BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78271_g1_i1 len=536 path=[1:0-535]

Length=536
                                                                      Score     E

gb|EYU45876.1|  hypothetical protein MIMGU_mgv1a022443mg                113   9e-29   
ref|XP_006343129.1|  PREDICTED: putative lipid-transfer protein D...    109   8e-27   
ref|XP_002268742.1|  PREDICTED: putative lipid-transfer protein DIR1    107   2e-26   Vitis vinifera
emb|CBI39455.3|  unnamed protein product                                107   2e-26   
ref|XP_004296699.1|  PREDICTED: putative lipid-transfer protein D...    106   7e-26   
ref|XP_009790835.1|  PREDICTED: LOW QUALITY PROTEIN: putative lip...    107   2e-25   
ref|XP_009595290.1|  PREDICTED: LOW QUALITY PROTEIN: putative lip...    105   4e-25   
gb|AEB33951.1|  defective in induced resistance 3 protein               105   4e-25   
ref|XP_010318493.1|  PREDICTED: putative lipid-transfer protein DIR1    103   1e-24   
emb|CDO97873.1|  unnamed protein product                                102   1e-24   
ref|XP_006443147.1|  hypothetical protein CICLE_v10022967mg             102   2e-24   
ref|XP_008387060.1|  PREDICTED: putative lipid-transfer protein DIR1    101   4e-24   
ref|XP_002529688.1|  lipid binding protein, putative                    101   6e-24   Ricinus communis
ref|XP_007223557.1|  hypothetical protein PRUPE_ppa013722mg             101   6e-24   
ref|XP_008386755.1|  PREDICTED: putative lipid-transfer protein DIR1    101   6e-24   
ref|XP_008222678.1|  PREDICTED: putative lipid-transfer protein DIR1    101   6e-24   
ref|XP_002529687.1|  lipid binding protein, putative                  99.8    1e-23   Ricinus communis
ref|XP_010241749.1|  PREDICTED: putative lipid-transfer protein DIR1  99.8    2e-23   
gb|KDO50536.1|  hypothetical protein CISIN_1g046518mg                 99.4    2e-23   
ref|XP_009339893.1|  PREDICTED: putative lipid-transfer protein DIR1  99.8    3e-23   
ref|XP_009339897.1|  PREDICTED: putative lipid-transfer protein DIR1  99.4    4e-23   
ref|XP_008386579.1|  PREDICTED: putative lipid-transfer protein DIR1  99.0    5e-23   
ref|XP_004296700.1|  PREDICTED: putative lipid-transfer protein D...  97.8    1e-22   
gb|KDP42884.1|  hypothetical protein JCGZ_23826                       97.4    2e-22   
ref|XP_006606947.1|  PREDICTED: putative lipid-transfer protein D...  94.7    1e-21   
ref|XP_002320450.2|  hypothetical protein POPTR_0014s14740g           94.4    2e-21   Populus trichocarpa [western balsam poplar]
gb|KHN27145.1|  Putative lipid-transfer protein DIR1                  94.0    2e-21   
gb|ABK93190.1|  unknown                                               94.0    3e-21   Populus trichocarpa [western balsam poplar]
gb|ACM90158.1|  trypsin-alpha amylase inhibitor                       92.0    1e-20   Jatropha curcas
ref|XP_010241751.1|  PREDICTED: putative lipid-transfer protein DIR1  89.7    1e-19   
gb|EYU21344.1|  hypothetical protein MIMGU_mgv1a016805mg              88.6    4e-19   
ref|XP_008792988.1|  PREDICTED: putative lipid-transfer protein DIR1  88.2    5e-19   
ref|XP_006590235.1|  PREDICTED: putative lipid-transfer protein D...  86.3    3e-18   
gb|KHN37258.1|  Putative lipid-transfer protein DIR1                  85.9    3e-18   
ref|XP_010069361.1|  PREDICTED: putative lipid-transfer protein DIR1  87.0    6e-18   
ref|XP_010258605.1|  PREDICTED: putative lipid-transfer protein DIR1  85.1    6e-18   
ref|XP_009604201.1|  PREDICTED: putative lipid-transfer protein DIR1  84.3    2e-17   
ref|XP_010908873.1|  PREDICTED: putative lipid-transfer protein DIR1  84.0    2e-17   
gb|AFK37599.1|  unknown                                               83.6    3e-17   
ref|XP_009782537.1|  PREDICTED: putative lipid-transfer protein DIR1  82.4    7e-17   
gb|AEB33949.1|  defective in induced resistance 1 protein             82.4    8e-17   
ref|XP_010069597.1|  PREDICTED: putative lipid-transfer protein DIR1  79.0    1e-15   
gb|KDP42880.1|  hypothetical protein JCGZ_23822                       78.6    2e-15   
ref|XP_008775676.1|  PREDICTED: putative lipid-transfer protein DIR1  77.8    4e-15   
ref|XP_009379984.1|  PREDICTED: putative lipid-transfer protein DIR1  77.0    7e-15   
gb|KHG11809.1|  Putative lipid-transfer DIR1 -like protein            76.6    9e-15   
ref|XP_007142607.1|  hypothetical protein PHAVU_007G001800g           76.3    1e-14   
ref|XP_008453924.1|  PREDICTED: putative lipid-transfer protein DIR1  76.3    2e-14   
gb|EYU46119.1|  hypothetical protein MIMGU_mgv1a022331mg              75.5    2e-14   
ref|XP_004229235.1|  PREDICTED: putative lipid-transfer protein DIR1  75.5    3e-14   
gb|EPS67451.1|  hypothetical protein M569_07329                       75.1    3e-14   
ref|XP_004152081.1|  PREDICTED: putative lipid-transfer protein D...  75.1    3e-14   
ref|XP_006342794.1|  PREDICTED: putative lipid-transfer protein D...  74.7    5e-14   
ref|XP_003622804.1|  hypothetical protein MTR_7g052640                74.3    7e-14   
ref|XP_011080533.1|  PREDICTED: putative lipid-transfer protein DIR1  73.9    8e-14   
emb|CEG62452.1|  Lipid binding/ Lipid transporter protein             73.2    2e-13   
ref|XP_004290137.1|  PREDICTED: putative lipid-transfer protein D...  73.2    2e-13   
emb|CDP03961.1|  unnamed protein product                              72.8    3e-13   
ref|XP_002283832.1|  PREDICTED: putative lipid-transfer protein DIR1  72.4    4e-13   Vitis vinifera
ref|XP_009396800.1|  PREDICTED: putative lipid-transfer protein DIR1  72.0    4e-13   
ref|XP_009399057.1|  PREDICTED: putative lipid-transfer protein DIR1  71.6    7e-13   
ref|XP_007049604.1|  Defective in induced resistance 1 protein        71.2    9e-13   
ref|XP_008369792.1|  PREDICTED: putative lipid-transfer protein DIR1  70.9    1e-12   
ref|XP_009358980.1|  PREDICTED: putative lipid-transfer protein DIR1  70.9    1e-12   
gb|EMS50543.1|  Putative lipid-transfer protein DIR1                  70.1    2e-12   
ref|XP_009342728.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    2e-12   
ref|XP_010908200.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    3e-12   
ref|NP_001059387.1|  Os07g0287400                                     70.1    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011092905.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    3e-12   
ref|XP_007200118.1|  hypothetical protein PRUPE_ppa018886mg           69.3    4e-12   
gb|EYU46116.1|  hypothetical protein MIMGU_mgv1a025642mg              68.9    5e-12   
ref|XP_008236806.1|  PREDICTED: putative lipid-transfer protein DIR1  68.9    6e-12   
ref|XP_008358527.1|  PREDICTED: putative lipid-transfer protein DIR1  68.6    8e-12   
gb|EMT01414.1|  hypothetical protein F775_28625                       68.2    9e-12   
ref|XP_006423199.1|  hypothetical protein CICLE_v10029642mg           68.6    1e-11   
ref|XP_008235902.1|  PREDICTED: putative lipid-transfer protein DIR1  68.2    1e-11   
ref|NP_001236410.1|  uncharacterized protein LOC100305511 precursor   67.8    1e-11   
ref|XP_006845077.1|  hypothetical protein AMTR_s00005p00100950        68.2    2e-11   
ref|XP_002527254.1|  lipid binding protein, putative                  67.4    2e-11   Ricinus communis
ref|XP_008236785.1|  PREDICTED: putative lipid-transfer protein DIR1  67.4    3e-11   
ref|XP_007200072.1|  hypothetical protein PRUPE_ppa021237mg           67.4    3e-11   
ref|NP_001236926.1|  uncharacterized protein LOC100527244 precursor   66.6    4e-11   
ref|XP_004292336.1|  PREDICTED: putative lipid-transfer protein D...  67.0    4e-11   
ref|XP_006845070.1|  hypothetical protein AMTR_s00005p00084040        67.0    5e-11   
gb|KFK31324.1|  hypothetical protein AALP_AA6G097600                  66.2    6e-11   
ref|NP_001238322.1|  uncharacterized protein LOC100305636             66.2    6e-11   
ref|XP_007140732.1|  hypothetical protein PHAVU_008G137100g           65.9    8e-11   
gb|KDO51453.1|  hypothetical protein CISIN_1g042956mg                 65.9    9e-11   
gb|KDP45250.1|  hypothetical protein JCGZ_15115                       65.9    9e-11   
gb|AFK44652.1|  unknown                                               65.5    1e-10   
gb|KDP46220.1|  hypothetical protein JCGZ_10060                       65.1    2e-10   
ref|XP_007200836.1|  hypothetical protein PRUPE_ppa026221mg           64.7    2e-10   
gb|KEH30405.1|  Lipid transfer protein                                64.7    2e-10   
gb|AFK40872.1|  unknown                                               64.7    2e-10   
ref|XP_002301823.1|  hypothetical protein POPTR_0002s25240g           64.3    3e-10   Populus trichocarpa [western balsam poplar]
gb|AFK43895.1|  unknown                                               64.3    3e-10   
dbj|BAJ87124.1|  predicted protein                                    63.9    3e-10   
ref|XP_006845076.1|  hypothetical protein AMTR_s00005p00099640        64.7    4e-10   
ref|XP_010493672.1|  PREDICTED: putative lipid-transfer protein DIR1  63.5    5e-10   
ref|NP_001237117.1|  uncharacterized protein LOC100527769             63.5    5e-10   
ref|XP_006657616.1|  PREDICTED: putative lipid-transfer protein D...  63.5    5e-10   
ref|XP_009403612.1|  PREDICTED: putative lipid-transfer protein DIR1  63.5    5e-10   
gb|KEH30406.1|  Lipid transfer protein                                63.5    5e-10   
ref|XP_009375630.1|  PREDICTED: putative lipid-transfer protein DIR1  63.5    6e-10   
ref|XP_004492249.1|  PREDICTED: putative lipid-transfer protein D...  63.5    6e-10   
ref|XP_009364632.1|  PREDICTED: putative lipid-transfer protein DIR1  63.5    6e-10   
ref|XP_009339389.1|  PREDICTED: putative lipid-transfer protein DIR1  63.2    7e-10   
gb|AAM28295.1|  PVR3-like protein                                     63.2    8e-10   Ananas comosus
ref|XP_008809954.1|  PREDICTED: putative lipid-transfer protein DIR1  63.2    8e-10   
ref|XP_006281372.1|  hypothetical protein CARUB_v10027430mg           62.8    9e-10   
ref|XP_010252660.1|  PREDICTED: putative lipid-transfer protein DIR1  62.8    1e-09   
ref|XP_009335428.1|  PREDICTED: putative lipid-transfer protein DIR1  63.2    1e-09   
ref|XP_010442271.1|  PREDICTED: putative lipid-transfer protein DIR1  62.4    1e-09   
ref|XP_004230985.1|  PREDICTED: putative lipid-transfer protein DIR1  62.8    1e-09   
gb|KHG12015.1|  Putative lipid-transfer DIR1 -like protein            62.8    1e-09   
ref|XP_006856839.1|  hypothetical protein AMTR_s00055p00181150        63.2    1e-09   
ref|XP_008779441.1|  PREDICTED: putative lipid-transfer protein DIR1  62.4    1e-09   
ref|XP_004292000.1|  PREDICTED: putative lipid-transfer protein D...  62.4    1e-09   
ref|XP_009797273.1|  PREDICTED: putative lipid-transfer protein DIR1  62.4    1e-09   
gb|AAM62457.1|  unknown                                               62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482097.1|  PREDICTED: putative lipid-transfer protein DIR1  62.0    2e-09   
ref|NP_568699.1|  putative lipid-transfer protein DIR1                62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365510.1|  PREDICTED: putative lipid-transfer protein D...  62.0    2e-09   
gb|EYU42633.1|  hypothetical protein MIMGU_mgv1a024655mg              62.0    2e-09   
ref|XP_006448002.1|  hypothetical protein CICLE_v10017274mg           61.6    2e-09   
gb|AEB33950.1|  defective in induced resistance 2 protein             61.6    2e-09   
ref|XP_006492236.1|  PREDICTED: putative lipid-transfer protein D...  61.6    2e-09   
ref|NP_199660.1|  bifunctional inhibitor/lipid-transfer protein/s...  61.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507410.1|  PREDICTED: putative lipid-transfer protein D...  61.6    3e-09   
ref|XP_009601194.1|  PREDICTED: putative lipid-transfer protein DIR1  61.6    3e-09   
ref|XP_009129731.1|  PREDICTED: putative lipid-transfer protein DIR1  61.2    3e-09   
ref|XP_002865639.1|  hypothetical protein ARALYDRAFT_917749           61.2    3e-09   
gb|AAO22703.1|  unknown protein                                       60.8    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845078.1|  hypothetical protein AMTR_s00005p00101720        60.5    4e-09   
emb|CDY05673.1|  BnaC02g38640D                                        60.8    5e-09   
ref|XP_003570573.1|  PREDICTED: putative lipid-transfer protein DIR1  60.1    8e-09   
ref|XP_002865640.1|  protease inhibitor/seed storage/lipid transf...  60.1    9e-09   
pdb|2RKN|A  Chain A, X-Ray Structure Of The Self-Defense And Sign...  59.3    1e-08   
ref|XP_007042728.1|  Bifunctional inhibitor/lipid-transfer protei...  59.3    2e-08   
ref|XP_008385814.1|  PREDICTED: putative lipid-transfer protein DIR1  59.3    2e-08   
ref|XP_009801499.1|  PREDICTED: putative lipid-transfer protein DIR1  58.9    2e-08   
ref|XP_002459717.1|  hypothetical protein SORBIDRAFT_02g009300        59.3    2e-08   Sorghum bicolor [broomcorn]
gb|ACG42309.1|  PVR3-like protein                                     58.9    2e-08   Zea mays [maize]
ref|XP_006395174.1|  hypothetical protein EUTSA_v10005129mg           58.9    3e-08   
ref|XP_007131858.1|  hypothetical protein PHAVU_011G047400g           58.2    3e-08   
ref|XP_010679256.1|  PREDICTED: putative lipid-transfer protein DIR1  58.2    4e-08   
emb|CAN72894.1|  hypothetical protein VITISV_022314                   58.5    5e-08   Vitis vinifera
ref|XP_010646191.1|  PREDICTED: putative lipid-transfer protein DIR1  57.8    5e-08   
ref|XP_004294054.1|  PREDICTED: putative lipid-transfer protein D...  57.4    7e-08   
emb|CAN61352.1|  hypothetical protein VITISV_027758                   57.4    7e-08   Vitis vinifera
ref|XP_002519093.1|  lipid binding protein, putative                  57.4    8e-08   Ricinus communis
ref|NP_001235382.1|  uncharacterized protein LOC100527644 precursor   56.6    1e-07   
ref|XP_002275805.1|  PREDICTED: putative lipid-transfer protein DIR1  56.6    2e-07   Vitis vinifera
gb|KHN14583.1|  Putative lipid-transfer protein DIR1                  56.2    2e-07   
ref|XP_006474969.1|  PREDICTED: putative lipid-transfer protein D...  56.2    2e-07   
ref|XP_008447223.1|  PREDICTED: putative lipid-transfer protein DIR1  55.8    2e-07   
ref|NP_001152561.1|  PVR3-like protein                                56.2    2e-07   Zea mays [maize]
gb|KDO62172.1|  hypothetical protein CISIN_1g039924mg                 55.8    2e-07   
ref|NP_001146924.1|  PVR3-like protein                                56.2    2e-07   Zea mays [maize]
ref|XP_004955968.1|  PREDICTED: putative lipid-transfer protein D...  55.8    2e-07   
ref|NP_001236851.1|  uncharacterized protein LOC100526983 precursor   55.5    3e-07   
ref|XP_004150334.1|  PREDICTED: putative lipid-transfer protein D...  55.1    5e-07   
ref|XP_006452488.1|  hypothetical protein CICLE_v10010463mg           54.7    5e-07   
ref|XP_004166453.1|  PREDICTED: putative lipid-transfer protein D...  55.1    5e-07   
ref|NP_001235288.1|  uncharacterized protein LOC100305686 precursor   55.1    5e-07   
ref|XP_010324294.1|  PREDICTED: putative lipid-transfer protein DIR1  54.7    6e-07   
ref|XP_010096215.1|  hypothetical protein L484_026950                 54.7    8e-07   
ref|XP_010028567.1|  PREDICTED: putative lipid-transfer protein DIR1  54.3    1e-06   
gb|ABK23184.1|  unknown                                               53.9    1e-06   Picea sitchensis
gb|KHG21649.1|  Putative lipid-transfer DIR1 -like protein            54.7    1e-06   
gb|ACG31910.1|  PVR3-like protein                                     53.1    1e-06   Zea mays [maize]
ref|XP_002313813.2|  hypothetical protein POPTR_0009s11560g           53.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003530774.2|  PREDICTED: putative lipid-transfer protein D...  53.5    2e-06   
ref|XP_008227058.1|  PREDICTED: putative lipid-transfer protein DIR1  53.1    2e-06   
ref|NP_001059392.1|  Os07g0290200                                     52.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AFK45052.1|  unknown                                               52.4    4e-06   
ref|XP_007140447.1|  hypothetical protein PHAVU_008G112900g           52.4    5e-06   
gb|ACG31932.1|  PVR3-like protein                                     51.6    5e-06   Zea mays [maize]
ref|XP_004500129.1|  PREDICTED: putative lipid-transfer protein D...  52.0    6e-06   
gb|KHN28416.1|  Putative lipid-transfer protein DIR1                  52.0    6e-06   
ref|XP_010099976.1|  hypothetical protein L484_014013                 52.8    6e-06   
ref|XP_007146550.1|  hypothetical protein PHAVU_006G050100g           51.6    7e-06   
ref|XP_007212412.1|  hypothetical protein PRUPE_ppa016471mg           50.8    1e-05   
ref|XP_009626093.1|  PREDICTED: uncharacterized protein LOC104116850  51.6    1e-05   
ref|XP_004491449.1|  PREDICTED: putative lipid-transfer protein D...  50.8    2e-05   
ref|XP_010063068.1|  PREDICTED: putative lipid-transfer protein DIR1  50.8    2e-05   
ref|NP_001150197.1|  PVR3-like protein                                50.1    2e-05   Zea mays [maize]
gb|KGN59078.1|  hypothetical protein Csa_3G759990                     50.8    2e-05   
ref|NP_001235199.1|  uncharacterized protein LOC100527120 precursor   50.4    2e-05   
ref|XP_010097506.1|  hypothetical protein L484_024714                 50.4    2e-05   
ref|XP_002459719.1|  hypothetical protein SORBIDRAFT_02g009320        50.4    2e-05   Sorghum bicolor [broomcorn]
gb|AFK43127.1|  unknown                                               50.4    2e-05   
gb|AES70438.2|  Lipid transfer protein                                50.4    2e-05   
gb|AFK43735.1|  unknown                                               50.1    2e-05   
ref|XP_004955975.1|  PREDICTED: putative lipid-transfer protein D...  50.1    3e-05   
ref|XP_004955978.1|  PREDICTED: putative lipid-transfer protein D...  50.1    3e-05   
ref|XP_004955977.1|  PREDICTED: putative lipid-transfer protein D...  49.7    4e-05   
ref|XP_008668903.1|  PREDICTED: putative lipid-transfer protein DIR1  49.3    5e-05   
gb|ABR16890.1|  unknown                                               49.3    6e-05   Picea sitchensis
ref|NP_001148038.1|  PVR3-like protein precursor                      49.3    6e-05   Zea mays [maize]
ref|XP_010527373.1|  PREDICTED: putative lipid-transfer protein DIR1  48.9    7e-05   
ref|XP_007020657.1|  Bifunctional inhibitor/lipid-transfer protei...  48.9    8e-05   
gb|AFK37659.1|  unknown                                               48.9    9e-05   
ref|NP_001151008.1|  PVR3-like protein precursor                      48.9    9e-05   Zea mays [maize]
tpg|DAA60275.1|  TPA: putative bifunctional inhibitor/lipid-trans...  48.5    9e-05   
ref|XP_003600187.1|  hypothetical protein MTR_3g055250                48.5    1e-04   
ref|XP_006299426.1|  hypothetical protein CARUB_v10015587mg           48.5    1e-04   
ref|XP_006658480.1|  PREDICTED: putative lipid-transfer protein D...  48.1    1e-04   
ref|XP_004150253.1|  PREDICTED: putative lipid-transfer protein D...  48.1    1e-04   
ref|XP_010545262.1|  PREDICTED: putative lipid-transfer protein DIR1  48.1    2e-04   
ref|XP_002459722.1|  hypothetical protein SORBIDRAFT_02g009340        47.8    2e-04   Sorghum bicolor [broomcorn]
ref|XP_002539949.1|  lipid binding protein, putative                  47.4    3e-04   Ricinus communis
ref|XP_004955976.1|  PREDICTED: putative lipid-transfer protein D...  47.4    3e-04   
ref|XP_006406557.1|  hypothetical protein EUTSA_v10021820mg           46.6    5e-04   
gb|EAZ03533.1|  hypothetical protein OsI_25668                        46.6    6e-04   Oryza sativa Indica Group [Indian rice]



>gb|EYU45876.1| hypothetical protein MIMGU_mgv1a022443mg, partial [Erythranthe 
guttata]
Length=89

 Score =   113 bits (282),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  80   KVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLG  259
             V   Q++CNMSG+DLMACKPS TPP+PPPPS  CCSAL HAD+RCLC+FKNSKLLPSLG
Sbjct  9    NVCYGQSVCNMSGEDLMACKPSATPPQPPPPSARCCSALSHADIRCLCTFKNSKLLPSLG  68

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDPNLA+QLP+KCKLPHPAHC
Sbjct  69   IDPNLAIQLPDKCKLPHPAHC  89



>ref|XP_006343129.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=129

 Score =   109 bits (272),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCL  220
            LA +A  + + +++VS+AQ ICN+SG+ LM+C+PS+TPP P  P+  CC+AL HADM CL
Sbjct  36   LALVAIVLSSVSIEVSQAQGICNVSGEGLMSCRPSITPPYPTAPTAQCCNALSHADMACL  95

Query  221  CSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CS+KNS+LLPSLGIDPNLA+QLP+KC+LP+P  C
Sbjct  96   CSYKNSQLLPSLGIDPNLAIQLPQKCRLPNPPRC  129



>ref|XP_002268742.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=98

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 2/94 (2%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCL  220
            LA +A  ++ +++  S AQTICNMSG+ LMACKP+V+PP P PPS  CCSAL HADM CL
Sbjct  7    LAIVA--LVLASLASSNAQTICNMSGEGLMACKPAVSPPNPAPPSAACCSALSHADMHCL  64

Query  221  CSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CS++NSKLLPS+GIDPNLA+QLP+KCK P+ AHC
Sbjct  65   CSYRNSKLLPSMGIDPNLALQLPKKCKFPNAAHC  98



>emb|CBI39455.3| unnamed protein product [Vitis vinifera]
Length=114

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 9/99 (9%)
 Frame = +2

Query  26   MVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHA  205
            +V ++LA++A+         S AQTICNMSG+ LMACKP+V+PP P PPS  CCSAL HA
Sbjct  25   IVALVLASLAS---------SNAQTICNMSGEGLMACKPAVSPPNPAPPSAACCSALSHA  75

Query  206  DMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            DM CLCS++NSKLLPS+GIDPNLA+QLP+KCK P+ AHC
Sbjct  76   DMHCLCSYRNSKLLPSMGIDPNLALQLPKKCKFPNAAHC  114



>ref|XP_004296699.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=104

 Score =   106 bits (264),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  74   TVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPS  253
             V+VSEAQTICN+S  +LM+CKP+VT P P  P+  CCSAL HAD+ CLCS++NS LLPS
Sbjct  22   NVEVSEAQTICNVSVNNLMSCKPAVTKPNPARPTQACCSALSHADLGCLCSYRNSNLLPS  81

Query  254  LGIDPNLAMQLPEKCKLPHPAHC  322
            LGIDP LAMQLP KCKLPHPA+C
Sbjct  82   LGIDPKLAMQLPGKCKLPHPANC  104



>ref|XP_009790835.1| PREDICTED: LOW QUALITY PROTEIN: putative lipid-transfer protein 
DIR1 [Nicotiana sylvestris]
Length=178

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            V LA +A  + + +++VS AQ ICN+SG+ LM+CKPSVT P P  P+  CCSAL  AD  
Sbjct  83   VALALVAIVLSSFSIEVSRAQGICNVSGEGLMSCKPSVTTPNPSAPTAKCCSALSQADWG  142

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLCS+KNS+ LPSLG+DP LAMQLPEKCK P+P HC
Sbjct  143  CLCSYKNSQWLPSLGVDPTLAMQLPEKCKFPNPPHC  178



>ref|XP_009595290.1| PREDICTED: LOW QUALITY PROTEIN: putative lipid-transfer protein 
DIR1 [Nicotiana tomentosiformis]
Length=150

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            V LA +A  + + +++VS AQ ICN+SG+ LM+CKPSVTPP P  P+  CCSAL HAD  
Sbjct  55   VALALVAILLSSFSIEVSRAQGICNISGEGLMSCKPSVTPPNPSAPTAKCCSALAHADWG  114

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLCS+ NS  LPSLG+DP LAMQLP+KCKLP+P HC
Sbjct  115  CLCSYMNSHWLPSLGVDPTLAMQLPQKCKLPNPPHC  150



>gb|AEB33951.1| defective in induced resistance 3 protein [Nicotiana tabacum]
Length=150

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            V LA +A  + + +++VS AQ ICN+SG+ LM+CKPSVTPP P  P+  CCSAL HAD  
Sbjct  55   VALALVAILLSSFSIEVSRAQGICNISGEGLMSCKPSVTPPNPSAPTAKCCSALAHADWG  114

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLCS+ NS  LPSLG+DP LAMQLP+KCKLP+P HC
Sbjct  115  CLCSYMNSHWLPSLGVDPTLAMQLPQKCKLPNPPHC  150



>ref|XP_010318493.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=106

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCL  220
            LA  A  + +  ++V  AQ ICN+SG+ LM+C+PS+TPP P  P+  CC+AL  ADM CL
Sbjct  13   LALFAIVLSSVNIEVVRAQGICNVSGEGLMSCRPSITPPYPTAPTAQCCNALSRADMACL  72

Query  221  CSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CS+KNS+LLPSLGIDPNLA+QLP+KC+LP+P  C
Sbjct  73   CSYKNSQLLPSLGIDPNLAIQLPQKCRLPNPPRC  106



>emb|CDO97873.1| unnamed protein product [Coffea canephora]
Length=104

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSAL  196
            MK    + +  +      S V V   QTIC MS ++LM+CKP+VTPP+P  PS  CC+AL
Sbjct  3    MKPYQNIFVLVLFLVAFASNVVVMHGQTICKMSAQELMSCKPAVTPPEPSDPSSACCAAL  62

Query  197  GHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             HAD+ CLCSFK+S  LPSLGIDPNLA QLPEKCKLPHPA+C
Sbjct  63   KHADVACLCSFKSSSWLPSLGIDPNLATQLPEKCKLPHPANC  104



>ref|XP_006443147.1| hypothetical protein CICLE_v10022967mg [Citrus clementina]
 gb|ESR56387.1| hypothetical protein CICLE_v10022967mg [Citrus clementina]
Length=109

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  14   IMKLMVGVLLAT-IAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCS  190
            I+ L+V V++   I  GM   +   ++   ICNM+G  LMACKPSVTPP P  P+  CC+
Sbjct  7    IIALVVKVIMVVGIGVGMSIGSSH-AQGTVICNMTGAGLMACKPSVTPPNPTRPTTACCT  65

Query  191  ALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            AL HAD+ C C +KNSKLLPSLGIDP LAMQLP+KCKLPHPA+C
Sbjct  66   ALSHADLECFCKYKNSKLLPSLGIDPKLAMQLPDKCKLPHPANC  109



>ref|XP_008387060.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+V  AQ ICN+S  DLM C+ +VT P   PP+  CC+AL HA++ CLCS+KNS +LPSL
Sbjct  27   VQVDNAQNICNVSVTDLMTCRAAVTSPNLAPPTKACCAALSHANLSCLCSYKNSSVLPSL  86

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KCKLPHPA+C
Sbjct  87   GIDPNLALQLPAKCKLPHPANC  108



>ref|XP_002529688.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32699.1| lipid binding protein, putative [Ricinus communis]
Length=106

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    FEFVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN  181
             E V +K  + + +  + A      V+V  AQ++CN+    LMACKP+VTPP P  P+  
Sbjct  1    MERVQIKPFIALAMILVIAIANNGVVQVCNAQSVCNVPISGLMACKPAVTPPNPSAPTSA  60

Query  182  CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
            CCSAL HADMRCLCS+KNS +LPSLGIDPNLA+QLP KCKLP P
Sbjct  61   CCSALTHADMRCLCSYKNSNVLPSLGIDPNLALQLPPKCKLPRP  104



>ref|XP_007223557.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
 gb|EMJ24756.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
Length=107

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+V +AQ ICN+S   LM C+P+VT P P PP+  CCSAL HADM CLCS+KNS LLPSL
Sbjct  26   VQVCDAQNICNVSLNGLMTCRPAVTAPNPAPPTTACCSALSHADMGCLCSYKNSNLLPSL  85

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KC+LPHPA+C
Sbjct  86   GIDPNLALQLPAKCRLPHPANC  107



>ref|XP_008386755.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008387154.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008343359.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+V+ AQ ICN+S  DLM C+P+VT P P PP+  CC+AL HA++ CLCS+KNS +LPSL
Sbjct  27   VQVANAQNICNVSVTDLMKCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVLPSL  86

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KCKLPHPA+C
Sbjct  87   GIDPNLALQLPAKCKLPHPANC  108



>ref|XP_008222678.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+V +AQ ICN+S   LM C+P+VT P P PP+  CCSAL HADM CLCS+KNS LLPSL
Sbjct  26   VQVCDAQNICNVSMNGLMTCRPAVTAPNPAPPTTACCSALSHADMGCLCSYKNSNLLPSL  85

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KC+LPHPA+C
Sbjct  86   GIDPNLALQLPAKCRLPHPANC  107



>ref|XP_002529687.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32698.1| lipid binding protein, putative [Ricinus communis]
Length=93

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+VS AQ+ICN+    LMACKP+VTPP P  P+  CCSAL HADMRCLCS+KNS LLPSL
Sbjct  13   VQVSNAQSICNVPISGLMACKPAVTPPNPSAPTSACCSALTHADMRCLCSYKNSNLLPSL  72

Query  257  GIDPNLAMQLPEKCKLPHP  313
            GIDPNLA+QLP KC LP P
Sbjct  73   GIDPNLALQLPPKCNLPRP  91



>ref|XP_010241749.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V VS +QTICNM    LMAC PSVT  KP PPS +CCSAL HAD++CLCS+KNSKLLPSL
Sbjct  22   VMVSYSQTICNMPAASLMACMPSVTGTKPSPPSGDCCSALSHADLKCLCSYKNSKLLPSL  81

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GI+P LA+QLP KCKLP P  C
Sbjct  82   GINPKLAIQLPAKCKLPQPKTC  103



>gb|KDO50536.1| hypothetical protein CISIN_1g046518mg [Citrus sinensis]
Length=94

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  38   LLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRC  217
            ++  I  GM   +   ++   ICNM+G  LMACKPSVTPP P  P+  CC+AL HAD+ C
Sbjct  1    MVVGIGVGMSIGSSH-AQGTVICNMTGAGLMACKPSVTPPNPTRPTTACCTALSHADLEC  59

Query  218  LCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             C +KNSKLLPSLGIDP LAMQLP+KCKLPHPA+C
Sbjct  60   FCKYKNSKLLPSLGIDPKLAMQLPDKCKLPHPANC  94



>ref|XP_009339893.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=108

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+V+ AQ ICN+S   LM C+P+VT P P PP+  CCSAL HA++ CLCS+KNS +LPSL
Sbjct  27   VQVANAQNICNVSVTGLMTCRPAVTSPNPAPPTKACCSALSHANVSCLCSYKNSSVLPSL  86

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KCKLPHPA+C
Sbjct  87   GIDPNLALQLPAKCKLPHPANC  108



>ref|XP_009339897.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=112

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V V  AQ ICN+S  DLM C+P+VT P P PP+  CC+AL HA++ CLCS+KNS +LPSL
Sbjct  31   VHVVNAQNICNVSVSDLMTCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVLPSL  90

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KCKLPHPA+C
Sbjct  91   GIDPNLALQLPAKCKLPHPANC  112



>ref|XP_008386579.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+V+ AQ ICN+S   LM C+P+VT P P PP+  CC+AL HA++ CLCS+KNS +LPSL
Sbjct  27   VQVANAQNICNISVTGLMTCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVLPSL  86

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDPNLA+QLP KCKLPHPA+C
Sbjct  87   GIDPNLALQLPAKCKLPHPANC  108



>ref|XP_004296700.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=104

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +2

Query  71   STVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLP  250
            + V+VS+AQTICN+   +LM+C+ ++T P P  PS  CCSAL  AD+ CLCS+KNS LLP
Sbjct  21   TNVEVSDAQTICNVPLNNLMSCRAAITRPNPAKPSKACCSALSLADLGCLCSYKNSNLLP  80

Query  251  SLGIDPNLAMQLPEKCKLPHPAHC  322
            SLGIDP LAMQLP KC LPHPA+C
Sbjct  81   SLGIDPELAMQLPGKCNLPHPANC  104



>gb|KDP42884.1| hypothetical protein JCGZ_23826 [Jatropha curcas]
Length=101

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 79/103 (77%), Gaps = 5/103 (5%)
 Frame = +2

Query  14   IMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            + KL+V +L+  + AG+ +S++     Q+ICN+S   L +C+P+VTPP P PP+  CCSA
Sbjct  4    VQKLLVIMLV--MVAGIFSSSI---NGQSICNVSISGLTSCRPAVTPPNPAPPTSACCSA  58

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L HAD+RCLCS+KNS LLPSLGIDP LA++LPEKC+LPH A C
Sbjct  59   LSHADLRCLCSYKNSTLLPSLGIDPKLALKLPEKCRLPHRAPC  101



>ref|XP_006606947.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=101

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            +++VGV L      ++  +VK    Q+ICN+S  DLM CKP+VTPP P PPS  CCS L 
Sbjct  7    QMIVGVALVVF---LLLISVK---GQSICNVSLPDLMTCKPAVTPPNPTPPSQQCCSVLS  60

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            HAD+ CLCS+KNS LLPSLGIDP LA+QLP KC LPHP +C
Sbjct  61   HADLPCLCSYKNSPLLPSLGIDPKLALQLPAKCNLPHPPNC  101



>ref|XP_002320450.2| hypothetical protein POPTR_0014s14740g [Populus trichocarpa]
 gb|ABK94334.1| unknown [Populus trichocarpa]
 gb|EEE98765.2| hypothetical protein POPTR_0014s14740g [Populus trichocarpa]
Length=103

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +2

Query  83   VSEAQ-TICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLG  259
            ++ AQ TIC M    LM+CKPSVTPP P  PS +CCSAL HAD+ CLCS+KNS LLPSLG
Sbjct  23   IANAQSTICKMPVAGLMSCKPSVTPPNPTAPSADCCSALSHADINCLCSYKNSNLLPSLG  82

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDP LAMQLP KCKLPHPA+C
Sbjct  83   IDPKLAMQLPGKCKLPHPANC  103



>gb|KHN27145.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=94

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            + Q+ICN+S  DLM CKP+VTPP P PPS  CCS L HAD+ CLCS+KNS LLPSLGIDP
Sbjct  17   KGQSICNVSLPDLMTCKPAVTPPNPTPPSQQCCSVLSHADLPCLCSYKNSPLLPSLGIDP  76

Query  269  NLAMQLPEKCKLPHPAHC  322
             LA+QLP KC LPHP +C
Sbjct  77   KLALQLPAKCNLPHPPNC  94



>gb|ABK93190.1| unknown [Populus trichocarpa]
Length=103

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +2

Query  83   VSEAQ-TICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLG  259
            ++ AQ TIC M    LM+CKPSVTPP P  PS +CCSAL HAD+ CLCS+KNS LLPSLG
Sbjct  23   IANAQSTICKMPVAGLMSCKPSVTPPNPTAPSADCCSALSHADLNCLCSYKNSNLLPSLG  82

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDP LAMQLP KCKLPHPA+C
Sbjct  83   IDPKLAMQLPGKCKLPHPANC  103



>gb|ACM90158.1| trypsin-alpha amylase inhibitor [Jatropha curcas]
Length=101

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 5/103 (5%)
 Frame = +2

Query  14   IMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            + KL+V +L+  + AG+ +S++     Q+ICN+S   L +C P+VTPP P PP+  CCSA
Sbjct  4    VQKLLVIMLV--MVAGIFSSSI---NGQSICNVSISGLTSCSPAVTPPNPAPPTSACCSA  58

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L HAD+RCLCS+KNS LLPSLGID  L ++LPEKC+LPH A C
Sbjct  59   LSHADLRCLCSYKNSTLLPSLGIDQKLPLKLPEKCRLPHRAPC  101



>ref|XP_010241751.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=106

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KL+V ++L  +AA   T   +  E   +CNMS  DLMACKP+V  P P  P+P CC AL 
Sbjct  6    KLVVVMVLLIMAAAFETQVARSKEVN-LCNMSEDDLMACKPAVIKPNPADPTPACCKALS  64

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             AD+ CLCS+K+S LLP+ GIDP+LAMQLP KCKL  PA+C
Sbjct  65   GADLSCLCSYKHSLLLPTFGIDPDLAMQLPTKCKLTPPANC  105



>gb|EYU21344.1| hypothetical protein MIMGU_mgv1a016805mg [Erythranthe guttata]
Length=106

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 3/101 (3%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            K+ +  +   +  G+ T+T   +  Q +C M+  D +ACK + TPP PPPPS  CCS + 
Sbjct  9    KIAILAIFFVVVLGVATTT---ANGQMVCKMTLGDFLACKSAATPPNPPPPSAACCSGIS  65

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            HAD+ CLCSFKN+ LLPS GIDPNLA+QLP+KC +P P+ C
Sbjct  66   HADLSCLCSFKNNTLLPSFGIDPNLALQLPKKCNIPLPSKC  106



>ref|XP_008792988.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=107

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspN-CCSALGHADMRCLCSFKNSKLLPSLGI  262
            S AQ  CNM+  +LMACKPS++  KP     + CC+AL HAD+ CLC++KNS +LP LGI
Sbjct  28   SGAQGFCNMTRDELMACKPSISTAKPVEKPADACCTALSHADLPCLCAYKNSGMLPYLGI  87

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            DPNLAMQLP KC +P PA C
Sbjct  88   DPNLAMQLPAKCSVPAPAQC  107



>ref|XP_006590235.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=103

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            + V+   + CN+S  DL+ CKP+VTPP PPPP+P CCS L HAD+ CLC +KNS LLPSL
Sbjct  22   ISVNGQSSTCNVSMSDLLTCKPAVTPPNPPPPTPECCSVLSHADLPCLCPYKNSPLLPSL  81

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDP LA+QLP KC LPHP +C
Sbjct  82   GIDPKLALQLPAKCNLPHPPNC  103



>gb|KHN37258.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=99

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            + V+   + CN+S  DL+ CKP+VTPP PPPP+P CCS L HAD+ CLC +KNS LLPSL
Sbjct  18   ISVNGQSSTCNVSMSDLLTCKPAVTPPNPPPPTPECCSVLSHADLPCLCPYKNSPLLPSL  77

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDP LA+QLP KC LPHP +C
Sbjct  78   GIDPKLALQLPAKCNLPHPPNC  99



>ref|XP_010069361.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
Length=171

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   ATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLC  223
            A I  G+M +    + AQTICNMS  +LMACKP+ TPP PPPP+  CC+ L HA+++C C
Sbjct  79   AVILLGLMVAIACCANAQTICNMSYSELMACKPAATPPNPPPPTSACCTGLSHANLKCFC  138

Query  224  SFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             +KNS +LPS+G++P LAMQLP KC++P+   C
Sbjct  139  QYKNSPILPSVGVNPKLAMQLPSKCQIPNAPTC  171



>ref|XP_010258605.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 3/101 (3%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            +++V  L+ T+  GM      +S+  ++CNMS  DL+ACKP+V+   P  PSP CC AL 
Sbjct  6    RIVVVFLVMTVIFGMQEV---MSKEVSLCNMSENDLLACKPAVSKQNPADPSPACCKALS  62

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             AD+ CLCS+KNS LLPSLGI+P+ AMQLP KC L  PA C
Sbjct  63   SADLSCLCSYKNSILLPSLGINPDFAMQLPTKCNLNPPAKC  103



>ref|XP_009604201.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana tomentosiformis]
Length=104

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHAD  208
            VGVL  T+  G++   V+++   ++CNM+   L ACKPSV  P P  PS +CC AL  AD
Sbjct  8    VGVL-GTMVLGILLVLVELTNGLSLCNMNEDGLTACKPSVIQPNPVAPSASCCEALSGAD  66

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            ++CLCS++NS LLPSLGIDP LA+ LP KC L  PA+C
Sbjct  67   LQCLCSYRNSLLLPSLGIDPELALALPPKCNLTSPANC  104



>ref|XP_010908873.1| PREDICTED: putative lipid-transfer protein DIR1 [Elaeis guineensis]
Length=104

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +2

Query  14   IMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            + KL++ +L+ +I  G     + VS A  +CNM+     ACKP+ T P+P  PS  CC A
Sbjct  4    LQKLVMVMLVLSITLG--CGEITVSRADGLCNMTMDGFNACKPAATGPEPTEPSKECCEA  61

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L +AD+ CLCS+++S LLPSLGIDP+LAMQLPEKC L  PA C
Sbjct  62   LANADLPCLCSYRHSVLLPSLGIDPDLAMQLPEKCNLTLPAEC  104



>gb|AFK37599.1| unknown [Lotus japonicus]
Length=107

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = +2

Query  5    EFVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNC  184
            ++V + LMV +L       MM ST+KVS+  ++CNM+   +MACKPSVT P P  PSP C
Sbjct  9    KWVTLHLMVVLL-------MMASTLKVSKGISLCNMNEDGIMACKPSVTKPNPVDPSPEC  61

Query  185  CSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            C AL  AD++CLCS+KNS  LP LGIDP LA+ LP KC L  P  C
Sbjct  62   CQALTGADLKCLCSYKNSSELPLLGIDPTLAVSLPAKCNLTPPDDC  107



>ref|XP_009782537.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=104

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHAD  208
            VGVL+ T+  G++    +++   ++CNM    L ACKPSVT P P  PS +CC AL  AD
Sbjct  8    VGVLV-TVFLGILLLIAELTNGLSLCNMGDDGLTACKPSVTKPNPVEPSASCCEALSGAD  66

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            ++CLCS++NS LLPSLGIDP LA+ LP KC L  PA+C
Sbjct  67   LQCLCSYRNSLLLPSLGIDPELALALPPKCNLTSPANC  104



>gb|AEB33949.1| defective in induced resistance 1 protein [Nicotiana tabacum]
Length=104

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHAD  208
            VGVL+ T+  G++    +++   ++CNM    L ACKPSVT P P  PS +CC AL  AD
Sbjct  8    VGVLV-TVFLGILLLIAELTNGLSLCNMGDDGLTACKPSVTKPNPVEPSASCCEALSGAD  66

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            ++CLCS++NS LLPSLGIDP LA+ LP KC L  PA+C
Sbjct  67   LQCLCSYRNSLLLPSLGIDPELALALPPKCNLTSPANC  104



>ref|XP_010069597.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
 gb|KCW57997.1| hypothetical protein EUGRSUZ_H00727 [Eucalyptus grandis]
Length=102

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            SEA T+C MS   L ACKP+VT P P  P+  CC  L  AD+ CLCS+KNS +LP+LGID
Sbjct  24   SEAITLCKMSDDQLTACKPAVTKPDPAEPTKECCEGLSGADLSCLCSYKNSAILPALGID  83

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P+LAM LP KC L  PA+C
Sbjct  84   PDLAMGLPAKCGLTPPANC  102



>gb|KDP42880.1| hypothetical protein JCGZ_23822 [Jatropha curcas]
Length=105

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            ++   + +S AQ +CN   +DL+ CKP+ TPP PPPP+  CC  L    M CLCSF NS 
Sbjct  15   IIVGELYLSNAQNVCNTLPQDLLPCKPATTPPHPPPPTGECCLVLARGGMSCLCSFVNSN  74

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            LLP+LGIDP+LA+QLP KC LPH  +C
Sbjct  75   LLPALGIDPDLALQLPAKCNLPHIPNC  101



>ref|XP_008775676.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=105

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = +2

Query  14   IMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            + KL++ V+L  ++  +    + +  A   CNM+ +   ACKP+VT P+P  PS  CC A
Sbjct  4    LQKLVIMVML-VLSIILGCGEIALLRADGFCNMTMEGFNACKPAVTGPEPTEPSEECCEA  62

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L +AD+ CLCS+++S LLPSLGIDP+LAMQLP+KC L  PA C
Sbjct  63   LSNADLPCLCSYRHSMLLPSLGIDPDLAMQLPQKCNLTPPAEC  105



>ref|XP_009379984.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=97

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   LLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRC  217
             L T A  ++  ++     + +CNM+ +   ACKPSVTPP PPPPS  CC AL +AD+ C
Sbjct  3    FLRTAAMAILLLSMTFEGGEAVCNMTQEGFDACKPSVTPPNPPPPSVACCKALANADLPC  62

Query  218  LCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            LCS+KNS LLP+LGIDP LAM LP KC L  PA+C
Sbjct  63   LCSYKNSPLLPALGIDPGLAMTLPPKCNLKLPANC  97



>gb|KHG11809.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=104

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 12/105 (11%)
 Frame = +2

Query  8    FVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCC  187
             V+M +MVG+            TV+ S A ++C+M+ + L ACKPSVT P P  P+P CC
Sbjct  7    VVVMIIMVGL------------TVEGSRAISLCDMNDEGLEACKPSVTQPDPVDPTPQCC  54

Query  188  SALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             AL  A++ CLCS+KNS  LPSLGIDP LAM LP KC L  P+ C
Sbjct  55   EALKGANLTCLCSYKNSMWLPSLGIDPTLAMGLPAKCSLDMPSDC  99



>ref|XP_007142607.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
 gb|ESW14601.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
Length=101

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            +A  +C +S  DLM CK +VTPP P  PS  CCS +   DM CLC++KNS LLPSLGIDP
Sbjct  24   DALDVCGVSVTDLMTCKAAVTPPSPSEPSDECCSVVSKVDMDCLCNYKNSPLLPSLGIDP  83

Query  269  NLAMQLPEKCKLPHPAHC  322
            +LA+QLP KCKL     C
Sbjct  84   DLALQLPAKCKLDKTPPC  101



>ref|XP_008453924.1| PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo]
Length=101

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  71   STVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLP  250
            + +   EAQ+ICNM    L AC+P+VTPP P  P+  CC ALG AD+ C C+++NS  L 
Sbjct  18   NNIGFGEAQSICNMPIAGLYACRPAVTPPNPTAPTAQCCMALGQADLHCFCAYRNSGALS  77

Query  251  SLGIDPNLAMQLPEKCKLPHPAHC  322
            S GIDPNLAMQLP++C +    +C
Sbjct  78   SFGIDPNLAMQLPKRCNISKSPNC  101



>gb|EYU46119.1| hypothetical protein MIMGU_mgv1a022331mg, partial [Erythranthe 
guttata]
Length=78

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            +A  +CN++   L ACKPSV  P P  PSP CC A+  AD++CLCS+KNS +LPSLGIDP
Sbjct  1    KAMDLCNVTEDGLTACKPSVVQPNPVEPSPECCDAVSGADLKCLCSYKNSFMLPSLGIDP  60

Query  269  NLAMQLPEKCKLPHPAHC  322
            +LA+ LP KC +P+P  C
Sbjct  61   DLALALPAKCNIPNPTEC  78



>ref|XP_004229235.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=101

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+ +    ICNM    L +CKPSVT P P  PS +CC AL  AD++CLCS++NS +LPSL
Sbjct  20   VEFASGMNICNMDDDGLTSCKPSVTQPNPVEPSASCCEALSGADLQCLCSYRNSFVLPSL  79

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDP LA+ LP KC L  P++C
Sbjct  80   GIDPELALALPTKCNLTSPSNC  101



>gb|EPS67451.1| hypothetical protein M569_07329 [Genlisea aurea]
Length=98

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSAL  196
            MK+   +L+A +    + S  K    Q +C+++  +LM C+P+ TPPKP  PS  CC AL
Sbjct  1    MKIEASILVAILVFEFVVSAAK---GQEVCSLTVGELMECRPAATPPKPENPSAACCKAL  57

Query  197  GHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
             HAD +CLC++ ++ +LPSL IDP LA+Q+P+KC LP P
Sbjct  58   KHADFKCLCNYLDNPVLPSLNIDPKLALQIPKKCGLPTP  96



>ref|XP_004152081.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 ref|XP_004167435.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 gb|KGN53126.1| hypothetical protein Csa_4G017140 [Cucumis sativus]
Length=101

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            M+ + +   EAQ+ICNM    L AC+PSVTPP P PP+  CCSAL HAD+ C C+++NS 
Sbjct  15   MVVNNIGFGEAQSICNMPIAGLYACRPSVTPPNPTPPTTQCCSALTHADLHCFCAYRNSG  74

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             L S GI+P LAM+LP++C +    +C
Sbjct  75   ALSSFGINPELAMELPKRCNISKSPNC  101



>ref|XP_006342794.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=103

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V+ +   +IC M+   L +CKPSVT P P  PS +CC AL  AD+RCLCS++NS +LPSL
Sbjct  22   VEFTSGLSICKMNDDGLTSCKPSVTQPNPVRPSASCCEALSAADLRCLCSYRNSFVLPSL  81

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDP LA+ LP KC L  P +C
Sbjct  82   GIDPELALALPTKCNLTSPPNC  103



>ref|XP_003622804.1| hypothetical protein MTR_7g052640 [Medicago truncatula]
 gb|AES79022.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
 gb|AFK43469.1| unknown [Medicago truncatula]
Length=104

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            + +V +L+  +   +M S +K S   ++CNM+   L ACKPSVT P P  PS  CC AL 
Sbjct  7    RKLVSLLMVVV---IMASMLKFSNGMSLCNMNEDGLDACKPSVTQPYPAKPSTECCKALT  63

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             AD++CLCS+KNS  LP LGIDP LA  LP++C L  P++C
Sbjct  64   GADLQCLCSYKNSAELPLLGIDPTLAASLPKECDLTPPSNC  104



>ref|XP_011080533.1| PREDICTED: putative lipid-transfer protein DIR1 [Sesamum indicum]
Length=102

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            + A ++CN++     ACKPSVTPP P  PSP CC A+  AD+ CLCS+KNS +LPSLGID
Sbjct  24   ANAMSLCNVTEDGFTACKPSVTPPNPEAPSPECCEAVAGADLECLCSYKNSFMLPSLGID  83

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P+LA+ LP KC +P P  C
Sbjct  84   PDLALALPAKCNVPSPPEC  102



>emb|CEG62452.1| Lipid binding/ Lipid transporter protein [Cucumis sativus]
Length=101

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            M+ + +   +AQ+ICNM    L AC+PSVTPP P PP+  CCSAL HAD+ C C+++NS 
Sbjct  15   MVVNNIGFGKAQSICNMPIAGLYACRPSVTPPNPTPPTTQCCSALTHADLHCFCAYRNSG  74

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             L S GI+P LAM+LP++C +    +C
Sbjct  75   ALSSFGINPELAMELPKRCNISKSPNC  101



>ref|XP_004290137.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=103

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +2

Query  38   LLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRC  217
            L+A +   M+ S  + S A T CNMS   L ACKPSV  P P  P+  CC  L  AD+ C
Sbjct  10   LMAILVVAMLVS-FEGSRAFTFCNMSEDGLTACKPSVMKPNPSDPTAECCKDLSAADLDC  68

Query  218  LCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            LC +K S +LP  GIDP LAM LP KC L  PA+C
Sbjct  69   LCGYKTSPVLPGFGIDPTLAMGLPAKCGLTPPANC  103



>emb|CDP03961.1| unnamed protein product [Coffea canephora]
Length=111

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +2

Query  80   KVSEAQTICNMSGKDLMACkpsvtppkppppsp--NCCSALGHADMRCLCSFKNSKLLPS  253
            + S A ++CNM  K LMACKPSVTPP P P  P  +CC AL  AD++CLCS+KNS  LPS
Sbjct  29   EWSRAMSLCNMDEKGLMACKPSVTPPPPDPVDPTSDCCDALKGADLKCLCSYKNSFTLPS  88

Query  254  LGIDPNLAMQLPEKCKLPHPAHC  322
            LGIDP+LA+ LP KC L  P  C
Sbjct  89   LGIDPDLALALPSKCNLALPPDC  111



>ref|XP_002283832.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=99

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  98   TICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            +IC M+   L ACKPSV+   P PPSP CC+A+  AD+ CLCSFKNS LLP LGIDPN+A
Sbjct  25   SICRMTQDGLTACKPSVSGQSPLPPSPACCAAISKADLPCLCSFKNSALLPYLGIDPNMA  84

Query  278  MQLPEKCKLPHPAHC  322
             QLP KC +    HC
Sbjct  85   TQLPAKCNIVTSTHC  99



>ref|XP_009396800.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=105

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN-CCSALGHA  205
            V V +A +   +  ST K ++ Q++C M+ + L ACKP +   KP       CC+AL  A
Sbjct  8    VVVAMAMVLLMVAASTTKAAD-QSLCKMTQEGLAACKPCIAMVKPEEKPSEACCAALKQA  66

Query  206  DMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            D+ CLCS+KNS LLP LGIDP  AMQLP KC +  P  C
Sbjct  67   DLPCLCSYKNSDLLPYLGIDPKQAMQLPAKCNIAPPQPC  105



>ref|XP_009399057.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspN-CCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            AQ++C MS + L AC+P ++  KP     + CC+AL  AD+ CLCS+KNS LLP +GIDP
Sbjct  26   AQSLCKMSQEGLDACRPCISTVKPAEQPSDACCAALKQADLPCLCSYKNSVLLPYIGIDP  85

Query  269  NLAMQLPEKCKLPHPAHC  322
              AMQLP KC +  P  C
Sbjct  86   KRAMQLPAKCSMAAPQQC  103



>ref|XP_007049604.1| Defective in induced resistance 1 protein [Theobroma cacao]
 gb|EOX93761.1| Defective in induced resistance 1 protein [Theobroma cacao]
Length=99

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            S A T+C++  K L  CKPSVT P P  PSP+CC AL  AD+ CLCS+KNS  LPS GID
Sbjct  21   SRAMTLCDIDDKGLADCKPSVTQPNPVDPSPDCCEALKGADLACLCSYKNSMWLPSFGID  80

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P LA+ LP KC L  P +C
Sbjct  81   PMLALSLPPKCNLQMPTNC  99



>ref|XP_008369792.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=100

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +2

Query  80   KVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLG  259
            K S   ++CNM+ + +  CKPSVT   P PP+P CC AL  AD++CLC +KNS LLPSLG
Sbjct  20   KGSTVSSLCNMTDEGIADCKPSVTKTNPTPPTPECCEALKGADLKCLCGYKNSFLLPSLG  79

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDP LAM LP KC L  P  C
Sbjct  80   IDPALAMALPAKCNLTPPNDC  100



>ref|XP_009358980.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=100

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            S   ++CNM+ + +  CKPSVT   P PP+P CC AL  AD++CLC +KNS LLPSLGID
Sbjct  22   STVSSLCNMTDEGIADCKPSVTKTNPTPPTPECCEALKGADLKCLCGYKNSFLLPSLGID  81

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P LAM LP KC L  P  C
Sbjct  82   PTLAMALPAKCNLTPPNDC  100



>gb|EMS50543.1| Putative lipid-transfer protein DIR1 [Triticum urartu]
Length=100

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +2

Query  83   VSEAQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSL  256
             + AQ +C+M   D MAC+P+      P P+P+  CC+ LG AD+RCLCS+KNS  L   
Sbjct  19   AATAQAVCDMDNDDFMACQPAAAATTDPQPAPSEACCATLGKADLRCLCSYKNSPWLSLY  78

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
             IDP  AM+LP KC L  P  C
Sbjct  79   NIDPKRAMELPAKCGLTTPPDC  100



>ref|XP_009342728.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=106

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 2/102 (2%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KL+V V L  +A  + + T+  +  Q+ C M+ + L AC PSV    P PPS  CC+AL 
Sbjct  6    KLLVIVAL-FLAVAIGSDTLMANSDQSFCRMTKEGLNACAPSVNGANPQPPSALCCTALS  64

Query  200  HADMRCLCSFKN-SKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +AD  CLC FK  S  L + GIDPNLAMQLP KC L  P  C
Sbjct  65   YADFGCLCLFKKYSNFLSAYGIDPNLAMQLPAKCNLGQPIRC  106



>ref|XP_010908200.1| PREDICTED: putative lipid-transfer protein DIR1 [Elaeis guineensis]
Length=105

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQ  283
            C M+ + L+AC PS+T  +P  PS  CC+AL  AD+RCLC +KNS +L  LGI P LAMQ
Sbjct  32   CRMTEEGLLACLPSITGSRPVNPSVKCCTALSKADLRCLCHYKNSPMLSQLGIKPQLAMQ  91

Query  284  LPEKCKLPHPAHC  322
            LP KCKL  P  C
Sbjct  92   LPAKCKLRLPRQC  104



>ref|NP_001059387.1| Os07g0287400 [Oryza sativa Japonica Group]
 dbj|BAC16424.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21301.1| Os07g0287400 [Oryza sativa Japonica Group]
 gb|EAZ03527.1| hypothetical protein OsI_25663 [Oryza sativa Indica Group]
 gb|EAZ39444.1| hypothetical protein OsJ_23875 [Oryza sativa Japonica Group]
 dbj|BAG97136.1| unnamed protein product [Oryza sativa Japonica Group]
Length=104

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkpppp--spNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            CNMS  + M C+P+      P    S  CCSAL HAD+ CLCS+KNS  L    IDPN A
Sbjct  30   CNMSNDEFMKCQPAAAATSNPTTNPSAGCCSALSHADLNCLCSYKNSPWLSIYNIDPNRA  89

Query  278  MQLPEKCKLPHPAHC  322
            MQLP KC L  PA+C
Sbjct  90   MQLPAKCGLTMPANC  104



>ref|XP_011092905.1| PREDICTED: putative lipid-transfer protein DIR1 [Sesamum indicum]
Length=111

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVS-EAQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHA  205
            V L  I +  +++T K + E  ++C MS  +L+ CKP+V      PP P+  CC+ALGHA
Sbjct  13   VALVVIVSAAVSATAKANDEGGSLCGMSQDELLECKPAVATGSAAPPPPSGACCAALGHA  72

Query  206  DMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            ++ C CSFKN+K LP  GI+   AM+LP KC     AHC
Sbjct  73   NLTCFCSFKNNKYLPMFGINSTRAMELPSKCDPNQTAHC  111



>ref|XP_007200118.1| hypothetical protein PRUPE_ppa018886mg [Prunus persica]
 gb|EMJ01317.1| hypothetical protein PRUPE_ppa018886mg [Prunus persica]
Length=91

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 57/91 (63%), Gaps = 5/91 (5%)
 Frame = +2

Query  65   MTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN-----CCSALGHADMRCLCSF  229
            M   ++ S    +CNMS + L +CKP+V    P  P+P+     CC AL  AD++CLC +
Sbjct  1    MAVLLEGSRVLGLCNMSDEGLASCKPAVAKATPEKPNPDKPTPECCEALKGADLKCLCGY  60

Query  230  KNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            KNS LLPSLGIDP LAM LP KC L  PA C
Sbjct  61   KNSFLLPSLGIDPALAMALPAKCNLTPPADC  91



>gb|EYU46116.1| hypothetical protein MIMGU_mgv1a025642mg [Erythranthe guttata]
Length=102

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSAL-GHADMRCLCSFKNSKLLPSLGI  262
            ++A  +CN++   L ACKPSV  P P  PSP CC A+   AD++CLCS+KN  +LPSLGI
Sbjct  23   AKAMDLCNVTEDGLTACKPSVVQPNPVEPSPECCDAVVSGADLKCLCSYKNLFMLPSLGI  82

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            DP+LA+ LP KC +P+P  C
Sbjct  83   DPDLALALPAKCNIPNPTEC  102



>ref|XP_008236806.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=105

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = +2

Query  26   MVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHA  205
            +V + LA          V++    T C ++ + L AC PSV+   P PPS  CCSAL  A
Sbjct  10   IVALFLALAIGSEANEQVQI----TFCRLTKEGLNACAPSVSGLNPLPPSALCCSALSIA  65

Query  206  DMRCLCSFKN-SKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            D +CLC FKN S LL S GIDPNLAMQLP KC L    HC
Sbjct  66   DFQCLCFFKNYSNLLTSYGIDPNLAMQLPAKCNLRQTVHC  105



>ref|XP_008358527.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008365974.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=106

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 59/102 (58%), Gaps = 2/102 (2%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KL+V V L  +A  + ++ +  +  Q  C M+ + L AC  SV    P PPS  CC+AL 
Sbjct  6    KLLVIVAL-FLAVAIGSNALTANSDQRFCRMTKEGLNACALSVNGANPQPPSALCCTALS  64

Query  200  HADMRCLCSFKN-SKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +AD  CLC FK  S  L + GIDPNLAMQLP KC L  P  C
Sbjct  65   YADFGCLCLFKKYSNFLSAYGIDPNLAMQLPAKCNLGQPIRC  106



>gb|EMT01414.1| hypothetical protein F775_28625 [Aegilops tauschii]
Length=98

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +2

Query  83   VSEAQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSL  256
             + AQ +C+M   D MAC+P+      P P+P+  CC+ LG AD+RCLCS+KNS  L   
Sbjct  17   AATAQAVCDMDNDDFMACQPAAAATTAPQPAPSEACCATLGKADLRCLCSYKNSPWLSLY  76

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
             IDP  AM+LP KC L  P  C
Sbjct  77   NIDPKRAMELPAKCGLTTPPDC  98



>ref|XP_006423199.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
 gb|ESR36439.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
Length=103

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVS-EAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            M+  V +L+  +  G+   +V        +C M+   L AC+P+V    P PPS  CCSA
Sbjct  1    MEAYVKLLILAVILGLAIGSVPTGVNGDGLCRMTKDGLTACQPAVAASNPSPPSTACCSA  60

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L  AD++C C+FKNS++L   GID N AMQLP KC L    HC
Sbjct  61   LSKADLQCFCAFKNSRVLSLYGIDFNQAMQLPAKCNLGDSFHC  103



>ref|XP_008235902.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=105

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = +2

Query  65   MTSTVKVSEAQTICNMSGKDLMACkpsvtppkp-----pppspNCCSALGHADMRCLCSF  229
            M   ++ S    +CNMS + L  CKP+V    P       P+P CC AL  AD++CLC +
Sbjct  15   MAVLLEGSRVLGLCNMSDEGLAFCKPAVAKATPDKPNPEKPTPECCKALEGADLKCLCGY  74

Query  230  KNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            KNS LLPSLGIDP LAM LP KC L  PA C
Sbjct  75   KNSFLLPSLGIDPALAMALPAKCNLTPPADC  105



>ref|NP_001236410.1| uncharacterized protein LOC100305511 precursor [Glycine max]
 gb|ACU13214.1| unknown [Glycine max]
 gb|KHN10927.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=103

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +2

Query  68   TSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLL  247
            +S  K S+  ++CNM    L ACKPSVT P P  PSP+CC AL  AD++CLCS+KNS  L
Sbjct  18   SSMWKGSKGLSLCNMDEGGLEACKPSVTQPNPVDPSPDCCKALAGADLKCLCSYKNSSEL  77

Query  248  PSLGIDPNLAMQLPEKCKLPHPAHC  322
            P LGID  LA  LP KC L  P +C
Sbjct  78   PFLGIDRTLATSLPAKCNLTPPDNC  102



>ref|XP_006845077.1| hypothetical protein AMTR_s00005p00100950 [Amborella trichopoda]
 gb|ERN06752.1| hypothetical protein AMTR_s00005p00100950 [Amborella trichopoda]
Length=114

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLG  259
            S+AQ IC MS     AC+PSV+   P P  P+  CC ALG AD+ CLCS+++S LLP  G
Sbjct  24   SKAQ-ICGMSQDGFKACQPSVSDSPPSPTDPSKACCKALGSADLGCLCSYRDSLLLPYFG  82

Query  260  IDPNLAMQLPEKCKLPHPAHC-*LSYLLTQYY  352
            IDP+LAMQLP KC L  P  C  L Y + Q +
Sbjct  83   IDPDLAMQLPAKCNLATPLQCQVLCYTVNQSF  114



>ref|XP_002527254.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF35098.1| lipid binding protein, putative [Ricinus communis]
Length=102

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspN-CCSALGHADMRCLCSFKNSKLLPSLGI  262
            S + T+C+M+   L+ACKPSVT P P  P    CC AL  A++ CLCS++NS +LPSLGI
Sbjct  23   SRSLTLCDMNDDGLLACKPSVTKPDPVEPPSPACCQALTGANLTCLCSYRNSLMLPSLGI  82

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            DP+LA+ LP KC L  PA C
Sbjct  83   DPDLALGLPSKCNLTPPADC  102



>ref|XP_008236785.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +2

Query  83   VSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKN-SKLLPSLG  259
            V+  Q+ C M+ + L AC P+V+   P PPS  CCSAL  AD +CLC FK  S LL + G
Sbjct  27   VNNEQSFCRMTKEGLNACAPAVSGQNPLPPSALCCSALKTADFQCLCLFKKYSNLLSAYG  86

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDPNLAMQLP KC L  P  C
Sbjct  87   IDPNLAMQLPAKCNLGQPIRC  107



>ref|XP_007200072.1| hypothetical protein PRUPE_ppa021237mg [Prunus persica]
 gb|EMJ01271.1| hypothetical protein PRUPE_ppa021237mg [Prunus persica]
Length=107

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +2

Query  83   VSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKN-SKLLPSLG  259
            V+  Q+ C M+ + L AC P+V+   P PPS  CCSAL  AD +CLC FK  S LL + G
Sbjct  27   VNNEQSFCRMTKEGLNACAPAVSGQNPLPPSALCCSALKTADFQCLCLFKKYSNLLSAYG  86

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDPNLAMQLP KC L  P  C
Sbjct  87   IDPNLAMQLPAKCNLGQPIRC  107



>ref|NP_001236926.1| uncharacterized protein LOC100527244 precursor [Glycine max]
 gb|ACU16299.1| unknown [Glycine max]
 gb|KHN10581.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=102

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +2

Query  68   TSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLL  247
            +S  K S+  ++CNM    L ACKPSVT P P  PSP+CC AL  AD++CLCS+KNS  L
Sbjct  18   SSMWKGSKGLSLCNMDEDGLEACKPSVTQPNPVDPSPDCCKALDGADLKCLCSYKNSSEL  77

Query  248  PSLGIDPNLAMQLPEKCKLPHPAHC  322
            P LGID  LA  LP KC L  P +C
Sbjct  78   PLLGIDLTLAASLPAKCNLTPPDNC  102



>ref|XP_004292336.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=118

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = +2

Query  2    FEFVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN  181
             E + M  M   L+  +   M+    + S A T C MS   L ACKPSVT P P  PSP 
Sbjct  12   LEVIKMVKMCNKLVVILVVAMLV-FFEGSTAFTFCKMSDDGLTACKPSVTKPNPVDPSPK  70

Query  182  CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CC AL  AD+ CLCS+KNS +L S GI  +LAM LP KC +  PA+C
Sbjct  71   CCKALSGADLGCLCSYKNSPMLTSFGISSDLAMGLPAKCGIAAPANC  117



>ref|XP_006845070.1| hypothetical protein AMTR_s00005p00084040 [Amborella trichopoda]
 gb|ERN06745.1| hypothetical protein AMTR_s00005p00084040 [Amborella trichopoda]
Length=121

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLG  259
            S AQ IC MS     AC+PSV+   P P +P+  CC AL  AD+ CLCS+++S LLPS G
Sbjct  23   SNAQ-ICRMSQDGFKACQPSVSGSSPAPTNPSKVCCKALASADLGCLCSYRHSLLLPSFG  81

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            IDP+LAMQLP KC L  P  C
Sbjct  82   IDPDLAMQLPAKCNLTTPPQC  102



>gb|KFK31324.1| hypothetical protein AALP_AA6G097600 [Arabis alpina]
Length=100

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPN  271
            A  +C MS  +L  CKP+V    P  PS  CC+AL HAD  CLC +K S  L S GIDP 
Sbjct  24   AIELCGMSEAELNECKPAVNKESPTTPSQLCCNALEHADFNCLCGYKTSPWLGSFGIDPT  83

Query  272  LAMQLPEKCKLPHPAHC  322
            LA+ LP KC LP+P  C
Sbjct  84   LAVGLPTKCGLPNPPTC  100



>ref|NP_001238322.1| uncharacterized protein LOC100305636 [Glycine max]
 gb|ACU13421.1| unknown [Glycine max]
 gb|KHN25355.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=103

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = +2

Query  5    EFVIMKLM-VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN  181
            E   MK+M VG++L  +  GM        +  + C M    + ACKPSV+   P  PS +
Sbjct  2    EGYKMKVMIVGMVLGMVMIGMANG-----QYYSFCRMPSDGMAACKPSVSGDNPVDPSTD  56

Query  182  CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CCSA+  AD++C C +K+S LL   G+DPN  M+LP KCK+    HC
Sbjct  57   CCSAIAKADLKCFCRYKDSGLLSMYGVDPNKCMELPVKCKVVDSFHC  103



>ref|XP_007140732.1| hypothetical protein PHAVU_008G137100g [Phaseolus vulgaris]
 gb|ESW12726.1| hypothetical protein PHAVU_008G137100g [Phaseolus vulgaris]
Length=103

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  98   TICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            + C+M+ + L ACKPSVT P P  PSP CC AL  AD++CLCS+KNS  LP LGIDP LA
Sbjct  29   SFCDMNEEGLEACKPSVTEPNPVDPSPECCKALAGADLKCLCSYKNSSELPFLGIDPILA  88

Query  278  MQLPEKCKLPHPAHC  322
              LP KC L  P +C
Sbjct  89   TSLPAKCNLTPPDNC  103



>gb|KDO51453.1| hypothetical protein CISIN_1g042956mg [Citrus sinensis]
Length=103

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVS-EAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            M+  V +L+  +  G+   +V        +C M+   L AC+P+V    P PPS  CCSA
Sbjct  1    MEAYVKLLILAVILGLAIGSVPTGVNGDGLCRMTKDGLTACQPAVAASNPSPPSTACCSA  60

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L  AD++C C FKNS++L   GID + AMQLP KC L    HC
Sbjct  61   LSKADLQCFCVFKNSRVLSFYGIDFHQAMQLPAKCNLGDSFHC  103



>gb|KDP45250.1| hypothetical protein JCGZ_15115 [Jatropha curcas]
Length=102

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppsp-NCCSALGHADMRCLCSFKNSKLLPSLGI  262
            + +  +C+M    L+ACKPSVT P P  P    CC AL  A++ CLCS++NS +LPSLGI
Sbjct  23   TRSLNLCDMDDDGLLACKPSVTKPNPVVPPSPKCCKALSGANLTCLCSYRNSLMLPSLGI  82

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            DP+LA+ LP KC L  PA C
Sbjct  83   DPDLALALPAKCNLTTPADC  102



>gb|AFK44652.1| unknown [Medicago truncatula]
 gb|KEH30408.1| Lipid transfer protein [Medicago truncatula]
Length=104

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 60/103 (58%), Gaps = 9/103 (9%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN---CCSA  193
            ++VG+LL      ++ +T+ +   Q++C+M+ + L AC P V+             CCSA
Sbjct  8    MIVGILL------IIANTMLLVNGQSLCHMTKQGLKACAPYVSGDNSVNGQKPSDVCCSA  61

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +  AD++CLC +K+S LL   GIDPN AM+LP  CKL    HC
Sbjct  62   IAKADLQCLCRYKDSGLLSFYGIDPNQAMELPVNCKLMDNFHC  104



>gb|KDP46220.1| hypothetical protein JCGZ_10060 [Jatropha curcas]
Length=109

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSAL  196
            MK +  +L   +   ++++ V  + A+T C+M+ + L AC+PSV+   P  PS  CCSAL
Sbjct  5    MKKLATILALVMGIALVSNPVVANGAETFCHMTDEGLNACRPSVSGQNPVAPSAACCSAL  64

Query  197  GHADMRCLCSFKNSK--LLPSLGIDPNLAMQLPEKCKL  304
              AD++CLC +KN+   LL +  IDPN A+QLP KC L
Sbjct  65   SKADLQCLCFYKNNYPWLLTTYKIDPNQALQLPVKCSL  102



>ref|XP_007200836.1| hypothetical protein PRUPE_ppa026221mg [Prunus persica]
 gb|EMJ02035.1| hypothetical protein PRUPE_ppa026221mg [Prunus persica]
Length=100

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGH  202
            ++V + LA          V+V    T C M+   L AC PSV+   P PPS  CCSAL  
Sbjct  9    VIVALFLALAIGPEANEQVQV----TFCRMTKGGLNACAPSVSGLNPLPPSALCCSALSI  64

Query  203  ADMRCLCSFKN-SKLLPSLGIDPNLAMQLPEKCKL  304
            AD +CLC FKN S LL S GIDPNLAMQLP KC L
Sbjct  65   ADFQCLCFFKNYSNLLTSYGIDPNLAMQLPAKCNL  99



>gb|KEH30405.1| Lipid transfer protein [Medicago truncatula]
Length=104

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 9/103 (9%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppsp---NCCSA  193
            ++VG+LL      ++ +T+ + + Q++C M+ K L AC+P V+  K          CC A
Sbjct  8    MIVGILL------IIANTMLLIDGQSLCQMTNKGLKACEPYVSGVKIAAFQIPSDACCHA  61

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
               AD+ CLCS+K+S LL   GIDP+ AM LP KCKL    +C
Sbjct  62   TAKADLECLCSYKDSGLLSFYGIDPDQAMDLPVKCKLVDSFNC  104



>gb|AFK40872.1| unknown [Lotus japonicus]
Length=101

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCL  220
            +  I   ++ +T  ++  Q++CNMS   L +C P+V+   P  P+  CCSA+ +AD+ CL
Sbjct  7    MVVIMGMLLLATAMLANVQSLCNMSNDGLKSCLPAVSGENPADPTLACCSAIANADLPCL  66

Query  221  CSFKNSKLLPSLGIDPNLAMQLPEKCKL  304
            C +K+S LL   G+DP+ AM LP KCKL
Sbjct  67   CHYKSSGLLSFYGVDPDEAMDLPVKCKL  94



>ref|XP_002301823.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 ref|XP_006386890.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 gb|ABK93979.1| unknown [Populus trichocarpa]
 gb|EEE81096.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 gb|ERP64687.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
Length=102

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtpp-kppppspNCCSALGHADMRCLCSFKNSKLLPSLGI  262
            S A ++C++S   L ACKPSVT P    PPS +CC A+  A+  CLCS+KNS LLP LGI
Sbjct  22   SRAVSVCDISEDGLAACKPSVTKPDPVEPPSVDCCKAVSGANFTCLCSYKNSYLLPYLGI  81

Query  263  DPNLAMQLPEKCKL  304
            DP+LAM LP KC L
Sbjct  82   DPDLAMALPSKCNL  95



>gb|AFK43895.1| unknown [Medicago truncatula]
Length=104

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 9/103 (9%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN---CCSA  193
            ++VG+LL  IA  M+     +   Q++C+M+ + L AC P V+             CCSA
Sbjct  8    MIVGILL-IIANAML-----LVNGQSLCHMTKQGLKACAPYVSGDNSVNGQKPSDVCCSA  61

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +  AD++CLC +K+S LL   GIDPN AM+LP  CKL    HC
Sbjct  62   IAKADLQCLCRYKDSGLLSFYGIDPNQAMELPVNCKLMDNFHC  104



>dbj|BAJ87124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=102

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            C+M   D MAC+P+      P P+P+  CC+ LG AD+RCLCS+KNS  L    IDP  A
Sbjct  28   CDMENDDFMACQPAAAATTDPQPAPSEACCATLGKADLRCLCSYKNSPWLSLYNIDPKRA  87

Query  278  MQLPEKCKLPHPAHC  322
            M+LP KC L  P  C
Sbjct  88   MELPAKCGLTTPPDC  102



>ref|XP_006845076.1| hypothetical protein AMTR_s00005p00099640 [Amborella trichopoda]
 gb|ERN06751.1| hypothetical protein AMTR_s00005p00099640 [Amborella trichopoda]
Length=129

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  179  NCCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             CC A+G AD+ CLCS+++S LLPSLGI+P+ AM+LP KC L  P  C
Sbjct  45   GCCKAIGSADLGCLCSYRHSILLPSLGINPDHAMKLPAKCSLTTPPQC  92



>ref|XP_010493672.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
 ref|XP_010493673.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=100

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            +M   V  S A  +C M+  +L  CKP+VT   P  P+  CC+AL HAD  CLC +KNS 
Sbjct  14   IMAMLVDRSVAIDLCGMTQDELNECKPAVTKGNPTNPTQPCCTALQHADFACLCGYKNSP  73

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             L S G+DP LA  LP++C +P+   C
Sbjct  74   WLGSFGVDPELASGLPKECGIPNAPTC  100



>ref|NP_001237117.1| uncharacterized protein LOC100527769 [Glycine max]
 gb|ACU16933.1| unknown [Glycine max]
 gb|KHN14850.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=104

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGH  202
            ++VG++L     GM           + C M    L ACKPSV+   P  PS  CCSA+  
Sbjct  11   MIVGMVLGMAMIGMANGQ------YSFCRMPSDGLAACKPSVSGDYPADPSTACCSAIAK  64

Query  203  ADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            AD++C C FK+S LL   G+DPN  M+LP KCK+    HC
Sbjct  65   ADLKCFCRFKDSGLLSMYGVDPNKCMELPVKCKVVDSFHC  104



>ref|XP_006657616.1| PREDICTED: putative lipid-transfer protein DIR1-like [Oryza brachyantha]
Length=100

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppk--ppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            CNMS    MAC+P+        P PS +CC+AL  AD+ CLCS+KNS  L    IDP+ A
Sbjct  26   CNMSNDQFMACQPAAAATSNPTPSPSADCCTALSKADLSCLCSYKNSPWLSLYNIDPSRA  85

Query  278  MQLPEKCKLPHPAHC  322
            MQLP KC L  P +C
Sbjct  86   MQLPAKCGLTAPPNC  100



>ref|XP_009403612.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  95   QTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNL  274
            ++ C M+ + L+AC PS+T   P  PSP CC+ALG AD+ CLC +++S  LP LGI+   
Sbjct  28   ESHCKMTEEGLIACLPSMTGASPAKPSPKCCAALGKADLACLCKYEDSPALPQLGINRTF  87

Query  275  AMQLPEKCKLPHPAHC  322
            A+QLP KCKL  P +C
Sbjct  88   ALQLPAKCKLSLPKNC  103



>gb|KEH30406.1| Lipid transfer protein [Medicago truncatula]
Length=104

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 10/105 (10%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN----CC  187
            K+M+ V+L  I     ++++      TICN++ ++   C+P V+       +      CC
Sbjct  6    KVMIMVMLLAIGNAKFSTSI------TICNLTREERETCEPYVSGENSVDATRKTFKACC  59

Query  188  SALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            S +  AD+ C C +KNS LL   GIDP LA++LP KCKL     C
Sbjct  60   SVMAKADLECFCRYKNSILLSYYGIDPKLALELPVKCKLRKSFKC  104



>ref|XP_009375630.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=106

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +2

Query  95   QTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKN-SKLLPSLGIDPN  271
            ++ C M+ + L AC PSV+   PPPPS  CCSAL +AD  CLC FK  S  L + GIDPN
Sbjct  30   ESFCRMTKEGLNACAPSVSGANPPPPSALCCSALSYADFGCLCLFKKYSNFLSAYGIDPN  89

Query  272  LAMQLPEKCKLPHPAHC  322
            LAMQLP +C L  P  C
Sbjct  90   LAMQLPARCNLRQPIRC  106



>ref|XP_004492249.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=105

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            +K S   ++CNM+   L ACKP+VT P   P    CC AL  AD+RCLCS+KNS  LP  
Sbjct  25   LKGSNGFSLCNMNEDGLDACKPAVTQPPEDPKP-ECCKALNGADLRCLCSYKNSSELPLF  83

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDP LA  LP KC L  P +C
Sbjct  84   GIDPILASSLPAKCNLTPPDNC  105



>ref|XP_009364632.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
 ref|XP_009364650.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
Length=108

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            +LL  + AG        S A +ICN+    L  C+P+VT   P PP+  CCS +  A++ 
Sbjct  20   ILLLALVAG--------STAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLP  71

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLC+FK+  +LPS+GIDP LAM LP+KC L  P  C
Sbjct  72   CLCNFKS--VLPSIGIDPALAMALPKKCGLKTPREC  105



>ref|XP_009339389.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=102

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            ++ + V  S A +ICN+    L  C+P+VT   P PP+  CCS +  A++ CLC+FK+  
Sbjct  15   LLLALVAGSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFKS--  72

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +LPS+GIDP LAM LP+KC L  P  C
Sbjct  73   VLPSIGIDPALAMALPKKCGLKTPREC  99



>gb|AAM28295.1| PVR3-like protein, partial [Ananas comosus]
Length=112

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +2

Query  101  ICNMSGKDLMACkpsvtppkpppp---spNCCSALGHADMRCLCSFKNSKLLPSLGIDPN  271
            +CNM+   L ACKPSV      P    S  CC+AL  AD+ CLCS+++S LLPSLGIDP+
Sbjct  36   LCNMTRGGLEACKPSVRSGSSDPAADPSKECCAALAGADLPCLCSYRHSFLLPSLGIDPD  95

Query  272  LAMQLPEKCKL  304
            LA+QLP KC L
Sbjct  96   LALQLPAKCNL  106



>ref|XP_008809954.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=104

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            VL+ T+  G   + + V      C MS  DL+ C+P+ +   P  PS  CCSA+  AD+ 
Sbjct  11   VLVLTVFLGDAVTILGVEAGA--CKMSTNDLLECRPAASLSNPTEPSAKCCSAIAKADLP  68

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            C CS+K+S  L  LGID N  +QLP KC +   AHC
Sbjct  69   CFCSYKHSFFLFILGIDVNRVLQLPSKCNIDAHAHC  104



>ref|XP_006281372.1| hypothetical protein CARUB_v10027430mg [Capsella rubella]
 gb|EOA14270.1| hypothetical protein CARUB_v10027430mg [Capsella rubella]
Length=102

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            +M   V +S A  +C M+  +L  CKP+V    P  P+  CC+AL HAD  CLC +KNS 
Sbjct  15   IMVMLVDMSVAIDLCGMTQDELNECKPAVNKENPTTPTQPCCTALQHADFACLCGYKNSP  74

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             L S G+DP LA  LP+ C +P+   C
Sbjct  75   WLGSFGVDPELASGLPKVCGVPNAPTC  101



>ref|XP_010252660.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=100

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            ++A TICNM    L  C P++  P P  P+  CC+ +  AD+ CLCS+K+  +LP+ GID
Sbjct  24   AKAMTICNMDSSQLAQCLPAIRGPSPSAPTSECCNIMRTADLHCLCSYKS--ILPNFGID  81

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P LAM LP++C L  P  C
Sbjct  82   PALAMSLPKRCNLGQPPTC  100



>ref|XP_009335428.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=118

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            ++ + V  S A +ICN+    L  C+P+VT   P PP+  CCS +  A++ CLC+FK+  
Sbjct  31   LLLALVAGSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFKS--  88

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +LPS+GIDP LAM LP+KC L  P  C
Sbjct  89   VLPSIGIDPALAMALPKKCGLKTPREC  115



>ref|XP_010442271.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=94

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V +S A  +C M+  +L  CKP+VT   P  PS  CC+AL HAD  CLC +KNS  L S 
Sbjct  13   VDMSVAIDLCGMTQDELNECKPAVTKGNPTSPSQLCCTALQHADFACLCGYKNSPWLGSF  72

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            G+DP LA  LP++C +P+   C
Sbjct  73   GVDPELASGLPKECGIPNAPTC  94



>ref|XP_004230985.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=104

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            ++++ A ++C ++  DLM CK +V+ PKP PPS  CC+AL  AD  CLC+FKNS +L   
Sbjct  22   IEMASADSLCGLTIYDLMTCKSAVSGPKPLPPSDKCCAALTKADFPCLCTFKNSPMLSDF  81

Query  257  GIDPNLAMQLPEKCKLPHP  313
             I+  LAM LP KCKL  P
Sbjct  82   KINSTLAMDLPSKCKLDSP  100



>gb|KHG12015.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=106

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 65/98 (66%), Gaps = 5/98 (5%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KL+V  L+AT+   ++ + V+ ++  TICN+  K L  CKP+VT   PPPP+  CCS + 
Sbjct  7    KLLVQCLVATL---LLIAAVEGAKETTICNIPLKKLEQCKPAVTGKNPPPPTKECCSLIK  63

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
             AD+ CLC++K++  LP+  I+P+ A  LP+KCK  HP
Sbjct  64   QADLTCLCNYKDA--LPAFQIEPSRAFALPQKCKCKHP  99



>ref|XP_006856839.1| hypothetical protein AMTR_s00055p00181150 [Amborella trichopoda]
 gb|ERN18306.1| hypothetical protein AMTR_s00055p00181150 [Amborella trichopoda]
Length=147

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  80   KVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLG  259
            +      IC M   +L  C P++  P P  P+P CCS +  AD+ CLCS+++S LLP+ G
Sbjct  48   EFGNGMEICGMDSGELQQCLPAIRGPSPSAPNPGCCSTIRKADLLCLCSYRDSFLLPTFG  107

Query  260  IDPNLAMQLPEKCKLPHPAHC  322
            +DP LAM LP +C L  P  C
Sbjct  108  VDPKLAMALPRECHLIPPPQC  128



>ref|XP_008779441.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Phoenix 
dactylifera]
Length=103

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQ  283
            C ++ + L+AC PS+T  +P  PS  CC+AL  AD+ CLC +KNS +L  LGI P LAMQ
Sbjct  32   CRITEEGLLACLPSITGSQPVKPSVWCCTALSKADLLCLCHYKNSPMLSQLGIKPKLAMQ  91

Query  284  LPEKCKLPHPAH  319
            LP KCKL  P  
Sbjct  92   LPAKCKLRLPKQ  103



>ref|XP_004292000.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=108

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 6/82 (7%)
 Frame = +2

Query  95   QTICNMSGKDLMACkpsvtppkp-----pppspNCCSALGHADMRCLCSF-KNSKLLPSL  256
             +IC M+    +AC PSVT           P+  CCSAL  AD  CLC F +NSK+L + 
Sbjct  27   SSICRMTKDGFLACAPSVTASATPGFIPAAPTAECCSALSVADFPCLCFFMRNSKILNAY  86

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            G+DP+LAMQLP KC L    HC
Sbjct  87   GVDPSLAMQLPAKCNLARSVHC  108



>ref|XP_009797273.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=106

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KL++ V L  +AA +           + C +S  DLM+CKP+V+ PKP PPS  CC+ALG
Sbjct  6    KLVIFVALVMVAA-VGFEVAAAGSGDSPCGLSIGDLMSCKPAVSGPKPLPPSEKCCAALG  64

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
             AD+ CLC+FKNS ++ +  I+  LAM LP KC L  P
Sbjct  65   KADLPCLCTFKNSPMISAFKINATLAMDLPSKCNLNSP  102



>gb|AAM62457.1| unknown [Arabidopsis thaliana]
Length=102

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V  S A  +C MS  +L  CKP+V+   P  PS  CC+AL HAD  CLC +KNS  L S 
Sbjct  21   VDTSVAIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSF  80

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            G+DP LA  LP++C L +   C
Sbjct  81   GVDPELASALPKQCGLANAPTC  102



>ref|XP_010482097.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=103

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V  S A  +C M+  +L  CKP+VT   P  PS  CC+AL HAD  CLC +KNS  L S 
Sbjct  22   VDRSVAIDLCGMTQDELNECKPAVTKGNPTSPSQLCCTALQHADFACLCGYKNSPWLGSF  81

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            G+DP LA  LP++C +P+   C
Sbjct  82   GVDPELASGLPKECGIPNAPTC  103



>ref|NP_568699.1| putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
 sp|Q8W453.1|DIRL1_ARATH RecName: Full=Putative lipid-transfer protein DIR1; AltName: 
Full=Protein DEFECTIVE IN INDUCED RESISTANCE 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32935.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL76110.1| DIR1 protein [Arabidopsis thaliana]
 gb|AAP21318.1| At5g48485 [Arabidopsis thaliana]
 gb|AED95676.1| putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
Length=102

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V  S A  +C MS  +L  CKP+V+   P  PS  CC+AL HAD  CLC +KNS  L S 
Sbjct  21   VDTSVAIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSF  80

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            G+DP LA  LP++C L +   C
Sbjct  81   GVDPELASALPKQCGLANAPTC  102



>ref|XP_006365510.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=104

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            ++++ A + C ++  DLM CK +V+ PKP PPS  CC+AL  AD+ CLC+FKNS +L S 
Sbjct  22   IEMASADSFCGLTINDLMTCKSAVSGPKPLPPSDKCCAALTKADLPCLCTFKNSPMLSSF  81

Query  257  GIDPNLAMQLPEKCKLPHP  313
             I+  LAM LP KCK   P
Sbjct  82   KINSTLAMDLPSKCKPDSP  100



>gb|EYU42633.1| hypothetical protein MIMGU_mgv1a024655mg [Erythranthe guttata]
Length=112

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHAD  208
            V+ A+  +GM  +    S+   +C MS  +L  CKP+V      PP P+  CC+AL HA+
Sbjct  17   VIAASAVSGM--AKAASSDDNGLCGMSQDELFECKPAVAAGSAIPPPPSAACCTALTHAN  74

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
              C C+FKN+K LP  GI+   AMQLP KC     AHC
Sbjct  75   ATCFCTFKNNKYLPLFGINSTRAMQLPSKCDPTQIAHC  112



>ref|XP_006448002.1| hypothetical protein CICLE_v10017274mg [Citrus clementina]
 gb|ESR61242.1| hypothetical protein CICLE_v10017274mg [Citrus clementina]
Length=103

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppk--ppppspNCCSALGH  202
            +G  L  + A +M   ++ S A ++C MS   L ACKP VT        PS  CC AL  
Sbjct  3    MGKKLVVLLAVVMMMGIESSRALSLCKMSDAGLEACKPYVTQDAPNTAAPSAQCCKALAG  62

Query  203  ADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            AD++CLC +K S +L + GIDP+LA+ LP KC  P    C
Sbjct  63   ADLQCLCGYKGSPMLKAFGIDPDLALALPAKCNPPIAVPC  102



>gb|AEB33950.1| defective in induced resistance 2 protein [Nicotiana tabacum]
Length=106

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KL++ V L  +AA +           + C +S  DLM+CKP+V+ PKP PPS  CC+ALG
Sbjct  6    KLVIFVALVMVAA-VGFEMAAAGSGDSPCGLSIGDLMSCKPAVSGPKPLPPSEKCCAALG  64

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
             AD+ CLC+FKNS ++ +  I+  LAM LP KC L  P
Sbjct  65   KADLPCLCTFKNSPMISAFKINATLAMDLPSKCNLNSP  102



>ref|XP_006492236.1| PREDICTED: putative lipid-transfer protein DIR1-like [Citrus 
sinensis]
Length=103

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppk--ppppspNCCSALGH  202
             G  L  + A +M   ++ S A ++C MS   L ACKP VT        PS  CC AL  
Sbjct  3    TGKKLVVLLAVVMMMGIESSRALSLCKMSDAGLEACKPYVTQDAPNTAAPSAQCCKALAG  62

Query  203  ADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            AD++CLC +K S +L + GIDP+LA+ LP KC  P    C
Sbjct  63   ADLQCLCGYKGSPMLKAFGIDPDLALALPAKCNPPIAVPC  102



>ref|NP_199660.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAA96969.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64774.1| unknown [Arabidopsis thaliana]
 gb|ABF82604.1| At5g48490 [Arabidopsis thaliana]
 gb|AED95677.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=101

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            V +  I   M +  V+ S A  +C M+  +L  C P+V+   P  PS  CC+AL HAD  
Sbjct  6    VAIMVIVMVMASLVVERSVAIDLCGMTQAELNECLPAVSKNNPTSPSLLCCNALKHADYT  65

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLC +KNS  L S G+DP LA  LP++C L +   C
Sbjct  66   CLCGYKNSPWLGSFGVDPKLASSLPKECDLTNAPTC  101



>ref|XP_004507410.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=105

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 58/103 (56%), Gaps = 8/103 (8%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkpppp---spNCCSA  193
            ++VG++L  IA  M+     +   Q+ C+M+   L +CKP V+          S  CCSA
Sbjct  8    MIVGIMLLAIANAML-----LVNGQSYCHMTKSGLNSCKPYVSGDNSVDDQIPSNACCSA  62

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +  AD++CLC + +S LL   G+DP  AM+LP KCKL    HC
Sbjct  63   ISKADLQCLCRYMDSGLLSFYGVDPKQAMELPVKCKLMDSFHC  105



>ref|XP_009601194.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana tomentosiformis]
Length=104

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 11/102 (11%)
 Frame = +2

Query  8    FVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCC  187
            FV + ++  V +   AAG            + C +S  DLM+CKP+V+ PKP PPS  CC
Sbjct  10   FVALVMVASVGIEIAAAG-----------DSSCGLSIADLMSCKPAVSGPKPMPPSEKCC  58

Query  188  SALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
            +ALG AD+ CLC+FKNS ++ +  I+  LAM LP KC L  P
Sbjct  59   TALGKADLPCLCTFKNSPIISTFKINATLAMDLPSKCNLNSP  100



>ref|XP_009129731.1| PREDICTED: putative lipid-transfer protein DIR1 [Brassica rapa]
 emb|CDY48760.1| BnaA02g30210D [Brassica napus]
Length=104

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
             + S A  +C M+  +L  CKP+V+   P  PS  CC  L HAD+ CLC +KNS LL S 
Sbjct  23   AERSVAIDLCGMTQSELNECKPAVSKENPTNPSTLCCDYLKHADISCLCGYKNSPLLGSF  82

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GIDP LA  LP KC +P+   C
Sbjct  83   GIDPALAAGLPTKCDMPNAPTC  104



>ref|XP_002865639.1| hypothetical protein ARALYDRAFT_917749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41898.1| hypothetical protein ARALYDRAFT_917749 [Arabidopsis lyrata subsp. 
lyrata]
Length=103

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   VKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSL  256
            V  S A  +C M+  +L  CKP+V+   P  PS  CCSAL HAD  CLC +KNS  L S 
Sbjct  22   VDRSVAIDLCGMTQDELNECKPAVSKENPTSPSQPCCSALQHADFTCLCGYKNSPWLGSF  81

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            G+DP LA  LP++C L +   C
Sbjct  82   GVDPELASGLPKQCGLTNAPTC  103



>gb|AAO22703.1| unknown protein [Arabidopsis thaliana]
Length=100

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            M +  V+ S A  +C M+  +L  C P+V+   P  PS  CC+AL HAD  CLC +KNS 
Sbjct  14   MASLVVERSVAIDLCGMTQAELNECLPAVSKNNPTSPSLLCCNALKHADYTCLCGYKNSP  73

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             L S G+DP LA  LP++C L +   C
Sbjct  74   WLGSFGVDPKLASSLPKECDLTNAPTC  100



>ref|XP_006845078.1| hypothetical protein AMTR_s00005p00101720 [Amborella trichopoda]
 gb|ERN06753.1| hypothetical protein AMTR_s00005p00101720 [Amborella trichopoda]
Length=91

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  182  CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC*LSYLL  340
            CC A+G AD+ CLCS+++S LL SLGI+P+LA+QLP KC L  P  C + ++L
Sbjct  27   CCKAIGSADLGCLCSYRHSLLLHSLGINPDLALQLPAKCNLRTPPQCQVMHVL  79



>emb|CDY05673.1| BnaC02g38640D [Brassica napus]
Length=103

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHAD  208
            VGV++  +   +M +  + S A  +C M+  +L  CKP+V+   P  PS  CC  L HAD
Sbjct  6    VGVMVMMMVVVVMATLAERSVAIDLCGMTQSELNECKPAVSKENPTKPSTLCCDYLKHAD  65

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
              CLC ++NS  L S GIDP LA+ LP KC +P+   C
Sbjct  66   FSCLCGYRNSPWLGSFGIDPALALGLPSKCDMPNAPAC  103



>ref|XP_003570573.1| PREDICTED: putative lipid-transfer protein DIR1 [Brachypodium 
distachyon]
Length=103

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkpppp---spNCCSALGHADMRCLCSFKNSKLLPSLGIDPNL  274
            C+M   D MAC+P+      P P   S  CC+ LG AD++CLCS+K S  L    IDP  
Sbjct  28   CDMDNDDFMACQPAAAATTSPTPPDPSAACCATLGKADLKCLCSYKKSPWLSLYNIDPKR  87

Query  275  AMQLPEKCKLPHPAHC  322
            AM+LP KC L  PA C
Sbjct  88   AMELPAKCGLSPPADC  103



>ref|XP_002865640.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41899.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=101

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 6/102 (6%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSAL  196
            M +MV V++      M +  ++ S A  +C M+  +L  C P+V+   P  PS  CC+AL
Sbjct  6    MAIMVIVMV------MASLVIERSVAIDLCGMTQAELNECLPAVSKNNPKSPSQLCCNAL  59

Query  197  GHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             HAD  CLC +KNS  L S G+DP LA  LP++C L +   C
Sbjct  60   KHADYTCLCGYKNSPWLGSFGVDPKLASGLPKECDLANAPAC  101



>pdb|2RKN|A Chain A, X-Ray Structure Of The Self-Defense And Signaling Protein 
Dir1 From Arabidopsis Taliana
Length=77

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  101  ICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNLAM  280
            +C MS  +L  CKP+V+   P  PS  CC+AL HAD  CLC +KNS  L S G+DP LA 
Sbjct  4    LCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELAS  63

Query  281  QLPEKCKLPHPAHC  322
             LP++C L +   C
Sbjct  64   ALPKQCGLANAPTC  77



>ref|XP_007042728.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOX98559.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=105

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGM-MTSTVKVSEAQTICNMSGKDLMAC--kpsvtppkppppspNCC  187
            M+    ++LA +  G+ + S   V+  Q +C MS +   AC    S   P PPPPSP CC
Sbjct  1    MEGYAKIVLAAMVLGLAIGSEPFVANGQKVCGMSKEGFQACEPSVSSANPHPPPPSPACC  60

Query  188  SALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             AL  AD++C C FKNSK+L + GID + A  LP +C L    HC
Sbjct  61   MALNDADLQCFCFFKNSKMLNAYGIDFDRATALPVQCNLVKSFHC  105



>ref|XP_008385814.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=114

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 2/77 (3%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPN  271
            A +ICN+    L  C+P+VT   P PP+  CC  +  A++ CLC+FK+  +LPS+GIDP 
Sbjct  37   AVSICNIESDQLKECRPAVTGKSPKPPTKRCCXVVRQANLPCLCNFKS--VLPSIGIDPA  94

Query  272  LAMQLPEKCKLPHPAHC  322
            LAM LP+KC L  P  C
Sbjct  95   LAMALPKKCGLKTPREC  111



>ref|XP_009801499.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=100

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +2

Query  26   MVGVLLATIAAGMMTSTVKVSEA---QTICNMSGKDLMACkpsvtppkppppspNCCSAL  196
            M  V L  +   +MT  + ++ A   +TIC ++  +L  C P+V   KPPPP+ +CC+AL
Sbjct  1    MAKVWLTLLFFALMTVYIDMANAGTPKTICRVTINELAECLPAVMGQKPPPPTADCCAAL  60

Query  197  GHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
              AD+RC+C+ K+   L  LGIDP  AM+LP++CK+  P  C
Sbjct  61   HKADLRCMCNKKSE--LGQLGIDPAAAMKLPKQCKIDVPRRC  100



>ref|XP_002459717.1| hypothetical protein SORBIDRAFT_02g009300 [Sorghum bicolor]
 gb|EER96238.1| hypothetical protein SORBIDRAFT_02g009300 [Sorghum bicolor]
Length=124

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +2

Query  95   QTICNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            + +C+MS +  M+C+P+      PP +P+  CC AL  AD++CLC +K+S  +    IDP
Sbjct  47   EAVCDMSNEQFMSCQPAAAKTTDPPAAPSQACCEALAGADLKCLCGYKDSPWMSVYNIDP  106

Query  269  NLAMQLPEKCKLPHPAHC  322
              AM+LP KC L  P +C
Sbjct  107  KRAMELPAKCGLATPPNC  124



>gb|ACG42309.1| PVR3-like protein [Zea mays]
Length=112

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGID  265
            A  +C+MS +  M+C+P+      PP +P+  CC AL  AD++CLC +KNS  +    ID
Sbjct  34   AAAVCDMSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNID  93

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P  AM+LP KC L  P  C
Sbjct  94   PKRAMELPAKCGLATPPDC  112



>ref|XP_006395174.1| hypothetical protein EUTSA_v10005129mg [Eutrema salsugineum]
 gb|ESQ32460.1| hypothetical protein EUTSA_v10005129mg [Eutrema salsugineum]
Length=126

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            V++  + A  M S+V +     +C M+  +L  CKP+VT   P  PS  CC AL HAD+ 
Sbjct  35   VMIVVVMAISMESSVAID----LCGMTETELNECKPAVTKESPTSPSQLCCDALKHADLN  90

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLC +K+S  L S GIDP LA+ LP  C L +   C
Sbjct  91   CLCGYKHSPWLGSFGIDPELAVGLPTICGLANAPTC  126



>ref|XP_007131858.1| hypothetical protein PHAVU_011G047400g [Phaseolus vulgaris]
 gb|AAC49370.1| non-specific lipid transfer-like protein [Phaseolus vulgaris]
 gb|ESW03852.1| hypothetical protein PHAVU_011G047400g [Phaseolus vulgaris]
Length=102

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  86   SEAQ-TICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGI  262
            S AQ + C M    L +C  SV+   P  P+ +CC A+  AD++C C +K+S LL   G+
Sbjct  23   SNAQYSFCRMPKDGLKSCLASVSGDNPVDPTSDCCLAIAKADLQCFCRYKDSGLLSIYGV  82

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            DPN  M+LP KCK+    HC
Sbjct  83   DPNKCMELPVKCKVVDSFHC  102



>ref|XP_010679256.1| PREDICTED: putative lipid-transfer protein DIR1 [Beta vulgaris 
subsp. vulgaris]
Length=105

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 4/100 (4%)
 Frame = +2

Query  14   IMKLMVGVLLATIAAGMMTSTVKVSEAQT-ICNMSGKDLMACkpsvtppkppppspNCCS  190
            ++ LM+ + +  +  G +   ++ ++AQT +C +    L++C PSV  P P PPS  CC+
Sbjct  7    LVNLMIVISIIMVVGGEL---MQRADAQTEVCGIPVTSLLSCLPSVKQPNPAPPSAQCCA  63

Query  191  ALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPH  310
             L  AD +CLCS+ +S LLP  GID  L + LP KC LP+
Sbjct  64   TLKQADEKCLCSYSSSPLLPKYGIDKGLFLALPAKCGLPN  103



>emb|CAN72894.1| hypothetical protein VITISV_022314 [Vitis vinifera]
Length=133

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            ++ TIC+M    L  C P++  P P PP+  CC+ +  ADM CLCS+K++  LP+ G++P
Sbjct  26   KSMTICSMDSTQLAQCLPAIXGPSPSPPTKECCAVIQKADMHCLCSYKHA--LPNFGVNP  83

Query  269  NLAMQLPEKCKLPHPAHC  322
             LAM LP+KC L  P  C
Sbjct  84   GLAMALPKKCGLNPPPEC  101



>ref|XP_010646191.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
 ref|XP_010646192.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=104

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            ++ TIC+M    L  C P++  P P PP+  CC+ +  ADM CLCS+K++  LP+ G++P
Sbjct  26   KSMTICSMDSTQLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHA--LPNFGVNP  83

Query  269  NLAMQLPEKCKLPHPAHC  322
             LAM LP+KC L  P  C
Sbjct  84   GLAMALPKKCGLNPPPEC  101



>ref|XP_004294054.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=102

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
            ++ + ++ + A +ICN+    L  C+ +V+   P PPS  CC  +  A++ CLC++K   
Sbjct  16   LLIALLEGAHAASICNIDSAQLNYCRRAVSGKSPTPPSKKCCGVVHRANLPCLCNYKT--  73

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +LPS GIDP LAM LP+KC +  P  C
Sbjct  74   VLPSFGIDPALAMALPKKCGMKTPPEC  100



>emb|CAN61352.1| hypothetical protein VITISV_027758 [Vitis vinifera]
Length=107

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            VL   +   ++ + V  S A TICN+    L  C P+V+   PPPP+  CC+AL  AD+ 
Sbjct  8    VLAQVVVVMVLIAMVGGSSAATICNIDTSKLAECLPAVSGRSPPPPTKACCTALLSADLH  67

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLC++K++  LP+ GI+P LAM LP+KC    P +C
Sbjct  68   CLCNYKSA--LPAFGINPALAMALPKKCGGSLPPNC  101



>ref|XP_002519093.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF43304.1| lipid binding protein, putative [Ricinus communis]
Length=99

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK--LLPSLGID  265
             +  C ++ + + AC+PSVT   P  PS  CC+AL  AD++CLC +KN+   LL S  ID
Sbjct  20   GENPCRLTNEGIEACRPSVTGQNPAAPSDACCAALSKADLQCLCFYKNNYPWLLSSYKID  79

Query  266  PNLAMQLPEKCKL  304
            PNLAMQLP KCKL
Sbjct  80   PNLAMQLPVKCKL  92



>ref|NP_001235382.1| uncharacterized protein LOC100527644 precursor [Glycine max]
 gb|ACU16775.1| unknown [Glycine max]
Length=101

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            +A  ICN+    L  C+ +VT   PPPP   CC+ +  A++RCLCS+K+  +LPS GI+P
Sbjct  26   QAVAICNIDSSQLSLCRAAVTGQNPPPPDEKCCAVIRQANLRCLCSYKS--ILPSFGINP  83

Query  269  NLAMQLPEKCKLPHPAHC  322
              A+ LP KC L  P +C
Sbjct  84   KNALALPGKCGLQSPPNC  101



>ref|XP_002275805.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=107

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            VL   +   ++ + V  + A TICN+    L  C P+V+   PPPP+  CC+AL  AD+ 
Sbjct  8    VLAQVVVVMVLIAMVGGASAATICNIDTSKLAECLPAVSGRSPPPPTKACCTALLSADLH  67

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLC++K++  LP+ GI+P LAM LP+KC    P +C
Sbjct  68   CLCNYKSA--LPAFGINPALAMALPKKCGGSLPPNC  101



>gb|KHN14583.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=101

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            +A  ICN+    L  C+ +VT   PPPP   CC+ +  A++RCLCS+K+  +LPS GI+P
Sbjct  26   QAVAICNIDSSQLNLCRAAVTGQNPPPPDEKCCAVIRQANLRCLCSYKS--ILPSFGINP  83

Query  269  NLAMQLPEKCKLPHPAHC  322
              A+ LP KC L  P +C
Sbjct  84   KNALALPGKCGLQSPPNC  101



>ref|XP_006474969.1| PREDICTED: putative lipid-transfer protein DIR1-like [Citrus 
sinensis]
Length=111

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPN  271
            A +ICN+    +  C P+V+   P  P+  CC+ +  A + CLCS+KN  LLP+ GI+P 
Sbjct  34   AISICNIESSKMNLCLPAVSGKSPTQPTEQCCAVVSGAKLSCLCSYKN--LLPAFGINPK  91

Query  272  LAMQLPEKCKLPHPAHC  322
             A+ LP+KC L  P  C
Sbjct  92   YALALPKKCGLETPPQC  108



>ref|XP_008447223.1| PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo]
Length=103

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 54/103 (52%), Gaps = 5/103 (5%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtpp-kppppspNCCSA  193
            M L V +    I  G+      +S A  +C +  + L ACKP VT P     P   CC+ 
Sbjct  3    MALKVKITAVVILVGI----AGISIAMEMCGVDEEGLTACKPWVTKPCPTEMPPATCCNK  58

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L +AD  C C +KNS LL S GIDP+LA+ LP KC + +   C
Sbjct  59   LSNADFSCFCKYKNSMLLSSFGIDPDLALALPVKCNITNTPTC  101



>ref|NP_001152561.1| PVR3-like protein [Zea mays]
 gb|ACG41491.1| PVR3-like protein [Zea mays]
 gb|ACG48209.1| PVR3-like protein [Zea mays]
Length=112

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            C+MS +  M+C+P+      PP +P+  CC AL  AD++CLC +KNS  +    IDP  A
Sbjct  38   CDMSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNIDPKRA  97

Query  278  MQLPEKCKLPHPAHC  322
            M+LP KC L  P  C
Sbjct  98   MELPAKCGLATPPDC  112



>gb|KDO62172.1| hypothetical protein CISIN_1g039924mg [Citrus sinensis]
Length=106

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPN  271
            A +ICN+    +  C P+V+   P  P+  CC+ +  A + CLCS+KN  LLP+ GI+P 
Sbjct  29   AISICNIESSKMNLCLPAVSGKSPTQPTEQCCAVVSGAKLSCLCSYKN--LLPAFGINPK  86

Query  272  LAMQLPEKCKLPHPAHC  322
             A+ LP+KC L  P  C
Sbjct  87   YALALPKKCGLETPPQC  103



>ref|NP_001146924.1| PVR3-like protein [Zea mays]
 gb|ACG24402.1| PVR3-like protein [Zea mays]
 gb|ACG24441.1| PVR3-like protein [Zea mays]
 gb|ACG24466.1| PVR3-like protein [Zea mays]
 gb|ACG25053.1| PVR3-like protein [Zea mays]
 gb|ACG25107.1| PVR3-like protein [Zea mays]
 tpg|DAA39398.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein isoform 1 [Zea mays]
 tpg|DAA39399.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein isoform 2 [Zea mays]
Length=115

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            C+MS +  M+C+P+      PP +P+  CC AL  AD++CLC +KNS  +    IDP  A
Sbjct  41   CDMSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNIDPKRA  100

Query  278  MQLPEKCKLPHPAHC  322
            M+LP KC L  P  C
Sbjct  101  MELPAKCGLATPPDC  115



>ref|XP_004955968.1| PREDICTED: putative lipid-transfer protein DIR1-like [Setaria 
italica]
Length=101

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +2

Query  104  CNMSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGIDPNLA  277
            C MS +  M+C+P+      PP  P   CC ALG AD+ CLC +KNS  +    IDP+ A
Sbjct  26   CGMSNEQFMSCQPAAAKTTDPPAPPTQACCDALGGADLGCLCGYKNSPWMGVYNIDPSRA  85

Query  278  MQLPEKCKLPHPAHC  322
            M LP KC L  P +C
Sbjct  86   MALPAKCGLATPPNC  100



>ref|NP_001236851.1| uncharacterized protein LOC100526983 precursor [Glycine max]
 gb|ACU16019.1| unknown [Glycine max]
 gb|KHN14582.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=101

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            +A  ICN+    L  C+ +VT   PPPP   CC+ +  A++RCLCS+K++  LPS GI+P
Sbjct  26   QAVAICNIDSSQLNLCRAAVTGQNPPPPDEKCCAVVRQANLRCLCSYKST--LPSFGINP  83

Query  269  NLAMQLPEKCKLPHPAHC  322
              A+ LP KC L  P +C
Sbjct  84   KNALALPGKCGLQWPPNC  101



>ref|XP_004150334.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 gb|KGN44690.1| hypothetical protein Csa_7G372360 [Cucumis sativus]
Length=103

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 54/103 (52%), Gaps = 5/103 (5%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtpp-kppppspNCCSA  193
            M   V V++  I  G+      +S A  +C +    L ACKP VT P     P   CC+ 
Sbjct  3    MAQKVTVMVVLILVGL----AGISIAMEVCGVDEDGLTACKPWVTKPCPAEMPPAACCNK  58

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L +AD  C C +KNS LL S GID +LA+ LP KC +P+   C
Sbjct  59   LSNADFDCFCKYKNSMLLSSFGIDSDLALALPVKCNIPNTPTC  101



>ref|XP_006452488.1| hypothetical protein CICLE_v10010463mg [Citrus clementina]
 gb|ESR65728.1| hypothetical protein CICLE_v10010463mg [Citrus clementina]
Length=79

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPN  271
            A +ICN+    +  C P+V+   P  P+  CC+ +  A + CLCS+KN  LLP+ GI+P 
Sbjct  2    AISICNIESSKMNLCLPAVSGKSPTQPTEQCCAVVSGAKLSCLCSYKN--LLPAFGINPK  59

Query  272  LAMQLPEKCKLPHPAHC  322
             A+ LP+KC L  P  C
Sbjct  60   YALALPKKCGLETPPQC  76



>ref|XP_004166453.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
Length=103

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 54/103 (52%), Gaps = 5/103 (5%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtpp-kppppspNCCSA  193
            M   V V++  I  G+      +S A  +C +    L ACKP VT P     P   CC+ 
Sbjct  3    MAQKVTVMVVLILVGL----AGISIAMEVCGVDEDGLTACKPWVTKPCPAEMPPAACCNK  58

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            L +AD  C C +KNS LL S GID +LA+ LP KC +P+   C
Sbjct  59   LSNADFDCFCKYKNSMLLSSFGIDSDLALALPVKCNIPNTPTC  101



>ref|NP_001235288.1| uncharacterized protein LOC100305686 precursor [Glycine max]
 gb|ACU13501.1| unknown [Glycine max]
 gb|KHN05129.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=103

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            + A  ICN+    L  C+ +VT   PPPP   CC+ +  A++RCLCS+K+  +LPS GI+
Sbjct  27   AHAVAICNIDSSQLNLCRAAVTGQNPPPPDEKCCAVIRQANLRCLCSYKS--ILPSFGIN  84

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P  A+ LP KC L  P +C
Sbjct  85   PKNALALPAKCGLQLPPNC  103



>ref|XP_010324294.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=104

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 10/105 (10%)
 Frame = +2

Query  8    FVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCC  187
            F++  L++ V +ATI A            + IC ++  DLM C P+V   +PP P+P+CC
Sbjct  10   FLLFALIITVQIATINAA--------ETPEVICKVTINDLMLCLPAVMGKRPPKPTPDCC  61

Query  188  SALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            + L  AD++C+C+ K+   L   GI P  AM LP++CK+  P  C
Sbjct  62   AVLRKADLQCMCNQKSE--LGKFGISPEAAMNLPKQCKIKVPDGC  104



>ref|XP_010096215.1| hypothetical protein L484_026950 [Morus notabilis]
 gb|EXB63610.1| hypothetical protein L484_026950 [Morus notabilis]
Length=114

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHAD  208
            + +L    A G MT T       + C M+ +   +C+PSV    P PPS  CC+A+  +D
Sbjct  21   LAILSGVGANGEMTYTY------SFCRMTKEGFGSCQPSVDRSNPLPPSKACCAAISKSD  74

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPA  316
             +CLC FK+S LL    +DP LA+ LP +C L  P+
Sbjct  75   FQCLCYFKDSPLLKIYQVDPQLAVDLPRQCNLDGPS  110



>ref|XP_010028567.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
 gb|KCW55323.1| hypothetical protein EUGRSUZ_I01246 [Eucalyptus grandis]
Length=104

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  98   TICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK-LLPSLGIDPNL  274
            ++C MS +   ACKPSV+   P  P+  CCSAL +AD+ CLC FK ++ LL +  I+P+L
Sbjct  29   SMCGMSKEGFEACKPSVSGSNPTEPTRGCCSALTNADLNCLCFFKYARTLLQTYQINPDL  88

Query  275  AMQLPEKCKLPHPAHC  322
            A QLP KC L    HC
Sbjct  89   AAQLPVKCNLVPSFHC  104



>gb|ABK23184.1| unknown [Picea sitchensis]
Length=103

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 53/104 (51%), Gaps = 3/104 (3%)
 Frame = +2

Query  17   MKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSAL  196
            MK M    +  +   ++ S         ICN+S  DLM CKP+VT P   P    CCS L
Sbjct  1    MKPMKITGMTIVIVAVLASISVAGGVVEICNVSKDDLMPCKPAVTQPPAQPVQA-CCSVL  59

Query  197  GHADMRCLCSFKNS--KLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
              A++ C C F N+   LL   GIDP+LA  LP +CKL  P  C
Sbjct  60   STANLTCFCEFGNNYPSLLRMFGIDPDLAKALPGECKLNSPPGC  103



>gb|KHG21649.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=152

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 5/94 (5%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            KLMV  L+A     ++ + V+ ++  TICN+    L  C+P+VT   PPPP+  CC  + 
Sbjct  7    KLMVYCLVAIF---VVIAMVEGAKGATICNIPLSRLNLCRPAVTGRYPPPPTKKCCLLIK  63

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCK  301
            HAD+ CLC FK++  LP+  I+P+ A  LP+KCK
Sbjct  64   HADLNCLCKFKDA--LPAFNINPSRAFALPKKCK  95



>gb|ACG31910.1| PVR3-like protein [Zea mays]
Length=73

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  182  CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CC AL  AD++CLC +KNS  +    IDP  AM+LP KC L  P  C
Sbjct  27   CCDALAGADLKCLCGYKNSPWMGVYNIDPKRAMELPAKCGLATPPDC  73



>ref|XP_002313813.2| hypothetical protein POPTR_0009s11560g [Populus trichocarpa]
 gb|EEE87768.2| hypothetical protein POPTR_0009s11560g [Populus trichocarpa]
Length=109

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQ-TICNMSGKDLMACkpsvtppkpppp-spNCCSALGHAD  208
            V++A + A  + S    ++ Q T+C M+ +   +CKPSV     P P S +CCSAL  AD
Sbjct  9    VVVALVMAFALVSNPIAAKGQVTLCGMTKEGFASCKPSVQTGVNPLPPSYSCCSALEKAD  68

Query  209  MRCLCSFKNS--KLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            + CLC FK +  K+L    IDPNLAMQLP KC +     C
Sbjct  69   LSCLCFFKKNYPKMLTDNNIDPNLAMQLPAKCNMAGSFSC  108



>ref|XP_003530774.2| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
 gb|KHM99504.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=104

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = +2

Query  38   LLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRC  217
            L+  + A ++ + +  ++A  +C++    L  C  +VT   P  P+  CC  + HA++ C
Sbjct  9    LVQWLVASLLIAMLGGAKAYVLCDIESNKLSLCYAAVTGSHPKKPNEKCCEIVQHANLPC  68

Query  218  LCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            LC +K+  +LP+LGI+P  A  LP KC L  P  C
Sbjct  69   LCRYKS--ILPALGINPTNAFALPSKCGLKTPPKC  101



>ref|XP_008227058.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=104

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 2/94 (2%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCL  220
            L  + A  + + V  + A +ICN+    L  C+P+VT   P PP+  CC  +  A++ CL
Sbjct  10   LQWVMAIFLIALVGGARAVSICNIDSAKLNECRPAVTGNSPKPPTKKCCDVVHQANLPCL  69

Query  221  CSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            C++K++   P+ GI+P LAM LP+KC +  P  C
Sbjct  70   CNYKSA--FPAFGINPALAMALPKKCGMNTPREC  101



>ref|NP_001059392.1| Os07g0290200 [Oryza sativa Japonica Group]
 dbj|BAC22364.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC22475.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21306.1| Os07g0290200 [Oryza sativa Japonica Group]
 gb|EAZ39449.1| hypothetical protein OsJ_23880 [Oryza sativa Japonica Group]
 dbj|BAG88344.1| unnamed protein product [Oryza sativa Japonica Group]
Length=104

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK----LLPSL  256
            A  ICN+S   L ACKP+     P    S  CC AL  AD+ CLC +K S      +   
Sbjct  23   AHGICNLSDAGLQACKPAAAVRNPADTPSSECCDALAAADLPCLCRYKGSAGARVWVRFY  82

Query  257  GIDPNLAMQLPEKCKLPHPAHC  322
            GID N AM LP KC L  PAHC
Sbjct  83   GIDLNRAMTLPGKCGLTLPAHC  104



>gb|AFK45052.1| unknown [Lotus japonicus]
Length=102

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            ++A  +CN+    L +C+ + T   PPPP  NCC  +  A++ CLC +K++  LPS GI+
Sbjct  25   AQAVALCNIDTSQLKSCRAAATGEHPPPPDKNCCDVVRQANLPCLCKYKSA--LPSFGIN  82

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P  A++LP +C L  P  C
Sbjct  83   PTQALKLPSECGLSTPPEC  101



>ref|XP_007140447.1| hypothetical protein PHAVU_008G112900g [Phaseolus vulgaris]
 gb|ESW12441.1| hypothetical protein PHAVU_008G112900g [Phaseolus vulgaris]
Length=101

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
            +L+  + AG+  + +  ++A  +CN+    L  C+ +VT   PPPP   CC  +  A++ 
Sbjct  8    ILVQWLVAGLFIALLGGAQAIVLCNIDSGKLNLCRAAVTGKNPPPPDEQCCGVIRQANLP  67

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLCS+K+  +LP  GI+   A+ LP KC L  P++C
Sbjct  68   CLCSYKS--MLPLFGINAKKALALPGKCGLQSPSNC  101



>gb|ACG31932.1| PVR3-like protein [Zea mays]
Length=73

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +2

Query  182  CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CC  L  AD++CLC +KNS  +    IDP  AM+LP KC L  P  C
Sbjct  27   CCDXLAGADLKCLCGYKNSPWMGVYNIDPKRAMELPAKCGLATPPDC  73



>ref|XP_004500129.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=104

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +2

Query  89   EAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDP  268
            +A  IC+     L  C  ++    PP P+  CC  + HA++ CLC+FK+   LP+LGI+P
Sbjct  28   KATVICDFDLNKLDICHAAINGKHPPKPNAKCCEVIKHANLPCLCTFKS--FLPALGINP  85

Query  269  NLAMQLPEKCKLPHPAHC  322
              A+ LP KC L  P+ C
Sbjct  86   KKALALPRKCGLKTPSEC  103



>gb|KHN28416.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=109

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
             L+  + A ++ + +  ++A  +C++    L  C  ++T   PP P   CC  + HA++ 
Sbjct  8    ALVQWLVAALLIAMLGGAKAYVLCDIESNKLNLCFEAITGNHPPKPIEKCCEVVKHANLP  67

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC*LSYL  337
            C C +K+  +LP+LGI+P  A  LP KC L  P  C  S+L
Sbjct  68   CFCRYKS--VLPALGINPANAFALPHKCGLKTPPECRGSHL  106



>ref|XP_010099976.1| hypothetical protein L484_014013 [Morus notabilis]
 gb|EXB81081.1| hypothetical protein L484_014013 [Morus notabilis]
Length=151

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 5/101 (5%)
 Frame = +2

Query  20   KLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALG  199
            K++V  LL  I    + + V    A T+CN+    L  C P+V+   PPPP+ +CCS + 
Sbjct  7    KVLVQWLLLAIC---LMALVGGGSATTLCNIDPSKLFDCLPAVSGESPPPPNESCCSVIH  63

Query  200  HADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            HA++ CLC +K +  L +L IDP  A++LP+KC L  P  C
Sbjct  64   HANLTCLCDYKAA--LRALKIDPAHAVELPKKCGLNKPWKC  102



>ref|XP_007146550.1| hypothetical protein PHAVU_006G050100g [Phaseolus vulgaris]
 gb|ESW18544.1| hypothetical protein PHAVU_006G050100g [Phaseolus vulgaris]
Length=104

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +2

Query  23   LMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGH  202
            ++V  LLAT+   M+      ++A  +C+     L +C  +VT   PP P+  CC  + H
Sbjct  8    VLVQWLLATLLIAMLGG----AKAIVLCDTESSKLSSCYAAVTGQYPPKPNEKCCDVVKH  63

Query  203  ADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +++ CLC +K+  +LP+ G +P  A+ LP KC L  P  C
Sbjct  64   SNLPCLCRYKS--ILPAFGFNPTNALALPSKCGLKTPPEC  101



>ref|XP_007212412.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
 gb|EMJ13611.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
Length=89

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +2

Query  62   MMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSK  241
             + + V  + A  ICN+    L  C+P+VT   P PP+  CC  +  A++ CLC++K++ 
Sbjct  4    FLIALVGGARAVPICNIDSAKLNECRPAVTGNSPKPPTKKCCDVVHQANLPCLCNYKSA-  62

Query  242  LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
              P+ GI+P LAM LP+KC +  P  C
Sbjct  63   -FPAFGINPALAMALPKKCGMNTPREC  88



>ref|XP_009626093.1| PREDICTED: uncharacterized protein LOC104116850 [Nicotiana tomentosiformis]
Length=141

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  95   QTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGIDPNL  274
            +TIC ++  +L  C P+V   KPPPP+ +CC+AL  AD+RC+C+ K+   L  LGI+P  
Sbjct  68   KTICRVTINELAECLPAVMGQKPPPPTADCCAALRKADLRCMCNKKSE--LGQLGINPAA  125

Query  275  AMQLPEKCKLPHPAHC  322
            AM+LP++CK+  P  C
Sbjct  126  AMKLPKQCKINVPHGC  141



>ref|XP_004491449.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=104

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 10/103 (10%)
 Frame = +2

Query  14   IMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSA  193
            +M+ MV  LL  +  G        ++A  IC++    L  C+ +VT   PPPP   CC+ 
Sbjct  9    LMQWMVAALLIALLGG--------AQAVKICDIESSQLKFCRAAVTGENPPPPDEKCCAV  60

Query  194  LGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +  A++ CLC++K+  +LPSLGI    AM+LP KC    P+ C
Sbjct  61   IRGANLPCLCTYKS--ILPSLGISVKDAMELPGKCGSKSPSKC  101



>ref|XP_010063068.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
 gb|KCW70258.1| hypothetical protein EUGRSUZ_F03514 [Eucalyptus grandis]
Length=104

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            ++A TIC +    L  C P+V    P PP+  CC  +  ADM CLC +++  +LP+ GI 
Sbjct  25   AKATTICKIPTDKLTFCLPAVAGDHPSPPTKQCCKVISKADMPCLCQYRS--VLPNYGIK  82

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P  AM LP+KC L  P  C
Sbjct  83   PANAMALPKKCGLKAPPKC  101



>ref|NP_001150197.1| PVR3-like protein [Zea mays]
 gb|ACG38213.1| PVR3-like protein [Zea mays]
Length=73

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = +2

Query  110  MSGKDLMACkpsvtppkppppspN--CCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQ  283
            MS +  M+C+P+      PP +P+  CC AL  AD++CL  +KNS  +    IDP  AM+
Sbjct  1    MSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLXGYKNSPWMGVYNIDPKXAME  60

Query  284  LPEKCKLPHPAHC  322
            LP KC L  P  C
Sbjct  61   LPAKCGLATPPDC  73



>gb|KGN59078.1| hypothetical protein Csa_3G759990 [Cucumis sativus]
Length=107

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +2

Query  179  NCCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             CCS L  AD++CLC+ K+  +LPS GI+  +A+ LP KC +P P  C
Sbjct  60   RCCSVLRSADLKCLCNLKS--ILPSAGINATIALALPSKCGIPSPPEC  105



>ref|NP_001235199.1| uncharacterized protein LOC100527120 precursor [Glycine max]
 gb|ACU16166.1| unknown [Glycine max]
 gb|KHN05127.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=101

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMR  214
             L+  + A ++ + +  ++A  +CN+    L  C+ +VT   PPPP   CC+ +  A++ 
Sbjct  8    TLVQWLVATLLIALLGGAQAVVLCNIDSSQLNLCRAAVTGQNPPPPDEKCCAVIRQANLP  67

Query  215  CLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            CLC +K+  +LP +GI P  A+ LP KC L  P +C
Sbjct  68   CLCRYKS--ILPLIGIKPEKALALPGKCGLQSPPNC  101



>ref|XP_010097506.1| hypothetical protein L484_024714 [Morus notabilis]
 gb|EXB68697.1| hypothetical protein L484_024714 [Morus notabilis]
Length=90

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -3

Query  279  MARLGSIPSDGSSFEFLKEQRQRMSAWPNAeqqfgeggggfgGVTDGLHAIRSFPDMLHI  100
            MAR GSIP +GSS EFL EQRQ  SA+ +A QQ  +GG GFG VT GL  +R     L +
Sbjct  1    MARFGSIPREGSSCEFLYEQRQLRSAFVSAAQQVVDGGLGFGAVTAGLQDMRPLIGTLQM  60

Query  99   VCASDTFTV  73
            V A +++T+
Sbjct  61   VWALESWTM  69



>ref|XP_002459719.1| hypothetical protein SORBIDRAFT_02g009320 [Sorghum bicolor]
 gb|EER96240.1| hypothetical protein SORBIDRAFT_02g009320 [Sorghum bicolor]
Length=104

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK--LLPSLGI  262
            A  +CN+S   + AC+P+     P    S  CC+AL  AD+ CLC +KN+    +    I
Sbjct  25   AHGVCNLSSAGIRACQPAAAIRNPTEQPSAECCAALAGADLACLCRYKNAAGVWVRFYRI  84

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D N AM LP KC L  PA+C
Sbjct  85   DINRAMGLPGKCGLAMPANC  104



>gb|AFK43127.1| unknown [Lotus japonicus]
Length=102

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            ++A  +CN+    L +C+ + T   PPPP   CC  +  A++ CLC +K++  LPS GI+
Sbjct  25   AQAVALCNIDTSQLKSCRAAATGEHPPPPDKKCCDVVRQANLPCLCKYKSA--LPSFGIN  82

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P  A++LP +C L  P  C
Sbjct  83   PTQALKLPSECGLSTPPEC  101



>gb|AES70438.2| Lipid transfer protein [Medicago truncatula]
Length=106

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            + A  +C++    L  C  ++T  +PP P+  CC+ +  AD+ CLC +K+  LLP+LGI+
Sbjct  17   ANAIIVCSIDTNKLDVCHDAITGKRPPKPTTKCCALIKKADLSCLCRYKS--LLPALGIN  74

Query  266  PNLAMQLPEKCKLPHPAHC--*LSYLLTQYYL  355
            P  A+ LP+KC    P  C   L Y L Q  L
Sbjct  75   PTKALALPKKCGRKTPPGCRGNLEYKLIQILL  106



>gb|AFK43735.1| unknown [Lotus japonicus]
Length=102

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +2

Query  86   SEAQTICNM-SGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGI  262
             +A ++C + S K L  C+ ++T   PP P   CC+ + HA++ CLC +K+  LLPS+GI
Sbjct  22   QKAVSLCGIDSPKQLDLCREAITGKYPPKPKEKCCAVIRHANLTCLCGYKS--LLPSVGI  79

Query  263  DPNLAMQLPEKCKLPHPAHC  322
             P  A+ LP KC L  P  C
Sbjct  80   SPTNALALPRKCGLKTPRQC  99



>ref|XP_004955975.1| PREDICTED: putative lipid-transfer protein DIR1-like [Setaria 
italica]
Length=103

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK--LLPSLGI  262
            A  ICN+S   + AC+P+     P    S  CC+AL  AD+ CLC +KN+    +    I
Sbjct  24   AHGICNLSSTGIRACQPAAAIRNPTDQPSSECCAALAGADLPCLCRYKNAAGVWVRFYRI  83

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D N AM LP KC L  PA+C
Sbjct  84   DINRAMALPGKCGLAMPANC  103



>ref|XP_004955978.1| PREDICTED: putative lipid-transfer protein DIR1-like [Setaria 
italica]
Length=103

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 9/108 (8%)
 Frame = +2

Query  8    FVIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkpppp-spNC  184
             V  + + G+L+A +A   M        A  IC M+ +D   C+P+     P    S  C
Sbjct  1    MVKEQALAGLLIALVALATMEG------AHAICGMANEDFKLCQPAAAVNDPTDSPSAEC  54

Query  185  CSALGHADMRCLCSFKN--SKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            C+ALG AD+ C+C ++      +    IDP+ AM LP KC L  P +C
Sbjct  55   CAALGKADLGCICRYRGVAGIWMRIYHIDPSRAMALPGKCGLTMPGNC  102



>ref|XP_004955977.1| PREDICTED: putative lipid-transfer protein DIR1-like [Setaria 
italica]
Length=103

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK--LLPSLGI  262
            A  ICN+S   + AC+P+     P    S  CC+AL  AD+ CLC +KN+    +    I
Sbjct  24   AHGICNLSSTGIRACQPAAAIRHPTDQPSAECCAALAGADLPCLCRYKNAAGVWVRFYRI  83

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D N AM LP KC L  PA+C
Sbjct  84   DINRAMGLPGKCGLAMPANC  103



>ref|XP_008668903.1| PREDICTED: putative lipid-transfer protein DIR1 [Zea mays]
 tpg|DAA36093.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein [Zea mays]
 tpg|DAA60274.1| TPA: hypothetical protein ZEAMMB73_386355 [Zea mays]
Length=103

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK--LLPSLGI  262
            A  +CN+S   + AC+P+     P    S  CC+AL  AD+ CLC +KN+    +    I
Sbjct  24   AHGVCNLSSAGIRACQPAAAIRNPTDQPSSECCAALAGADLACLCRYKNAAGVWVRFYRI  83

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D N AM LP KC L  PA+C
Sbjct  84   DINRAMALPGKCGLAMPANC  103



>gb|ABR16890.1| unknown [Picea sitchensis]
Length=107

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 8/96 (8%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQ---TICNMSGKDLMACkpsvtppkp---pppspNCCSALGH  202
            +  +AA M++   ++S A+    ICN++  DLM C P+VT         P   CCS L  
Sbjct  6    IIAMAAAMLSLLARISVARGYIIICNVNKDDLMPCMPAVTHFSVRPPAQPVQACCSVLRT  65

Query  203  ADMRCLCSFKNSK--LLPSLGIDPNLAMQLPEKCKL  304
            A++ C C  +N    LL   GIDP+LA  LP +CKL
Sbjct  66   ANLTCFCELENKYPWLLYMFGIDPDLAKALPGECKL  101



>ref|NP_001148038.1| PVR3-like protein precursor [Zea mays]
 gb|ACG29560.1| PVR3-like protein [Zea mays]
Length=103

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK--LLPSLGI  262
            A  +CN+S   + AC+P+     P    S  CC+AL  AD+ CLC +KN+    +    I
Sbjct  24   AHGVCNLSSAGIRACQPAAAIRNPTDQPSSECCAALAGADLACLCRYKNAAGVWVRFYRI  83

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D N AM LP KC L  PA+C
Sbjct  84   DINRAMGLPGKCGLAMPANC  103



>ref|XP_010527373.1| PREDICTED: putative lipid-transfer protein DIR1 [Tarenaya hassleriana]
Length=98

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 46/81 (57%), Gaps = 6/81 (7%)
 Frame = +2

Query  74   TVKVSEAQTICNMSGKDLMACkpsvtppkppppspN----CCSALGHADMRCLCSFKNSK  241
            T+ VS  Q IC M+   L ACKP VT P P     +    CC+AL  AD  CLCS +NS 
Sbjct  17   TLTVSNGQKICGMTLAGLNACKPYVTTPNPSTDPIDPKGPCCTALTDADFPCLCSNRNSP  76

Query  242  LLPSLGIDPNLAMQLPEKCKL  304
               + GID  LA +LPEKC +
Sbjct  77   F--ASGIDFGLASKLPEKCAI  95



>ref|XP_007020657.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY12182.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=104

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = +2

Query  83   VSEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGI  262
             +   T+CN++   L  C+P+VT   PPPP+  CC  +  A++ CLC FK +  LP+  I
Sbjct  25   TTNEPTVCNIALTKLNLCRPAVTGKYPPPPTKECCGLMKQANLTCLCKFKEA--LPAFEI  82

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            DP  A  LP+KC L  P  C
Sbjct  83   DPARAFALPKKCNLRTPPQC  102



>gb|AFK37659.1| unknown [Lotus japonicus]
Length=102

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 55/104 (53%), Gaps = 10/104 (10%)
 Frame = +2

Query  11   VIMKLMVGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkppppspNCCS  190
             +++ +V VL   +  G        ++A  +CN+    L +C+ + T   PPPP   CC 
Sbjct  8    ALVQWLVAVLFIALLGG--------AQAIRLCNIDTSQLKSCRAAATGEHPPPPDKKCCD  59

Query  191  ALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             +  A++ CLC +K++  LP  GI+P  A++LP +C L  P  C
Sbjct  60   VVRQANLPCLCKYKSA--LPQFGINPTNAIKLPGECGLNTPPEC  101



>ref|NP_001151008.1| PVR3-like protein precursor [Zea mays]
 gb|ACG41271.1| PVR3-like protein [Zea mays]
Length=105

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADM  211
             +LAT+A  MM S      A  IC M+ +D   C+P+     P    S  CC+ALG AD+
Sbjct  14   AVLATLA--MMES------AHAICGMANEDFKLCQPAAAANDPTDSPSAECCAALGKADL  65

Query  212  RCLCSFKNSK--LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             C+C +K      +    IDP+ AM LP KC L  P++C
Sbjct  66   GCICRYKGVAGIWMRIYHIDPSXAMALPGKCGLTMPSNC  104



>tpg|DAA60275.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein [Zea mays]
Length=105

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADM  211
             +LAT+A  MM S      A  IC M+ +D   C+P+     P    S  CC+ALG AD+
Sbjct  14   AVLATLA--MMES------AHAICGMANEDFKLCQPAAAANDPTDSPSAECCAALGKADL  65

Query  212  RCLCSFKNSK--LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
             C+C +K      +    IDP+ AM LP KC L  P++C
Sbjct  66   GCICRYKGVAGIWMRIYHIDPSRAMALPGKCGLTMPSNC  104



>ref|XP_003600187.1| hypothetical protein MTR_3g055250 [Medicago truncatula]
 gb|AFK37587.1| unknown [Medicago truncatula]
Length=106

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +2

Query  86   SEAQTICNMSGKDLMACkpsvtppkppppspNCCSALGHADMRCLCSFKNSKLLPSLGID  265
            + A  +C++    L  C  ++T  +PP P+  CC+ +  AD+ CLC +K+  LLP+LGI+
Sbjct  27   ANAIIVCSIDTNKLDVCHDAITGKRPPKPTTKCCALIKKADLSCLCRYKS--LLPALGIN  84

Query  266  PNLAMQLPEKCKLPHPAHC  322
            P  A+ LP+KC    P  C
Sbjct  85   PTKALALPKKCGRKTPPGC  103



>ref|XP_006299426.1| hypothetical protein CARUB_v10015587mg [Capsella rubella]
 gb|EOA32324.1| hypothetical protein CARUB_v10015587mg [Capsella rubella]
Length=102

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = +2

Query  74   TVKVSEAQTICNMSGKDLMACkpsvtppkppppspN----CCSALGHADMRCLCSFKNSK  241
            T+  +  Q  C M+   L ACKP V    P   + +    CCSAL  AD  CLC  KN K
Sbjct  17   TLTAATGQNTCGMTIAGLYACKPYVQTKNPLTTAIDPLGACCSALSKADFPCLCKEKN-K  75

Query  242  LLPSL-GIDPNLAMQLPEKCKLP  307
              P L GID  LA +LPEKC LP
Sbjct  76   FNPFLSGIDFGLAAKLPEKCNLP  98



>ref|XP_006658480.1| PREDICTED: putative lipid-transfer protein DIR1-like [Oryza brachyantha]
Length=105

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKNSK--LLPSLGI  262
            A  ICNMS  D   C+P+     P    S  CC+ALG+AD+ C+C ++      +    I
Sbjct  25   AHAICNMSNGDFRLCQPAAAVADPTDSPSAECCAALGNADLACICRYRGVAGFWMRIYHI  84

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D   AM LP KC L  PA+C
Sbjct  85   DAARAMALPAKCGLAMPANC  104



>ref|XP_004150253.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 gb|KGN59080.1| hypothetical protein Csa_3G760500 [Cucumis sativus]
Length=103

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +2

Query  179  NCCSALGHADMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +CCS + HAD++CLC+ K+  +LPS+GID   A+ LP KC +  P  C
Sbjct  56   DCCSVVRHADLKCLCNLKS--VLPSMGIDTANALALPSKCNVASPPEC  101



>ref|XP_010545262.1| PREDICTED: putative lipid-transfer protein DIR1 [Tarenaya hassleriana]
Length=103

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = +2

Query  35   VLLATIAAGMMTSTVKVSEAQ--TICNMSGKDLMACkpsvtppkppppspNCCSALGHAD  208
            V L  +   M  + + V EA    ICN+   DL  C+ +VT  +PPPP+  CC  +  +D
Sbjct  5    VFLQCLVMAMALTAIVVEEAYGIPICNIDTNDLGQCRAAVTGNQPPPPTGECCGVIKRSD  64

Query  209  MRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKL  304
            + CLC +K+   LP++GIDP+ A  L  KC +
Sbjct  65   LSCLCKYKS--YLPAVGIDPSKATTLLSKCGI  94



>ref|XP_002459722.1| hypothetical protein SORBIDRAFT_02g009340 [Sorghum bicolor]
 gb|EER96243.1| hypothetical protein SORBIDRAFT_02g009340 [Sorghum bicolor]
Length=84

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 3/83 (4%)
 Frame = +2

Query  83   VSEAQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKN--SKLLPS  253
            +  A  IC M+ +D   C+P+ +   P    S  CC+ALG AD+ C+C +K      +  
Sbjct  1    MESADAICGMANEDFKLCQPAASVSDPTDSPSAECCAALGKADLGCICRYKGVAGIWMRI  60

Query  254  LGIDPNLAMQLPEKCKLPHPAHC  322
              IDP+ AM LP KC L  P++C
Sbjct  61   YHIDPSRAMALPGKCGLTMPSNC  83



>ref|XP_002539949.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF22434.1| lipid binding protein, putative [Ricinus communis]
Length=101

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +2

Query  29   VGVLLATIAAGMMTSTVKVSEAQTICNMSGKDLMA-CkpsvtppkppppspNCCSALGHA  205
            V ++LA +   M++     ++A+ +C +   DL+  C P+ T   PPPPS  CC  +   
Sbjct  10   VKIVLAMLVIAMISG----AQAKPVCGVDHYDLIERCYPTTTLTPPPPPSQQCCDIVKRT  65

Query  206  DMRCLCSFKNSKLLPSLGIDPNLAMQLPEKCKLPHP  313
            D+ CLC ++   +LP+ GID   A+++P KC +P P
Sbjct  66   DLLCLCKYRF--MLPTFGIDYARAIEVPGKCGIPQP  99



>ref|XP_004955976.1| PREDICTED: putative lipid-transfer protein DIR1-like [Setaria 
italica]
Length=104

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 49/97 (51%), Gaps = 3/97 (3%)
 Frame = +2

Query  41   LATIAAGMMTSTVKVSEAQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRC  217
            LA +   ++ +   +  A  IC M+ +D   C+P+     P    S  CC+ALG AD+ C
Sbjct  7    LAALLLAIVVALATMEGAHAICGMANEDFKLCQPAAAVNDPTDNPSAECCAALGKADLGC  66

Query  218  LCSFKNSK--LLPSLGIDPNLAMQLPEKCKLPHPAHC  322
            +C ++      +    IDP+ AM LP KC L  P +C
Sbjct  67   ICRYRGVAGIWMRIYHIDPSRAMALPGKCGLTMPNNC  103



>ref|XP_006406557.1| hypothetical protein EUTSA_v10021820mg [Eutrema salsugineum]
 gb|ESQ48010.1| hypothetical protein EUTSA_v10021820mg [Eutrema salsugineum]
Length=101

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +2

Query  101  ICNMSGKDLMACkpsvtppkppppspN----CCSALGHADMRCLCSFKNSKLLPSL-GID  265
            +C MS  DL +CKP V    P   + +    CC+AL  AD++CLC  K +K+ P L GID
Sbjct  25   LCGMSVADLYSCKPYVQTKNPVTTAIDPKGPCCTALSEADLQCLCKQK-TKINPFLSGID  83

Query  266  PNLAMQLPEKCKLPHP  313
              LA +LPEKC L  P
Sbjct  84   FGLAAKLPEKCGLSGP  99



>gb|EAZ03533.1| hypothetical protein OsI_25668 [Oryza sativa Indica Group]
Length=103

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 3/80 (4%)
 Frame = +2

Query  92   AQTICNMSGKDLMACkpsvtppkpppp-spNCCSALGHADMRCLCSFKN--SKLLPSLGI  262
            A  ICNMS  D   C+P+     P    S  CC+ALG AD+ C+C +K      +    I
Sbjct  23   ADAICNMSNGDFRLCQPAAAASDPTDGPSAECCAALGEADLACICRYKGVAGFWMRIYHI  82

Query  263  DPNLAMQLPEKCKLPHPAHC  322
            D   AM LP KC L  P +C
Sbjct  83   DAARAMALPGKCGLTMPTNC  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360