F PSG G+ +  Y+++ S      S V  +T+ AG L C   SS
Sbjct  376   LNGAFFTPSGAGA-SASYSRASSLGAKSSSMVGTITSGAGVLSCRKGSS  423



>emb|CDY41506.1| BnaA06g22590D [Brassica napus]
Length=413

 Score =   419 bits (1076),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 247/349 (71%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  63    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F++DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFSRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  183   HIHDCKQGGNTDVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S SK+VTK E   +  WS+W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFLAPDNSFSKEVTKHEDAPESEWSHWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVAD-GSRVPALTADAGPLRCSYSS  321
             LNGA+F  SG G          S   A   S V  +T  +G L C   S
Sbjct  363   LNGAFFTLSGAGPTKSSSYSRASSLAARPSSNVGEITISSGALSCKKGS  411



>ref|NP_568967.1| putative pectate lyase 22 [Arabidopsis thaliana]
 sp|Q93Z25.1|PLY22_ARATH RecName: Full=Probable pectate lyase 22; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL25610.1| AT5g63180/MDC12_15 [Arabidopsis thaliana]
 gb|AED97715.1| putative pectate lyase 22 [Arabidopsis thaliana]
Length=432

 Score =   419 bits (1077),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 202/351 (58%), Positives = 249/351 (71%), Gaps = 10/351 (3%)
 Frame = -3

Query  1451  AMAAAVIIIMPLLGIMGFVPTLNAAADK-------ATSMNVIDSCWRAKSNWASNRRALA  1293
             A+A+++ +  P L +      +N +  +         S N ID CWR   +W  NR+ LA
Sbjct  43    ALASSLPVSDPELVVEEVHRKINESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLA  102

Query  1292  DCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLK  1116
             DCG+GFGK+A+GG+ G  YVVTDP +D+P NP+PGTLRY  IQ  PLWI+F +DM I LK
Sbjct  103   DCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFKRDMTIQLK  162

Query  1115  NELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAG  936
              EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+ +HDCK G +  VRD+P H G
Sbjct  163   EELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYG  222

Query  935   RRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGH  756
              R  SDGD +SIF  S++W+DHC L+   DGLID I GSTAITISNNY T H+KVML GH
Sbjct  223   YRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGH  282

Query  755   NDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFS  576
             +D   +DK M+VT+AFNHFG GL++RMPR R GY HV NN YT W MYAIGGSANPTI S
Sbjct  283   SDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINS  342

Query  575   EGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFLNGAYFVPSGYG  429
             +GN F+AP+ S SK+VTK E   +  W NW WRS  D  LNGA+F  SG G
Sbjct  343   QGNRFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSEGDLLLNGAFFTYSGAG  393



>ref|XP_004975046.1| PREDICTED: probable pectate lyase 15-like isoform X1 [Setaria 
italica]
Length=509

 Score =   422 bits (1084),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 256/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+   NP+ GTLRY
Sbjct  161   NPIDDCWRCDQDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPRKGTLRY  220

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
             G IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V I+ G CITIQ V+N+IIHG+
Sbjct  221   GVIQDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGANVHISGGACITIQYVSNVIIHGL  280

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  281   HIHDCKPTGNAMVRSSPSHYGWRTIADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  340

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  341   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  400

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W +W WRS  D  
Sbjct  401   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTVWQSWNWRSEGDLL  460

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V ++T+DAG L C
Sbjct  461   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVGSITSDAGALSC  503



>dbj|BAK06362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   420 bits (1080),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 255/349 (73%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  S+W +NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NPK GTLRY
Sbjct  118   NPIDDCWRCDSDWHNNRQRLADCGIGFGRNAIGGRDGKIYVVTDAGDDDPVNPKKGTLRY  177

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITL  EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  178   AVIQDEPLWIIFKRDMVITLSQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  237

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF AS++W+DHC L+  ADGLID I GS
Sbjct  238   HIHDCRPTGNAMVRSSPSHYGWRTIADGDAVSIFGASHVWVDHCSLSNCADGLIDAIMGS  297

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ ++DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  298   TAITVSNNYFTHHNEVMLLGHSDSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  357

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  358   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTTWKAWNWRSEGDML  417

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGA+F PSG G+ +  Y+++ S      S V  +T+ AG L C   SS
Sbjct  418   LNGAFFTPSGAGA-SASYSRASSLGAKSSSMVATITSGAGALSCHKGSS  465



>ref|XP_009150377.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=413

 Score =   418 bits (1075),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 246/349 (70%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  63    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F++DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFSRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  183   HIHDCKQGGNTDVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S SK+VTK E   +  WS W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFLAPDNSFSKEVTKHEDAPESEWSRWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVAD-GSRVPALTADAGPLRCSYSS  321
             LNGA+F  SG G          S   A   S V  +T  +G L C   S
Sbjct  363   LNGAFFTLSGAGPTKSSSYSRASSLAARPSSNVGEITISSGALSCKKGS  411



>ref|XP_010918897.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   419 bits (1076),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 254/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADCG+GFG++AVGG+ G  Y VTDP  D+P NP+PGTLR+
Sbjct  78    NSIDDCWRCDPQWHRNRKRLADCGIGFGRNAVGGRDGRYYAVTDPGDDDPVNPRPGTLRH  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  138   AVIQEEPLWIVFKRDMVITLKEELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S+IW+DHC L+  ADGLID I GS
Sbjct  198   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H++VML GH+D+ V DK+M+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  258   TAITISNNYFTHHNEVMLLGHSDSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR       W +W WRS  D  
Sbjct  318   NDYTHWEMYAIGGSADPTINSQGNRYLAPADPFAKEVTKRVDTDASEWKSWNWRSEGDLL  377

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V ++T++AG L+C
Sbjct  378   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVASITSEAGVLQC  420



>ref|XP_003523121.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   418 bits (1074),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 209/361 (58%), Positives = 252/361 (70%), Gaps = 4/361 (1%)
 Frame = -3

Query  1394  PTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD  1215
             P  N       S N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVV D  D
Sbjct  47    PRRNLGYLSCGSGNPIDDCWRCDPNWEQNRQRLADCAIGFGKNAIGGRDGKIYVVEDDGD  106

Query  1214  NPG-NPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCI  1038
             +   NPKPGTLR+  IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V +A GPCI
Sbjct  107   DDAVNPKPGTLRHAVIQDEPLWIIFARDMVIQLKEELLMNSFKTIDGRGASVHVAGGPCI  166

Query  1037  TIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLA  858
             TIQ VTN+IIHGI +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+
Sbjct  167   TIQYVTNVIIHGIHIHDCKQGGNAMVRDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLS  226

Query  857   RAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIER  678
                DGLID IHGSTAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++R
Sbjct  227   NCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDKDMQVTIAFNHFGEGLVQR  286

Query  677   MPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKG  504
             MPR RLGY HV NN YT W MYAIGGSANPTI  +GN F+AP+   SK+VTKRE   +  
Sbjct  287   MPRCRLGYFHVVNNDYTHWEMYAIGGSANPTINCQGNRFVAPDDRFSKEVTKREDTPESE  346

Query  503   WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYS  324
             W +W WRS  D  +NGA+F  SG G+ +  Y ++ S      S V ++T  AG L C   
Sbjct  347   WQDWNWRSEGDLLVNGAFFTASGAGA-SSSYARASSLSARPSSLVGSITTGAGALSCKKG  405

Query  323   S  321
             S
Sbjct  406   S  406



>ref|XP_009137472.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   418 bits (1074),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/354 (58%), Positives = 248/354 (70%), Gaps = 5/354 (1%)
 Frame = -3

Query  1364  TSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGT  1188
             T+ N ID CWR   +W S+R  LADC +GFGK+A+GG+ G  YVVTD  +D+P  PKPGT
Sbjct  55    TTGNPIDDCWRRPPHWESHRHRLADCAIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGT  114

Query  1187  LRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIII  1008
             LR+  +Q  PLWI+F +DM I LK EL++NS KTIDGRGA+V IA GPC+TIQ VTNIII
Sbjct  115   LRHAVVQDEPLWIIFQRDMTIRLKEELIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIII  174

Query  1007  HGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVI  828
             HG+ +HDCK G +  VR +P H G R  SDGD +SIF  S++W+DHC L+   DGLID I
Sbjct  175   HGVHIHDCKRGGNAMVRSSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAI  234

Query  827   HGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAH  648
              GSTAIT+SNNY T HDKVML GH+D    DK M++T+AFNHFG GL++RMPR R GY H
Sbjct  235   MGSTAITLSNNYMTHHDKVMLLGHSDTYARDKNMQITIAFNHFGEGLVQRMPRCRHGYFH  294

Query  647   VANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSK  474
             V NN YT W MYAIGGSANPTI S+GN F+APN   SK+VTK E   +  W  W WRSS 
Sbjct  295   VVNNDYTHWEMYAIGGSANPTINSQGNRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSG  354

Query  473   DKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             D  LNGA+F PSG G+ +  Y K+ S      S V  LT  +G L C    S+C
Sbjct  355   DLLLNGAFFTPSG-GAQSSSYAKASSLGAKPSSLVGPLTVGSGALNCR-KGSRC  406



>emb|CDX92652.1| BnaC07g39100D [Brassica napus]
Length=406

 Score =   418 bits (1074),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 249/355 (70%), Gaps = 5/355 (1%)
 Frame = -3

Query  1367  ATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPG  1191
              T+ N ID CWR   +W ++R+ LADC +GFGK+A+GG+ G  YVVTD  +D+P  PKPG
Sbjct  54    CTTGNPIDDCWRCDPHWETHRQRLADCAIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPG  113

Query  1190  TLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNII  1011
             TLR+  +Q  PLWI+F +DM I LK EL++NS KTIDGRGA+V IA GPC+TIQ VTNII
Sbjct  114   TLRHAVVQDEPLWIIFQRDMTIRLKEELIMNSFKTIDGRGASVHIAGGPCVTIQYVTNII  173

Query  1010  IHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDV  831
             IHG+ +HDCK G +  VR +P H G R  SDGD +SIF  S++W+DHC L+   DGLID 
Sbjct  174   IHGVHIHDCKRGGNAMVRSSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDA  233

Query  830   IHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYA  651
             I GSTAIT+SNNY T HDKVML GH+D    DK M++T+AFNHFG GL++RMPR R GY 
Sbjct  234   IMGSTAITLSNNYMTHHDKVMLLGHSDTYARDKNMQITIAFNHFGEGLVQRMPRCRHGYF  293

Query  650   HVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSS  477
             HV NN YT W MYAIGGSANPTI S+GN F+APN   SK+VTK E   +  W  W WRSS
Sbjct  294   HVVNNDYTHWEMYAIGGSANPTINSQGNRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSS  353

Query  476   KDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
              D  LNGA+F PSG G+ +  Y K+ S      S V  LT  +G L C    S+C
Sbjct  354   GDLLLNGAFFTPSG-GAQSSSYAKASSLGAKPSSLVGPLTVGSGALNCR-KGSRC  406



>ref|XP_002526952.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF35439.1| Pectate lyase precursor, putative [Ricinus communis]
Length=396

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/350 (57%), Positives = 249/350 (71%), Gaps = 12/350 (3%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPGNPKPGTLRYG  1176
             N ID CWR   NW +NR+ LADC +GFGKDA+GG+ G  YVVT         KPGTLR+ 
Sbjct  57    NPIDDCWRCDPNWETNRKRLADCAIGFGKDAIGGRNGRFYVVT--------XKPGTLRHA  108

Query  1175  AIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGIS  996
              IQ  PLWI+F +DMVI LK EL++NS KTIDGRGA+V IANGPCITI   TNIIIHG++
Sbjct  109   VIQDEPLWIIFKRDMVIQLKQELVMNSFKTIDGRGASVHIANGPCITIHYATNIIIHGLN  168

Query  995   MHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGST  816
             +HDCK G +G +RD+P H G    SDGD +SIF++ +IW+DHC L+   DGLID IHGST
Sbjct  169   IHDCKQGGNGDIRDSPDHFGWWTQSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGST  228

Query  815   AITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANN  636
             AIT+SNN+FT HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV NN
Sbjct  229   AITLSNNFFTHHDKVMLLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNN  288

Query  635   RYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFL  462
              YT W MYAIGGSA+PTI S+GN F+AP+  E K+VTK E   +  W +W WRS  D+ L
Sbjct  289   DYTHWEMYAIGGSASPTINSQGNRFLAPDAREKKEVTKHEDAPESEWRHWNWRSEGDQLL  348

Query  461   NGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             NGA+F  SG G+ +  Y ++ S      S V ++T  AG L C    S+C
Sbjct  349   NGAFFRQSGAGASST-YARASSLSARPSSLVNSITRTAGALNCR-KGSRC  396



>ref|XP_009408120.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 252/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NP+PGTLRY
Sbjct  99    NPIDDCWRCDPDWHLNRKRLADCGIGFGRNALGGRDGQYYVVTDAGDDDPVNPRPGTLRY  158

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI F +DMVITLK EL++NS KT+DGRGA V IANG CITIQ +TN+IIHG+
Sbjct  159   AVIQDEPLWITFERDMVITLKEELIMNSFKTVDGRGANVHIANGACITIQDITNVIIHGL  218

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIFS+S+IW+DHC L+  ADGL+D + GS
Sbjct  219   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFSSSHIWVDHCSLSNCADGLVDAVVGS  278

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H++VML GH+D+ V DK+M+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  279   TAITISNNYFTHHNEVMLLGHSDSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  338

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN ++AP    +K+VTKR       W +W WRS  D  
Sbjct  339   NDYTHWEMYAIGGSANPTINSQGNRYLAPTDPFAKEVTKRVDTDASVWKSWNWRSEGDLL  398

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y ++ S      S V  LT++AG L C
Sbjct  399   LNGAYFTPSGAGA-SASYARASSLGAKPSSLVATLTSNAGVLSC  441



>ref|XP_010239619.1| PREDICTED: probable pectate lyase 8 isoform X1 [Brachypodium 
distachyon]
Length=450

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/349 (58%), Positives = 256/349 (73%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  S+W +NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NPK GTLRY
Sbjct  102   NPIDDCWRCDSDWHNNRQRLADCGIGFGRNAIGGRDGKLYVVTDAGDDDPVNPKEGTLRY  161

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  162   AVIQDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  221

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF +S++W+DHC L+  ADGL+D I GS
Sbjct  222   HIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHVWVDHCSLSNCADGLVDAIMGS  281

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ ++DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  282   TAITVSNNYFTHHNEVMLLGHSDSYLKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  341

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  342   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTTWKGWNWRSEGDLL  401

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGA+F PSG G+ +  Y+++ S      S V  +T+ AG L C   SS
Sbjct  402   LNGAFFTPSGAGA-SASYSRASSLGAKSSSMVGTITSGAGVLSCRKGSS  449



>ref|XP_010918895.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=451

 Score =   419 bits (1076),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 254/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADCG+GFG++AVGG+ G  Y VTDP  D+P NP+PGTLR+
Sbjct  103   NSIDDCWRCDPQWHRNRKRLADCGIGFGRNAVGGRDGRYYAVTDPGDDDPVNPRPGTLRH  162

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  163   AVIQEEPLWIVFKRDMVITLKEELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  222

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S+IW+DHC L+  ADGLID I GS
Sbjct  223   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGS  282

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H++VML GH+D+ V DK+M+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  283   TAITISNNYFTHHNEVMLLGHSDSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  342

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR       W +W WRS  D  
Sbjct  343   NDYTHWEMYAIGGSADPTINSQGNRYLAPADPFAKEVTKRVDTDASEWKSWNWRSEGDLL  402

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V ++T++AG L+C
Sbjct  403   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVASITSEAGVLQC  445



>ref|XP_010671109.1| PREDICTED: probable pectate lyase 5 [Beta vulgaris subsp. vulgaris]
Length=414

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 253/357 (71%), Gaps = 3/357 (1%)
 Frame = -3

Query  1397  VPTLNAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPS  1218
             V   N A +   + N ID CW+   NW  NR+ LADC +GFGK+AVGGK G  Y+V DPS
Sbjct  49    VSRRNLATNSCKTGNPIDDCWQCDKNWDENRQQLADCAIGFGKNAVGGKKGKIYIVKDPS  108

Query  1217  DNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCI  1038
             D+  NPK G+LRYG IQ+ PLWI+FAKDMVI L+  L++NS KTIDGRGA V IA+G CI
Sbjct  109   DDAINPKRGSLRYGVIQNEPLWIVFAKDMVIKLQQVLLINSFKTIDGRGANVHIADGACI  168

Query  1037  TIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLA  858
              I+ V NIIIHGI +HDCK G  G VR TPTH G R  SDGD ISI S+ +IW+DHC L+
Sbjct  169   VIEDVNNIIIHGIHIHDCKRGGIGYVRYTPTHYGWRSKSDGDGISIISSRHIWVDHCSLS  228

Query  857   RAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIER  678
             R  DGLID I GSTAITISNNY + H+KVML GHNDN+ +DK M+VT+A+NHFG GL++R
Sbjct  229   RCTDGLIDAIRGSTAITISNNYMSHHNKVMLLGHNDNHKQDKNMQVTIAYNHFGEGLVQR  288

Query  677   MPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKG  504
             MPR R GY HV NN YT W MYAIGGSA PTI S+GN F+AP+   +K+VTKRE  V+K 
Sbjct  289   MPRCRHGYFHVVNNDYTKWEMYAIGGSAEPTINSQGNRFLAPDNRFTKEVTKRENAVEKE  348

Query  503   WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             W  W WRS  D FLNGA FV SG  S +  Y K+ S      S V ++T  AG L C
Sbjct  349   WKKWNWRSEGDLFLNGAKFVNSGNES-SLLYAKAMSLSARPASLVASMTKKAGVLIC  404



>ref|XP_003549832.1| PREDICTED: probable pectate lyase 18 isoform 1 [Glycine max]
Length=406

 Score =   417 bits (1071),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD   D+P  PKPGTLRY
Sbjct  58    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRY  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA GPCITIQ VTN+IIHGI
Sbjct  118   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  178   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             T ITISNNY T HDKVML GH+D+  +DK+M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TGITISNNYMTHHDKVMLLGHSDSYTQDKSMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK E   +  W  W WRS  D  
Sbjct  298   NDYTHWEMYAIGGSANPTINSQGNRFVAPDDRFSKEVTKHEDAPESEWKGWNWRSEGDLL  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y ++ S      S V ++T  AG L C    S+C
Sbjct  358   VNGAFFTASGAGA-SSSYARASSLSARPSSLVGSITTGAGALSCR-KGSRC  406



>gb|AAG28907.1|AC008113_23 F12A21.12 [Arabidopsis thaliana]
Length=392

 Score =   416 bits (1070),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 218/394 (55%), Positives = 267/394 (68%), Gaps = 11/394 (3%)
 Frame = -3

Query  1469  FISSNLAMAAAVIIIMPLLGIMGFVPTLNAAADKATSM-----NVIDSCWRAKSNWASNR  1305
             F SS+  +   + II  LL I      +NA+      +     N ID CWR    W  NR
Sbjct  2     FKSSSFILLLNIGIITLLLCIY-ICRKINASRRNLGVLSCGTGNPIDDCWRCDPKWEKNR  60

Query  1304  RALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRYGAIQSAPLWIMFAKDMV  1128
             + LADC +GFGK A+GG+ G  YVVTD SD +  NPKPGTLR+  IQ  PLWI+FA+DMV
Sbjct  61    QRLADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMV  120

Query  1127  ITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTP  948
             I LK EL++NS KTIDGRGA+V IA G CIT+Q VTNIIIHG+++HDCK   +  VRD+P
Sbjct  121   IKLKEELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSP  180

Query  947   THAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVM  768
             +H G R  SDGDA+SIF  S++W+DHC L+  ADGLID IHGSTAITISNNY + H+KVM
Sbjct  181   SHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLSHHNKVM  240

Query  767   LFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANP  588
             L GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV NN YT W MYAIGGSA P
Sbjct  241   LLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAP  300

Query  587   TIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPY  414
             TI S+GN F+APN    K+VTK E   +  W  W WRS  D FLNGA+F PSG G  +  
Sbjct  301   TINSQGNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTPSG-GGASSS  359

Query  413   YTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             Y K+ S      S V ++T++AG L C    S+C
Sbjct  360   YAKASSLSARPSSLVASVTSNAGALFCR-KGSRC  392



>ref|XP_007209185.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
 gb|ABV32549.1| pectase lyase [Prunus persica]
 gb|EMJ10384.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
Length=413

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 249/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVVTD  DN P NPKPGTLR+
Sbjct  65    NPIDDCWRCDPNWEQNRQRLADCAIGFGKNAIGGRDGKIYVVTDSGDNDPVNPKPGTLRH  124

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  125   AVIQDEPLWIIFQRDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQFVTNIIIHGL  184

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKPG +  VR +P H G R  SDGD +SIF  S++W+DHC L+   DGL+D IHGS
Sbjct  185   HIHDCKPGGNAMVRSSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGS  244

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  EDK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  245   TAITISNNYMTHHDKVMLLGHSDSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  304

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+   SK+VTK E   +  W NW WRS  D  
Sbjct  305   NDYTHWEMYAIGGSANPTINSQGNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLM  364

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y ++ S      S V ++T  +G L C    S+C
Sbjct  365   INGAFFTASGAGA-SSSYARASSLGAKPSSLVGSITTASGALSCR-KGSRC  413



>emb|CDY48132.1| BnaCnng15740D [Brassica napus]
Length=428

 Score =   417 bits (1073),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 234/312 (75%), Gaps = 3/312 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  78    NPIDDCWRCDKDWEKNRKQLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  138   AVIQDQPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  198   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D  V+DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  258   TAITISNNYLTHHNKVMLLGHSDTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+APN    K+VTK E   +  WS+W WRS  D  
Sbjct  318   NDYTHWEMYAIGGSANPTINSQGNRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLM  377

Query  464   LNGAYFVPSGYG  429
             LNGA+F  SG G
Sbjct  378   LNGAFFTLSGAG  389



>gb|AEN70985.1| pectate lyase [Gossypium lobatum]
Length=411

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F APN   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F+ SG G+ +  Y ++ S      S V  +T +AG L C    S+C
Sbjct  363   VNGAFFIASGAGA-SSSYARASSLGARPSSLVATITTNAGALNCK-KGSRC  411



>ref|XP_009359518.1| PREDICTED: probable pectate lyase 18 [Pyrus x bretschneideri]
Length=411

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 249/348 (72%), Gaps = 4/348 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVVTD   DNP NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGRDGKIYVVTDSGDDNPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFQRDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPGHFGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK E   +  W NW WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFVAPDIRFSKEVTKHEDAPEGEWKNWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
             LNGA+F  SG G+ +  Y ++ S      S V ++T  AG L C   S
Sbjct  363   LNGAFFRASGAGA-SSSYARASSLGARPSSLVGSITTAAGALSCRKGS  409



>ref|XP_010023767.1| PREDICTED: probable pectate lyase 8 isoform X1 [Eucalyptus grandis]
 gb|KCW60135.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=444

 Score =   418 bits (1074),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 252/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADCG+GFG++A+GG+ G  YVVTDPSDN P NP+PGTLR+
Sbjct  96    NPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPSDNDPVNPRPGTLRH  155

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  156   AVIQDRPLWIVFKRDMVIVLKQELLMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  215

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  +R +PTH G R  +DGDA+SIF AS+IW+DH  L++ ADGL+D I GS
Sbjct  216   HIHDCKPTGNAMIRSSPTHYGWRTMADGDAVSIFGASHIWVDHNSLSKCADGLVDAIMGS  275

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  276   TAITISNNHMTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  335

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN + AP+   +K+VTKR       W +W WRS  D  
Sbjct  336   NDYTHWEMYAIGGSASPTINSQGNRYAAPSNPFAKEVTKRVDTATSQWKSWNWRSEGDLL  395

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y ++ S      S V ++T+ AGPL C
Sbjct  396   LNGAYFTPSGAGA-SASYARASSLGAKSSSMVGSITSGAGPLPC  438



>ref|XP_009112069.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=428

 Score =   417 bits (1072),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 234/312 (75%), Gaps = 3/312 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  78    NPIDDCWRCDKDWEKNRKQLADCGIGFGKNAIGGRDGEFYVVTDPGNDDPVNPKPGTLRY  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  138   AVIQDQPLWIIFIRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  198   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D  V+DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  258   TAITISNNYLTHHNKVMLLGHSDTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+APN    K+VTK E   +  WS+W WRS  D  
Sbjct  318   NDYTHWEMYAIGGSANPTINSQGNRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLM  377

Query  464   LNGAYFVPSGYG  429
             LNGA+F  SG G
Sbjct  378   LNGAFFTLSGAG  389



>ref|XP_010484044.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=413

 Score =   417 bits (1071),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 207/352 (59%), Positives = 253/352 (72%), Gaps = 5/352 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+AVGG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  63    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAVGGRDGEIYVVTDPGNDDPVNPKPGTLRY  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  123   AVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  183   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S+SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYG-SCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G + +  Y+K+ S      S V  +T  +G L C    S+C
Sbjct  363   LNGAFFTYSGAGPTKSSSYSKASSLAARPSSHVGEITVASGALSCK-RGSRC  413



>ref|XP_007037815.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY22316.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=404

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+AVGG+ G  YVVTD  +D+P NPKPGTLR+
Sbjct  56    NPIDDCWRCDPNWETNRQRLADCAIGFGKNAVGGRDGKIYVVTDSGNDDPVNPKPGTLRH  115

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  116   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGL  175

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF +S++W+DH  L+   DGL+D IHGS
Sbjct  176   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGSSHVWVDHNSLSNCKDGLVDAIHGS  235

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  236   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  295

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP    SK+VTK E   +  W  W WRS  D  
Sbjct  296   NDYTHWEMYAIGGSANPTINSQGNRFTAPEDRFSKEVTKHEDAPESEWKGWNWRSEGDLM  355

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F PSG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  356   VNGAFFTPSGAGA-SSSYAKASSLGARPSSLVATITTNAGALNCK-KGSRC  404



>emb|CDP04431.1| unnamed protein product [Coffea canephora]
Length=388

 Score =   416 bits (1068),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 246/354 (69%), Gaps = 48/354 (14%)
 Frame = -3

Query  1385  NAAADKATSMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG  1206
             N    K  ++N IDSCWR+   W SNR+ALA+C  GFG                      
Sbjct  74    NNTNSKTQTLNAIDSCWRSNPKWDSNRQALANCAKGFG----------------------  111

Query  1205  NPKPGTLRYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQG  1026
                                    +MV+ L+NEL++NS+KTIDGRG  VEIANGPCITIQ 
Sbjct  112   -----------------------NMVLKLENELIMNSYKTIDGRGVKVEIANGPCITIQN  148

Query  1025  VTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAAD  846
             V+++IIHGIS+H C  GK G VR TP H G R GSDGDAI++F++S++WIDH YLA  AD
Sbjct  149   VSHVIIHGISIHSCTLGKRGLVRSTPDHVGLRLGSDGDAITVFTSSHVWIDHNYLANCAD  208

Query  845   GLIDVIHGSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRV  666
             GL+DV+ GST++TISNNY+TQH++VMLFGH D N+ED+ MKVTV FNHFG GL++R+PRV
Sbjct  209   GLVDVVSGSTSVTISNNYYTQHEEVMLFGHRDGNIEDQIMKVTVVFNHFGYGLVQRIPRV  268

Query  665   RLGYAHVANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG---WSN  495
             R+GYAHVANN Y  WL YAIGGS+NPTI SEGNYF+APN++++KQVT+R+   G   W N
Sbjct  269   RVGYAHVANNFYEPWLFYAIGGSSNPTILSEGNYFIAPNRTDTKQVTRRDNAGGPNNWKN  328

Query  494   WKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             W WRS  D F+NGAYFV SG GSC P Y  SQ F VA G  VP+LT+DAGPL+C
Sbjct  329   WNWRSLDDVFVNGAYFVQSGNGSCYPNYNGSQVFTVASGDLVPSLTSDAGPLKC  382



>ref|XP_008812405.1| PREDICTED: probable pectate lyase 8 [Phoenix dactylifera]
Length=451

 Score =   418 bits (1074),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 250/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LA CG+GFG+ A+GG+ G  Y VTDP  D+P NP+PGTLR+
Sbjct  103   NPIDDCWRCDPKWHRNRKRLAGCGIGFGRSAIGGRDGRYYAVTDPRDDDPVNPRPGTLRH  162

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  163   AVIQEEPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  222

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGDA+SIF +S+IW+DHC L++ ADGL+D + GS
Sbjct  223   HIHDCKPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHCSLSKCADGLVDAVMGS  282

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H++VML GH+D+   DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  283   TAITISNNYFTHHNEVMLLGHSDSYERDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  342

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    G  W  W WRS  D  
Sbjct  343   NDYTHWEMYAIGGSAGPTINSQGNRYLAPANPFAKEVTKRVETDGSVWKRWNWRSEGDLL  402

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V  +T+ AG LRC
Sbjct  403   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVATMTSGAGALRC  445



>emb|CDY16732.1| BnaA09g06500D [Brassica napus]
Length=428

 Score =   417 bits (1072),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 234/312 (75%), Gaps = 3/312 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  78    NPIDDCWRCDKDWEKNRKQLADCGIGFGKNAIGGRDGEFYVVTDPGNDDPVNPKPGTLRY  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  138   AVIQDQPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  198   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D  V+DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  258   TAITISNNYLTHHNKVMLLGHSDTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+APN    K+VTK E   +  WS+W WRS  D  
Sbjct  318   NDYTHWEMYAIGGSANPTINSQGNRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLM  377

Query  464   LNGAYFVPSGYG  429
             LNGA+F  SG G
Sbjct  378   LNGAFFTLSGAG  389



>emb|CDY65626.1| BnaC03g74840D [Brassica napus]
Length=454

 Score =   418 bits (1074),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 235/312 (75%), Gaps = 3/312 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  104   NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  163

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  164   AVIQDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGL  223

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  224   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  283

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  284   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  343

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S SK+VTK E   +  WS+W WRS  D  
Sbjct  344   NDYTHWEMYAIGGSANPTINSQGNRFVAPDDSFSKEVTKHEDAPESEWSHWNWRSEGDLM  403

Query  464   LNGAYFVPSGYG  429
             LNGA+F  SG G
Sbjct  404   LNGAFFTLSGAG  415



>gb|EEE60442.1| hypothetical protein OsJ_13660 [Oryza sativa Japonica Group]
Length=443

 Score =   417 bits (1073),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 255/349 (73%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+   NPK GTLRY
Sbjct  95    NPIDDCWRCDPDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPKKGTLRY  154

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  155   AVIRDEPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  214

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  215   HIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  274

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  275   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  334

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  335   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLL  394

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSS  318
             LNGA+F PSG G+ +  Y+++ S      S V  +T+ AG L C   S+
Sbjct  395   LNGAFFTPSGAGA-SASYSRASSLGAKSSSMVGTITSGAGALSCRGGSA  442



>ref|XP_006653139.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Oryza brachyantha]
Length=483

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 238/310 (77%), Gaps = 3/310 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W +NR+ LADCG+GFG++A+GG+ G  YVVTDP  D+P NPKPGTLRY
Sbjct  116   NPIDDCWRCDPDWHNNRQRLADCGIGFGRNAIGGRDGKIYVVTDPGDDDPVNPKPGTLRY  175

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG C+TIQ VTNIIIHG+
Sbjct  176   AVIRDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACLTIQYVTNIIIHGL  235

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  236   HIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  295

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  296   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  355

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  356   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQSIWKGWNWRSEGDLL  415

Query  464   LNGAYFVPSG  435
             LNGA+F PSG
Sbjct  416   LNGAFFTPSG  425



>ref|XP_011072008.1| PREDICTED: probable pectate lyase 18 [Sesamum indicum]
Length=405

 Score =   416 bits (1069),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 224/387 (58%), Positives = 269/387 (70%), Gaps = 10/387 (3%)
 Frame = -3

Query  1448  MAAAVIIIMPLLGIMGFVPTLNAAADK-----ATSMNVIDSCWRAKSNWASNRRALADCG  1284
             +A++  +  P L +      LNA+  K       + N ID CWR   NW  NR+ LADC 
Sbjct  21    IASSPTLQDPELVVQEVHSKLNASRRKLGFLSCNTGNPIDDCWRCDPNWEQNRQKLADCA  80

Query  1283  VGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRYGAIQSAPLWIMFAKDMVITLKNEL  1107
             +GFGK+AVGG+ G  YVVTD   D+P NPKPGTLRY  IQ  PLWI+FA+DMVI LK EL
Sbjct  81    IGFGKNAVGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFARDMVIQLKEEL  140

Query  1106  MVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAGRRR  927
             ++NS KTIDGRGA+V IANGPCITIQ VTNIIIHGI +HDCK G +  VRD+P H G R 
Sbjct  141   IMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRDSPRHYGWRT  200

Query  926   GSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGHNDN  747
              SDGD +SIF  S++W+DHC L+   DGLID IHGSTAITISNNY T HDKVML GH+D+
Sbjct  201   ISDGDGVSIFGGSHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDS  260

Query  746   NVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFSEGN  567
               +DK M+VT+AFNHFG GL++RMPR R GY HV NN YT W MYAIGGSA+PTI S+GN
Sbjct  261   YTQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGN  320

Query  566   YFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKSQSF  393
              F+APN   SK+VTK E   +  W NW WRS  D  LNGAYF PSG G+ +  Y K+ S 
Sbjct  321   RFLAPNDRFSKEVTKHEDAPETEWKNWNWRSEGDLMLNGAYFTPSGAGA-SSSYAKASSL  379

Query  392   PVADGSRVPALTADAGPLRCSYSSSKC  312
                  S V ++T+ +G L C    S+C
Sbjct  380   GARPSSLVSSITSGSGALNCR-KGSRC  405



>ref|XP_009105097.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
 emb|CDY56520.1| BnaA07g38610D [Brassica napus]
Length=407

 Score =   416 bits (1069),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 248/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTD SD    NPKPGTLR+
Sbjct  59    NPIDDCWRCDPKWEKNRQRLADCAIGFGKHAIGGRDGRIYVVTDSSDKDAVNPKPGTLRH  118

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK ELM+NS KTIDGRGA+V IA G CIT+Q VTNIIIHG+
Sbjct  119   AVIQDEPLWIIFARDMVIKLKEELMMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGV  178

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+   DGL+D I GS
Sbjct  179   NIHDCKKRGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCDDGLVDAIRGS  238

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  239   TAITISNNYLTHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  298

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W NW WRS  D F
Sbjct  299   NDYTHWQMYAIGGSAAPTINSQGNRFLAPNDHVFKEVTKYEDAPQSKWKNWNWRSEGDLF  358

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T +AG L C    S+C
Sbjct  359   LNGAFFTPSG-GRASSSYAKASSLSARPSSLVASVTGNAGSLSCR-KGSRC  407



>gb|ADB90475.1| pectate lyase [Gossypium herbaceum]
Length=411

 Score =   416 bits (1070),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F APN   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F+ SG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  363   VNGAFFIASGAGA-SSSYAKASSLGARPSSLVATITTNAGALNCK-KGSRC  411



>ref|XP_010933172.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   417 bits (1071),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 252/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADCG+GFG++A+GG+ G  YVV+DP  D+P NP+ GTLR+
Sbjct  78    NSIDDCWRCDPKWHRNRKRLADCGIGFGRNAIGGRDGRYYVVSDPGDDDPVNPRRGTLRH  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITL+ EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  138   AVIQDEPLWIVFKRDMVITLQEELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S+IW+DHC L+  ADGLID I GS
Sbjct  198   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H+KVML GH+D+   DKAM+VT+AFNHFG  LI+RMPR R GY HV N
Sbjct  258   TAITISNNYFTHHNKVMLLGHSDSYKRDKAMQVTIAFNHFGEDLIQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR   +G  W NW WRS  D  
Sbjct  318   NDYTHWEMYAIGGSAEPTINSQGNRYLAPANPFAKEVTKRVNTEGRVWKNWNWRSEGDLL  377

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V  +T+DAG L+C
Sbjct  378   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVATITSDAGALQC  420



>ref|XP_010444201.1| PREDICTED: probable pectate lyase 22 isoform X3 [Camelina sativa]
Length=365

 Score =   414 bits (1065),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/352 (59%), Positives = 253/352 (72%), Gaps = 5/352 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  15    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  74

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  75    AVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  134

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  135   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  194

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  195   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  254

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S+SK+VTK E   +  W +W WRS  D  
Sbjct  255   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLM  314

Query  464   LNGAYFVPSGYG-SCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G + +  Y+K+ S      S V  +T  +G L C    S+C
Sbjct  315   LNGAFFTYSGAGPTKSSSYSKASSLAARPSSHVGEITVASGALSCK-RGSRC  365



>gb|KHG19997.1| hypothetical protein F383_02891 [Gossypium arboreum]
Length=411

 Score =   416 bits (1069),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 250/348 (72%), Gaps = 4/348 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F APN   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPNNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
             +NGA+F+ SG G+ +  Y K+ S      S V  +T +AG L C   S
Sbjct  363   VNGAFFIASGAGA-SSSYAKASSLGARPSSLVATITTNAGALNCKKGS  409



>ref|XP_006280553.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
 gb|EOA13451.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
Length=412

 Score =   416 bits (1069),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 250/349 (72%), Gaps = 4/349 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  62    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  121

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DM I LK EL++NS KT+DGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  122   AVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGL  181

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  182   HIHDCKQGGNTYVRDSPEHYGYRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  241

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  242   TAITISNNYMTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  301

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S+SK+VTK E   +  W  W WRS  D  
Sbjct  302   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSDSKEVTKHEDAPESEWQGWNWRSEGDLM  361

Query  464   LNGAYFVPSGYG-SCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSS  321
             LNGA+F  SG G + +  Y+K+ S      S V  +T  +G L C   S
Sbjct  362   LNGAFFRFSGAGPTKSSSYSKASSLAARPSSHVGEITVASGALSCKRGS  410



>ref|XP_010459939.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=412

 Score =   416 bits (1069),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 206/352 (59%), Positives = 253/352 (72%), Gaps = 5/352 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  62    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGQIYVVTDPGNDDPVNPKPGTLRY  121

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  122   AVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  181

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  182   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  241

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  242   TAITISNNYLTHHNKVMLLGHSDTYAQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  301

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S+SK+VTK E   +  W +W WRS  D  
Sbjct  302   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLM  361

Query  464   LNGAYFVPSGYG-SCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G + +  Y+K+ S      S V  +T  +G L C    S+C
Sbjct  362   LNGAFFTYSGAGPTKSSSYSKASSLAARPSSHVGEITVASGALSCK-RGSRC  412



>ref|XP_010023768.1| PREDICTED: probable pectate lyase 1 isoform X2 [Eucalyptus grandis]
 gb|KCW60136.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=427

 Score =   416 bits (1070),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 252/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADCG+GFG++A+GG+ G  YVVTDPSDN P NP+PGTLR+
Sbjct  79    NPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPSDNDPVNPRPGTLRH  138

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  139   AVIQDRPLWIVFKRDMVIVLKQELLMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  198

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  +R +PTH G R  +DGDA+SIF AS+IW+DH  L++ ADGL+D I GS
Sbjct  199   HIHDCKPTGNAMIRSSPTHYGWRTMADGDAVSIFGASHIWVDHNSLSKCADGLVDAIMGS  258

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  259   TAITISNNHMTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  318

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN + AP+   +K+VTKR       W +W WRS  D  
Sbjct  319   NDYTHWEMYAIGGSASPTINSQGNRYAAPSNPFAKEVTKRVDTATSQWKSWNWRSEGDLL  378

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y ++ S      S V ++T+ AGPL C
Sbjct  379   LNGAYFTPSGAGA-SASYARASSLGAKSSSMVGSITSGAGPLPC  421



>ref|XP_010444198.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
 ref|XP_010444199.1| PREDICTED: probable pectate lyase 22 isoform X1 [Camelina sativa]
 ref|XP_010444200.1| PREDICTED: probable pectate lyase 22 isoform X2 [Camelina sativa]
Length=413

 Score =   416 bits (1068),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 206/352 (59%), Positives = 253/352 (72%), Gaps = 5/352 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFGK+A+GG+ G  YVVTDP +D+P NPKPGTLRY
Sbjct  63    NPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRY  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCITIQ VTNIIIHG+
Sbjct  123   AVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID I GS
Sbjct  183   HIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D   +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+ S+SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYG-SCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G + +  Y+K+ S      S V  +T  +G L C    S+C
Sbjct  363   LNGAFFTYSGAGPTKSSSYSKASSLAARPSSHVGEITVASGALSCK-RGSRC  413



>ref|XP_010933171.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=452

 Score =   417 bits (1072),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 252/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADCG+GFG++A+GG+ G  YVV+DP  D+P NP+ GTLR+
Sbjct  104   NSIDDCWRCDPKWHRNRKRLADCGIGFGRNAIGGRDGRYYVVSDPGDDDPVNPRRGTLRH  163

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITL+ EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  164   AVIQDEPLWIVFKRDMVITLQEELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGL  223

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF +S+IW+DHC L+  ADGLID I GS
Sbjct  224   HIHDCKPTGNAMVRSSPSHYGWRTMADGDGVSIFGSSHIWVDHCSLSNCADGLIDAIMGS  283

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H+KVML GH+D+   DKAM+VT+AFNHFG  LI+RMPR R GY HV N
Sbjct  284   TAITISNNYFTHHNKVMLLGHSDSYKRDKAMQVTIAFNHFGEDLIQRMPRCRHGYFHVVN  343

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR   +G  W NW WRS  D  
Sbjct  344   NDYTHWEMYAIGGSAEPTINSQGNRYLAPANPFAKEVTKRVNTEGRVWKNWNWRSEGDLL  403

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG G+ +  Y+++ S      S V  +T+DAG L+C
Sbjct  404   LNGAYFTPSGAGA-SASYSRASSLGAKSSSMVATITSDAGALQC  446



>ref|NP_001242543.1| uncharacterized protein LOC100779940 precursor [Glycine max]
 gb|ACU21247.1| unknown [Glycine max]
Length=406

 Score =   415 bits (1067),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 249/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GGK G  YVVTD   D+P  PKPGTLRY
Sbjct  58    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRY  117

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK E ++NS KTIDGRGA+V IA GPCITIQ VTN+IIHGI
Sbjct  118   AVIQDEPLWIIFARDMVIKLKEERIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGI  177

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  178   NIHDCKQGGNAMVRDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  237

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  238   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  297

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S GN F+AP+   SK+VTK E   +  W  W WRS  D  
Sbjct  298   NDYTHWEMYAIGGSANPTINSRGNRFVAPDDRFSKEVTKHEDAAESEWKGWNWRSEGDLL  357

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y ++ S      S V ++T  AG L C    S+C
Sbjct  358   VNGAFFTASGAGA-SSSYARASSLSARPSSLVGSITTGAGALTCR-KGSRC  406



>ref|XP_009382167.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   416 bits (1069),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  + W  NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NP+PGTLRY
Sbjct  79    NPIDDCWRCDAEWHRNRKRLADCGIGFGRNAIGGREGRFYVVTDSGDDDPVNPRPGTLRY  138

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F + MVITL+ EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+
Sbjct  139   AVIQEEPLWIVFKRSMVITLEQELIMNSFKTIDGRGAEVHIANGACITIQFVTNIIIHGL  198

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGD +SIF AS+IW+DH  L+  ADGLID I GS
Sbjct  199   HIHDCKPTGNAMVRSSPSHYGWRTIADGDGVSIFGASHIWVDHNSLSNCADGLIDAIIGS  258

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNYFT H++V+L GH+D+ V DKAM+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  259   TAITISNNYFTNHNEVILLGHSDSYVRDKAMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  318

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR       W +W WRS  D  
Sbjct  319   NDYTHWEMYAIGGSADPTINSQGNRYLAPTNPFAKEVTKRVDTDSSVWKSWNWRSDDDLL  378

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGAYF  +  G  +  Y K+ S      S V ++T+DAG LRC    S+C
Sbjct  379   LNGAYFT-TSGGGSSGSYAKASSLGAKSSSMVGSITSDAGALRCR-KGSQC  427



>emb|CAE02420.2| OSJNBa0095E20.8 [Oryza sativa Japonica Group]
 emb|CAH65848.1| OSIGBa0147B06.7 [Oryza sativa Indica Group]
Length=472

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 253/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+   NPK GTLRY
Sbjct  124   NPIDDCWRCDPDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPKKGTLRY  183

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  184   AVIRDEPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  243

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  244   HIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  303

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  304   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  363

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  364   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLL  423

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGA+F PSG G+ +  Y+++ S      S V  +T+ AG L C
Sbjct  424   LNGAFFTPSGAGA-SASYSRASSLGAKSSSMVGTITSGAGALSC  466



>dbj|BAB59066.1| pectate lyase [Salix gilgiana]
Length=409

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  Y VTD   D+P NPKPGTLRY
Sbjct  61    NPIDDCWRCDPKWGENRQRLADCAIGFGKHAIGGRDGKIYAVTDSGDDDPVNPKPGTLRY  120

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI L+ EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  121   AVIQDEPLWIVFARDMVIKLREELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGV  180

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P+H G R  SDGD +SIF  S++W+DHC L+   DGLID IHGS
Sbjct  181   NIHDCKRGGNAHVRDSPSHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGS  240

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  241   TAITISNNYLTHHNKVMLLGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  300

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+APN   +K+VTK E   +  W  W WRS  D  
Sbjct  301   NDYTHWKMYAIGGSADPTINSQGNRFLAPNDRFNKEVTKHEDAPQSAWKGWNWRSEGDLL  360

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG G+ +  Y K+ S      S V ++TA AG L C    S+C
Sbjct  361   LNGAFFTASGAGA-SSSYAKASSLGARSSSLVSSITAGAGSLVCK-KGSRC  409



>gb|EEC76710.1| hypothetical protein OsI_14719 [Oryza sativa Indica Group]
Length=473

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 253/344 (74%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTDPSD+   NPK GTLRY
Sbjct  125   NPIDDCWRCDPDWHKNRQRLADCGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPKKGTLRY  184

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               I+  PLWI+F +DMVITLK EL++NS KTIDGRGA V IANG CITIQ VTN+IIHG+
Sbjct  185   AVIRDEPLWIVFKRDMVITLKQELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGL  244

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDC+P  +  VR +P+H G R  +DGDA+SIF AS+IW+DHC L+  ADGLID I GS
Sbjct  245   HIHDCRPTGNAMVRSSPSHYGWRTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGS  304

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+ V+DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  305   TAITVSNNYFTHHNEVMLLGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVN  364

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN ++AP    +K+VTKR    +  W  W WRS  D  
Sbjct  365   NDYTHWEMYAIGGSAEPTINSQGNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLL  424

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGA+F PSG G+ +  Y+++ S      S V  +T+ AG L C
Sbjct  425   LNGAFFTPSGAGA-SASYSRASSLGAKSSSMVGTITSGAGALSC  467



>ref|XP_010556943.1| PREDICTED: probable pectate lyase 1 [Tarenaya hassleriana]
Length=428

 Score =   416 bits (1068),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR  SNW  NR+ LADCG+GFG++A+GG+ G  YVVTDP  D+P NP+PGTLR+
Sbjct  78    NPIDDCWRCDSNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPRDDDPVNPRPGTLRH  137

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               +Q  PLWI+F +DMVI LK EL+VNS KTIDGRGA V IANG CIT+Q VTN+IIHG+
Sbjct  138   AVVQDRPLWIVFERDMVIQLKQELIVNSFKTIDGRGANVHIANGGCITVQFVTNVIIHGL  197

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR + TH G R  +DGDAISIF +S+IWIDH  L+  ADGL+D + GS
Sbjct  198   HIHDCKPTGNAMVRSSETHFGWRTMADGDAISIFGSSHIWIDHNSLSHCADGLVDAVMGS  257

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+F  H++VML GH+D+   DKAM+VT+AFNHFG GLI+RMPR R GY HV N
Sbjct  258   TAITISNNHFAHHNEVMLLGHSDSYTRDKAMQVTIAFNHFGIGLIQRMPRCRHGYFHVVN  317

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN + AP    +K+VTKR       W  W WRS  D  
Sbjct  318   NDYTHWEMYAIGGSADPTINSQGNRYAAPTNPFAKEVTKRVETPASKWKGWNWRSEGDML  377

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGAYF PSG G+   Y   S     +  S V A+T+DAG L C    S+C
Sbjct  378   LNGAYFTPSGAGASGSYARASSLAAKS-SSMVGAITSDAGALPCR-RGSRC  426



>gb|AEN70981.1| pectate lyase [Gossypium davidsonii]
 gb|AEN70982.1| pectate lyase [Gossypium klotzschianum]
Length=411

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F+ SG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  363   VNGAFFIASGAGA-SSSYAKASSLGARPSSLVATITTNAGALNCK-KGSRC  411



>ref|NP_564906.1| putative pectate lyase 5 [Arabidopsis thaliana]
 sp|Q9FXD8.2|PLY5_ARATH RecName: Full=Probable pectate lyase 5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL58893.1|AF462797_1 At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AAM26656.1| At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AEE34690.1| putative pectate lyase 5 [Arabidopsis thaliana]
Length=408

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTD SD +  NPKPGTLR+
Sbjct  60    NPIDDCWRCDPKWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRH  119

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA G CIT+Q VTNIIIHG+
Sbjct  120   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGV  179

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+  ADGLID IHGS
Sbjct  180   NIHDCKRKGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGS  239

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY + H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  240   TAITISNNYLSHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  299

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W  W WRS  D F
Sbjct  300   NDYTHWQMYAIGGSAAPTINSQGNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLF  359

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T++AG L C    S+C
Sbjct  360   LNGAFFTPSG-GGASSSYAKASSLSARPSSLVASVTSNAGALFCR-KGSRC  408



>ref|XP_010026892.1| PREDICTED: probable pectate lyase 18 [Eucalyptus grandis]
Length=408

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 249/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+AVGG+ G  YVVTD   D+P NPKPGT+R+
Sbjct  60    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAVGGRDGRIYVVTDSGDDDPVNPKPGTIRH  119

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  120   AVIQDEPLWIIFQRDMSIQLKEELIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGL  179

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VR +P H G R  SDGD +SIF  S+IW+DHC L+   DGLID I GS
Sbjct  180   HIHDCKQGGNANVRSSPRHYGWRTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIEGS  239

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  240   TAITISNNYMTHHDKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  299

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F AP+K  SK+VTK EV  +  W NW WRS  D  
Sbjct  300   NDYTHWEMYAIGGSADPTINSQGNRFTAPDKRFSKEVTKHEVAPQSEWRNWNWRSEGDLL  359

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  360   LNGAFFTPSGAGA-SSSYAKASSLGARPSSLVGTITGNAGTLGCK-KGSRC  408



>gb|AEN70964.1| pectate lyase [Gossypium laxum]
 gb|AEN70983.1| pectate lyase [Gossypium aridum]
Length=411

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F+ SG G+ +  Y ++ S      S V  +T +AG L C    S+C
Sbjct  363   VNGAFFIASGAGA-SSSYARASSLGARPSSLVATITTNAGALNCK-KGSRC  411



>gb|AEN70963.1| pectate lyase [Gossypium thurberi]
 gb|AEN70966.1| pectate lyase [Gossypium turneri]
 gb|AEN70979.1| pectate lyase [Gossypium armourianum]
 gb|AEN70980.1| pectate lyase [Gossypium harknessii]
 gb|AEN70986.1| pectate lyase [Gossypium trilobum]
Length=411

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWRCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F+ SG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  363   VNGAFFIASGAGA-SSSYAKASSLGARPSSLVATITTNAGALNCK-KGSRC  411



>gb|KDP30994.1| hypothetical protein JCGZ_11370 [Jatropha curcas]
Length=411

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVVTDP +D+P  PKPGTLR+
Sbjct  63    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGRNGRIYVVTDPGNDDPVTPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KT+DGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTLDGRGASVHIAGGPCITIQFVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VRD+P H G R  SDGD +SIF AS+IW+DH  L+   DGLID IHGS
Sbjct  183   HIHDCKQGGNAYVRDSPQHYGWRTISDGDGVSIFGASHIWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F+AP+   SK+VTK E   +  W NW WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFLAPDNRFSKEVTKHEDAPESEWRNWNWRSEGDLM  362

Query  464   LNGAYFVPSG  435
             +NGA+F  SG
Sbjct  363   MNGAFFKASG  372



>gb|AAK66161.1| pectate lyase [Fragaria x ananassa]
Length=368

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 247/344 (72%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADCG+GFG++A+GG+ G  YVVTDP+D+ P NP+PGTLR+
Sbjct  20    NPIDDCWRCDPNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPNDDDPVNPRPGTLRH  79

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTIDGRG  V IANG CITIQ VTN+I+HG+
Sbjct  80    AVIQDEPLWIVFKRDMVIQLKQELIMNSFKTIDGRGVNVHIANGACITIQFVTNVIVHGL  139

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGDAISIF +S+IW+DH  L+  ADGL+D + GS
Sbjct  140   HIHDCKPTGNAMVRSSPSHFGWRTMADGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGS  199

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  200   TAITISNNHLTHHNEVMLLGHSDSYTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  259

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN + AP    +K+VTKR    +  W  W WRS  D  
Sbjct  260   NDYTHWEMYAIGGSADPTINSQGNRYAAPTNPFAKEVTKRVETSQTQWRGWNWRSEGDLL  319

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGA+F PSG G+ A  Y ++ S      + V  +TA AG L C
Sbjct  320   LNGAFFTPSGAGASA-VYARASSLGAKSSAMVGTITASAGALGC  362



>ref|XP_010531484.1| PREDICTED: probable pectate lyase 5 [Tarenaya hassleriana]
Length=404

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR   +W  NR+ LADC +GFGK A+GG+ G  YVVTDP+D +P NPKPGTLR+
Sbjct  56    NPIDDCWRCDPHWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDPTDKDPVNPKPGTLRH  115

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRG++V IA G C+TIQ VTNIIIHGI
Sbjct  116   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGSSVHIAGGACVTIQYVTNIIIHGI  175

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK   +  VRD+P+H G R  SDGDAISIF  S++W+DHC L+   DGLID IHGS
Sbjct  176   NVHDCKRAGNTYVRDSPSHYGWRTASDGDAISIFGGSHVWVDHCSLSNCQDGLIDAIHGS  235

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  236   TAITISNNYMTHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  295

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W  W WRS  D F
Sbjct  296   NDYTHWQMYAIGGSAAPTINSQGNRFLAPNDRVFKEVTKYEDAPQSEWKKWNWRSEGDMF  355

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F  SG  + +  Y K+ S      + V ++TA+AG L C    S+C
Sbjct  356   LNGAFFTASGKAA-SSSYAKASSLAARPSTLVASVTANAGALVCK-KGSRC  404



>gb|KCW83228.1| hypothetical protein EUGRSUZ_B00168 [Eucalyptus grandis]
Length=484

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 249/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+AVGG+ G  YVVTD   D+P NPKPGT+R+
Sbjct  136   NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAVGGRDGRIYVVTDSGDDDPVNPKPGTIRH  195

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  196   AVIQDEPLWIIFQRDMSIQLKEELIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGL  255

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCK G +  VR +P H G R  SDGD +SIF  S+IW+DHC L+   DGLID I GS
Sbjct  256   HIHDCKQGGNANVRSSPRHYGWRTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIEGS  315

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  316   TAITISNNYMTHHDKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  375

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREV--KKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F AP+K  SK+VTK EV  +  W NW WRS  D  
Sbjct  376   NDYTHWEMYAIGGSADPTINSQGNRFTAPDKRFSKEVTKHEVAPQSEWRNWNWRSEGDLL  435

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  436   LNGAFFTPSGAGA-SSSYAKASSLGARPSSLVGTITGNAGTLGCK-KGSRC  484



>ref|XP_004299169.1| PREDICTED: probable pectate lyase 18-like [Fragaria vesca subsp. 
vesca]
Length=412

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 251/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P  PKPGTLR+
Sbjct  64    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAIGGRDGRIYVVTDSGDDDPVTPKPGTLRH  123

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DM I LK EL++NS KT+DGRGA+V I+ GPCIT+Q VTNIIIHG+
Sbjct  124   AVIQDEPLWIIFERDMSIKLKEELIMNSFKTLDGRGASVHISGGPCITVQYVTNIIIHGL  183

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKPG +  VRD+P H G R  SDGD +SIF  S++W+DHC L+  ADGL+D IHGS
Sbjct  184   NIHDCKPGGNAMVRDSPNHFGWRTISDGDGVSIFGGSHVWVDHCSLSNCADGLVDAIHGS  243

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  244   TAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  303

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+   SK+VTK E   +  W NW WRS  D  
Sbjct  304   NDYTHWEMYAIGGSANPTINSQGNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDML  363

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F  SG G+ +  Y K+ S      S V ++T  +G L C    S+C
Sbjct  364   INGAFFTASGAGA-SSSYAKASSLGARPSSLVGSITTTSGALNCR-KGSRC  412



>ref|XP_006443655.1| hypothetical protein CICLE_v10019202mg [Citrus clementina]
 gb|ESR56895.1| hypothetical protein CICLE_v10019202mg [Citrus clementina]
Length=661

 Score =   423 bits (1087),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 250/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDNPG-NPKPGTLRY  1179
             N ID CWR  S W   R+ LADC +GFG++AVGG+ G  YVV+DP D+   NPKPGTLR+
Sbjct  313   NPIDDCWRCDSRWYLRRKRLADCAIGFGRNAVGGRDGRYYVVSDPGDDDAVNPKPGTLRH  372

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTIDGRG  V IANG CITIQ +TN+IIHGI
Sbjct  373   AVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGI  432

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKP  +  VR +P+H G R  +DGDAISIF +S+IWIDH  L+  ADGLID I GS
Sbjct  433   NIHDCKPTGNAMVRSSPSHYGWRTMADGDAISIFGSSHIWIDHNSLSNCADGLIDAIMGS  492

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAIT+SNNYFT H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  493   TAITVSNNYFTHHNEVMLLGHSDSYTRDKVMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  552

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W+MYAIGGSANPTI S+GN ++AP  + +K+VTKR       W  W WRS  D  
Sbjct  553   NDYTHWVMYAIGGSANPTINSQGNRYLAPENTFAKEVTKRVDTSTAVWRGWNWRSEGDML  612

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGAYF PSG GS A  Y ++ S      S V  LT++AG LRC
Sbjct  613   LNGAYFTPSGAGSGAS-YARASSLGAKSSSSVGTLTSNAGALRC  655



>ref|XP_002887143.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63402.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   414 bits (1064),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR    W  NR+ LADC +GFGK A+GG+ G  YVVTD SD +  NPKPGTLR+
Sbjct  60    NPIDDCWRCNPKWEKNRQQLADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRH  119

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DMVI LK EL++NS KTIDGRGA+V IA G CITIQ VTNIIIHG+
Sbjct  120   AVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGACITIQYVTNIIIHGL  179

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK   +  VRD+P+H G R  SDGDA+SIF  S++W+DHC L+   DGLID IHGS
Sbjct  180   NIHDCKRKGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLSNCDDGLIDAIHGS  239

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T H+KVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  240   TAITISNNYLTHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  299

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA PTI S+GN F+APN    K+VTK E   +  W  W WRS  D F
Sbjct  300   NDYTHWQMYAIGGSAAPTINSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLF  359

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G  +  Y K+ S      S V ++T++AG L C    S+C
Sbjct  360   LNGAFFTPSG-GGASSSYAKASSLSARPSSLVASVTSNAGALFCR-KGSRC  408



>ref|XP_006854397.1| hypothetical protein AMTR_s00039p00186640 [Amborella trichopoda]
 gb|ERN15864.1| hypothetical protein AMTR_s00039p00186640 [Amborella trichopoda]
Length=435

 Score =   415 bits (1066),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 248/344 (72%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR   +WA +R+ LADC +GFGKDA+GG+ G  Y V DPSD +P  PKPGTLRY
Sbjct  87    NPIDDCWRCDPDWALHRKRLADCTIGFGKDAIGGRDGRYYTVVDPSDEDPITPKPGTLRY  146

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWIMF +DMVI LK EL+VN+ KTIDGRGA+V IA+G CITIQ V+++IIHG+
Sbjct  147   AVIQDEPLWIMFQRDMVIQLKQELIVNNFKTIDGRGASVHIADGACITIQYVSHVIIHGL  206

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +H CKP  +  VR +P H G R  +DGD +SIF +S++W+DHC L+  ADGL+D I GS
Sbjct  207   HIHGCKPTGNAMVRSSPRHYGWRTMADGDGVSIFGSSHVWVDHCSLSDCADGLVDAIMGS  266

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN F  HDKVML GH+D+   DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  267   TAITISNNQFNHHDKVMLLGHSDSYELDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  326

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN ++AP    +K+VTKR   +   W +W WRS +D  
Sbjct  327   NDYTHWEMYAIGGSASPTINSQGNRYLAPTNPFAKEVTKRVDTLSGVWKDWNWRSDRDMM  386

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             LNGA+F PSG G+ +  Y K+ S      S V ++T++AG L C
Sbjct  387   LNGAFFTPSGTGA-STVYAKASSLGAKSSSMVASMTSNAGALFC  429



>dbj|BAI94495.1| pectate lyase [Dianthus caryophyllus]
Length=407

 Score =   414 bits (1063),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 249/351 (71%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRY  1179
             N ID CWR   +W SNR+ LADC +GFGK+A+GGK G  YVVTD SDN P  PKPGTLR+
Sbjct  59    NPIDDCWRCDPDWESNRQRLADCAIGFGKNALGGKNGRIYVVTDSSDNDPVTPKPGTLRH  118

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTIDGRGA+V I+ GPCITIQ VTNIIIHGI
Sbjct  119   AVIQDEPLWIIFQRDMVIRLKEELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGI  178

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCKPG +  VR +P H G R  SDGD +S+F AS +W+DH  L+  ADGLID I GS
Sbjct  179   NVHDCKPGGNAMVRSSPRHYGWRTVSDGDGVSLFGASQVWVDHVSLSNCADGLIDAIMGS  238

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+   DK M+ T+AFNHFG GL++RMPR R GY HV N
Sbjct  239   TAITISNNYMTHHDKVMLLGHSDSYSPDKNMQATIAFNHFGEGLVQRMPRCRHGYFHVVN  298

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSA+PTI S+GN F+APN    K+VTK E   +  W NW WRS  D  
Sbjct  299   NDYTHWEMYAIGGSASPTINSQGNRFLAPNDRFKKEVTKHEDAPEGEWKNWNWRSEGDLM  358

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             LNGA+F PSG G+ +  Y ++ S      + V  LT  AG L C    S+C
Sbjct  359   LNGAFFTPSGAGA-SSSYARASSLGARPSTLVGTLTGSAGSLVCR-KGSRC  407



>gb|KDO69407.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=404

 Score =   414 bits (1063),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDPSD-NPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADC +GFGK+AVGG+ G  YVVTDP D +  NPKPGTLRY
Sbjct  56    NPIDDCWRCDPNWEKNRQRLADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRY  115

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCITIQ VTNIIIHG+
Sbjct  116   AVIQDEPLWIIFARDMTIRLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL  175

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  ++IW+DHC L+   DGL+D IHGS
Sbjct  176   NIHDCKKGGNAMVRDSPRHFGWRTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGS  235

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+ T HDKVML GH+D   +DK M+VT+AFNHFG GL++R+PR R GY HV N
Sbjct  236   TAITISNNFMTHHDKVMLLGHSDTYTQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVN  295

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+++ SK+VTK E   +  W NW WRS  D  
Sbjct  296   NDYTHWEMYAIGGSANPTINSQGNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLM  355

Query  464   LNGAYFVPSG  435
             +NGA+F  SG
Sbjct  356   VNGAFFTASG  365



>ref|XP_009371193.1| PREDICTED: probable pectate lyase 8 [Pyrus x bretschneideri]
Length=451

 Score =   416 bits (1068),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 249/342 (73%), Gaps = 2/342 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   +W  +R+ LA+CG+GFG++AVGG+ G  YVV +P +D+P NP+ GTLR+
Sbjct  105   NPIDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGRYYVVNNPGNDDPVNPRSGTLRH  164

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVITLK EL++NS KTID RG  V IA G CITIQ VTN+IIHG+
Sbjct  165   AVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDARGVNVHIAYGACITIQYVTNVIIHGL  224

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  +DGDAISIF +S+IWIDH  L++ ADGL+D I GS
Sbjct  225   HIHDCKPTGNAMVRSSPSHYGWRTMADGDAISIFGSSHIWIDHNSLSKCADGLVDAIMGS  284

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TA+TISNNYFT H++VML GH+D+ V DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  285   TALTISNNYFTHHNEVMLLGHSDSYVRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  344

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKREVKKGWSNWKWRSSKDKFLN  459
             N YT W MYAIGGSA PTI S+GN ++APN + +K+VT R     W +W WRS  D  LN
Sbjct  345   NDYTHWEMYAIGGSAEPTINSQGNRYLAPNNAFAKEVTHRVDPNDWKHWNWRSEGDLLLN  404

Query  458   GAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             GAYF+ SG GS A  Y ++ S      S V ++TA AG L C
Sbjct  405   GAYFIASGTGSGAS-YARASSLGAKSSSLVGSITASAGVLNC  445



>ref|XP_009400924.1| PREDICTED: probable pectate lyase 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   415 bits (1067),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 215/387 (56%), Positives = 264/387 (68%), Gaps = 14/387 (4%)
 Frame = -3

Query  1472  QFISSNLAMAAAVIIIMPLLGIMGFVPTLNAAADKATSMNVIDSCWRAKSNWASNRRALA  1293
             +FI++ + M    I     LG +              + N ID CWR    W  +R+ LA
Sbjct  69    EFIATEVEMQIGNITARRSLGYL----------STCVTGNPIDDCWRCDPEWHLHRKRLA  118

Query  1292  DCGVGFGKDAVGGKYGNTYVVTDPSDN-PGNPKPGTLRYGAIQSAPLWIMFAKDMVITLK  1116
             DCG+GFG+ A+GG+ G  Y VTDPSD+ P NP+PGTLRY  IQ  PLWI+F +DMVITLK
Sbjct  119   DCGIGFGRSAMGGRNGRFYRVTDPSDDDPVNPRPGTLRYAVIQDEPLWIVFKRDMVITLK  178

Query  1115  NELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGISMHDCKPGKSGTVRDTPTHAG  936
              EL++NS KTIDGRGA V IANG CITIQ VTNIIIHG+ +HDCKP  +  VR +P+H G
Sbjct  179   QELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYG  238

Query  935   RRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGSTAITISNNYFTQHDKVMLFGH  756
              R  +DGDAISIF +S+IW+DH  L+  ADGL+D I GSTAITISNNYFT H++VML GH
Sbjct  239   WRTIADGDAISIFGSSHIWVDHNSLSNCADGLVDAIMGSTAITISNNYFTHHNEVMLLGH  298

Query  755   NDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVANNRYTGWLMYAIGGSANPTIFS  576
             +D+ V DKAM+VT+AFNHFG GLI+RMPR R GY HV NN YT W MYAIGGSANPTI S
Sbjct  299   SDSYVRDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINS  358

Query  575   EGNYFMAPNKSESKQVTKREVKKG--WSNWKWRSSKDKFLNGAYFVPSGYGSCAPYYTKS  402
             + N ++AP    +K+VTKR       W +W WRS  D  LNGAYF PSG G+ +  Y+++
Sbjct  359   QSNRYLAPTNPFAKEVTKRVETSSDVWESWNWRSEGDLLLNGAYFTPSGAGA-SASYSRA  417

Query  401   QSFPVADGSRVPALTADAGPLRCSYSS  321
              S      S V ++TA AG L C   S
Sbjct  418   SSLGAKSSSMVGSITAGAGALPCRKGS  444



>gb|AEN70984.1| pectate lyase [Gossypium gossypioides]
Length=411

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/351 (59%), Positives = 252/351 (72%), Gaps = 5/351 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CW+   NW +NR+ LADC +GFGK+A+GG+ G  YVVTD   D+P NPKPGTLR+
Sbjct  63    NPIDDCWKCDPNWETNRQKLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRH  122

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+FA+DM I LK EL++NS KTIDGRGA+V IA GPCIT+Q VTNIIIHG+
Sbjct  123   AVIQDEPLWIIFARDMTIQLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGL  182

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
             ++HDCK G +  VRD+P H G R  SDGD +SIF  S++W+DH  L+   DGLID IHGS
Sbjct  183   NIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGS  242

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNNY T HDKVML GH+D+  +DK M+VT+AFNHFG GL++RMPR R GY HV N
Sbjct  243   TAITISNNYLTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVN  302

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKRE--VKKGWSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN F AP+   SK+VTK E   +  W +W WRS  D  
Sbjct  303   NDYTHWEMYAIGGSANPTINSQGNRFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLM  362

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRCSYSSSKC  312
             +NGA+F+ SG G+ +  Y K+ S      S V  +T +AG L C    S+C
Sbjct  363   VNGAFFIASGAGA-SSSYAKASSLGARPSSLVATITTNAGALNCK-KGSRC  411



>gb|AAF19196.1|AF206320_1 pectate lyase 2 [Musa acuminata AAA Group]
Length=454

 Score =   416 bits (1068),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 248/346 (72%), Gaps = 4/346 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTL  1185
             S N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NP+PGTL
Sbjct  104   SGNPIDDCWRCDPDWHVNRKKLADCGIGFGRNAIGGRDGELYVVTDSGDDDPVNPRPGTL  163

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RY  IQ  PLWI F  DM ITLK EL++NS KTIDGRG  V IANG CITIQ +TN+IIH
Sbjct  164   RYAVIQDVPLWITFKHDMEITLKEELIMNSFKTIDGRGVNVHIANGACITIQYITNVIIH  223

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             G+ +HDCKP  +  VR +P+H G R  +DGDA+SIF +S+IW+DHC L+  ADGL+D + 
Sbjct  224   GLHIHDCKPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHCSLSNCADGLVDAVM  283

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAIT+SNNYFT H++VML GH D+   D  M+VT+AFNHFG GLI+RMPR R GY HV
Sbjct  284   GSTAITVSNNYFTHHNEVMLLGHTDSYARDSIMQVTIAFNHFGEGLIQRMPRCRHGYFHV  343

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSANPTI S+GN ++AP    +K+VTKR    +  W NW WRS  D
Sbjct  344   VNNDYTHWEMYAIGGSANPTINSQGNRYLAPTNPFAKEVTKRVDTDQSTWKNWNWRSEGD  403

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
               LNGA+F PSG G+ +  Y ++ SF     S V  LT+DAG L C
Sbjct  404   LLLNGAFFTPSGAGA-SASYARASSFGAKPSSLVDTLTSDAGVLSC  448



>ref|XP_010106682.1| hypothetical protein L484_004616 [Morus notabilis]
 gb|EXC11270.1| hypothetical protein L484_004616 [Morus notabilis]
Length=397

 Score =   413 bits (1062),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 251/344 (73%), Gaps = 4/344 (1%)
 Frame = -3

Query  1355  NVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTLRY  1179
             N ID CWR   NW  NR+ LADCG+GFG++A+GG+ G  YVVTDP  D+P NPKPGTLR+
Sbjct  49    NPIDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPRDDDPVNPKPGTLRH  108

Query  1178  GAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIHGI  999
               IQ  PLWI+F +DMVI LK EL++NS KTIDGRG  V IANG CITIQ +TN+IIHG+
Sbjct  109   AVIQEEPLWIVFKRDMVIQLKQELIMNSFKTIDGRGVNVHIANGACITIQFITNVIIHGL  168

Query  998   SMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIHGS  819
              +HDCKP  +  VR +P+H G R  SDGDAISIF +S+IW+DH  L+  ADGL+D + GS
Sbjct  169   HIHDCKPTGNAMVRSSPSHFGWRTMSDGDAISIFGSSHIWVDHNSLSNCADGLVDAVMGS  228

Query  818   TAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHVAN  639
             TAITISNN+FT H++VML GH+D+   DK M+VT+A+NHFG GLI+RMPR R GY HV N
Sbjct  229   TAITISNNHFTHHNEVMLLGHSDSYTRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHVVN  288

Query  638   NRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR-EVKKG-WSNWKWRSSKDKF  465
             N YT W MYAIGGSANPTI S+GN + APN   +K+VTKR +   G W NW WRS  D  
Sbjct  289   NDYTHWEMYAIGGSANPTINSQGNRYAAPNNRFAKEVTKRVDTSTGVWKNWNWRSEGDLL  348

Query  464   LNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
             +NGAYF PSG G+ +  Y ++ S      S V A+TA +G L C
Sbjct  349   VNGAYFTPSGAGA-SASYARASSLGAKSSSMVGAITATSGALGC  391



>ref|XP_009385867.1| PREDICTED: probable pectate lyase 8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=454

 Score =   415 bits (1067),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/346 (59%), Positives = 248/346 (72%), Gaps = 4/346 (1%)
 Frame = -3

Query  1361  SMNVIDSCWRAKSNWASNRRALADCGVGFGKDAVGGKYGNTYVVTDP-SDNPGNPKPGTL  1185
             S N ID CWR   +W  NR+ LADCG+GFG++A+GG+ G  YVVTD   D+P NP+PGTL
Sbjct  104   SGNPIDDCWRCDPDWHVNRKKLADCGIGFGRNAIGGRDGELYVVTDSGDDDPVNPRPGTL  163

Query  1184  RYGAIQSAPLWIMFAKDMVITLKNELMVNSHKTIDGRGATVEIANGPCITIQGVTNIIIH  1005
             RY  IQ  PLWI F  DM ITLK EL++NS KTIDGRG  V IANG CITIQ +TN+IIH
Sbjct  164   RYAVIQDVPLWITFKHDMEITLKEELIMNSFKTIDGRGVNVHIANGACITIQYITNVIIH  223

Query  1004  GISMHDCKPGKSGTVRDTPTHAGRRRGSDGDAISIFSASNIWIDHCYLARAADGLIDVIH  825
             G+ +HDCKP  +  VR +P+H G R  +DGDA+SIF +S+IW+DHC L+  ADGL+D + 
Sbjct  224   GLHIHDCKPTGNAMVRSSPSHYGWRTMADGDAVSIFGSSHIWVDHCSLSNCADGLVDAVM  283

Query  824   GSTAITISNNYFTQHDKVMLFGHNDNNVEDKAMKVTVAFNHFGPGLIERMPRVRLGYAHV  645
             GSTAIT+SNNYFT H++VML GH D+   D  M+VT+AFNHFG GLI+RMPR R GY HV
Sbjct  284   GSTAITVSNNYFTHHNEVMLLGHTDSYARDSIMQVTIAFNHFGEGLIQRMPRCRHGYFHV  343

Query  644   ANNRYTGWLMYAIGGSANPTIFSEGNYFMAPNKSESKQVTKR--EVKKGWSNWKWRSSKD  471
              NN YT W MYAIGGSANPTI S+GN ++AP    +K+VTKR    +  W NW WRS  D
Sbjct  344   VNNDYTHWEMYAIGGSANPTINSQGNRYLAPTNPFAKEVTKRVDTDQSTWKNWNWRSEGD  403

Query  470   KFLNGAYFVPSGYGSCAPYYTKSQSFPVADGSRVPALTADAGPLRC  333
               LNGA+F PSG G+ +  Y ++ SF     S V  LT+DAG L C
Sbjct  404   LLLNGAFFTPSGAGA-SASYARASSFGAKPSSLVDTLTSDAGVLSC  448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4042190923560