BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78233_g1_i1 len=1315 path=[1:0-1314]

Length=1315
                                                                      Score     E

ref|XP_006347915.1|  PREDICTED: uncharacterized protein LOC102584275    379   2e-126   
ref|XP_004229779.1|  PREDICTED: uncharacterized protein LOC101267648    373   3e-124   
ref|XP_009776946.1|  PREDICTED: uncharacterized protein LOC104226615    371   4e-123   
ref|XP_008232561.1|  PREDICTED: uncharacterized protein LOC103331692    316   8e-102   
emb|CDP09483.1|  unnamed protein product                                315   2e-101   
ref|XP_011093293.1|  PREDICTED: uncharacterized protein LOC105173298    314   3e-101   
ref|XP_002511643.1|  conserved hypothetical protein                     310   1e-99    Ricinus communis
ref|XP_011017444.1|  PREDICTED: uncharacterized protein LOC105120771    310   2e-99    
gb|KHG03984.1|  Alanine--tRNA ligase                                    304   5e-97    
gb|KDP28809.1|  hypothetical protein JCGZ_14580                         303   6e-97    
ref|XP_002302514.1|  hypothetical protein POPTR_0002s14390g             302   3e-96    Populus trichocarpa [western balsam poplar]
ref|XP_006445337.1|  hypothetical protein CICLE_v10021755mg             300   1e-95    
ref|XP_010524407.1|  PREDICTED: uncharacterized protein LOC104802474    300   3e-95    
gb|AFK47092.1|  unknown                                                 298   5e-95    
gb|AFK39373.1|  unknown                                                 295   1e-93    
ref|XP_007052188.1|  Uncharacterized protein isoform 1                  293   2e-92    
ref|XP_003538068.1|  PREDICTED: uncharacterized protein LOC100804339    291   3e-92    
ref|XP_010258900.1|  PREDICTED: uncharacterized protein LOC104598502    290   8e-92    
ref|XP_002277999.1|  PREDICTED: uncharacterized protein LOC100266783    289   2e-91    Vitis vinifera
gb|KEH22362.1|  hypothetical protein MTR_7g445370                       287   1e-90    
ref|XP_007052189.1|  Uncharacterized protein isoform 2                  288   1e-90    
ref|XP_009339857.1|  PREDICTED: uncharacterized protein LOC103932041    285   6e-90    
gb|AFK35211.1|  unknown                                                 284   2e-89    
ref|XP_002881994.1|  hypothetical protein ARALYDRAFT_903941             284   3e-89    
ref|XP_009337245.1|  PREDICTED: uncharacterized protein LOC103929743    283   4e-89    
ref|NP_566034.1|  uncharacterized protein                               283   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|EYU42370.1|  hypothetical protein MIMGU_mgv1a023111mg                282   5e-89    
ref|XP_010506443.1|  PREDICTED: uncharacterized protein LOC104783...    283   6e-89    
ref|XP_006294796.1|  hypothetical protein CARUB_v10023846mg             283   7e-89    
ref|XP_010508215.1|  PREDICTED: uncharacterized protein LOC104784826    282   2e-88    
ref|XP_008375716.1|  PREDICTED: uncharacterized protein LOC103438950    281   3e-88    
ref|XP_010518116.1|  PREDICTED: uncharacterized protein LOC104793462    281   4e-88    
ref|XP_006397686.1|  hypothetical protein EUTSA_v10001582mg             280   1e-87    
gb|KEH22363.1|  hypothetical protein MTR_7g445370                       278   5e-87    
ref|XP_010053946.1|  PREDICTED: uncharacterized protein LOC104442278    277   1e-86    
ref|XP_007052191.1|  Uncharacterized protein isoform 4                  277   2e-86    
ref|XP_004514234.1|  PREDICTED: uncharacterized protein LOC101491840    276   3e-86    
emb|CDY37025.1|  BnaA04g26030D                                          275   1e-85    
ref|XP_009142315.1|  PREDICTED: uncharacterized protein LOC103866188    275   1e-85    
gb|EPS62058.1|  hypothetical protein M569_12732                         272   3e-85    
gb|KFK37300.1|  hypothetical protein AALP_AA4G239300                    272   2e-84    
ref|XP_008459726.1|  PREDICTED: uncharacterized protein LOC103498769    271   3e-84    
ref|XP_009133693.1|  PREDICTED: uncharacterized protein LOC103858149    271   4e-84    
ref|XP_010506444.1|  PREDICTED: uncharacterized protein LOC104783...    270   7e-84    
gb|KDO85659.1|  hypothetical protein CISIN_1g024845mg                   256   5e-79    
emb|CDX83410.1|  BnaA03g20960D                                          254   2e-78    
emb|CDX95625.1|  BnaC03g25060D                                          258   7e-78    
ref|XP_010692135.1|  PREDICTED: uncharacterized protein LOC104905332    254   1e-77    
ref|XP_004140609.1|  PREDICTED: uncharacterized protein LOC101214960    253   3e-77    
ref|XP_004306965.1|  PREDICTED: uncharacterized protein LOC101308610    252   7e-77    
ref|XP_007052190.1|  Uncharacterized protein isoform 3                  252   1e-76    
ref|XP_004171485.1|  PREDICTED: uncharacterized LOC101214960            241   1e-73    
gb|KGN46560.1|  hypothetical protein Csa_6G108580                       239   7e-73    
ref|XP_011033296.1|  PREDICTED: uncharacterized protein LOC105131821    239   1e-72    
ref|XP_006838189.1|  hypothetical protein AMTR_s00106p00135890          236   5e-71    
gb|KCW78323.1|  hypothetical protein EUGRSUZ_D02501                     235   3e-70    
ref|XP_009631125.1|  PREDICTED: uncharacterized protein LOC104120950    226   4e-68    
gb|KDO85660.1|  hypothetical protein CISIN_1g024845mg                   224   1e-66    
ref|XP_006375267.1|  hypothetical protein POPTR_0014s05780g             217   2e-63    
ref|XP_007221158.1|  hypothetical protein PRUPE_ppa020296mg             184   1e-52    
ref|XP_010934947.1|  PREDICTED: uncharacterized protein LOC105054...    174   4e-47    
ref|XP_006294795.1|  hypothetical protein CARUB_v10023846mg             172   6e-47    
emb|CAN64905.1|  hypothetical protein VITISV_042831                     179   3e-46    Vitis vinifera
gb|KHN41331.1|  hypothetical protein glysoja_049618                     160   6e-44    
ref|XP_007140975.1|  hypothetical protein PHAVU_008G156600g             157   1e-41    
ref|XP_008796934.1|  PREDICTED: uncharacterized protein LOC103712...    154   9e-40    
ref|XP_010934948.1|  PREDICTED: uncharacterized protein LOC105054...    150   1e-38    
ref|XP_008796933.1|  PREDICTED: uncharacterized protein LOC103712...    149   4e-38    
ref|XP_009787718.1|  PREDICTED: uncharacterized protein LOC104235612    147   1e-37    
ref|XP_009385849.1|  PREDICTED: uncharacterized protein LOC103973101    148   2e-37    
ref|XP_001760783.1|  predicted protein                                  149   6e-37    
ref|XP_004228972.1|  PREDICTED: uncharacterized protein LOC101267925    142   8e-36    
dbj|BAJ98005.1|  predicted protein                                      144   9e-36    
ref|XP_006829819.1|  hypothetical protein AMTR_s00119p00084860          144   9e-36    
emb|CDY27396.1|  BnaC04g50090D                                          142   1e-35    
gb|EEC72302.1|  hypothetical protein OsI_05485                          143   1e-35    Oryza sativa Indica Group [Indian rice]
ref|XP_003570319.1|  PREDICTED: uncharacterized protein LOC100834616    142   4e-35    
ref|XP_006659070.1|  PREDICTED: uncharacterized protein LOC102721384    142   5e-35    
ref|XP_010032828.1|  PREDICTED: uncharacterized protein LOC104422263    140   6e-35    
ref|NP_001045615.1|  Os02g0104800                                       141   8e-35    Oryza sativa Japonica Group [Japonica rice]
gb|AFW66822.1|  hypothetical protein ZEAMMB73_141697                    140   1e-34    
ref|XP_006445553.1|  hypothetical protein CICLE_v10016445mg             139   1e-34    
ref|XP_006375268.1|  hypothetical protein POPTR_0014s05780g             137   3e-34    
ref|XP_004951200.1|  PREDICTED: uncharacterized protein LOC101766807    139   4e-34    
ref|XP_006488962.1|  PREDICTED: uncharacterized protein LOC102628779    138   4e-34    
ref|XP_002523392.1|  conserved hypothetical protein                     138   5e-34    Ricinus communis
ref|NP_001144763.1|  uncharacterized protein LOC100277822               138   8e-34    Zea mays [maize]
gb|KHG03556.1|  Chromosome-associated kinesin KIF4                      135   3e-33    
ref|XP_003556589.1|  PREDICTED: uncharacterized protein LOC100780119    134   7e-33    
gb|ACU19454.1|  unknown                                                 134   8e-33    Glycine max [soybeans]
ref|XP_010276434.1|  PREDICTED: uncharacterized protein LOC104611177    134   1e-32    
ref|XP_007220768.1|  hypothetical protein PRUPE_ppa024369mg             132   1e-32    
gb|KDO54526.1|  hypothetical protein CISIN_1g025242mg                   134   1e-32    
ref|XP_003607819.1|  hypothetical protein MTR_4g083250                  134   2e-32    
ref|XP_007205735.1|  hypothetical protein PRUPE_ppa010110mg             132   5e-32    
ref|XP_008220369.1|  PREDICTED: uncharacterized protein LOC103320436    132   6e-32    
emb|CDP18577.1|  unnamed protein product                                132   8e-32    
ref|XP_006348221.1|  PREDICTED: uncharacterized protein LOC102606203    131   9e-32    
ref|XP_007140976.1|  hypothetical protein PHAVU_008G156700g             126   1e-31    
ref|XP_002451349.1|  hypothetical protein SORBIDRAFT_04g000540          131   3e-31    Sorghum bicolor [broomcorn]
ref|XP_004505352.1|  PREDICTED: uncharacterized protein LOC101513717    129   4e-31    
ref|XP_003529452.1|  PREDICTED: uncharacterized protein LOC100808143    129   6e-31    
gb|EYU32819.1|  hypothetical protein MIMGU_mgv1a012602mg                129   8e-31    
gb|EEE56139.1|  hypothetical protein OsJ_05019                          129   1e-30    Oryza sativa Japonica Group [Japonica rice]
gb|KHN20511.1|  hypothetical protein glysoja_029524                     127   2e-30    
ref|XP_001771369.1|  predicted protein                                  129   4e-30    
ref|XP_008384350.1|  PREDICTED: uncharacterized protein LOC103446960    126   7e-30    
ref|XP_008781206.1|  PREDICTED: uncharacterized protein LOC103701046    126   9e-30    
ref|XP_010673453.1|  PREDICTED: uncharacterized protein LOC104889828    126   1e-29    
ref|XP_011048149.1|  PREDICTED: uncharacterized protein LOC105142285    125   1e-29    
ref|XP_003607823.1|  hypothetical protein MTR_4g083290                  127   2e-29    
ref|XP_002285769.1|  PREDICTED: uncharacterized protein LOC100250...    125   2e-29    Vitis vinifera
ref|XP_002299091.1|  hypothetical protein POPTR_0001s03860g             125   2e-29    Populus trichocarpa [western balsam poplar]
ref|XP_010536807.1|  PREDICTED: uncharacterized protein LOC104811711    125   2e-29    
ref|XP_011089758.1|  PREDICTED: uncharacterized protein LOC105170618    124   3e-29    
ref|XP_009339217.1|  PREDICTED: uncharacterized protein LOC103931455    124   5e-29    
ref|XP_004144064.1|  PREDICTED: uncharacterized protein LOC101216...    122   1e-28    
gb|KDP30630.1|  hypothetical protein JCGZ_16195                         122   2e-28    
ref|XP_007157828.1|  hypothetical protein PHAVU_002G101500g             122   2e-28    
ref|XP_008450994.1|  PREDICTED: uncharacterized protein LOC103492410    121   3e-28    
ref|XP_007014648.1|  Uncharacterized protein TCM_039966                 121   4e-28    
ref|XP_010921336.1|  PREDICTED: uncharacterized protein LOC105044929    120   1e-27    
gb|KHN42956.1|  hypothetical protein glysoja_007486                     120   2e-27    
ref|XP_010651409.1|  PREDICTED: uncharacterized protein LOC100250...    118   4e-27    
gb|KFK29159.1|  hypothetical protein AALP_AA7G096800                    117   9e-27    
ref|XP_009393907.1|  PREDICTED: uncharacterized protein LOC103979471    116   1e-26    
ref|XP_003558009.1|  PREDICTED: uncharacterized protein LOC100838509    116   1e-26    
emb|CDY42739.1|  BnaA03g48000D                                          117   1e-26    
ref|XP_002869612.1|  hypothetical protein ARALYDRAFT_913923             117   1e-26    
ref|XP_004294933.1|  PREDICTED: uncharacterized protein LOC101308945    116   3e-26    
dbj|BAK05826.1|  predicted protein                                      114   5e-26    
ref|XP_006284348.1|  hypothetical protein CARUB_v10005520mg             115   9e-26    
ref|NP_001049981.1|  Os03g0324800                                       112   3e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009617840.1|  PREDICTED: uncharacterized protein LOC104110119    110   3e-25    
ref|XP_004984525.1|  PREDICTED: uncharacterized protein LOC101782...    110   8e-25    
ref|XP_002465337.1|  hypothetical protein SORBIDRAFT_01g036710          110   2e-24    Sorghum bicolor [broomcorn]
emb|CDX92771.1|  BnaC07g40290D                                          110   3e-24    
gb|KEH30817.1|  hypothetical protein MTR_4g083250                       110   4e-24    
gb|KHN10117.1|  hypothetical protein glysoja_048900                     107   4e-24    
ref|XP_009137593.1|  PREDICTED: uncharacterized protein LOC103861626    109   6e-24    
ref|XP_004984524.1|  PREDICTED: uncharacterized protein LOC101782...    108   7e-24    
ref|XP_010448277.1|  PREDICTED: uncharacterized protein LOC104730768    109   9e-24    
ref|XP_006650015.1|  PREDICTED: uncharacterized protein LOC102714271    108   9e-24    
ref|XP_010105296.1|  hypothetical protein L484_002346                   108   1e-23    
ref|XP_006413188.1|  hypothetical protein EUTSA_v10026011mg             108   2e-23    
ref|XP_010438763.1|  PREDICTED: uncharacterized protein LOC104722317    108   2e-23    
gb|EMS64683.1|  hypothetical protein TRIUR3_01262                       105   7e-23    
ref|XP_010433511.1|  PREDICTED: uncharacterized protein LOC104717609    106   7e-23    
ref|XP_009142234.1|  PREDICTED: uncharacterized protein LOC103866109    105   1e-22    
ref|XP_008670078.1|  PREDICTED: uncharacterized protein LOC100276...    104   2e-22    
emb|CDX89342.1|  BnaA01g15510D                                          105   2e-22    
gb|KDO54525.1|  hypothetical protein CISIN_1g025242mg                   105   2e-22    
emb|CDX94341.1|  BnaC01g18430D                                          105   2e-22    
gb|EPS63583.1|  hypothetical protein M569_11194                         103   6e-22    
ref|XP_004144065.1|  PREDICTED: uncharacterized protein LOC101216...    102   8e-22    
ref|NP_194371.2|  uncharacterized protein                               103   9e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375269.1|  hypothetical protein POPTR_0014s05780g             100   2e-21    
ref|XP_002983323.1|  hypothetical protein SELMODRAFT_445444             102   1e-20    
gb|EEC75159.1|  hypothetical protein OsI_11373                        98.2    2e-20    Oryza sativa Indica Group [Indian rice]
ref|XP_002987624.1|  hypothetical protein SELMODRAFT_447060             101   4e-20    
gb|EEC75161.1|  hypothetical protein OsI_11375                        94.4    5e-19    Oryza sativa Indica Group [Indian rice]
gb|EMT05527.1|  hypothetical protein F775_07413                       92.8    2e-18    
ref|XP_006413187.1|  hypothetical protein EUTSA_v10026011mg           92.4    7e-18    
gb|AIA26010.1|  hypothetical protein                                  79.3    3e-14    
gb|AIA26008.1|  hypothetical protein                                  79.3    3e-14    
gb|EMT21115.1|  hypothetical protein F775_32566                       80.5    6e-14    
gb|AIA26006.1|  hypothetical protein                                  78.6    6e-14    
gb|AIA26007.1|  hypothetical protein                                  78.2    8e-14    
emb|CAA18229.1|  putative protein                                     80.1    2e-13    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001143401.1|  uncharacterized protein LOC100276044             76.6    2e-13    Zea mays [maize]
gb|EMS57790.1|  hypothetical protein TRIUR3_22595                     67.8    4e-10    
gb|AIA25954.1|  hypothetical protein                                  64.3    3e-09    
gb|AIA25947.1|  hypothetical protein                                  63.9    6e-09    
gb|AIA25953.1|  hypothetical protein                                  63.2    9e-09    
gb|KFM24094.1|  hypothetical protein F751_1359                        58.9    2e-06    
gb|AIA26009.1|  hypothetical protein                                  56.2    2e-06    
ref|XP_005846915.1|  hypothetical protein CHLNCDRAFT_134807           58.5    3e-06    
gb|KDD75675.1|  hypothetical protein H632_c557p1                      58.2    3e-06    
emb|CDY35478.1|  BnaC03g61820D                                        51.2    2e-04    
gb|AIA25951.1|  hypothetical protein                                  49.7    4e-04    



>ref|XP_006347915.1| PREDICTED: uncharacterized protein LOC102584275 [Solanum tuberosum]
Length=266

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 227/270 (84%), Gaps = 4/270 (1%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA IAESS+ N  +P    + SLP +R N+ D   TL +A PWID+A+QQA+ A++T E 
Sbjct  1     MAAIAESSEANVNSP----SLSLPPERVNHEDKSNTLGEAVPWIDNAVQQAQLARKTAED  56

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
               E+AI VTKSRL+RILTTSSAHFNQTLD+LQD+K+EY +YEDL FG++KEG+ +AASHP
Sbjct  57    TFENAIVVTKSRLNRILTTSSAHFNQTLDTLQDLKSEYSVYEDLAFGKIKEGLLLAASHP  116

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             L TTGA L +G LGLKRPRRFLYY A  +FV EEA+LS+ADAKVKEL+KSID LKAES K
Sbjct  117   LATTGAVLGVGVLGLKRPRRFLYYSAMRLFVREEALLSRADAKVKELQKSIDLLKAESAK  176

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              E  A+QAE E+IRG+TKLRQAGKQIRSVI+SAYKIERQA GL+DVLKELPRRE +LFRS
Sbjct  177   LENQAIQAEGEMIRGRTKLRQAGKQIRSVIQSAYKIERQATGLQDVLKELPRREVALFRS  236

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QVSNLASEAKKERN LTKEVTKISN+GIS+
Sbjct  237   QVSNLASEAKKERNVLTKEVTKISNYGISI  266



>ref|XP_004229779.1| PREDICTED: uncharacterized protein LOC101267648 [Solanum lycopersicum]
Length=266

 Score =   373 bits (958),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 225/270 (83%), Gaps = 4/270 (1%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA IAESS+ N  +P    +PSLP +R N+ D   T  +A PWID+ALQQA+ A++T E 
Sbjct  1     MAAIAESSEANVNSP----SPSLPPERVNHEDKSNTWGEAVPWIDNALQQAQLARKTAED  56

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
               E+AI VTKSRL+RILTTSSAHFNQTLD+LQD+K+EY +YEDL FG++KEG+ +AASHP
Sbjct  57    TFENAIVVTKSRLNRILTTSSAHFNQTLDTLQDLKSEYSVYEDLAFGKIKEGLLLAASHP  116

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             L TTGA L +G L LKRPRRFLYY A  +FV EEA+LS+ADAKVKEL+KSID LKAES K
Sbjct  117   LATTGAVLGVGVLVLKRPRRFLYYSAMRLFVREEALLSRADAKVKELQKSIDLLKAESAK  176

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              E  A+QAE E+IRG+TKLRQAGKQIRSVI+SA+KIERQA GL+DVLKE PRRE SLFRS
Sbjct  177   LENQAIQAEGEMIRGRTKLRQAGKQIRSVIQSAHKIERQATGLQDVLKEFPRREVSLFRS  236

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QVSNLASEAKKERN LTKEVTKISN+GIS+
Sbjct  237   QVSNLASEAKKERNVLTKEVTKISNYGISI  266



>ref|XP_009776946.1| PREDICTED: uncharacterized protein LOC104226615 [Nicotiana sylvestris]
Length=274

 Score =   371 bits (952),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 197/274 (72%), Positives = 230/274 (84%), Gaps = 4/274 (1%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQA----APWIDDalqqarqaqQ  1049
             MA IAESS+ N+ +P    +PSLP  R  + D  +T+ Q      PWID+A+QQA+ AQ+
Sbjct  1     MAAIAESSEANADSPSPSPSPSLPADRVKHEDKSDTVGQGLGEFVPWIDNAVQQAQLAQK  60

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TVE  +E+AI VTKSRLDR+LTTSS HFNQTLDSLQD+K+EY +YEDL FG+++EG+ +A
Sbjct  61    TVENTLENAIVVTKSRLDRLLTTSSVHFNQTLDSLQDLKSEYSVYEDLVFGKIREGLLLA  120

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             ASHPL TTGA L +G LGLKRPRRFLYY A  +FVSEEA+LS+ADAKVKEL+KSIDFLKA
Sbjct  121   ASHPLTTTGAVLGVGVLGLKRPRRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFLKA  180

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES K E  AVQAE E+IRG+TKLRQAGKQIRSVI+SAY+IERQAAGLKDVL+ELPRRE S
Sbjct  181   ESAKLENRAVQAEGEMIRGRTKLRQAGKQIRSVIQSAYRIERQAAGLKDVLRELPRREVS  240

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              FRSQVSNLASEAKKERN LTKEVTKISN+GISV
Sbjct  241   RFRSQVSNLASEAKKERNVLTKEVTKISNYGISV  274



>ref|XP_008232561.1| PREDICTED: uncharacterized protein LOC103331692 [Prunus mume]
Length=264

 Score =   316 bits (810),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 206/262 (79%), Gaps = 6/262 (2%)
 Frame = -1

Query  1189  ENSKAPPSPVAPSLPRQRGNYSDNLETLAQAA-PWIDDalqqarqaqQTVETVIESAITV  1013
             ENS      ++P+      + S +L TL Q+A PWID A++QAR  Q+T+E   ESAI  
Sbjct  8     ENSSEEKPAISPN-----DSISHSLHTLEQSATPWIDYAVEQARVYQKTIEETFESAIEA  62

Query  1012  TKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFL  833
             ++SRL  I +TS+AHF+QT++SL+D+K++Y  YED+ FG++KEG+ IAASHP+IT G   
Sbjct  63    SRSRLSEIRSTSAAHFSQTINSLEDIKSDYGTYEDMFFGKIKEGVLIAASHPMITGGVAA  122

Query  832   SLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQA  653
              LG L LKRPRR LY+K   +FVSEE++LS+ADAKVKEL+ SID LKAE EK EK A  A
Sbjct  123   GLGLLVLKRPRRMLYHKTLRLFVSEESLLSRADAKVKELRHSIDLLKAEGEKLEKRASHA  182

Query  652   EQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASE  473
             E+ELIRG+TKLR  GKQI SVIRSAYKIERQAAGLKD+L ELPRREAS+FRSQVS LA+E
Sbjct  183   EEELIRGRTKLRHTGKQIESVIRSAYKIERQAAGLKDILGELPRREASMFRSQVSKLATE  242

Query  472   AKKERNFLTKEVTKISNHGISV  407
             AK+ERN LTKE+TKISN+GISV
Sbjct  243   AKQERNALTKEITKISNYGISV  264



>emb|CDP09483.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 211/267 (79%), Gaps = 4/267 (1%)
 Frame = -1

Query  1204  AESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQ-AAPWIDDalqqarqaqQTVETVIE  1028
             A S ++++ APP  + P+      +  + L+TL + A+PWID AL+QA+ AQ+T+   ++
Sbjct  9     ASSPEKSNSAPPQGIVPAF---NDDIVEKLKTLEETASPWIDYALKQAQAAQKTIGHHLQ  65

Query  1027  SAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLIT  848
              AI VTKSRLDRI TTSSAHFNQTLDSLQD K++++ YEDL  G+++EG  +AA++P I 
Sbjct  66    DAIEVTKSRLDRIRTTSSAHFNQTLDSLQDAKSDFNAYEDLAIGKIREGFNLAAANPFIA  125

Query  847   TGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEK  668
              G+  ++G LGLK PRR LYYK R +F SE+ +LSKADAKVKEL++S + LKAE+EK EK
Sbjct  126   AGSIFAVGLLGLKTPRRILYYKLRRLFASEQVLLSKADAKVKELRQSFEVLKAEAEKLEK  185

Query  667   NAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVS  488
              A+QAE+E+ RG+TKLRQAGKQI+SV+RSAYKIERQA GLKDVL++LP  EAS FRSQVS
Sbjct  186   AALQAEEEMTRGRTKLRQAGKQIQSVVRSAYKIERQAVGLKDVLRDLPSIEASRFRSQVS  245

Query  487   NLASEAKKERNFLTKEVTKISNHGISV  407
             NLA EAKKER  L KEVTKISN+GISV
Sbjct  246   NLAKEAKKERRVLNKEVTKISNYGISV  272



>ref|XP_011093293.1| PREDICTED: uncharacterized protein LOC105173298 [Sesamum indicum]
Length=261

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/270 (61%), Positives = 205/270 (76%), Gaps = 9/270 (3%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             M+I  ES     K P  P    +P+  G     +        W D A+QQA  AQ+TVE+
Sbjct  1     MSIAGESP--GGKPPEYPSDERIPKLPGGIEGII-------LWTDYAVQQAVIAQKTVES  51

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              +ESAI  T+SR+DRIL TSSAHFNQT+DS QD+K++Y  YED+ FG++KEG  +AASHP
Sbjct  52    TVESAIEATRSRIDRILNTSSAHFNQTIDSFQDLKSDYSQYEDIAFGKIKEGCLLAASHP  111

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             LITTGA L +GFLGLKR R+F YY    +  SEE +LS+ADAKVK+L++SID LKAESEK
Sbjct  112   LITTGAVLGVGFLGLKRTRQFFYYNTMRLLFSEETLLSRADAKVKQLRQSIDLLKAESEK  171

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              EK A+QAE++++RG+TKLRQAGKQI+S + SAYKIERQA GLKDVL+ELP RE+S FR+
Sbjct  172   LEKKAMQAEEDVVRGRTKLRQAGKQIQSALNSAYKIERQARGLKDVLRELPSRESSRFRT  231

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QV+N+A EAKKERN L+KEV +ISNHGISV
Sbjct  232   QVNNVAKEAKKERNALSKEVARISNHGISV  261



>ref|XP_002511643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50312.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/271 (63%), Positives = 202/271 (75%), Gaps = 5/271 (2%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPS-LPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  IAE S   S+  PSP APS  P          +TL +  PWID A+QQA   Q+T+E
Sbjct  1     MTTIAEESSP-SEEKPSPPAPSHFPEAE---MIKYKTLEEVTPWIDYAIQQALTYQKTIE  56

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++ A    +SR   I +TSSAHFNQT+DSLQDVK+E   YED  FG++K+G+ +AASH
Sbjct  57    EAVDDATKALRSRFSEIRSTSSAHFNQTMDSLQDVKSELGAYEDTLFGKVKDGVNVAASH  116

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             PLIT G  + LGF+  KRPRRFLYY    +FVSEEA+LSKADAKVKEL++SI  L+AESE
Sbjct  117   PLITGGVAVGLGFVLFKRPRRFLYYNTLRLFVSEEALLSKADAKVKELQQSISLLRAESE  176

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K EK A  AE ELIRG+TKLRQAGKQI  VI S YKIERQAAGLKD+++ELP REAS FR
Sbjct  177   KLEKRASSAEGELIRGRTKLRQAGKQICGVITSTYKIERQAAGLKDIIRELPSREASRFR  236

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQVS+LA+EAK+ERN LTKEVTKISN+GISV
Sbjct  237   SQVSSLATEAKRERNALTKEVTKISNYGISV  267



>ref|XP_011017444.1| PREDICTED: uncharacterized protein LOC105120771 [Populus euphratica]
Length=270

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 201/257 (78%), Gaps = 2/257 (1%)
 Frame = -1

Query  1171  PSPVAPSLPRQRGNYSDNLETLA--QAAPWIDDalqqarqaqQTVETVIESAITVTKSRL  998
             PS   P  P    + +  L++ A  + APWID ALQQA   Q+T++  ++ AI  +KSR 
Sbjct  14    PSTHLPPRPTAETDLTSILKSKAVEETAPWIDSALQQALVYQKTIQDSLDIAIESSKSRF  73

Query  997   DRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFL  818
               I+TTS AHF+QT+DSLQDVK+E  +YED  FG+ KEGI +AASHPLIT+   + LGF+
Sbjct  74    SEIITTSQAHFSQTIDSLQDVKSEIGVYEDKLFGKAKEGINVAASHPLITSAVAVGLGFV  133

Query  817   GLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELI  638
              LKRPRR LYYK   +F SEEA+LS+ADAKVKEL++SI  LKAESEK E+ A  AE+ELI
Sbjct  134   VLKRPRRILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELI  193

Query  637   RGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKER  458
             RG+TKLRQAGKQI+ VIRSAYKIERQA GL+D+L+ELPR EAS FRSQVS+LASEAK+ER
Sbjct  194   RGRTKLRQAGKQIQGVIRSAYKIERQATGLRDILRELPRAEASKFRSQVSSLASEAKQER  253

Query  457   NFLTKEVTKISNHGISV  407
             N L+KEVTKISNHGISV
Sbjct  254   NALSKEVTKISNHGISV  270



>gb|KHG03984.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=266

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = -1

Query  1102  QAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEY  923
             Q  PWID A++QA   Q+ +E  +  AI  ++SRL  I +TSSAHFN T++SL+DVK++ 
Sbjct  35    QVTPWIDSAVEQALLYQKIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQL  94

Query  922   HLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLS  743
              +YEDL FG++KEGI IAAS+PLIT GA + LGFL LKRPR  LYYK   +F SEE+++S
Sbjct  95    DVYEDLAFGKVKEGINIAASNPLITVGAAVGLGFLVLKRPRHLLYYKTLRLFQSEESLIS  154

Query  742   KADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIER  563
             KAD +VKEL++SID LKAESEK E++A  AE ELIRG+TKLRQAGKQIRSVI+SAYKIER
Sbjct  155   KADIRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTKLRQAGKQIRSVIQSAYKIER  214

Query  562   QAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QAAGLKD L ELP REAS FRSQVS+LAS+AK+ERN LTKEV+KISNHGI+V
Sbjct  215   QAAGLKDTLGELPSREASRFRSQVSSLASQAKRERNVLTKEVSKISNHGIAV  266



>gb|KDP28809.1| hypothetical protein JCGZ_14580 [Jatropha curcas]
Length=264

 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 200/259 (77%), Gaps = 2/259 (1%)
 Frame = -1

Query  1177  APPSPVAPSLPRQRGNYSDNLE--TLAQAAPWIDDalqqarqaqQTVETVIESAITVTKS  1004
              P SP    + +Q  ++   ++  TL +  PWID A+QQA   Q+ +E  +E A +V +S
Sbjct  6     GPSSPEEKPIVKQPNDFPSTIKSKTLEEVTPWIDSAVQQALIYQKNMEETLEGATSVFRS  65

Query  1003  RLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLG  824
             R   I +TSSAHF+QT+DSLQD K+E+  YED+ FG++KEG+ IA SHP+IT G  + LG
Sbjct  66    RFSEIRSTSSAHFHQTIDSLQDFKSEFDAYEDMLFGKVKEGVKIAVSHPIITGGVAVGLG  125

Query  823   FLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQE  644
                LKRPRRFLYY    +FVSEE++LS+ADAKVKEL++SI  LKAESEK EK A  AE E
Sbjct  126   LALLKRPRRFLYYNTLRLFVSEESLLSQADAKVKELRQSISLLKAESEKIEKRASLAETE  185

Query  643   LIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKK  464
             LIRG+TKLRQAGKQI+ VIRSAYKIE+QAAGLKDVL++LP REAS FRS+VS+L+SEAK+
Sbjct  186   LIRGRTKLRQAGKQIQGVIRSAYKIEKQAAGLKDVLRDLPSREASRFRSKVSSLSSEAKQ  245

Query  463   ERNFLTKEVTKISNHGISV  407
             E+N LTKE+TKISN+GISV
Sbjct  246   EKNALTKEITKISNYGISV  264



>ref|XP_002302514.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
 gb|EEE81787.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
Length=270

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 203/268 (76%), Gaps = 5/268 (2%)
 Frame = -1

Query  1195  SDENSKAP---PSPVAPSLPRQRGNYSDNLET--LAQAAPWIDDalqqarqaqQTVETVI  1031
             +D  S +P   PS   P  P    + +  L++  L + APWID+ALQQA   Q+T++  +
Sbjct  3     TDAESPSPEEKPSTHLPPRPTAETDLTSILKSKALEETAPWIDNALQQALIYQKTIQDSL  62

Query  1030  ESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLI  851
             + AI  +KSR   I+TTS AHF+QT+DSLQ   +E  +YED  FG+ KEGI +AASHPLI
Sbjct  63    DIAIESSKSRFSEIITTSQAHFSQTIDSLQYFTSEIGVYEDKLFGKAKEGINVAASHPLI  122

Query  850   TTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWE  671
             T+   + LGF+ LKRPRR LYYK   +F SEEA+LS+ADAKVKEL++SI  LKAESEK E
Sbjct  123   TSAVAVGLGFVVLKRPRRILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLE  182

Query  670   KNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQV  491
             + A  AE+ELIRG+TKLRQAGKQI+ VIRSAYKIERQA GL+D+L+ELPR EAS FRSQV
Sbjct  183   RRASLAEEELIRGRTKLRQAGKQIQGVIRSAYKIERQATGLRDILRELPRAEASKFRSQV  242

Query  490   SNLASEAKKERNFLTKEVTKISNHGISV  407
             S+LASEAK+ERN L+KEV KISNHGISV
Sbjct  243   SSLASEAKQERNALSKEVAKISNHGISV  270



>ref|XP_006445337.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 ref|XP_006490844.1| PREDICTED: uncharacterized protein LOC102630500 [Citrus sinensis]
 gb|ESR58577.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 gb|KDO85658.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=261

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 197/273 (72%), Gaps = 15/273 (5%)
 Frame = -1

Query  1216  MAIIAESSDE---NSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQT  1046
             MA + ESS++   N  A    V  S   + GN            PWID+A+QQ    ++ 
Sbjct  1     MATVTESSEDEKPNVAAASDTVFKSQSLEDGN------------PWIDNAVQQVMIYRKI  48

Query  1045  VETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAA  866
             VE  I+SAI  ++SRL +   T+S HF QTLD LQDVK+EY  YED   G++KEGI +AA
Sbjct  49    VEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHVAA  108

Query  865   SHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAE  686
             SHP IT G  + LG   LKRPR FLYY    +F SEE++LS+AD KVK+L++SID LKAE
Sbjct  109   SHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLKAE  168

Query  685   SEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASL  506
             SEK EK A+ AE ELIRG+TKLRQAGKQI+ VI SAYKIERQAAGLKD++ ELPRREAS 
Sbjct  169   SEKLEKVALVAEDELIRGRTKLRQAGKQIQGVINSAYKIERQAAGLKDIVGELPRREASR  228

Query  505   FRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             FRSQVSN+ASEAK+ERN LTKEV+KISN+GISV
Sbjct  229   FRSQVSNIASEAKRERNALTKEVSKISNYGISV  261



>ref|XP_010524407.1| PREDICTED: uncharacterized protein LOC104802474 [Tarenaya hassleriana]
Length=269

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -1

Query  1099  AAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYH  920
             AA WIDD LQQA   Q TV   +ES I  ++SRL +I  TSSAHFNQTLDSL+D+ +EY 
Sbjct  39    AASWIDDTLQQALIYQNTVTETVESTIQASRSRLSQIRETSSAHFNQTLDSLRDIASEYT  98

Query  919   LYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSK  740
             +YE + FG++KEG+ +AAS+PLI+ G    +G   LKR RRFLYY    IF SEEA+LS+
Sbjct  99    VYEHMLFGKVKEGVNVAASYPLISGGVAFGVGIFSLKRTRRFLYYSTLRIFSSEEALLSQ  158

Query  739   ADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQ  560
             AD KVKEL++SID LKAESEK E+    AEQELIRG+ KLRQAGKQI+ VI SAYK E+Q
Sbjct  159   ADLKVKELRQSIDRLKAESEKLERRTTVAEQELIRGRMKLRQAGKQIQGVIHSAYKTEKQ  218

Query  559   AAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             AAGLKD+LKELPRREAS FRSQVSNLASEAK+ERN LTKEV KISN+GI V
Sbjct  219   AAGLKDLLKELPRREASRFRSQVSNLASEAKQERNALTKEVNKISNYGIPV  269



>gb|AFK47092.1| unknown [Lotus japonicus]
Length=262

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 201/272 (74%), Gaps = 12/272 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYS--DNLETLAQAAPWIDDalqqarqaqQTV  1043
             MA + ESS E+   PP+P         GN+S   N  TL    P+ID A+ QA   Q+  
Sbjct  1     MATVVESS-ESDTPPPAP---------GNHSTTSNRPTLDPTTPFIDYAVGQALLYQKAF  50

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
                +ESAI  +KSR  +I +TSSAHF QTL +L D K++Y+ YEDL FG++KEG+ +A+S
Sbjct  51    NDAVESAIDASKSRFSQIRSTSSAHFQQTLYALDDFKSQYNAYEDLLFGKIKEGVLVASS  110

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP+IT GA  + G +  KRPRR LYY    +F++EE ++S+A A+VKEL+KSID LKAE 
Sbjct  111   HPVITCGAAAATGLMVFKRPRRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAEG  170

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
             EKWEK+A+ AE++ + G+TKLRQAGKQIR+VI SAYKIER+A GLKD+L ELPRREAS F
Sbjct  171   EKWEKSALHAEEQFLHGRTKLRQAGKQIRNVIDSAYKIERRAGGLKDILGELPRREASHF  230

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             RSQVS LASEAK+E+N LTKEV+KISN+GISV
Sbjct  231   RSQVSKLASEAKREKNSLTKEVSKISNYGISV  262



>gb|AFK39373.1| unknown [Lotus japonicus]
Length=262

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 200/272 (74%), Gaps = 12/272 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYS--DNLETLAQAAPWIDDalqqarqaqQTV  1043
             MA + ESS E+   PP+P         GN+S   N  TL    P+ID A+ QA   Q+  
Sbjct  1     MATVVESS-ESDTPPPAP---------GNHSTTSNRPTLDPTTPFIDYAVGQALLYQKAF  50

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
                +ESAI  +KSR  +I +TSSAHF QTL +L D K++Y+ YEDL FG++KEG+ +A+S
Sbjct  51    NDAVESAIDASKSRFSQIRSTSSAHFQQTLYALDDFKSQYNAYEDLLFGKIKEGVLVASS  110

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP+IT GA  + G +  KRPRR LYY    +F++EE ++S+A A+VKEL+KSID LKAE 
Sbjct  111   HPVITCGAAAATGLMVFKRPRRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAEG  170

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
             EKWEK+A+ AE++ + G+TKL QAGKQIR+VI SAYKIER+A GLKD+L ELPRREAS F
Sbjct  171   EKWEKSALHAEEQFLHGRTKLGQAGKQIRNVIDSAYKIERRAGGLKDILGELPRREASHF  230

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             RSQVS LASEAK+E+N LTKEV+KISN+GISV
Sbjct  231   RSQVSKLASEAKREKNSLTKEVSKISNYGISV  262



>ref|XP_007052188.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96345.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=284

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 205/272 (75%), Gaps = 4/272 (1%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLET--LAQAAPWIDDalqqarqaqQTV  1043
             MA ++ES +++    P+  AP+      +Y    E+  L QA PWID A++QA   Q+ +
Sbjct  15    MATVSESPEDSPN--PNSPAPTPLPPPSDYPSKSESKVLEQATPWIDYAVEQALLYQKII  72

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
             E  I + I  ++SRL    +TS+AHFNQT+DSL+DVK++  +YE++ FG++KEGI IAAS
Sbjct  73    EQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVYENMMFGKVKEGIKIAAS  132

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP+IT G  + LG L LKRPRRFLYY    +FVSEE+ LSKAD +VKEL++SID LK ES
Sbjct  133   HPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTES  192

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
              K E++A  AE++LIRG+ KLR AGKQI+SVI SAYKIERQAAGLKD+L ELP REAS F
Sbjct  193   VKLERSASVAEEDLIRGRKKLRHAGKQIQSVIHSAYKIERQAAGLKDILGELPSREASRF  252

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             RSQVSNLASEAK+ERN L KEV+KISN+GI+V
Sbjct  253   RSQVSNLASEAKRERNALAKEVSKISNYGIAV  284



>ref|XP_003538068.1| PREDICTED: uncharacterized protein LOC100804339 [Glycine max]
Length=258

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 201/270 (74%), Gaps = 12/270 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA++AES + +S    S             ++N +TL + AP++D AL QA+   +    
Sbjct  1     MAMVAESPESDSDNNSSK------------TNNPQTLNETAPFLDYALAQAQLYHKAFND  48

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              ++S I   KSR  +I +TSSAHF+QTLDSL D+K++Y  YE L FG++KEG+ +AASHP
Sbjct  49    AVDSTIDTAKSRFSQIRSTSSAHFHQTLDSLDDLKSQYTAYEGLLFGKIKEGVVVAASHP  108

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             +IT GA  SLG L LKRPRR LYY    +FVSEE+M+S+A A+VKEL++SI+ LKAE EK
Sbjct  109   VITCGATASLGLLVLKRPRRVLYYNTLRLFVSEESMISRAHAEVKELRQSIELLKAEGEK  168

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              EK+A+ AE++ + G+TKLR AGKQIR+VI+SAYKIE +A GLKD+L ELP+RE SLFRS
Sbjct  169   LEKSALHAEEQFLHGRTKLRHAGKQIRNVIQSAYKIEIRAGGLKDILGELPKRETSLFRS  228

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QVS LASEAKKE+N ++KE++KISN+GISV
Sbjct  229   QVSKLASEAKKEKNTMSKEISKISNYGISV  258



>ref|XP_010258900.1| PREDICTED: uncharacterized protein LOC104598502 [Nelumbo nucifera]
Length=250

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -1

Query  1102  QAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEY  923
             Q  PWI+ A+QQA+  Q+T++  ++S I V  SRL  I +TSSAH +QTLD+LQD+K+E+
Sbjct  19    QQTPWIEYAVQQAQLVQKTIQETVDSTIEVAGSRLSEIRSTSSAHLHQTLDNLQDIKSEF  78

Query  922   HLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLS  743
             + YED+ FG++K+G+ +AA HP+IT G    +G + LKRPR FLY+    +F+SEE++L+
Sbjct  79    NTYEDVFFGKIKDGLTLAALHPMITCGVAAGVGLVALKRPRLFLYHSTLRLFMSEESLLA  138

Query  742   KADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIER  563
             +AD+KVK L++SI  +KAESEK EK A+QAEQE+ RG+TKLRQAG QI+ VIRSAYKIER
Sbjct  139   RADSKVKALRQSIALMKAESEKLEKRALQAEQEMKRGRTKLRQAGNQIQGVIRSAYKIER  198

Query  562   QAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QA GLKD+LKELP REAS FRSQVS+LASEAK+ERN LTKEV+KISN+GISV
Sbjct  199   QARGLKDILKELPSREASRFRSQVSSLASEAKRERNALTKEVSKISNYGISV  250



>ref|XP_002277999.1| PREDICTED: uncharacterized protein LOC100266783 [Vitis vinifera]
 emb|CBI16597.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -1

Query  1099  AAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYH  920
             A+ WI+  + QA+   +T++  + S I  + SR  +IL+TSSAH  QT++SL+DVK+EY 
Sbjct  30    ASSWIEYGVNQAQLLHKTLDDTVNSFIEASGSRFSQILSTSSAHLQQTIESLKDVKSEYD  89

Query  919   LYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSK  740
             +YEDL  G++KEGI +AAS+PLIT+G  + LG L LKRPR FLYY    + VSEE+M+++
Sbjct  90    VYEDLAVGKIKEGILVAASNPLITSGVCVGLGCLLLKRPRHFLYYNTLRLLVSEESMVAR  149

Query  739   ADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQ  560
             ADAKV EL+KSID LKAESEK EK A+QAE E+ RG+TKLRQAG QI+SVIRSAYKIERQ
Sbjct  150   ADAKVNELRKSIDLLKAESEKLEKRALQAEDEMKRGRTKLRQAGNQIQSVIRSAYKIERQ  209

Query  559   AAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             A GLKD+L ELP REAS FRSQVS LASEAK+ER+ L+KEV+KISN+GISV
Sbjct  210   ARGLKDILGELPSREASRFRSQVSKLASEAKRERSALSKEVSKISNYGISV  260



>gb|KEH22362.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=264

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 206/270 (76%), Gaps = 6/270 (2%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA +AESS+   +APPS  AP++ +   + + N +TL    P+ID A+      Q+T   
Sbjct  1     MATVAESSE--PEAPPSTPAPTVNQ---STTTNPQTL-DVKPFIDYAVGHVLYYQKTFND  54

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              ++SAI  + SR  +I +TSSAHF+Q+LD L D K++Y+ YE+L FG++KEG+ +AASHP
Sbjct  55    AVDSAIDASTSRFSQIRSTSSAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHP  114

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             +IT+GA  S+G L LKRPRRFLYY  + +FVSEE+++SKA  +VKEL++SID LK+E E+
Sbjct  115   VITSGATASMGLLVLKRPRRFLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVER  174

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              EK+A+ AE++ + G+TKLRQAGKQIR+VI+SAYKIER+A GLKD+L ELP+ EAS FRS
Sbjct  175   MEKSALHAEEQFLHGRTKLRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKSEASHFRS  234

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QVS +AS+ K+E+  L KEV+KISN+GIS+
Sbjct  235   QVSRIASDVKQEKRSLAKEVSKISNYGISI  264



>ref|XP_007052189.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX96346.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=285

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 205/273 (75%), Gaps = 5/273 (2%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLET--LAQAAPWIDDalqqarqaqQTV  1043
             MA ++ES +++    P+  AP+      +Y    E+  L QA PWID A++QA   Q+ +
Sbjct  15    MATVSESPEDSPN--PNSPAPTPLPPPSDYPSKSESKVLEQATPWIDYAVEQALLYQKII  72

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
             E  I + I  ++SRL    +TS+AHFNQT+DSL+DVK++  +YE++ FG++KEGI IAAS
Sbjct  73    EQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVYENMMFGKVKEGIKIAAS  132

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP+IT G  + LG L LKRPRRFLYY    +FVSEE+ LSKAD +VKEL++SID LK ES
Sbjct  133   HPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTES  192

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQ-AAGLKDVLKELPRREASL  506
              K E++A  AE++LIRG+ KLR AGKQI+SVI SAYKIERQ AAGLKD+L ELP REAS 
Sbjct  193   VKLERSASVAEEDLIRGRKKLRHAGKQIQSVIHSAYKIERQAAAGLKDILGELPSREASR  252

Query  505   FRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             FRSQVSNLASEAK+ERN L KEV+KISN+GI+V
Sbjct  253   FRSQVSNLASEAKRERNALAKEVSKISNYGIAV  285



>ref|XP_009339857.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339858.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339859.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339860.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
Length=262

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 209/271 (77%), Gaps = 10/271 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQ-AAPWIDDalqqarqaqQTVE  1040
             MA + E+S E +        P+L     + S++ +TL Q A PW+D A++QAR  Q+ VE
Sbjct  1     MATVPETSSEKN--------PTLS-HSNSISNSPQTLDQLATPWVDYAVEQARIYQKNVE  51

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
                ESAI  ++SRL  I  TS+AHF+QT++SL+D+K+    YE+L FG++KEG+ +AAS+
Sbjct  52    ETFESAIAASRSRLSEIRATSAAHFSQTINSLEDIKSNCGAYEELLFGKIKEGVHVAASN  111

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+ T G    LGFL LKRPRR LY+KA  +FVSEE++LS+ADAKVKEL+ SID LKAESE
Sbjct  112   PMKTAGVATGLGFLLLKRPRRLLYHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESE  171

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K EK A+ AE+EL RG+TKLRQ GKQI+SVIRSAYK ERQAAGLKD+L ELPRREA++FR
Sbjct  172   KLEKRALHAEEELTRGRTKLRQTGKQIQSVIRSAYKAERQAAGLKDILGELPRREAAVFR  231

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQVS LA+EAKKERN L+KEVTKISN+GISV
Sbjct  232   SQVSKLATEAKKERNALSKEVTKISNYGISV  262



>gb|AFK35211.1| unknown [Medicago truncatula]
Length=264

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 204/270 (76%), Gaps = 6/270 (2%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA +AESS+   +APPS  AP++ +   + + N +TL    P+ID A+      Q+T   
Sbjct  1     MATVAESSE--PEAPPSTPAPTVNQ---STTTNPQTL-DVKPFIDYAVGHVLYYQKTFND  54

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              ++SAI  + SR  +I +TSSAHF+Q+LD L D K++Y+ YE+L FG++KEG+ +AASHP
Sbjct  55    AVDSAIDASTSRFSQIRSTSSAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHP  114

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             +IT+GA  S+G L LKRPRRFLYY  + +FVSEE+++SKA  +VKEL++SID LK+E E+
Sbjct  115   VITSGATASMGLLVLKRPRRFLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVER  174

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              EK+A+ AE++ + GKTKLRQAGKQIR+VI+SAYKIER+A GLKD+L ELP+ EAS FRS
Sbjct  175   MEKSALHAEEQFLHGKTKLRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKSEASHFRS  234

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QVS +A + K+E+  L KEV KISN+GIS+
Sbjct  235   QVSRIAFDVKQEKRSLAKEVFKISNYGISI  264



>ref|XP_002881994.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58253.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
Length=272

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 196/272 (72%), Gaps = 2/272 (1%)
 Frame = -1

Query  1216  MAIIAES-SDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTV  1043
             MA + ES S E     P  +  S P     Y      T+  AA WIDDAL+QA   Q+T+
Sbjct  1     MAALGESLSSEMDNTNPPEIQQSSPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTI  60

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
                ++S I  +K+RL +I  TS AH +QT+DSL+D+ +EY++YE + FG++K+G+ +AAS
Sbjct  61    SETVDSTIDASKARLSQIRDTSVAHTSQTIDSLRDIASEYNVYEQMVFGKIKDGVNVAAS  120

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HPLI+      +G   LK+ R+F+YY    +FVSEEA+LS+AD KVKEL++S+D LKAES
Sbjct  121   HPLISGTLAFGVGIFALKKTRKFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLKAES  180

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
             EK E+ A  AE+ELIRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP REAS F
Sbjct  181   EKLERVATVAEEELIRGRMKLRQAGKQIRGAISSAYKIEKQAAGLKDVLKELPTREASRF  240

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             R+Q+SN ASE K+ERN LTKEV KISN+GISV
Sbjct  241   RTQISNRASEVKQERNALTKEVNKISNYGISV  272



>ref|XP_009337245.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337246.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337247.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
Length=262

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/271 (61%), Positives = 207/271 (76%), Gaps = 10/271 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQ-AAPWIDDalqqarqaqQTVE  1040
             MA + E+S E +        P+L     + S + +TL Q   PW+D A++QAR  Q+ VE
Sbjct  1     MATVPETSSEKN--------PTLS-HSNSISHSPQTLDQLGTPWVDYAVEQARIYQKNVE  51

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
                ESAI  ++S L  I  TS+AHF+QT++SL+D+K+    YE+L FG++KEG+ +AAS+
Sbjct  52    ETFESAIAASRSHLSEIRATSAAHFSQTINSLEDIKSNCGAYEELLFGKIKEGVHVAASN  111

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+IT G    LGFL LKRPRR LY+KA  +FVSEE++LS+ADAKVKEL+ SID LKAESE
Sbjct  112   PMITAGVATGLGFLLLKRPRRLLYHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESE  171

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K EK A+ AE+EL RG+TKLRQ GKQI+SVIRSAYK ERQAAGLKD+L ELPRREA++FR
Sbjct  172   KLEKRALHAEEELTRGRTKLRQTGKQIQSVIRSAYKAERQAAGLKDILGELPRREAAVFR  231

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQVS LA+EAKKERN L+KEVTKISN+GISV
Sbjct  232   SQVSKLATEAKKERNALSKEVTKISNYGISV  262



>ref|NP_566034.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK73943.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AAM62665.1| unknown [Arabidopsis thaliana]
 gb|AAN28847.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AEC10501.1| uncharacterized protein AT2G45060 [Arabidopsis thaliana]
Length=272

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 201/277 (73%), Gaps = 12/277 (4%)
 Frame = -1

Query  1216  MAIIAESSD---ENSKAP----PSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarq  1058
             MA + ESS    +N+K+P     SPV P  P  +   +  +E    AA WIDDAL+QA  
Sbjct  1     MAALGESSSSEMDNAKSPEIQQSSPVHP--PEYQKIATTTVEN---AASWIDDALRQALV  55

Query  1057  aqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGI  878
              Q+T+   ++S I  +K+RL +I  TS AH +QT+DSL+D+ +EY++YE + FG++K+G+
Sbjct  56    YQKTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLRDIASEYNVYEQMVFGKIKDGV  115

Query  877   CIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDF  698
              +AASHPLI+      +G   LK+ RRF+YY    +FVSEEA+LS+AD KVKEL++S+D 
Sbjct  116   NVAASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFVSEEALLSRADLKVKELRQSMDR  175

Query  697   LKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRR  518
             LKAESEK E+ A  AE+E IRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP R
Sbjct  176   LKAESEKLERVATVAEEEFIRGRMKLRQAGKQIRGAISSAYKIEKQAAGLKDVLKELPTR  235

Query  517   EASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             EAS FR+Q+S  ASE K+ERN LTKEV KISN+GISV
Sbjct  236   EASRFRTQISKRASEVKQERNALTKEVNKISNYGISV  272



>gb|EYU42370.1| hypothetical protein MIMGU_mgv1a023111mg [Erythranthe guttata]
Length=240

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 171/214 (80%), Gaps = 0/214 (0%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             T+E  +E+AI  T+SR+DR+LTTSSAH NQT+DSLQ++K+E   YED+ FG+MKEG  +A
Sbjct  27    TIEITVENAIEATRSRVDRLLTTSSAHLNQTIDSLQELKSECSTYEDIVFGKMKEGFLLA  86

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             +S P + TG  L +G L LKR R+FL +    +F+SEE MLS+ +AKVKEL++SID LK 
Sbjct  87    SSRPFVATGVVLGVGVLSLKRTRQFLSHSTMRLFLSEEIMLSRTNAKVKELRQSIDLLKV  146

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ESEK EK A+QAE+ L+RG+TKL+QAGKQI  VI SAYKIE QA GL+DVL ELP REAS
Sbjct  147   ESEKLEKRALQAEENLVRGRTKLKQAGKQIHGVINSAYKIESQARGLQDVLTELPSREAS  206

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              FR+QV ++A EAKKERN L+KEVTKISN+GISV
Sbjct  207   RFRTQVKSVAKEAKKERNALSKEVTKISNYGISV  240



>ref|XP_010506443.1| PREDICTED: uncharacterized protein LOC104783057 isoform X1 [Camelina 
sativa]
Length=271

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 195/271 (72%), Gaps = 1/271 (0%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  + ESS E + A P  +  S P     Y      T+  AA WIDDAL+QA   Q+T+ 
Sbjct  1     MRTLGESSSEMNDANPPAIPQSSPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTIT  60

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++S I  +K+RL +I  TS AH +QTLDSL+++ +EY++YE + FG++K+G+ +AASH
Sbjct  61    ETLDSTIDASKARLSQIRDTSVAHTSQTLDSLREIASEYNVYEQMVFGKIKDGVNVAASH  120

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+I+      +G   LK+ RR +YY    +FVSEEA+LS+AD KVKEL++S+D L A+SE
Sbjct  121   PVISGTLAFGVGIFALKKTRRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLTAQSE  180

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K E+ A  AE+ELIRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP REAS FR
Sbjct  181   KLERVATMAEEELIRGRMKLRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPSREASRFR  240

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQ+SN ASE K+ERN LTKEV KISN+GISV
Sbjct  241   SQISNRASEVKQERNALTKEVNKISNYGISV  271



>ref|XP_006294796.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27694.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=271

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 195/271 (72%), Gaps = 1/271 (0%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  + ESS E + A    +  S P     Y      T+  AA WIDDAL+QA   Q+T+ 
Sbjct  1     MTTLGESSSEMNDANQPAIPQSAPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTIT  60

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++S I  +K+RL +I  TS AH +QT+DSL+++ +EY++YE + FG++K+G+ +AASH
Sbjct  61    ETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNVAASH  120

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             PLI+      +G   LK+ RRF+YY    +F+SEEA+LS+AD KVKEL++S+D L AESE
Sbjct  121   PLISGTLAFGVGIFALKKTRRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLTAESE  180

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K ++ A  AE+ELIRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP REAS FR
Sbjct  181   KLQRVATVAEEELIRGRMKLRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPTREASRFR  240

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQ+SN ASE KKERN LTKEV KISN+GISV
Sbjct  241   SQISNRASEVKKERNALTKEVNKISNYGISV  271



>ref|XP_010508215.1| PREDICTED: uncharacterized protein LOC104784826 [Camelina sativa]
Length=271

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 196/271 (72%), Gaps = 1/271 (0%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  + ESS E + A P     S P     Y      T+  AA WIDDAL+QA   Q+T+ 
Sbjct  1     MTTLGESSSEMTDANPPANPQSSPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTIT  60

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++S I  +K+RL +I  TS+AH +QT+DSL+++ +EY++YE + FG++K+G+ +AASH
Sbjct  61    ETVDSTIDASKARLSQIRDTSAAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNVAASH  120

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+I+      +G   LK+ RRF+Y+    +FVSEEA+LS+AD KVKEL++S+D L A+SE
Sbjct  121   PVISGTLAFGVGVFALKKTRRFVYFNTVRMFVSEEALLSRADLKVKELRQSMDRLTAQSE  180

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K E+ A  AE+ELIRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP REAS FR
Sbjct  181   KLERVATMAEEELIRGRMKLRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPTREASRFR  240

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             +Q+SN ASE K+ERN LTKEV KISN+GISV
Sbjct  241   TQISNRASEVKQERNALTKEVNKISNYGISV  271



>ref|XP_008375716.1| PREDICTED: uncharacterized protein LOC103438950 [Malus domestica]
Length=262

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 163/271 (60%), Positives = 206/271 (76%), Gaps = 10/271 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQ-AAPWIDDalqqarqaqQTVE  1040
             MA + E+S E +        P+L     + S + + L Q A PW+D A++QAR  Q+ VE
Sbjct  1     MATVPETSSEEN--------PTLS-HSNSISHSPQPLDQLATPWVDYAVEQARIYQKNVE  51

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
                ESA+  ++SRL  I  TS+AHF+QT++SL+D+K+    YE+L FG++KEG+ +AAS+
Sbjct  52    ETFESAVAASRSRLSEIRATSAAHFSQTINSLEDIKSNCXAYEELLFGKIKEGVHVAASN  111

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+IT G    LGFL LKRPRR LY+KA  +FVSEE++LS+ADAKVKEL+ SID LKAESE
Sbjct  112   PMITAGVATGLGFLLLKRPRRLLYHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESE  171

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K EK A+ AE+E  RG+TKLRQ GKQI+SVIRSAYK ERQAAGLKD+L ELPRREA++FR
Sbjct  172   KLEKRALHAEEEXTRGRTKLRQTGKQIQSVIRSAYKAERQAAGLKDILGELPRREAAVFR  231

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQVS LA EAKKERN L+KEVTKISN+GISV
Sbjct  232   SQVSKLAXEAKKERNALSKEVTKISNYGISV  262



>ref|XP_010518116.1| PREDICTED: uncharacterized protein LOC104793462 [Camelina sativa]
Length=271

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 194/271 (72%), Gaps = 1/271 (0%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  + ESS E + A P  +    P     Y      T+  AA WIDDAL+QA   Q+T+ 
Sbjct  1     MTTLGESSSEMNDANPPAIPQYSPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTIT  60

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++S I  +K+RL +I  TS AH +QT+DSL+++  EY++YE + FG++K+G+ +AASH
Sbjct  61    ETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIACEYNVYEQMVFGKIKDGVNVAASH  120

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+I+      +G   L++ RR +YY    +FVSEEA+LS+AD KVKEL++S+D L A+SE
Sbjct  121   PVISGTLAFGVGIFALRKTRRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLTAQSE  180

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K E+ A  AE+ELIRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP+REAS FR
Sbjct  181   KLERVATMAEEELIRGRMKLRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPKREASRFR  240

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQ+SN ASE K+ERN LTKEV KISN+GISV
Sbjct  241   SQISNRASEVKQERNALTKEVNKISNYGISV  271



>ref|XP_006397686.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
 gb|ESQ39139.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
Length=275

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 197/279 (71%), Gaps = 13/279 (5%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPP---------SPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqa  1064
             MA + ESS     A P          P+  S+P  +   +    T+  AA WIDD ++QA
Sbjct  1     MATLGESSSGMEDAQPPEIPQSMQSQPLTSSIPSSKIAAT----TVENAASWIDDTMRQA  56

Query  1063  rqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKE  884
                Q+T+   ++S I  ++SRL +I  TS AH +QT+DSL+D+ +EY++YE + FG++KE
Sbjct  57    LVYQKTIVETLDSTIDASRSRLSQIRDTSLAHTSQTIDSLKDIASEYNVYEHMVFGKIKE  116

Query  883   GICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSI  704
             G+ +AASHPLI+      +G   LK+ RRF+YY    +F+SEEA+LS+AD +VKEL++S+
Sbjct  117   GVNVAASHPLISGTLAFGVGIFALKKTRRFVYYNTIRMFLSEEALLSRADLRVKELRQSM  176

Query  703   DFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELP  524
             D L AESEK E+ A  AE ELIRG+ KLRQAGKQIR V+ SAYKIE+QAAGLKDVLKELP
Sbjct  177   DRLTAESEKLERVATVAEDELIRGRMKLRQAGKQIRGVVSSAYKIEKQAAGLKDVLKELP  236

Query  523   RREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              REAS FRSQ+S+ ASE K+ERN LTKEV KISN+GISV
Sbjct  237   TREASRFRSQISSRASEIKQERNALTKEVNKISNYGISV  275



>gb|KEH22363.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=276

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 206/282 (73%), Gaps = 18/282 (6%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA +AESS+   +APPS  AP++ +   + + N +TL    P+ID A+      Q+T   
Sbjct  1     MATVAESSE--PEAPPSTPAPTVNQ---STTTNPQTL-DVKPFIDYAVGHVLYYQKTFND  54

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              ++SAI  + SR  +I +TSSAHF+Q+LD L D K++Y+ YE+L FG++KEG+ +AASHP
Sbjct  55    AVDSAIDASTSRFSQIRSTSSAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHP  114

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             +IT+GA  S+G L LKRPRRFLYY  + +FVSEE+++SKA  +VKEL++SID LK+E E+
Sbjct  115   VITSGATASMGLLVLKRPRRFLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVER  174

Query  676   WE------------KNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLK  533
              E            K+A+ AE++ + G+TKLRQAGKQIR+VI+SAYKIER+A GLKD+L 
Sbjct  175   MEGARFAIAFRYPRKSALHAEEQFLHGRTKLRQAGKQIRNVIQSAYKIERRAGGLKDILG  234

Query  532   ELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             ELP+ EAS FRSQVS +AS+ K+E+  L KEV+KISN+GIS+
Sbjct  235   ELPKSEASHFRSQVSRIASDVKQEKRSLAKEVSKISNYGISI  276



>ref|XP_010053946.1| PREDICTED: uncharacterized protein LOC104442278 [Eucalyptus grandis]
 gb|KCW78322.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=268

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 189/240 (79%), Gaps = 4/240 (2%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTL----DS  947
             +++  A PW+D A+ QAR  ++ VE  + S    ++SRL +I +T++AH   T+    D+
Sbjct  29    KSIGDATPWVDYAVDQARLLRKGVEDDVGSFAEASRSRLAQIRSTAAAHTMMTVAMIQDT  88

Query  946   LQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIF  767
              Q+VK++Y  YED+ FG++K GI IAAS+P++T G     GF+ LKRPRRFLYY    + 
Sbjct  89    FQEVKSKYDAYEDIFFGKVKGGIEIAASNPMLTAGVVTGSGFIVLKRPRRFLYYNTLRLL  148

Query  766   VSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVI  587
             +SEE+MLS+ADAKVKEL+KSID LKAESEK E+ A  AE+E++RG+TKLRQAGKQI+SV 
Sbjct  149   MSEESMLSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTKLRQAGKQIQSVS  208

Query  586   RSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              SAYKIERQAAGLKDV++ELPRREAS FRSQVSNLASEAK+ERN LTKEV+KI+++GISV
Sbjct  209   HSAYKIERQAAGLKDVIRELPRREASRFRSQVSNLASEAKRERNALTKEVSKITDYGISV  268



>ref|XP_007052191.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX96348.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=278

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 200/272 (74%), Gaps = 10/272 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLET--LAQAAPWIDDalqqarqaqQTV  1043
             MA ++ES +++    P+  AP+      +Y    E+  L QA PWID A++QA   Q+ +
Sbjct  15    MATVSESPEDSPN--PNSPAPTPLPPPSDYPSKSESKVLEQATPWIDYAVEQALLYQKII  72

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
             E  I + I  ++SRL    +TS+AHFNQT+DSL+DVK++  +YE++ FG++K      AS
Sbjct  73    EQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVYENMMFGKVK------AS  126

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP+IT G  + LG L LKRPRRFLYY    +FVSEE+ LSKAD +VKEL++SID LK ES
Sbjct  127   HPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTES  186

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
              K E++A  AE++LIRG+ KLR AGKQI+SVI SAYKIERQAAGLKD+L ELP REAS F
Sbjct  187   VKLERSASVAEEDLIRGRKKLRHAGKQIQSVIHSAYKIERQAAGLKDILGELPSREASRF  246

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             RSQVSNLASEAK+ERN L KEV+KISN+GI+V
Sbjct  247   RSQVSNLASEAKRERNALAKEVSKISNYGIAV  278



>ref|XP_004514234.1| PREDICTED: uncharacterized protein LOC101491840 [Cicer arietinum]
Length=262

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 197/270 (73%), Gaps = 8/270 (3%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA + ESS    +  P+PV  S P      + +++      P+ID A+ QA   Q+    
Sbjct  1     MATVEESS--QPEKTPAPVNHSTPTTTQPQTLDVK------PFIDYAVGQALFYQKAFND  52

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              IES+I  + SR  +I +TSSAHF+QTL  L D K++Y  YEDL FG++KEG+ +AASHP
Sbjct  53    AIESSIEASTSRFSQIRSTSSAHFHQTLHYLDDFKSQYDAYEDLLFGKIKEGVLVAASHP  112

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             +IT GA  S+G L  KRPRR LYY  + +FVSEE+++S+A A+VKEL++SID LK+E EK
Sbjct  113   VITCGATASVGLLVFKRPRRMLYYNTKRLFVSEESLVSRASAEVKELRQSIDILKSEVEK  172

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
              EK+A+ AE++ + G+TKLRQAGKQIR+VI SA KIER+A GLKD+L ELP+REAS FRS
Sbjct  173   MEKSALHAEEQFLHGRTKLRQAGKQIRNVISSACKIERRAGGLKDILGELPKREASHFRS  232

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QVS LASEAK+E+N L KEV+KISN+GISV
Sbjct  233   QVSKLASEAKREKNSLNKEVSKISNYGISV  262



>emb|CDY37025.1| BnaA04g26030D [Brassica napus]
Length=279

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 189/256 (74%), Gaps = 4/256 (2%)
 Frame = -1

Query  1174  PPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLD  995
             PP P+  S+P  +   +    T+  AA WID+ ++QA   Q T+   ++S I  +KSRL 
Sbjct  28    PPHPLLSSIPSAKIATT----TVENAASWIDETMRQALVYQNTIVETLDSKIDASKSRLA  83

Query  994   RILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLG  815
             +I  TS AH +QT+DS++++ +EY++YE L F ++K+G+ +AASHPL++ G    +G   
Sbjct  84    QIRDTSIAHTSQTIDSIREIVSEYNVYEHLVFAKIKDGVNVAASHPLVSGGLAFGVGIFA  143

Query  814   LKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIR  635
             LK+ RRF+YY A  +F +EEA+LS+AD +VKEL++S+D L AESEK E+ A  AE ELIR
Sbjct  144   LKKTRRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIR  203

Query  634   GKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERN  455
             G+ KLRQAGKQIR V+ SAYKIE+QAAGLKDVLKELP REAS FRSQ+SN ASE K+ER 
Sbjct  204   GRMKLRQAGKQIRGVVNSAYKIEKQAAGLKDVLKELPTREASRFRSQISNRASEVKQERK  263

Query  454   FLTKEVTKISNHGISV  407
              LTKEV KISN+GISV
Sbjct  264   ALTKEVNKISNYGISV  279



>ref|XP_009142315.1| PREDICTED: uncharacterized protein LOC103866188 [Brassica rapa]
Length=279

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 189/256 (74%), Gaps = 4/256 (2%)
 Frame = -1

Query  1174  PPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLD  995
             PP P+  S+P  +   +    T+  AA WID+ ++QA   Q T+   ++S I  +KSRL 
Sbjct  28    PPHPLLSSIPSAKIATT----TVENAASWIDETMRQALVYQNTIVETLDSKIDASKSRLA  83

Query  994   RILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLG  815
             +I  TS AH +QT+DS++++ +EY++YE + F ++K+G+ +AASHPL++ G    +G   
Sbjct  84    QIRDTSIAHTSQTIDSIREIVSEYNVYEHMVFAKIKDGVNVAASHPLVSGGLAFGVGIFA  143

Query  814   LKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIR  635
             LK+ RRF+YY A  +F +EEA+LS+AD +VKEL++S+D L AESEK E+ A  AE ELIR
Sbjct  144   LKKTRRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIR  203

Query  634   GKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERN  455
             G+ KLRQAGKQIR V+ SAYKIE+QAAGLKDVLKELP REAS FRSQ+SN ASE K+ER 
Sbjct  204   GRMKLRQAGKQIRGVVNSAYKIEKQAAGLKDVLKELPTREASRFRSQISNRASEVKQERK  263

Query  454   FLTKEVTKISNHGISV  407
              LTKEV KISN+GISV
Sbjct  264   ALTKEVNKISNYGISV  279



>gb|EPS62058.1| hypothetical protein M569_12732, partial [Genlisea aurea]
Length=221

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 168/214 (79%), Gaps = 0/214 (0%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             T+   +E+ I  T+SRLDR LTT+S HF+QT +S QD K EYH YE +  G++KE   +A
Sbjct  8     TIANTVENTIEATRSRLDRFLTTASIHFDQTAESFQDFKFEYHKYEAVALGKIKESFVVA  67

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             +SHP +TTGA L LGF+ LK  R++ YY     FV+EE ++S+ADAKVK+LK+S D LK 
Sbjct  68    SSHPYLTTGAVLGLGFISLKGTRQYFYYNTLRFFVTEEKLVSRADAKVKQLKQSFDALKL  127

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             E EK EK A++AE++L+RG+TKL+QAGKQI++ I SAYKIERQA+GLKDVLK+LP  E+S
Sbjct  128   EGEKLEKRALEAEEDLLRGRTKLKQAGKQIQTAINSAYKIERQASGLKDVLKDLPSIESS  187

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              FR QV+NLA EAKKERN L+KEVTKISN+GISV
Sbjct  188   RFRKQVTNLAKEAKKERNALSKEVTKISNYGISV  221



>gb|KFK37300.1| hypothetical protein AALP_AA4G239300 [Arabis alpina]
Length=272

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 196/272 (72%), Gaps = 2/272 (1%)
 Frame = -1

Query  1216  MAIIAESSDEN-SKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTV  1043
             MA + ESS  +   A PS +  S+P Q   Y   +  T+  AA WIDDAL+QA   Q+T+
Sbjct  1     MATLGESSSSDMGDANPSEIPQSIPVQSPEYPKISTTTVENAASWIDDALRQAMIYQKTI  60

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
                ++S I  +KSRL +I  TS AH +QT+DSL+++ +EY +YE + FG++K+G+ +AAS
Sbjct  61    SDTLDSTIDASKSRLTQIRDTSIAHTSQTIDSLREIASEYSVYEHMVFGKIKDGVNVAAS  120

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             +P+++      +G   LK+ RRF+Y+    + +SEEA+ S+AD KVKEL++S+D L AES
Sbjct  121   YPVLSGALAFGVGIFALKKTRRFVYHNTLRMVMSEEALFSRADLKVKELRQSMDRLIAES  180

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
             +K E+ A  AE+E IRG+ KLRQAGKQI   IRSAYKIE+QAAGLKDVLKELP REAS F
Sbjct  181   DKLERVATVAEEEFIRGRLKLRQAGKQIHGAIRSAYKIEKQAAGLKDVLKELPTREASRF  240

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             R+Q+SN ASE K+ERN +TKEV KISN+GISV
Sbjct  241   RTQISNRASEVKQERNAMTKEVNKISNYGISV  272



>ref|XP_008459726.1| PREDICTED: uncharacterized protein LOC103498769 [Cucumis melo]
Length=265

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 186/238 (78%), Gaps = 2/238 (1%)
 Frame = -1

Query  1120  NLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQ  941
             +LE LA+  PW + A QQA   Q+ ++  +ESAI  +KSRL +I +TS  HF + +DS  
Sbjct  30    SLEDLAK--PWAEYAAQQALLYQRAIDHSLESAIEASKSRLSQIRSTSYPHFQKAIDSFW  87

Query  940   DVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVS  761
             + K+E   YE+L FG++++GI +AASHPLI+ G    +GFL  K+PR FLYYK   +F++
Sbjct  88    EAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRSFLYYKTVRLFMN  147

Query  760   EEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRS  581
             EE++LSKADAKVKEL++SID +K ESE+ EK  +QAE+ELIRG+TKLRQAGKQI  VI+S
Sbjct  148   EESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEEELIRGRTKLRQAGKQIEGVIQS  207

Query  580   AYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             A+KIER+A GLKD+L +LP REAS FR+QVSNLASEAKKER  L+KEV+KISN+GISV
Sbjct  208   AHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSKEVSKISNYGISV  265



>ref|XP_009133693.1| PREDICTED: uncharacterized protein LOC103858149 [Brassica rapa]
Length=275

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 196/275 (71%), Gaps = 5/275 (2%)
 Frame = -1

Query  1216  MAIIAESSDE--NSKAPPSP-VAPSLPRQRGNYSDNL--ETLAQAAPWIDDalqqarqaq  1052
             MA  AESS E  ++ +P  P  +PS P      S N+   T+  AA WIDDA++QA   Q
Sbjct  1     MAASAESSSEMEDAHSPTIPQSSPSQPLLSTIPSANIAATTVENAASWIDDAMRQALVYQ  60

Query  1051  QTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICI  872
              T+   + S I  +++RL +I  TS AH +QT+DSL+++ +EY +YE + F ++KEG+ +
Sbjct  61    NTIVETLNSTIDASRTRLSQIRDTSIAHTSQTIDSLREIASEYSVYEHMVFTKIKEGVNV  120

Query  871   AASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLK  692
             AASHPLI+      +G   LK+ RRF+YY    +F SEEA+LS+AD +VKEL++S+D L 
Sbjct  121   AASHPLISGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLT  180

Query  691   AESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREA  512
             AESEK E+ +  AE ELIRG+ KLRQAGKQIR V++SAYKIE QAAGLKD+LKELP REA
Sbjct  181   AESEKLERISTVAEDELIRGRMKLRQAGKQIRGVVQSAYKIENQAAGLKDLLKELPTREA  240

Query  511   SLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             S FRSQ+SN ASE K+ER  LTKEV KISN+GISV
Sbjct  241   SRFRSQISNRASEIKQERKALTKEVNKISNYGISV  275



>ref|XP_010506444.1| PREDICTED: uncharacterized protein LOC104783057 isoform X2 [Camelina 
sativa]
Length=267

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 191/271 (70%), Gaps = 5/271 (2%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  + ESS E + A P  +  S P     Y      T+  AA WIDDAL+QA   Q+T+ 
Sbjct  1     MRTLGESSSEMNDANPPAIPQSSPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTIT  60

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++S I  +K+RL +I  TS AH +QTLDSL+++ +EY++YE + FG++K+G+ +AASH
Sbjct  61    ETLDSTIDASKARLSQIRDTSVAHTSQTLDSLREIASEYNVYEQMVFGKIKDGVNVAASH  120

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P+I+      +G   LK+ RR +YY    +F    A+LS+AD KVKEL++S+D L A+SE
Sbjct  121   PVISGTLAFGVGIFALKKTRRLVYYNTVRMF----ALLSRADLKVKELRQSMDRLTAQSE  176

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K E+ A  AE+ELIRG+ KLRQAGKQIR  I SAYKIE+QAAGLKDVLKELP REAS FR
Sbjct  177   KLERVATMAEEELIRGRMKLRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPSREASRFR  236

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             SQ+SN ASE K+ERN LTKEV KISN+GISV
Sbjct  237   SQISNRASEVKQERNALTKEVNKISNYGISV  267



>gb|KDO85659.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=237

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 172/248 (69%), Gaps = 15/248 (6%)
 Frame = -1

Query  1216  MAIIAESSDE---NSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQT  1046
             MA + ESS++   N  A    V  S   + GN            PWID+A+QQ    ++ 
Sbjct  1     MATVTESSEDEKPNVAAASDTVFKSQSLEDGN------------PWIDNAVQQVMIYRKI  48

Query  1045  VETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAA  866
             VE  I+SAI  ++SRL +   T+S HF QTLD LQDVK+EY  YED   G++KEGI +AA
Sbjct  49    VEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHVAA  108

Query  865   SHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAE  686
             SHP IT G  + LG   LKRPR FLYY    +F SEE++LS+AD KVK+L++SID LKAE
Sbjct  109   SHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLKAE  168

Query  685   SEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASL  506
             SEK EK A+ AE ELIRG+TKLRQAGKQI+ VI SAYKIERQAAGLKD++ ELPRREAS 
Sbjct  169   SEKLEKVALVAEDELIRGRTKLRQAGKQIQGVINSAYKIERQAAGLKDIVGELPRREASR  228

Query  505   FRSQVSNL  482
             FRSQVS L
Sbjct  229   FRSQVSFL  236



>emb|CDX83410.1| BnaA03g20960D [Brassica napus]
Length=223

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             T+   ++S I  +++RL ++  TS AH +QT+DSL+++ +EY +YE++ F ++KEG+ +A
Sbjct  10    TIVETLDSTINASRTRLSQLRDTSKAHTSQTIDSLREIASEYSVYENMVFAKIKEGVNVA  69

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             ASHPLI+      +G   LK+ RRF+YY    +F SEEA+LS+AD +VKEL++S+D L A
Sbjct  70    ASHPLISGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTA  129

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ESEK E+ +  AE ELIRG+ KLRQAGKQIR V++SAYKIE QA GLKDVLKELP REAS
Sbjct  130   ESEKLERISTVAEDELIRGRMKLRQAGKQIRGVVQSAYKIENQAEGLKDVLKELPTREAS  189

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              FRSQ+SN ASE K+ER  LTKEV KISN+GISV
Sbjct  190   RFRSQISNRASEIKQERKALTKEVNKISNYGISV  223



>emb|CDX95625.1| BnaC03g25060D [Brassica napus]
Length=371

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 191/273 (70%), Gaps = 3/273 (1%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNL--ETLAQAAPWIDDalqqarqaqQTV  1043
             MA  AESS E   A    +  S P      S N+   T+  AA WIDDA++QA   Q T+
Sbjct  99    MAASAESSSEMEDAHSPTIPQSQPLLSTIPSANIAATTVENAASWIDDAMRQALVYQNTI  158

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
                ++S I  +++RL +I  TS AH +QT+DSL+++ +E+ +YE + F ++KEG+ +AAS
Sbjct  159   VETLDSTIDASRTRLSQIRDTSIAHTSQTIDSLREIASEFSVYEHMVFAKIKEGVNVAAS  218

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HPL++      +G   LK+ RRF+YY    +F SEEA+LS+AD +VKEL++S+D L AES
Sbjct  219   HPLMSGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTAES  278

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGL-KDVLKELPRREASL  506
             EK E+ +  AE ELIRG+ KLRQAGKQIR V++SAYKIE QAAG+ + VLKELP REAS 
Sbjct  279   EKLERISTVAEDELIRGRMKLRQAGKQIRGVVQSAYKIENQAAGMFERVLKELPTREASR  338

Query  505   FRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             FRSQ+SN ASE K+ER  LTKEV KISN+GISV
Sbjct  339   FRSQISNSASEIKQERKALTKEVNKISNYGISV  371



>ref|XP_010692135.1| PREDICTED: uncharacterized protein LOC104905332 [Beta vulgaris 
subsp. vulgaris]
Length=266

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 174/244 (71%), Gaps = 2/244 (1%)
 Frame = -1

Query  1132  NYS--DNLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQ  959
             NYS    L++L Q  PWI  A+QQA  AQ+TVE   +S I+   SR  R  +T SAHF Q
Sbjct  23    NYSVEKALKSLEQTNPWIQQAIQQAVIAQKTVEQTFDSTISAAHSRFSRFRSTGSAHFQQ  82

Query  958   TLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKA  779
             T++S++DVKAE+ +YE   F ++KEG  +AASHP I TGA   LGFL LK PRRFLYY+ 
Sbjct  83    TIESVKDVKAEFDVYEAKFFAKVKEGAFMAASHPFIATGAATGLGFLALKGPRRFLYYRT  142

Query  778   RSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQI  599
               +F +EEA+L++ADAKVKELK+S    KAE+EK EK A  AE+E+ RG+TKLR AG QI
Sbjct  143   LRLFSTEEALLARADAKVKELKQSFQSFKAETEKLEKRASMAEEEMKRGRTKLRHAGNQI  202

Query  598   RSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNH  419
             R  + SA KI++QA GLKD+L +LP  E+S F SQ+  + +EA +ER  L KEVTKISN+
Sbjct  203   RKAVLSADKIDKQARGLKDILADLPSAESSRFNSQIKKVVAEANQERKVLAKEVTKISNY  262

Query  418   GISV  407
             GIS+
Sbjct  263   GISI  266



>ref|XP_004140609.1| PREDICTED: uncharacterized protein LOC101214960 [Cucumis sativus]
Length=284

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 186/258 (72%), Gaps = 23/258 (9%)
 Frame = -1

Query  1120  NLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQ  941
             +LE LA+  PW + A QQA   Q+ ++  +ESAI V+KSRL +I +TS  HF + +DS  
Sbjct  30    SLEDLAK--PWAEYAAQQALLYQRAIDHSLESAIEVSKSRLSQIRSTSFPHFQKAVDSFW  87

Query  940   DVKAEYHLYEDLTFGRMKEGI-----C---------------IAASHPLITTGAFLSLGF  821
             + K+E   YE+L FG+++ G+     C               +AASHPLI+ G    +GF
Sbjct  88    EAKSELAAYENLVFGKIR-GLFLIYHCDGKLTLPSFVFSFSFVAASHPLISCGVATGMGF  146

Query  820   LGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQEL  641
             L  K+PR FLYYK   +FV+EE++LSKADAKVKEL++SID +K ESE+ EK  +QAE EL
Sbjct  147   LVFKKPRNFLYYKTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDEL  206

Query  640   IRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKE  461
             IRG+TKLRQAGKQI  VI+SA+KIER+A GLKD+L +LP REAS FR+QVSNLASEAKKE
Sbjct  207   IRGRTKLRQAGKQIEGVIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKE  266

Query  460   RNFLTKEVTKISNHGISV  407
             R  L+KEV+KISN+GISV
Sbjct  267   RIGLSKEVSKISNYGISV  284



>ref|XP_004306965.1| PREDICTED: uncharacterized protein LOC101308610 [Fragaria vesca 
subsp. vesca]
Length=274

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 138/267 (52%), Positives = 186/267 (70%), Gaps = 3/267 (1%)
 Frame = -1

Query  1198  SSDENSKAPPSPVAPSLP--RQRGNYSDNLETLAQA-APWIDDalqqarqaqQTVETVIE  1028
             SS EN    P+  +P  P      ++S + ETL Q   PWID A+ QAR  Q+ +E  + 
Sbjct  8     SSPENPIFSPTDSSPEKPIFSPTDSFSHSTETLDQPPTPWIDYAIAQARVYQKNIEETLN  67

Query  1027  SAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLIT  848
             SA+  ++SRL +   T SAH +QT+D ++DVK  Y  YE+    +++EG  +AASHPLIT
Sbjct  68    SALEASRSRLSQFRATGSAHLSQTIDLVEDVKTNYADYENTFLAKIREGASVAASHPLIT  127

Query  847   TGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEK  668
              G   +LG + LK PRRFLYYK+  + +SEE++L++A  +VKEL+ +ID LKAES+K E 
Sbjct  128   GGVATALGLVVLKGPRRFLYYKSLRLLMSEESLLNRAHIEVKELRHAIDVLKAESQKLEI  187

Query  667   NAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVS  488
              A  AE E I+G+ KLR AG+QI+S I + YKIERQA GLKD+++ELPRREASLFR +V+
Sbjct  188   RAANAENEFIQGRKKLRYAGQQIQSAIGTGYKIERQARGLKDIIRELPRREASLFRDRVT  247

Query  487   NLASEAKKERNFLTKEVTKISNHGISV  407
             NL  EAK+ER  L+KEV KISN+GISV
Sbjct  248   NLVDEAKQERKALSKEVRKISNYGISV  274



>ref|XP_007052190.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX96347.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=290

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 191/267 (72%), Gaps = 6/267 (2%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLET--LAQAAPWIDDalqqarqaqQTV  1043
             MA ++ES +++    P+  AP+      +Y    E+  L QA PWID A++QA   Q+ +
Sbjct  15    MATVSESPEDSPN--PNSPAPTPLPPPSDYPSKSESKVLEQATPWIDYAVEQALLYQKII  72

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
             E  I + I  ++SRL    +TS+AHFNQT+DSL+DVK++  +YE++ FG++KEGI IAAS
Sbjct  73    EQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVYENMMFGKVKEGIKIAAS  132

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP+IT G  + LG L LKRPRRFLYY    +FVSEE+ LSKAD +VKEL++SID LK ES
Sbjct  133   HPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTES  192

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
              K E++A  AE++LIRG+ KLR AGKQI+SVI SAYKIERQAAGLKD+L ELP REAS F
Sbjct  193   VKLERSASVAEEDLIRGRKKLRHAGKQIQSVIHSAYKIERQAAGLKDILGELPSREASRF  252

Query  502   RSQVS--NLASEAKKERNFLTKEVTKI  428
             RSQVS  N++ +A   + ++   + K+
Sbjct  253   RSQVSFLNISMQALCLKIYIASAIMKL  279



>ref|XP_004171485.1| PREDICTED: uncharacterized LOC101214960, partial [Cucumis sativus]
Length=186

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -1

Query  964  NQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYY  785
             + +DS  + K+E   YE+L FG++++GI +AASHPLI+ G    +GFL  K+PR FLYY
Sbjct  1    QKAVDSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRNFLYY  60

Query  784  KARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGK  605
            K   +FV+EE++LSKADAKVKEL++SID +K ESE+ EK  +QAE ELIRG+TKLRQAGK
Sbjct  61   KTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTKLRQAGK  120

Query  604  QIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKIS  425
            QI  VI+SA+KIER+A GLKD+L +LP REAS FR+QVSNLASEAKKER  L+KEV+KIS
Sbjct  121  QIEGVIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSKEVSKIS  180

Query  424  NHGISV  407
            N+GISV
Sbjct  181  NYGISV  186



>gb|KGN46560.1| hypothetical protein Csa_6G108580 [Cucumis sativus]
Length=209

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            DS  + K+E   YE+L FG++++GI +AASHPLI+ G    +GFL  K+PR FLYYK   
Sbjct  28   DSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRNFLYYKTIR  87

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRS  593
            +FV+EE++LSKADAKVKEL++SID +K ESE+ EK  +QAE ELIRG+TKLRQAGKQI  
Sbjct  88   LFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTKLRQAGKQIEG  147

Query  592  VIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
            VI+SA+KIER+A GLKD+L +LP REAS FR+QVSNLASEAKKER  L+KEV+KISN+GI
Sbjct  148  VIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSKEVSKISNYGI  207

Query  412  SV  407
            SV
Sbjct  208  SV  209



>ref|XP_011033296.1| PREDICTED: uncharacterized protein LOC105131821, partial [Populus 
euphratica]
Length=217

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 161/214 (75%), Gaps = 7/214 (3%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
              ++  +++AI  +KSR   I +TS AHF+QT+       +E  +YE   FG++KE I +A
Sbjct  11    NIQDSLDTAIEASKSRFSEITSTSQAHFSQTI-------SEIGVYEGKLFGKVKEEINVA  63

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             ASHPLIT+   + LG +  KRPR+ LYYK   +  SEEA+LS+ADAKVKEL++SI  LKA
Sbjct  64    ASHPLITSAVAVGLGLVAHKRPRQILYYKTLRLLTSEEALLSQADAKVKELQQSISLLKA  123

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ESE  ++ A  AE+ELIRG+TKLRQAGKQI+ VI SAYKIERQA GL+D+L ELPR +AS
Sbjct  124   ESENSKRRASLAEEELIRGRTKLRQAGKQIQGVICSAYKIERQAMGLRDILGELPRADAS  183

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              F+SQVS+LASEAK+ERN L+K +TKISN+ ISV
Sbjct  184   RFQSQVSSLASEAKQERNALSKMITKISNYRISV  217



>ref|XP_006838189.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
 gb|ERN00758.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
Length=263

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -1

Query  1093  PWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLY  914
             PWI+ A+Q+A   ++T+    +SA+  T+SRL  I  TSSAHF Q  ++L DVK +Y  Y
Sbjct  35    PWIEYAVQEAESIKKTLMEATDSALEATRSRLFDIHATSSAHFYQAKEALLDVKTKYSEY  94

Query  913   EDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKAD  734
             ED  FG++KEG+ IAASHP +  G  +  G L +KRPRR+L+   + +FVSEE+ML+ A+
Sbjct  95    EDSMFGKVKEGLLIAASHPSLACGVAVGSGVLIMKRPRRYLFNSVQRLFVSEESMLASAE  154

Query  733   AKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAA  554
             AKVKEL++SI+ +K ES+K E+ A  AE+E+ RG+TKLR AG QI++ I SAYKIE+QA 
Sbjct  155   AKVKELRQSIELVKNESKKLEERARLAEEEMRRGQTKLRHAGHQIQTAIHSAYKIEKQAR  214

Query  553   GLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             GLKD+L ELPRREAS FRSQVS +ASEAK+ER+ L KEVTKI+N+GI +
Sbjct  215   GLKDILGELPRREASRFRSQVSKMASEAKRERDALGKEVTKITNYGIPI  263



>gb|KCW78323.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=270

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 166/220 (75%), Gaps = 4/220 (2%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTL----DS  947
             +++  A PW+D A+ QAR  ++ VE  + S    ++SRL +I +T++AH   T+    D+
Sbjct  29    KSIGDATPWVDYAVDQARLLRKGVEDDVGSFAEASRSRLAQIRSTAAAHTMMTVAMIQDT  88

Query  946   LQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIF  767
              Q+VK++Y  YED+ FG++K GI IAAS+P++T G     GF+ LKRPRRFLYY    + 
Sbjct  89    FQEVKSKYDAYEDIFFGKVKGGIEIAASNPMLTAGVVTGSGFIVLKRPRRFLYYNTLRLL  148

Query  766   VSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVI  587
             +SEE+MLS+ADAKVKEL+KSID LKAESEK E+ A  AE+E++RG+TKLRQAGKQI+SV 
Sbjct  149   MSEESMLSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTKLRQAGKQIQSVS  208

Query  586   RSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAK  467
              SAYKIERQAAGLKDV++ELPRREAS FRSQVS L S  K
Sbjct  209   HSAYKIERQAAGLKDVIRELPRREASRFRSQVSFLHSREK  248



>ref|XP_009631125.1| PREDICTED: uncharacterized protein LOC104120950 [Nicotiana tomentosiformis]
Length=191

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 147/186 (79%), Gaps = 8/186 (4%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQA----APWIDDalqqarqaqQ  1049
             M  IAESS+ N+ +P +    SLP  R  + +   T+ Q      PWID+A+QQA+ AQ+
Sbjct  1     MVAIAESSEANADSPST----SLPADRVKHEEKSHTVGQGLGEFVPWIDNAVQQAQLAQK  56

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TVE+ +E+AI VTKSRLDRILTTSSAHFNQTLDSLQD+K+EY +YEDL FG+++EG+ +A
Sbjct  57    TVESTLENAIVVTKSRLDRILTTSSAHFNQTLDSLQDLKSEYSVYEDLVFGKIREGLLLA  116

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             ASHPL TTGA L +G LGLKRPRRFLYY A  +FVSEEA+LS+ADAKVKEL+KSIDFLKA
Sbjct  117   ASHPLTTTGAVLGVGVLGLKRPRRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFLKA  176

Query  688   ESEKWE  671
             ES K E
Sbjct  177   ESAKLE  182



>gb|KDO85660.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=217

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 153/226 (68%), Gaps = 15/226 (7%)
 Frame = -1

Query  1216  MAIIAESSDE---NSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQT  1046
             MA + ESS++   N  A    V  S   + GN            PWID+A+QQ    ++ 
Sbjct  1     MATVTESSEDEKPNVAAASDTVFKSQSLEDGN------------PWIDNAVQQVMIYRKI  48

Query  1045  VETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAA  866
             VE  I+SAI  ++SRL +   T+S HF QTLD LQDVK+EY  YED   G++KEGI +AA
Sbjct  49    VEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHVAA  108

Query  865   SHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAE  686
             SHP IT G  + LG   LKRPR FLYY    +F SEE++LS+AD KVK+L++SID LKAE
Sbjct  109   SHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLKAE  168

Query  685   SEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGL  548
             SEK EK A+ AE ELIRG+TKLRQAGKQI+ VI SAYKIERQAAG+
Sbjct  169   SEKLEKVALVAEDELIRGRTKLRQAGKQIQGVINSAYKIERQAAGM  214



>ref|XP_006375267.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53064.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=259

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 152/205 (74%), Gaps = 7/205 (3%)
 Frame = -1

Query  1102  QAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEY  923
             + APWID+A+QQA   Q+ ++  +++AI  +KSR   I +TS AHF+QT+       +E 
Sbjct  41    ETAPWIDNAMQQALIYQKNIQYSLDTAIEASKSRFSEITSTSQAHFSQTI-------SEI  93

Query  922   HLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLS  743
              +YE   FG++KE I +AASHPLIT+   + LG + LKRPR+ LYYK   +F SEEA+LS
Sbjct  94    GVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEEALLS  153

Query  742   KADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIER  563
             +ADAKVKEL++SI  LKAESE  ++ A  AE+ELIRG+TKLRQAGKQI+ VI SAYKIE 
Sbjct  154   QADAKVKELQQSISLLKAESENLKRRASLAEEELIRGRTKLRQAGKQIQGVICSAYKIEI  213

Query  562   QAAGLKDVLKELPRREASLFRSQVS  488
             QA GL+D+L ELPR +AS F+SQVS
Sbjct  214   QATGLRDILGELPRADASRFQSQVS  238



>ref|XP_007221158.1| hypothetical protein PRUPE_ppa020296mg, partial [Prunus persica]
 gb|EMJ22357.1| hypothetical protein PRUPE_ppa020296mg, partial [Prunus persica]
Length=116

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -1

Query  754  AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
            ++LS+ADAKVKEL+ SID LKAE EK EK A  AE+ELIRG+TKLRQ GKQI SVIRSAY
Sbjct  1    SLLSRADAKVKELRHSIDLLKAEGEKLEKRASHAEEELIRGRTKLRQTGKQIESVIRSAY  60

Query  574  KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            KIERQAAGLKD+L ELPRREAS+FRSQVS LA+EAK+ERN LTKEVTKISN+GISV
Sbjct  61   KIERQAAGLKDILGELPRREASMFRSQVSKLATEAKQERNALTKEVTKISNYGISV  116



>ref|XP_010934947.1| PREDICTED: uncharacterized protein LOC105054975 isoform X1 [Elaeis 
guineensis]
Length=261

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 158/255 (62%), Gaps = 12/255 (5%)
 Frame = -1

Query  1177  APPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRL  998
              PP    PS  R  G          + + W++ A+QQA   ++T+    ++A    +S L
Sbjct  17    GPP----PSAARGGG--------AGEVSQWVEYAVQQALDLKKTLGDATDAAFGAAESSL  64

Query  997   DRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFL  818
                ++ S +   +    ++ VK +Y + E+L FG++KEG+ +AASHP ++ G   + G +
Sbjct  65    VHAVSASKSSLQEARGMMEWVKGQYTVGEELVFGKIKEGVIVAASHPSLSLGIAGTAGLV  124

Query  817   GLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELI  638
               KRPRRF+ +  R IFVS E++LS A AKV EL++S++ +K ES+K E+ A++AE+E+ 
Sbjct  125   LFKRPRRFVIWNVRRIFVSNESLLSDAQAKVNELRQSVNLVKNESKKLEERALKAEEEMR  184

Query  637   RGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKER  458
              G+ KL + G+ IR+ +R   KIE++AA LKDV+ ELP  EAS +RS+VS L S+ KKE+
Sbjct  185   EGRMKLIEEGRGIRNELRYVNKIEKKAADLKDVINELPIGEASRYRSEVSTLVSQVKKEK  244

Query  457   NFLTKEVTKISNHGI  413
               L+   +KI N+GI
Sbjct  245   KALSGAFSKIINYGI  259



>ref|XP_006294795.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27693.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=207

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 134/201 (67%), Gaps = 1/201 (0%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSD-NLETLAQAAPWIDDalqqarqaqQTVE  1040
             M  + ESS E + A    +  S P     Y      T+  AA WIDDAL+QA   Q+T+ 
Sbjct  1     MTTLGESSSEMNDANQPAIPQSAPVHPPEYQKIATTTVENAASWIDDALRQALVYQKTIT  60

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
               ++S I  +K+RL +I  TS AH +QT+DSL+++ +EY++YE + FG++K+G+ +AASH
Sbjct  61    ETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNVAASH  120

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             PLI+      +G   LK+ RRF+YY    +F+SEEA+LS+AD KVKEL++S+D L AESE
Sbjct  121   PLISGTLAFGVGIFALKKTRRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLTAESE  180

Query  679   KWEKNAVQAEQELIRGKTKLR  617
             K ++ A  AE+ELIRG+ KLR
Sbjct  181   KLQRVATVAEEELIRGRMKLR  201



>emb|CAN64905.1| hypothetical protein VITISV_042831 [Vitis vinifera]
Length=587

 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 139/249 (56%), Gaps = 68/249 (27%)
 Frame = -1

Query  1099  AAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTL-----------  953
             A+ WI+  + QA+   +T++  + S I  + SR  +IL+TSSAH  QT+           
Sbjct  332   ASSWIEYGVNQAQLLHKTLDDTVNSFIEASGSRFSQILSTSSAHLQQTIIIGKKFQNFDF  391

Query  952   -------------------------------DSLQDVKAEYHLYEDLTFGRMKEGICIAA  866
                                            +SL+DVK+EY +YEDL  G+         
Sbjct  392   FHFPTLSRQXYGEFLMFCQVVGFEPVDGGIEESLKDVKSEYDVYEDLAVGK---------  442

Query  865   SHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAE  686
                              +K PR FLYY    + VSEE+M+++ADAKV EL+KSID LKAE
Sbjct  443   -----------------IKGPRHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAE  485

Query  685   SEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASL  506
             SEK EK A+QAE E+ RG+TKLRQAG QI+SVIRSAYKIERQA GLKD+L ELP REAS 
Sbjct  486   SEKLEKRALQAEDEMKRGRTKLRQAGNQIQSVIRSAYKIERQARGLKDILGELPSREASR  545

Query  505   FRSQVSNLA  479
             FRSQV  L 
Sbjct  546   FRSQVPELT  554



>gb|KHN41331.1| hypothetical protein glysoja_049618 [Glycine soja]
Length=118

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  757  EAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSA  578
            ++M+S+A A+VKEL++SI+ LKAE EK EK+A+ AE++ + G+TKLR AGKQIR+VI+SA
Sbjct  2    QSMISRAHAEVKELRQSIELLKAEGEKLEKSALHAEEQFLHGRTKLRHAGKQIRNVIQSA  61

Query  577  YKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            YKIE +A GLKD+L ELP+RE SLFRSQVS LASEAKKE+N ++KE++KISN+GISV
Sbjct  62   YKIEIRAGGLKDILGELPKRETSLFRSQVSKLASEAKKEKNTMSKEISKISNYGISV  118



>ref|XP_007140975.1| hypothetical protein PHAVU_008G156600g [Phaseolus vulgaris]
 gb|ESW12969.1| hypothetical protein PHAVU_008G156600g [Phaseolus vulgaris]
Length=180

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 120/182 (66%), Gaps = 9/182 (5%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA +AES +  S+  P    PSL   + N   +L+T  +  P+ID A  QA+   Q    
Sbjct  1     MATVAESPE--SETHP----PSLDYSKTN---SLQTFNETTPFIDYATAQAQLYHQAFND  51

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              ++S I   KSR  +I +TS AHFNQTLDSL D+K++Y+ YEDL FG++KEG+ +AAS P
Sbjct  52    GVDSTIDAAKSRFAQIRSTSYAHFNQTLDSLDDLKSQYNAYEDLLFGKIKEGVLVAASRP  111

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             LIT GA  +LG   LKRPRR LYY    +F+ EE+M+S+A A+VKEL++SI  LKAE EK
Sbjct  112   LITCGAAAALGLTVLKRPRRDLYYNTLRLFLKEESMISRAHAEVKELRQSIQLLKAEGEK  171

Query  676   WE  671
              E
Sbjct  172   LE  173



>ref|XP_008796934.1| PREDICTED: uncharacterized protein LOC103712238 isoform X2 [Phoenix 
dactylifera]
Length=244

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 135/203 (67%), Gaps = 0/203 (0%)
 Frame = -1

Query  1090  WIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYE  911
             W++ A++QA   ++T+    ++ +   +SRL   ++ S +   +    ++ V+ +Y + E
Sbjct  41    WVEYAVRQALDVKKTLGDATDATLRAAESRLVHAVSASKSSLQEARGMMEWVQGQYAVGE  100

Query  910   DLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADA  731
             +L FG++KEG+ +A+SHP ++ G   + G +  KRPRRFL +  R IFVS E++LS A A
Sbjct  101   ELVFGKIKEGVIVASSHPNLSLGIAGTAGLVLFKRPRRFLIWNVRRIFVSNESLLSDAQA  160

Query  730   KVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAG  551
              V EL++S++ +K ES+K E+ A++AEQE+  G+ KL + G+ IR+ +R   KIER+A+ 
Sbjct  161   NVNELRQSVNLVKNESKKLEERALKAEQEMREGRMKLIEEGRGIRNELRYVNKIERKASD  220

Query  550   LKDVLKELPRREASLFRSQVSNL  482
             LKDV+ ELP  EAS +RS+VS L
Sbjct  221   LKDVINELPIGEASRYRSEVSFL  243



>ref|XP_010934948.1| PREDICTED: uncharacterized protein LOC105054975 isoform X2 [Elaeis 
guineensis]
Length=246

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 135/206 (66%), Gaps = 0/206 (0%)
 Frame = -1

Query  1105  AQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAE  926
              + + W++ A+QQA   ++T+    ++A    +S L   ++ S +   +    ++ VK +
Sbjct  29    GEVSQWVEYAVQQALDLKKTLGDATDAAFGAAESSLVHAVSASKSSLQEARGMMEWVKGQ  88

Query  925   YHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAML  746
             Y + E+L FG++KEG+ +AASHP ++ G   + G +  KRPRRF+ +  R IFVS E++L
Sbjct  89    YTVGEELVFGKIKEGVIVAASHPSLSLGIAGTAGLVLFKRPRRFVIWNVRRIFVSNESLL  148

Query  745   SKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIE  566
             S A AKV EL++S++ +K ES+K E+ A++AE+E+  G+ KL + G+ IR+ +R   KIE
Sbjct  149   SDAQAKVNELRQSVNLVKNESKKLEERALKAEEEMREGRMKLIEEGRGIRNELRYVNKIE  208

Query  565   RQAAGLKDVLKELPRREASLFRSQVS  488
             ++AA LKDV+ ELP  EAS +RS+ +
Sbjct  209   KKAADLKDVINELPIGEASRYRSEFN  234



>ref|XP_008796933.1| PREDICTED: uncharacterized protein LOC103712238 isoform X1 [Phoenix 
dactylifera]
Length=245

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 135/204 (66%), Gaps = 1/204 (0%)
 Frame = -1

Query  1090  WIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYE  911
             W++ A++QA   ++T+    ++ +   +SRL   ++ S +   +    ++ V+ +Y + E
Sbjct  41    WVEYAVRQALDVKKTLGDATDATLRAAESRLVHAVSASKSSLQEARGMMEWVQGQYAVGE  100

Query  910   DLTFGRMKEGICIAASHPLITTGAFLSLGFLGLK-RPRRFLYYKARSIFVSEEAMLSKAD  734
             +L FG++KEG+ +A+SHP ++ G   + G +  K RPRRFL +  R IFVS E++LS A 
Sbjct  101   ELVFGKIKEGVIVASSHPNLSLGIAGTAGLVLFKSRPRRFLIWNVRRIFVSNESLLSDAQ  160

Query  733   AKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAA  554
             A V EL++S++ +K ES+K E+ A++AEQE+  G+ KL + G+ IR+ +R   KIER+A+
Sbjct  161   ANVNELRQSVNLVKNESKKLEERALKAEQEMREGRMKLIEEGRGIRNELRYVNKIERKAS  220

Query  553   GLKDVLKELPRREASLFRSQVSNL  482
              LKDV+ ELP  EAS +RS+VS L
Sbjct  221   DLKDVINELPIGEASRYRSEVSFL  244



>ref|XP_009787718.1| PREDICTED: uncharacterized protein LOC104235612 [Nicotiana sylvestris]
Length=249

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 130/214 (61%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TV+   +SA+   +S    I  TSS H     D +  +KA+Y  YE++ F ++K+ +  A
Sbjct  40    TVQESTDSALRSARS----IQYTSSTHLRTLQDFMPKIKAQYTTYEEVFFRKIKDELVTA  95

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               HP +  G  ++ G L ++ PRRFL+ +      SEEA  SKA+  VKEL  S+D +K 
Sbjct  96    REHPAMAGGIGIAAGLLLMRGPRRFLFRQTLGRLQSEEAKFSKAEKNVKELSLSVDLMKK  155

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K  + A  AE+++ RG + L  AG QI+S+ ++ YK+E QAA L DVL+E+P REA 
Sbjct  156   ESKKLLERAALAEKDMKRGLSDLMDAGNQIQSIGKTVYKVEAQAADLMDVLREIPGREAL  215

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R++V+++AS  +++R  + K + K+S  G+ +
Sbjct  216   KLRAEVASMASHLRQQRTAIDKRIVKVSELGVPI  249



>ref|XP_009385849.1| PREDICTED: uncharacterized protein LOC103973101 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 126/212 (59%), Gaps = 0/212 (0%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             +V    +SA     S L RI++ SS    +    +   K  Y   E++   ++K+GI  A
Sbjct  68    SVTAAADSAFQSVGSVLSRIVSDSSESLEEAKVKIAWAKDHYAAAEEVALAKIKDGIVDA  127

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
             A HP ++ G    LG + LK PRRFL    R IFVSEE+MLS A  KVKEL++S++ +  
Sbjct  128   ALHPALSCGIAAGLGLVLLKGPRRFLIRNTRRIFVSEESMLSSAQVKVKELQQSVNLVTN  187

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K E  A +A +++ RG+ +L + G QI+  +  A  IERQ   LK  L ELP+ +AS
Sbjct  188   ESKKLEDRATRAVEDMKRGQKRLIEEGHQIQKQLNFAAGIERQIMSLKGRLNELPKADAS  247

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
              ++SQVS ++S+ K+E+  L   +++I NHGI
Sbjct  248   RYQSQVSTISSQIKQEKKALNGALSRIINHGI  279



>ref|XP_001760783.1| predicted protein [Physcomitrella patens]
 gb|EDQ74522.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   149 bits (377),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 128/215 (60%), Gaps = 7/215 (3%)
 Frame = -1

Query  1030  ESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLI  851
             + A+   + ++D++   SS  F          K EY  YE L F ++KEG+ IA  +P  
Sbjct  99    DEALRTARVQIDQLQDASSQQFAAAQKLADRAKQEYTHYEGLVFKKLKEGVNIAVQNPNA  158

Query  850   TTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWE  671
             T G       L L+ PRR LY      F SEEAML++A+ KVKE+ +++D LK E++K E
Sbjct  159   TFGILGVTTLLALRTPRRLLYRYTIGQFRSEEAMLTRAETKVKEMHQTVDSLKNETKKLE  218

Query  670   KNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQ-  494
             + A  AE+E +RG TKL+ +G QI S+ R AYK E  A GL D L++LP REA   R++ 
Sbjct  219   ERAKLAEEEFLRGMTKLKNSGSQISSLSRGAYKTESSARGLMDSLRDLPGREALRLRAEG  278

Query  493   ------VSNLASEAKKERNFLTKEVTKISNHGISV  407
                   V+++ASE K++RN L K V++I+++ + +
Sbjct  279   YDYDALVASMASEVKQQRNLLDKRVSQIASYALKI  313



>ref|XP_004228972.1| PREDICTED: uncharacterized protein LOC101267925 [Solanum lycopersicum]
Length=233

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 125/214 (58%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TV+    SAI   +S    I  TSS H     D +  +K +Y  YE++ F ++K+ +  A
Sbjct  24    TVQQSTYSAIRSARS----IQNTSSTHLRTLQDFMPKIKGQYRTYEEVFFRKIKDELVSA  79

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               HP +  G  ++ G L  + PRRFLY +      SEEA   KA+  VKEL  S+  +K 
Sbjct  80    REHPALAGGIGIAAGLLLTRGPRRFLYRQTLGRLQSEEAKFIKAEKNVKELGLSVGLMKK  139

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K  + A  AE+++ RG + L  AG QI+SV +S YK+E QAA L DVL+E+P REA 
Sbjct  140   ESKKLLERASLAEKDMKRGHSDLMVAGNQIQSVAKSVYKVEGQAADLMDVLREIPGREAL  199

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R++V+++AS  +++R  + K + KIS  G+ +
Sbjct  200   KLRAEVASMASHLRQQRTAIDKRIVKISELGVPI  233



>dbj|BAJ98005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 111/180 (62%), Gaps = 0/180 (0%)
 Frame = -1

Query  946  LQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIF  767
            L+ VK EY   E +  G++KEG+ +A  HP I  G+    G + LKRPR +L  + R +F
Sbjct  98   LEWVKKEYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRVF  157

Query  766  VSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVI  587
            VS+E +LS   A+V  ++++++ +  ES+K    A  AE+   +G   LR+ G+ I+S +
Sbjct  158  VSKETLLSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNTLREEGRAIQSEL  217

Query  586  RSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            +    IE QA GLK +L +LPR  AS FRS++S LAS+ KKE+  L   +TKI N+G+ +
Sbjct  218  KQISDIENQAVGLKGILDQLPRAHASEFRSEISGLASQVKKEKRVLNSALTKIVNYGVPI  277



>ref|XP_006829819.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
 gb|ERM97235.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
Length=292

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 118/188 (63%), Gaps = 0/188 (0%)
 Frame = -1

Query  970  HFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFL  791
            HF+   D +  +K++YH+YED  F + KE + ++  HP+ T G  ++ G L L+ PRRFL
Sbjct  105  HFSTLQDFIPQLKSKYHVYEDAFFKKAKEELMVSREHPIETIGIAVATGLLLLRGPRRFL  164

Query  790  YYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQA  611
            +        SEEA   + + ++ EL  S+D +K ES+K  + A  AE E+ RG  KL+ A
Sbjct  165  FRHTFGRLQSEEAQYVRTEKRLTELGLSLDLMKKESKKLLQRATFAEDEMRRGHAKLKNA  224

Query  610  GKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTK  431
            G +I+ ++ S YK+E QAA L D L+ +P REA   R++V+++A + KKER+ L K++ K
Sbjct  225  GNEIQRLVNSVYKMEPQAADLMDALRVIPGREALKLRAEVASMACQVKKERSALDKKLLK  284

Query  430  ISNHGISV  407
            IS+ GI V
Sbjct  285  ISDFGIPV  292



>emb|CDY27396.1| BnaC04g50090D [Brassica napus]
Length=237

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 115/169 (68%), Gaps = 4/169 (2%)
 Frame = -1

Query  1177  APPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRL  998
             +PP P+  S+P  +   +    T+  AA WI++ ++QA   Q T+   ++S I  +KSRL
Sbjct  27    SPPDPLLSSIPSAKIATT----TVENAASWINETMRQALVYQSTIVETLDSKIDASKSRL  82

Query  997   DRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFL  818
              +I  TS AH +QT+DS++++ +EY++YE + F ++K+G+ +AASHPL++ G    +G  
Sbjct  83    AQIRDTSIAHTSQTIDSIREIVSEYNVYEHMVFAKIKDGVNVAASHPLVSGGLAFGVGIF  142

Query  817   GLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWE  671
              LK+ RR +YY A  +F +EEA+LS+AD +VKEL++S+D L AESEK E
Sbjct  143   ALKKTRRLVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLE  191



>gb|EEC72302.1| hypothetical protein OsI_05485 [Oryza sativa Indica Group]
Length=280

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 110/177 (62%), Gaps = 0/177 (0%)
 Frame = -1

Query  937  VKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSE  758
            +K EY ++E + FG++KEG  +A  HP I  G+    G +  KRPR +L  + R IFVS+
Sbjct  104  IKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  163

Query  757  EAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSA  578
            E +LS   A+V  ++++++ +  ES+K    A  AE+   +G   LR+ G+ I+S +   
Sbjct  164  ETLLSGIQAEVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTLREEGRAIQSELNQI  223

Query  577  YKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              IE+QA GLK +L +LPR  AS FRS++S LAS+ KKE+  L   +TKI N+G+ +
Sbjct  224  SDIEKQAVGLKSILNQLPRAHASEFRSEISGLASQVKKEKRVLNNTLTKIVNYGVPI  280



>ref|XP_003570319.1| PREDICTED: uncharacterized protein LOC100834616 [Brachypodium 
distachyon]
Length=285

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 112/186 (60%), Gaps = 0/186 (0%)
 Frame = -1

Query  964  NQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYY  785
            N   + L+ VK EY   E +  G++KEG+ +A  HP I  G+    G + LKRPR +L  
Sbjct  100  NAAKEELEWVKKEYLAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQ  159

Query  784  KARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGK  605
            + R IFVS+E +LS   A+V  ++++++ +  ES+K    A  AE+   +G   LR+ G+
Sbjct  160  RVRRIFVSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTLREEGR  219

Query  604  QIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKIS  425
             I+S ++    IE Q  GLK +L +LPR  AS FRS++S LAS+ KKE+  L   +TKI 
Sbjct  220  AIQSELKQISDIENQVVGLKGILDQLPRAHASEFRSEISGLASQVKKEKRVLNSALTKIV  279

Query  424  NHGISV  407
            N+G+ +
Sbjct  280  NYGVPI  285



>ref|XP_006659070.1| PREDICTED: uncharacterized protein LOC102721384 [Oryza brachyantha]
Length=282

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 112/182 (62%), Gaps = 0/182 (0%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            + L+ +K EY  +E + FG++KE + +A  HP I  G+    G +  KRPR +L  + R 
Sbjct  101  EKLEWIKNEYMAHEQMVFGKIKESVIVAIEHPRIAAGSTTIAGIVLFKRPRSYLIQRVRR  160

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRS  593
            IFVS+E +LS   A+V  ++++++ +  ES+K    A  AE+   +G   LR+ G+ I+S
Sbjct  161  IFVSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTLREEGRAIQS  220

Query  592  VIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
             +     IE QA GLK +L +LPR  AS FRS++S LAS+ KKE+  L+  ++KI N+G+
Sbjct  221  ELNQIGDIENQAVGLKSILGQLPRAHASEFRSEISGLASQVKKEKRVLSTTLSKIVNYGV  280

Query  412  SV  407
             +
Sbjct  281  PI  282



>ref|XP_010032828.1| PREDICTED: uncharacterized protein LOC104422263 [Eucalyptus grandis]
 gb|KCW52324.1| hypothetical protein EUGRSUZ_J01745 [Eucalyptus grandis]
Length=242

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 142/261 (54%), Gaps = 22/261 (8%)
 Frame = -1

Query  1183  SKAPPSPVA--PSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAITVT  1010
             ++A PSP A  P++PRQ G      +++A  A  +           +TV    +SAI   
Sbjct  2     AEASPSPPAAEPAVPRQNG------KSIADIAEDVQ----------RTVLESRDSAIQTA  45

Query  1009  KSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLS  830
             +S    +   SS H     + L  ++++YH YED    ++K+ +  A  HP  T G  ++
Sbjct  46    RS----LQQNSSTHLRSLQELLTKMRSQYHAYEDTFVNKVKDEVRSAREHPGTTVGVSVA  101

Query  829   LGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAE  650
                L L+ PRRFL  +      SEEA   +A+  VK+L  S+D +K ES+K  + A  AE
Sbjct  102   AALLLLRGPRRFLIRQTFGRLQSEEAQFVRAEKNVKDLNLSVDLMKKESKKLIERAALAE  161

Query  649   QELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEA  470
              ++ RG T L+  G Q + + +S YK+E QA GL D L+E+P REA   R++V++LAS  
Sbjct  162   TDMKRGLTDLKNTGNQTQRLAKSIYKVESQAGGLMDDLREIPGREALKLRAEVASLASNL  221

Query  469   KKERNFLTKEVTKISNHGISV  407
             K++R  + K + KIS  G++V
Sbjct  222   KQQRVAMEKRIVKISELGVAV  242



>ref|NP_001045615.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAD06279.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD07539.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07529.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAG92178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 110/177 (62%), Gaps = 0/177 (0%)
 Frame = -1

Query  937  VKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSE  758
            +K EY ++E + FG++KEG  +A  HP I  G+    G +  KRPR +L  + R IFVS+
Sbjct  103  LKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  162

Query  757  EAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSA  578
            E +LS   A V  ++++++ +  ES+K    A  AE+   +G   LR+ G+ I+S +   
Sbjct  163  ETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTLREEGRAIQSELNQI  222

Query  577  YKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              IE+QA GLK +L +LPR  AS F+S++S LAS+ KKE+  L   +TKI+N+G+ +
Sbjct  223  SDIEKQAVGLKSILNQLPRAHASEFQSEISGLASQVKKEKRVLNNTLTKIANYGVPI  279



>gb|AFW66822.1| hypothetical protein ZEAMMB73_141697 [Zea mays]
Length=278

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 110/182 (60%), Gaps = 0/182 (0%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            + L+  K EY  +E + FG++KEG+ +A  HP I  G+    G +  KRPR +L  + R 
Sbjct  97   EELEWFKTEYSAHEQIVFGKIKEGVVMAIMHPGIAAGSATLAGIILFKRPRSYLIQRVRH  156

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRS  593
            +FVS+E +LS   A+V  ++++++ +  E +K    A  AE+   +G   LR+ G+ I+ 
Sbjct  157  MFVSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTLREEGRSIQH  216

Query  592  VIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
             +R    IE QA GLK +L +LPR  AS FRS++S LAS+ KKE+  L   +TKI N+G+
Sbjct  217  ELREISDIENQAVGLKGILDQLPRAHASEFRSKMSGLASQVKKEKRVLNAALTKIVNYGV  276

Query  412  SV  407
             +
Sbjct  277  PI  278



>ref|XP_006445553.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|ESR58793.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|KDO54524.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=243

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 144/264 (55%), Gaps = 23/264 (9%)
 Frame = -1

Query  1195  SDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAIT  1016
             S++    P    AP++  +  +          A  W++D             +VI+S  +
Sbjct  2     SEQGESTPTVAAAPAITTRTKD----------AKEWVEDLQ----------RSVIQSKDS  41

Query  1015  VTKSRLDRILTTSSAHFNQTL-DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGA  839
               +S   R    +S+ + QTL D +    ++Y  YED  F ++K+ +  A  HP   TG 
Sbjct  42    AIRS--ARSFQHNSSTYLQTLQDFVLHGVSQYQTYEDAFFSKVKDELVSAREHPAAATGV  99

Query  838   FLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAV  659
              L+ G L ++ PRRFL+        SEEAM  +A+  V EL  S + +K ES+K  + A 
Sbjct  100   ALTAGLLFMRGPRRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAA  159

Query  658   QAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLA  479
              AE+E+IRG+T+L+ AG Q++ + +  YK+E QAA L + L+E+P REA   R++V+++A
Sbjct  160   LAEKEMIRGETELKNAGNQVQRLAKQVYKVETQAADLMEGLREIPGREALKLRAEVASMA  219

Query  478   SEAKKERNFLTKEVTKISNHGISV  407
             S  K++R  + K++ KIS  G+SV
Sbjct  220   SLLKRQRAMMDKQIMKISELGVSV  243



>ref|XP_006375268.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53065.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=187

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 100/141 (71%), Gaps = 7/141 (5%)
 Frame = -1

Query  1102  QAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEY  923
             + APWID+A+QQA   Q+ ++  +++AI  +KSR   I +TS AHF+QT+       +E 
Sbjct  41    ETAPWIDNAMQQALIYQKNIQYSLDTAIEASKSRFSEITSTSQAHFSQTI-------SEI  93

Query  922   HLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLS  743
              +YE   FG++KE I +AASHPLIT+   + LG + LKRPR+ LYYK   +F SEEA+LS
Sbjct  94    GVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEEALLS  153

Query  742   KADAKVKELKKSIDFLKAESE  680
             +ADAKVKEL++SI  LKAESE
Sbjct  154   QADAKVKELQQSISLLKAESE  174



>ref|XP_004951200.1| PREDICTED: uncharacterized protein LOC101766807 [Setaria italica]
Length=280

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 112/182 (62%), Gaps = 0/182 (0%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            + L+ VK EY  +E + FG++KEG+ +A  HP I  G+    G +  KRPR +L  + R 
Sbjct  99   EELEWVKKEYSTHEQMVFGKIKEGVIMAIMHPGIAAGSATLAGIVLFKRPRSYLIQRVRR  158

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRS  593
            +FVS+E +LS   A+V  ++++++ +  ES+K    A  AE+   +G   LR+ G+ I+ 
Sbjct  159  MFVSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTLREEGRAIQH  218

Query  592  VIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
             +     IE+QA GLK +L +LPR  AS F+S++S LAS+ KKE+  L   ++KI N+G+
Sbjct  219  ELNEISDIEQQAVGLKGILDQLPRAHASEFQSEISGLASQVKKEKRVLNAALSKIVNYGV  278

Query  412  SV  407
             +
Sbjct  279  PI  280



>ref|XP_006488962.1| PREDICTED: uncharacterized protein LOC102628779 [Citrus sinensis]
Length=243

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/264 (33%), Positives = 144/264 (55%), Gaps = 23/264 (9%)
 Frame = -1

Query  1195  SDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAIT  1016
             S++    P    AP++  +  +          A  W++D             +VI+S  +
Sbjct  2     SEQGESTPTVAAAPAITTRTKD----------AKEWVEDLQ----------RSVIQSKDS  41

Query  1015  VTKSRLDRILTTSSAHFNQTL-DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGA  839
               +S   R    +S+ + QTL D +    ++Y  YED  F ++K+ +  A  HP   TG 
Sbjct  42    AIRS--ARSFQHNSSTYLQTLQDFVLHGVSQYQTYEDAFFSKVKDELVSAREHPAAATGV  99

Query  838   FLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAV  659
              L+ G L ++ PRRFL+        SEEAM  +A+  V EL  S + +K ES+K  + A 
Sbjct  100   ALTAGLLFMRGPRRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAA  159

Query  658   QAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLA  479
              AE+++IRG+T+L+ AG Q++ + +  YK+E QAA L + L+E+P REA   R++V+++A
Sbjct  160   LAEKDMIRGETELKNAGNQVQRLAKQVYKVETQAADLMEGLREIPGREALKLRAEVASMA  219

Query  478   SEAKKERNFLTKEVTKISNHGISV  407
             S  K++R  + K++ KIS  G+SV
Sbjct  220   SLLKRQRAMMDKQIMKISELGVSV  243



>ref|XP_002523392.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38971.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 122/210 (58%), Gaps = 6/210 (3%)
 Frame = -1

Query  1018  TVTKSRLDRILTTSSAHFNQT--LDSLQDVKAE----YHLYEDLTFGRMKEGICIAASHP  857
             TV +S+   I +  S H N +  L SLQD   +    +  YED  F ++KE + IA  HP
Sbjct  56    TVIESKDSAIRSARSLHQNSSSRLRSLQDHVPQALSLFRTYEDSFFNKIKEELMIAREHP  115

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEK  677
             +   G  ++ GFL ++ PRRFL+      F SEEA   K +  VKEL  S+D +K ES K
Sbjct  116   VEVVGVAVTAGFLLMRGPRRFLFRHTFGRFQSEEARFLKTEKNVKELNLSVDLMKNESRK  175

Query  676   WEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRS  497
               + A  AE+++  G T+L  AG QI+ + +S YK+E Q AGL D L+E+P R+A   R+
Sbjct  176   LLERASLAEKDMKHGHTELMDAGSQIQRLAKSIYKVETQVAGLMDGLREIPGRDALKLRA  235

Query  496   QVSNLASEAKKERNFLTKEVTKISNHGISV  407
             +V+ +AS  KK ++ L K + KIS  GI V
Sbjct  236   EVATMASALKKHKSVLDKRIMKISELGIPV  265



>ref|NP_001144763.1| uncharacterized protein LOC100277822 [Zea mays]
 gb|ACG42816.1| hypothetical protein [Zea mays]
Length=278

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 109/182 (60%), Gaps = 0/182 (0%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            + L+  K EY  +E + FG++KEG+ +A  HP I  G+    G +  KRPR +L  + R 
Sbjct  97   EELEWFKTEYSAHEQIVFGKIKEGVVMAIMHPGIAAGSATLAGIILFKRPRSYLIQRVRH  156

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRS  593
            +FVS+E +LS   A+V  ++++++ +  E +K    A  AE+   +G   L + G+ I+ 
Sbjct  157  MFVSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTLSEEGRSIQH  216

Query  592  VIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
             +R    IE QA GLK +L +LPR  AS FRS++S LAS+ KKE+  L   +TKI N+G+
Sbjct  217  ELREISDIENQAVGLKGILDQLPRAHASEFRSKMSGLASQVKKEKRVLNAALTKIVNYGV  276

Query  412  SV  407
             +
Sbjct  277  PI  278



>gb|KHG03556.1| Chromosome-associated kinesin KIF4 [Gossypium arboreum]
Length=243

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 125/229 (55%), Gaps = 9/229 (4%)
 Frame = -1

Query  1093  PWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLY  914
             PW+++          T+E +I+S     +S    +   SS H     DSL    + Y  Y
Sbjct  24    PWVEELP--------TIENLIDSKDLAIRS-AQSLFHNSSTHLRTFQDSLPQASSYYKSY  74

Query  913   EDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKAD  734
             ED  F ++KEG+ IA  +P    G  L+     ++ PRRFL+      F SEEA  S+A+
Sbjct  75    EDAFFSKLKEGVMIAKENPGAAVGITLTASLCLMRGPRRFLFRNTLGRFQSEEAKFSRAE  134

Query  733   AKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAA  554
               VK L  S+D +K ES K  + A  AE+++ RG+ +L  +G QI  + +S YK+E +A 
Sbjct  135   KNVKVLSLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSGGQIHRLAKSVYKVEAEAV  194

Query  553   GLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              L D L+E+P REA   R++V+++AS  +++R  L + + KIS  GI V
Sbjct  195   DLMDGLREIPGREALKLRAEVASMASLLRQQRVSLDRRIRKISELGIPV  243



>ref|XP_003556589.1| PREDICTED: uncharacterized protein LOC100780119 [Glycine max]
Length=230

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 122/211 (58%), Gaps = 8/211 (4%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + I+SA TV  S        SS HF    + L +  ++Y  YED    ++K+G+ IA  +
Sbjct  28    SAIQSARTVQHS--------SSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKDGLMIAKEN  79

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P ++ G  +S   L ++ PRRFL+      F SEEA  ++ +  VK+L  S+D LK E+ 
Sbjct  80    PAVSAGVAISAALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSVDLLKKENA  139

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G T+L  AG Q + + +SAYK+E +AA L D L+ +P REA   R
Sbjct  140   KLLQRTTLAEKEMKYGHTELVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALALR  199

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++V+++AS  K++R+ L K + KI+  G+ V
Sbjct  200   AEVASMASNLKRQRSSLNKRIMKINELGVPV  230



>gb|ACU19454.1| unknown [Glycine max]
Length=230

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 122/211 (58%), Gaps = 8/211 (4%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + I+SA TV  S        SS HF    + L +  ++Y  YED    ++K+G+ IA  +
Sbjct  28    SAIQSARTVQHS--------SSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKDGLMIAKEN  79

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P ++ G  +S+  L ++ PRRFL+      F SEEA  ++ +  VK+L  S+D LK E+ 
Sbjct  80    PAVSAGVAISVALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSVDLLKKENA  139

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G T+L  AG Q + + +SAYK+E +AA L D L+ +P REA   R
Sbjct  140   KLLQRTTLAEKEMKYGHTELVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALALR  199

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++V+++AS  K++R  L K + KI+  G+ V
Sbjct  200   AEVASMASNLKRQRFSLNKRIMKINELGVPV  230



>ref|XP_010276434.1| PREDICTED: uncharacterized protein LOC104611177 [Nelumbo nucifera]
Length=248

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 123/214 (57%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TV    +SA+   +S    +   SS HF         +K++Y  YED  F ++K+ +  A
Sbjct  39    TVFGTTDSALRSARS----LQENSSTHFRSLQTFTAQLKSQYKTYEDAVFKKVKDELMSA  94

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               HP +  G  ++ G L ++ PRRFL+        SEEA   +A+  VKEL  S+D +K 
Sbjct  95    QEHPAVAGGIAVTAGLLLMRGPRRFLFRHTLGRLQSEEAQFLRAEKNVKELTLSVDLMKN  154

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K  + A  AE+++ RG  +L  AG  I+ + +S YKIE QAA L D L+E+P REA 
Sbjct  155   ESKKLLERATLAEKDMKRGYDQLMNAGADIQRLAKSVYKIEAQAADLMDGLREIPGREAL  214

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R++V+++AS  K++R+ L K + K+S  G++V
Sbjct  215   KLRAEVASMASLVKQQRSSLDKRIMKMSELGVAV  248



>ref|XP_007220768.1| hypothetical protein PRUPE_ppa024369mg [Prunus persica]
 gb|EMJ21967.1| hypothetical protein PRUPE_ppa024369mg [Prunus persica]
Length=175

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  1099  AAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYH  920
             A PWID A++QAR  Q+T+E   ESAI  ++SRL  I +TS+AHF+QT++SL+D+K++Y 
Sbjct  55    ATPWIDYAVEQARVYQKTIEETFESAIEASRSRLSEIRSTSAAHFSQTINSLEDIKSDYG  114

Query  919   LYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAML  746
              YED+ FG++KEG+ IAASHP+IT G    LG L LKRPRR LY+K   +FVSEE  +
Sbjct  115   TYEDMFFGKIKEGVLIAASHPMITGGVAAGLGLLVLKRPRRLLYHKTLRLFVSEEVRM  172



>gb|KDO54526.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=250

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 111/175 (63%), Gaps = 0/175 (0%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
            ++Y  YED  F ++K+ +  A  HP   TG  L+ G L ++ PRRFL+        SEEA
Sbjct  76   SQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRSEEA  135

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            M  +A+  V EL  S + +K ES+K  + A  AE+E+IRG+T+L+ AG Q++ + +  YK
Sbjct  136  MFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKNAGNQVQRLAKQVYK  195

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            +E QAA L + L+E+P REA   R++V+++AS  K++R  + K++ KIS  G+SV
Sbjct  196  VETQAADLMEGLREIPGREALKLRAEVASMASLLKRQRAMMDKQIMKISELGVSV  250



>ref|XP_003607819.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AES90016.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AFK36915.1| unknown [Medicago truncatula]
Length=266

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 8/211 (4%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + IESA TV  +        S+ HF    + L    ++Y  YED  F ++K+G+ +A  +
Sbjct  64    SAIESARTVQHN--------STTHFRTFQNFLPGAVSQYRTYEDAFFNKVKDGVMVAREN  115

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P I  G  +S   L ++ PRRFL+      F SEEA  + A+  VK+L  S+D LK ES 
Sbjct  116   PAIGVGLAVSTALLVMRGPRRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESI  175

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G ++L   G Q++ + +S+YK E +A  L D L+++P REA   R
Sbjct  176   KLLQRTALAEKEMKYGHSELMNTGAQLQRLAKSSYKAEARATDLIDRLRDIPSREALTLR  235

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++V++LAS  K++R+ L K + KIS  GISV
Sbjct  236   AEVASLASSLKRQRSVLDKRIMKISELGISV  266



>ref|XP_007205735.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
 gb|EMJ06934.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
Length=263

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 109/175 (62%), Gaps = 0/175 (0%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
            ++Y  YE+  F ++KEG+  A  HP  T G  L+  FL L  PRRF   +  S   SEEA
Sbjct  89   SDYRTYENAFFTKIKEGLMSAREHPTSTLGIGLTAAFLLLPGPRRFFIRQTFSRLQSEEA  148

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
               +A+  VKEL  S+D +K ES+K  + A+ AE+++  G+T L   G QI+S+ +S +K
Sbjct  149  QFVRAEKNVKELNLSVDLMKKESKKLLERALLAEKDMKYGQTDLMDVGSQIQSLSKSVHK  208

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            +E QAA L D L+E+P REA   R++V+++AS  K++R+ L K + KIS  G+ V
Sbjct  209  VESQAADLMDGLREIPNREALKLRAEVASMASVLKRQRSVLDKRIMKISELGLPV  263



>ref|XP_008220369.1| PREDICTED: uncharacterized protein LOC103320436 [Prunus mume]
Length=263

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 109/175 (62%), Gaps = 0/175 (0%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
            ++Y  YE+  F ++KEG+  A  HP  T G  L+  FL L  PRRF   +  S   SEEA
Sbjct  89   SDYRTYENAFFTKIKEGLMSAREHPASTLGIGLTAAFLLLPGPRRFFIRQTFSRLQSEEA  148

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
               +A+  VKEL  S+D +K ES+K  + A+ AE+++  G+T L   G QI+S+ +S +K
Sbjct  149  QFVRAEKNVKELNLSVDLMKKESKKLLERALLAEKDMKYGQTDLMDVGSQIQSLSKSVHK  208

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            +E QAA L D L+E+P REA   R++V+++AS  K++R+ L K + KIS  G+ V
Sbjct  209  VESQAADLMDGLREIPNREALKLRAEVASMASVLKRQRSVLDKRIMKISELGLPV  263



>emb|CDP18577.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 125/214 (58%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TV+   +SA+   +S       +SS HF    D +  + ++Y  YED  F ++K+ +   
Sbjct  51    TVQQSTDSALRSARS----FHHSSSTHFRTLRDFMPQLGSQYRTYEDAFFLKIKDELTKV  106

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               +P +T G  +++G L  + PRRFL+      F SEEA   +A+  VKEL  S+D +K 
Sbjct  107   RENPAVTGGIAVAVGLLLFRGPRRFLFRHTLGRFQSEEAQFIRAEKNVKELNLSVDLMKK  166

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES K  + A  AE+E+  G+  L  AG QI+++ RS +K E +A  L D+L+ELP REA 
Sbjct  167   ESGKLLERAALAEKEMKHGQIDLMNAGVQIQTLARSVHKAETKATDLMDLLRELPGREAL  226

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R++V+++AS  +++R  + K++ KIS+ G+ V
Sbjct  227   KLRAEVASVASHLREQRIAMEKKIMKISDSGLPV  260



>ref|XP_006348221.1| PREDICTED: uncharacterized protein LOC102606203 [Solanum tuberosum]
Length=233

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 126/214 (59%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             TV+   +SAI   +S    I  TSS H     D +  +K +Y   E++ F ++K+ +  A
Sbjct  24    TVQASTDSAIRSARS----IQNTSSTHLRTLQDFIPKIKGQYRTCEEVFFRKIKDELVSA  79

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               HP I  G  ++ G L ++ PRRFLY +      SEEA   KA+  VKEL  S+  +K 
Sbjct  80    REHPAIAGGIGIAAGLLLMRGPRRFLYRQTLGRLQSEEAKFIKAEKNVKELGLSVGLMKK  139

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K  + A  AE+++ RG + L  AG QI+SV +S YK+E QAA L DVL+E+P REA 
Sbjct  140   ESKKLLERASLAEKDMQRGHSDLMVAGNQIQSVAKSVYKVEGQAADLMDVLREIPGREAL  199

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R++V+++AS  +++R  + K + KIS  G+ +
Sbjct  200   KLRAEVASMASHLRQQRTAIDKRIVKISELGVPI  233



>ref|XP_007140976.1| hypothetical protein PHAVU_008G156700g [Phaseolus vulgaris]
 gb|ESW12970.1| hypothetical protein PHAVU_008G156700g [Phaseolus vulgaris]
Length=88

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  667  NAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVS  488
             A+ AE++ + G+ KLRQAGKQIR+VI+SAYKIER+A GLKD+L ELP+REAS+FRSQVS
Sbjct  2    GALHAEEQFLHGRRKLRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKREASIFRSQVS  61

Query  487  NLASEAKKERNFLTKEVTKISNHGISV  407
             LASEAKKE+  L+KE++KISN+GISV
Sbjct  62   KLASEAKKEKRSLSKEISKISNYGISV  88



>ref|XP_002451349.1| hypothetical protein SORBIDRAFT_04g000540 [Sorghum bicolor]
 gb|EES04325.1| hypothetical protein SORBIDRAFT_04g000540 [Sorghum bicolor]
Length=281

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 108/182 (59%), Gaps = 0/182 (0%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            + L+ VK EY  +E + F ++KEG+ +A  +P I  G+    G +  KRPR +L  + R 
Sbjct  100  EELEWVKKEYSAHEQIVFSKIKEGVVMAIMNPGIAAGSATLAGIVLFKRPRSYLIQRVRR  159

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRS  593
            +FVS+E +LS   A+V  ++++++ +  E +K    A  AE+   +G   LR+ G+ I+ 
Sbjct  160  MFVSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTLREEGRSIQH  219

Query  592  VIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
             +     IE  A GLK ++ +LPR  AS FRS++S LAS+ KKE+  L   +TKI N+G+
Sbjct  220  ELSEIRDIENHAVGLKGIIDQLPRAHASEFRSEISGLASQVKKEKRVLNAALTKIVNYGV  279

Query  412  SV  407
             +
Sbjct  280  PI  281



>ref|XP_004505352.1| PREDICTED: uncharacterized protein LOC101513717 [Cicer arietinum]
Length=233

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 112/192 (58%), Gaps = 0/192 (0%)
 Frame = -1

Query  982  TSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRP  803
             SS HF    + L +  ++Y  YED  F ++K+G+ +   +P +  G  +S   L ++ P
Sbjct  42   NSSTHFRTFQNFLPEAVSQYITYEDAFFNKVKDGLMVGRENPALGVGLAISAALLVMRAP  101

Query  802  RRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTK  623
            RRFL+      F SEEA  + A+  VK+L  S+D LK ES K  +    AE+E+  G  +
Sbjct  102  RRFLFRNTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHNE  161

Query  622  LRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTK  443
            L   G Q++ + +S+YK+E +A  L D L+++P RE    R++V++LAS  K++R+ L K
Sbjct  162  LMNTGAQLQKLAKSSYKVEARATDLIDRLRDIPSRETLALRAEVASLASNLKRQRSVLDK  221

Query  442  EVTKISNHGISV  407
             + KIS  GISV
Sbjct  222  RIMKISELGISV  233



>ref|XP_003529452.1| PREDICTED: uncharacterized protein LOC100808143 [Glycine max]
Length=231

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 121/211 (57%), Gaps = 8/211 (4%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + I+SA TV  S ++        HF    + L +   +Y  YED    ++K+G+ IA  +
Sbjct  29    SAIQSARTVQHSTIN--------HFRAFQNFLPEAVPQYRTYEDAFVNKVKDGLMIAKEN  80

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P ++ G  +S   L ++ PRRFL+      F SEE   ++ +  VK+L  S+D LK ES 
Sbjct  81    PALSAGLAVSGALLAMRAPRRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSVDLLKKESV  140

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G T+L  AG Q + + +SAYK+E +AA L D L+ +P REA + R
Sbjct  141   KLLQRTALAEKEMKYGHTELVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALVLR  200

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++V+++AS  K++R+ L K + KI+  G+ V
Sbjct  201   AEVASMASNLKRQRSSLNKRIMKINELGVPV  231



>gb|EYU32819.1| hypothetical protein MIMGU_mgv1a012602mg [Erythranthe guttata]
Length=245

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 122/214 (57%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             +V+   +SAI   +S    +  +SS H     D +  +   Y  YED    ++K+ +   
Sbjct  36    SVQQSADSAIRSARS----LQESSSTHLRSIQDFVPQIGTRYRYYEDAFIHKVKDELMTL  91

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               HP +  G  ++  FL +  PRRFL+ +      SEEA   KA+  VKEL  S+D +K 
Sbjct  92    KEHPALAGGVAVTAFFLLMPGPRRFLFRQTLGRLQSEEAQFVKAENNVKELTLSVDIMKK  151

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K  + +V AE+++ RG + L  AG +I+S+ RS YK E +AA L D+L+E+P REA 
Sbjct  152   ESKKLLERSVLAEKDMKRGHSDLMGAGTEIQSLARSVYKTETKAADLMDLLREIPGREAL  211

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R+ V+++AS  +++R+ + + + KIS  G+ V
Sbjct  212   KLRADVASMASHLRQQRSAMDRRILKISELGVPV  245



>gb|EEE56139.1| hypothetical protein OsJ_05019 [Oryza sativa Japonica Group]
Length=257

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 111/206 (54%), Gaps = 29/206 (14%)
 Frame = -1

Query  937  VKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSE  758
            +K EY ++E + FG++KEG  +A  HP I  G+    G +  KRPR +L  + R IFVS+
Sbjct  52   LKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  111

Query  757  EAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQA-----------  611
            E +LS   A V  ++++++ +  ES+K    A  AE+   +G   LRQA           
Sbjct  112  ETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTLRQAYFLKPFTIYFC  171

Query  610  ------------------GKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSN  485
                              G+ I+S +     IE+QA GLK +L +LPR  AS F+S++S 
Sbjct  172  LPFSNTALDLLSTCFREEGRAIQSELNQISDIEKQAVGLKSILNQLPRAHASEFQSEISG  231

Query  484  LASEAKKERNFLTKEVTKISNHGISV  407
            LAS+ KKE+  L   +TKI+N+G+ +
Sbjct  232  LASQVKKEKRVLNNTLTKIANYGVPI  257



>gb|KHN20511.1| hypothetical protein glysoja_029524 [Glycine soja]
Length=237

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 122/218 (56%), Gaps = 15/218 (7%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + I+SA TV  S        SS HF    + L +  ++Y  YED    ++K+G+ IA  +
Sbjct  28    SAIQSARTVQHS--------SSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKDGLMIAKEN  79

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P ++ G  +S   L ++ PRRFL+      F SEEA  ++ +  VK+L  S+D LK E+ 
Sbjct  80    PAVSAGVAISAALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSVDLLKKENA  139

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G T+L  AG Q + + +SAYK+E +AA L D L+ +P REA   R
Sbjct  140   KLLQRTTLAEKEMKYGHTELVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALALR  199

Query  499   SQ-------VSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++       V+++AS  K++R+ L K + KI+  G+ V
Sbjct  200   AEASQLCLIVASMASNLKRQRSSLNKRIMKINELGVPV  237



>ref|XP_001771369.1| predicted protein [Physcomitrella patens]
 gb|EDQ63759.1| predicted protein [Physcomitrella patens]
Length=342

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 126/202 (62%), Gaps = 0/202 (0%)
 Frame = -1

Query  1030  ESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLI  851
             +  I V ++++ ++   SS +F          + EY+ YE L F ++KEG+  AA +P  
Sbjct  78    DETIEVARNQMKQLTDASSQYFAAAQGYAARAQQEYNYYESLFFKKLKEGVHTAAQNPNA  137

Query  850   TTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWE  671
             T G       L L+  RR LY      F +E+A+L++A+ KVKE+++++D L+ E++K E
Sbjct  138   TCGVLGVTTILALRTSRRMLYRYTIGRFQNEQALLARAETKVKEMRQTVDLLRNETKKLE  197

Query  670   KNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQV  491
             + A  AE+EL+RG++KL+ +G Q+R++ RSAYK E  A GLKD L +LP RE+   R++V
Sbjct  198   ERARLAEEELLRGRSKLKNSGYQLRNLSRSAYKTESAARGLKDNLVDLPGRESIRLRTEV  257

Query  490   SNLASEAKKERNFLTKEVTKIS  425
             + + S AK+ R  L K V+KI+
Sbjct  258   AAMTSLAKQHRKILDKRVSKIA  279



>ref|XP_008384350.1| PREDICTED: uncharacterized protein LOC103446960 [Malus domestica]
Length=259

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 105/173 (61%), Gaps = 0/173 (0%)
 Frame = -1

Query  925  YHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAML  746
            Y +YE   F ++KEG+  A  +P  T G  L+  FL L  PRRFL+ +      SEEA  
Sbjct  87   YRIYEHAFFTKIKEGLTSAIENPAPTLGIGLTAAFLVLPGPRRFLFRQTFRRLQSEEAQF  146

Query  745  SKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIE  566
              A+  VKEL  S+D +  ES+K  + A+ AE+++  G T L   G+QI+ + +SA+K+E
Sbjct  147  LSAEKSVKELNLSVDLMXKESKKLLERALLAEKDMTYGHTDLMDVGRQIQHLCKSAHKVE  206

Query  565  RQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QA+ L D L+E+P REA   R++V+++ S  K++R+ L K + KIS  G+ V
Sbjct  207  SQASDLMDGLREIPNREALKLRAEVASMTSILKRQRSVLDKHIMKISELGLPV  259



>ref|XP_008781206.1| PREDICTED: uncharacterized protein LOC103701046 [Phoenix dactylifera]
Length=248

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 112/192 (58%), Gaps = 0/192 (0%)
 Frame = -1

Query  982  TSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRP  803
             SS    +  D +  V+A Y  YED    ++K+ + IA  HP  T G  ++ GF+ ++ P
Sbjct  57   NSSWSLQRLQDYMPSVQAWYKDYEDAFVKKVKDQLMIARDHPTETFGVVVAAGFVLMQGP  116

Query  802  RRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTK  623
            RRFL        +SE+   +KA+  +KEL +S+D LK +S+     A   EQ+L RG TK
Sbjct  117  RRFLVRNTIGRLLSEQDRSAKAELCLKELSQSVDKLKKDSKNMLLKASWGEQDLQRGHTK  176

Query  622  LRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTK  443
            +R AG++I+ +  S YKIE +AA L D L+ LP R A   R++V+++AS+ K +R  L K
Sbjct  177  IRAAGREIQRLANSIYKIESEAADLMDGLRALPGRTALQLRAEVASMASDLKTQRRELNK  236

Query  442  EVTKISNHGISV  407
             + KIS  GI V
Sbjct  237  RIMKISELGIRV  248



>ref|XP_010673453.1| PREDICTED: uncharacterized protein LOC104889828 [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 110/191 (58%), Gaps = 0/191 (0%)
 Frame = -1

Query  979  SSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPR  800
            SS       D + +VK ++  YE+    + K+G+     HP +T G  L+  FL ++ PR
Sbjct  58   SSTRLRFMQDLIPEVKFKFSNYEEACIKKFKDGLATGLQHPTMTVGITLATVFLLMRGPR  117

Query  799  RFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKL  620
            RFL+        SEE    +A+  VK L+ S+D +K ES K  + A  AE+E+I G+T L
Sbjct  118  RFLFQHTVGRLQSEEVQFVRAEKSVKMLELSVDLMKKESRKLLERASLAEKEMINGQTDL  177

Query  619  RQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKE  440
              AGK IR + +S  ++E QAA L D+L+E+P REA   R++V+++AS  K++R  L K 
Sbjct  178  MNAGKHIRHLAKSVDQVENQAADLVDLLREIPGREALQLRAEVASVASLLKQQRTGLAKR  237

Query  439  VTKISNHGISV  407
              K++  G+ V
Sbjct  238  KIKLTEMGVPV  248



>ref|XP_011048149.1| PREDICTED: uncharacterized protein LOC105142285 [Populus euphratica]
Length=236

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 119/212 (56%), Gaps = 8/212 (4%)
 Frame = -1

Query  1042  ETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAAS  863
             ++ I SA++  +S        SS+H     D + +  ++++ YE+  F ++KE +  A  
Sbjct  33    DSAIRSAVSFQQS--------SSSHLRSFQDHVPEAISKFNSYENTFFSKVKEELLTAKD  84

Query  862   HPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAES  683
             HP    G  L+ G   ++ PRRFL+      F SEEA   +A+  VKE   S+D +K ES
Sbjct  85    HPAAAIGLTLTAGLFLMRGPRRFLFRNTLGRFQSEEAQFLRAEKNVKEYSFSVDLMKKES  144

Query  682   EKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLF  503
              K  + A  AE+E+  G T+L  AG QI+ + +S YK+E + A L D L+E+P R+A   
Sbjct  145   RKLLERASLAEKEMKNGHTELLDAGIQIQRLSKSVYKVETKTADLMDGLREIPGRDALKL  204

Query  502   RSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             R++V+++ S  K++R  L K + KIS  GI V
Sbjct  205   RAEVASMTSLLKQQRAVLDKRIMKISELGIPV  236



>ref|XP_003607823.1| hypothetical protein MTR_4g083290 [Medicago truncatula]
Length=353

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 0/175 (0%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
            ++Y  YED  F ++K+G+ +A  +P I  G  +S   L ++ PRRFL+      F SEEA
Sbjct  179  SQYRTYEDAFFNKVKDGVMVARENPAIGVGLAVSTALLVMRGPRRFLFRHTLGRFQSEEA  238

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
              + A+  VK+L  S+D LK ES K  +    AE+E+  G ++L   G Q++ + +S+YK
Sbjct  239  RYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHSELMNTGAQLQRLAKSSYK  298

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             E +A  L D L+++P REA   R++V++LAS  K++R+ L K + KIS  GISV
Sbjct  299  AEARATDLIDRLRDIPSREALTLRAEVASLASSLKRQRSVLDKRIMKISELGISV  353



>ref|XP_002285769.1| PREDICTED: uncharacterized protein LOC100250144 isoform X2 [Vitis 
vinifera]
 emb|CBI16570.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 123/211 (58%), Gaps = 1/211 (0%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             TV ESA +  +S L  +   SS+H     + +  ++++Y  YED  F ++K+ +  A  H
Sbjct  37    TVSESADSAIRSALS-LQQNSSSHLRSLQEFIPQMESQYRTYEDAFFKKVKDELTSAKEH  95

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P++     ++ G + L+ PRRFL++     F SEEA   +A+  VKEL  S+D +K ES 
Sbjct  96    PVVVGAVAVTAGLIFLRGPRRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESR  155

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  + A  AE+++  G T+L   G Q++ + ++ +K+E QAA L D L+E P REA   R
Sbjct  156   KLLERAALAEKDMKCGHTELMNTGSQLKRLAKTVFKVEAQAADLMDGLRETPGREALKLR  215

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             S+V+++ S  K++R  L K + KIS  G+ V
Sbjct  216   SEVASMTSLLKQQRIALDKRIMKISELGVPV  246



>ref|XP_002299091.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
 gb|EEE83896.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
Length=239

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 118/211 (56%), Gaps = 1/211 (0%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             TV ES  +  +S L     +SS+H     D + +  ++++ YE+  F ++KE +  A  H
Sbjct  30    TVKESKDSAIRSALS-FQQSSSSHLRSFQDHVPEAISKFNSYENTFFSKVKEELLTAKDH  88

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P    G  L+ G   ++ PRRFL+      F SEEA   +A+  VKE   S+D +K ES 
Sbjct  89    PAAAIGLTLTAGLFLMRGPRRFLFRNTLGRFQSEEAQFLRAEKNVKEFSFSVDLMKKESR  148

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  + A  AE+E+  G T+L   G QI+ + +S YK+E + A L D L+E+P R+A   R
Sbjct  149   KLLERASLAEKEMKNGHTELLDTGIQIQRLAKSVYKVETKTADLMDGLREIPGRDALKLR  208

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++V+++ S  K++R  L K + KIS  GI V
Sbjct  209   AEVASMTSLLKQQRAVLDKRIMKISELGIPV  239



>ref|XP_010536807.1| PREDICTED: uncharacterized protein LOC104811711 [Tarenaya hassleriana]
Length=255

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 128/231 (55%), Gaps = 11/231 (5%)
 Frame = -1

Query  1099  AAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYH  920
             A  W++D  +       TV+   +SAI   +S    +   SS+HF    D +     +Y 
Sbjct  36    AERWVEDFQR-------TVKESTDSAIRSARS----LRNNSSSHFRSLQDFIPHALVQYK  84

Query  919   LYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSK  740
              YE+  F ++ E +  A  HP  T G  ++ G L ++ PRRFL+ +    F SEEA   K
Sbjct  85    TYENAFFSKVTEELTNAKDHPAATVGLGVAAGLLLMRGPRRFLFRQTLGRFQSEEARYLK  144

Query  739   ADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQ  560
              +  V+EL  ++D +K ES K  + A  AE+++ RG ++L  +G +++ + +S YK+E Q
Sbjct  145   VEKNVQELNMTVDLMKKESRKLLERAALAEKDMKRGLSELMSSGCEVQRLAKSVYKVESQ  204

Query  559   AAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             A  L DVL+++  R+A   R++V+++AS  +++R  L K + KIS  G+ V
Sbjct  205   ATDLMDVLRQISGRDALKLRAEVASMASILRQKRIALNKRIMKISELGVPV  255



>ref|XP_011089758.1| PREDICTED: uncharacterized protein LOC105170618 [Sesamum indicum]
Length=234

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 123/214 (57%), Gaps = 4/214 (2%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             +V+   +SAI   +S    +  +SS H     +    +  +Y  YE+    R+K+ +   
Sbjct  25    SVQESADSAIRSARS----LQQSSSTHLRSLQEFFPQLGTQYRYYEEAFVNRVKDELVNV  80

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               +P +  G  ++   L ++ PRRFL+ +      SEEA   +A+  VKEL  S+D +K 
Sbjct  81    RENPALAGGVAVAACLLLMRGPRRFLFRQTLGRLQSEEAQFVRAEKNVKELNLSVDLMKK  140

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREAS  509
             ES+K  + +  AE+++ RG + L  AGKQI+S++RS YK E +AA L D+L+E+P REA 
Sbjct  141   ESKKLLERSALAEKDMKRGHSDLMNAGKQIQSLVRSVYKTEAEAADLMDLLREIPGREAL  200

Query  508   LFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               R+ V+++AS  +++R+ L K + KIS  GI V
Sbjct  201   KLRADVASMASHLRQQRSALDKRILKISELGIHV  234



>ref|XP_009339217.1| PREDICTED: uncharacterized protein LOC103931455 [Pyrus x bretschneideri]
Length=259

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 104/173 (60%), Gaps = 0/173 (0%)
 Frame = -1

Query  925  YHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAML  746
            Y +YE   F ++KEG+  A  +P  T G  L+  FL L  PRRFL+ +      SEEA  
Sbjct  87   YRIYEHAFFTKIKEGLTSAIENPAPTLGIGLTAAFLVLPGPRRFLFRQTFRRLQSEEAQF  146

Query  745  SKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIE  566
              A+  VKEL  S+D +K ES+K  + A+ AE+++  G   L   G+QI+ + +S +K+E
Sbjct  147  LSAEKSVKELNLSVDLMKKESKKLLERALLAEKDMTYGHNDLMDVGRQIQHLSKSVHKVE  206

Query  565  RQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             QA+ L D L+E+P REA   R++V+++ S  K++R+ L K + KIS  G+ V
Sbjct  207  SQASDLMDGLREIPNREALKLRAEVASMTSILKRQRSVLDKHIMKISELGLPV  259



>ref|XP_004144064.1| PREDICTED: uncharacterized protein LOC101216418 isoform 1 [Cucumis 
sativus]
 ref|XP_004159354.1| PREDICTED: uncharacterized LOC101216418 isoform 1 [Cucumis sativus]
 gb|KGN66344.1| hypothetical protein Csa_1G599380 [Cucumis sativus]
Length=241

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 108/189 (57%), Gaps = 0/189 (0%)
 Frame = -1

Query  979  SSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPR  800
            SS+H     D +    +++  YED  F ++ + + IA  HP  T G  ++ G L ++ PR
Sbjct  51   SSSHIRSLQDFVPQATSQFKTYEDTFFRKLTDELKIAREHPAATIGVAVTAGLLIMRGPR  110

Query  799  RFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKL  620
            RFL+      F +EEA   KA+  VKEL  S+D +K ES+K  + A  AE+++  G  +L
Sbjct  111  RFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDLMKNESKKLLERAALAEKDMKYGHNEL  170

Query  619  RQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKE  440
              AG QI+ + RS YK E QAA L D L+E+  R+A   R++V+++ +  K++R  L   
Sbjct  171  MNAGSQIQRLSRSIYKAEAQAADLMDGLREISGRDALKLRAEVASMTTFLKRQRTLLENR  230

Query  439  VTKISNHGI  413
              K+S+ GI
Sbjct  231  AMKVSDMGI  239



>gb|KDP30630.1| hypothetical protein JCGZ_16195 [Jatropha curcas]
Length=226

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 120/228 (53%), Gaps = 11/228 (5%)
 Frame = -1

Query  1090  WIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYE  911
             W++D             TVI+S  +  +S        SS H     D L    +++  YE
Sbjct  10    WVEDLQ----------RTVIQSKDSAIRSACS-FQQNSSFHLRSLQDHLPRAVSQFKTYE  58

Query  910   DLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADA  731
             D    ++KE +  A  HP+ T G  ++ G L ++ PRR L+ +      SEEA   KA+ 
Sbjct  59    DAFVNKIKEELMSAREHPVETVGVAVTAGLLLMRGPRRLLFRQTFGRLQSEEAKFLKAEK  118

Query  730   KVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAG  551
              +KEL  S+D +K ES K  + A  AE+++  G T+L  +G QI+ + +S YK+E Q A 
Sbjct  119   NLKELTLSVDLMKNESRKLLERASYAEKDMKHGLTELLDSGSQIQRLAKSVYKVENQVAD  178

Query  550   LKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             L D L+E+  REA   R++V+++AS  K+ R  L K + KIS  G+ V
Sbjct  179   LMDGLREISGREALKLRAEVASMASGLKQHRTALDKRIMKISELGVPV  226



>ref|XP_007157828.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
 gb|ESW29822.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
Length=241

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 119/218 (55%), Gaps = 15/218 (7%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + I+SA TV  S        SS  F+   +SL +  ++Y  YED  F ++K+G+ I   +
Sbjct  32    SAIQSARTVQHS--------SSTQFHAFQNSLPEAASQYRTYEDAFFNKVKDGLMIVKEN  83

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P +  G  +S   L ++ PRRFL+ +    F SEEA  ++ +  VK+   S+D LK ES 
Sbjct  84    PALGAGVAISAALLVMRAPRRFLFRQTLGRFQSEEARYARTEKSVKDFNLSVDLLKKESG  143

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G ++L  AG Q + + +SAYK+E +A  L D L+ +P REA   R
Sbjct  144   KLLQRTALAEKEMKYGHSELLSAGSQFQQLAKSAYKVENRAIDLLDKLRYIPNREALALR  203

Query  499   SQ-------VSNLASEAKKERNFLTKEVTKISNHGISV  407
             ++       V+++ S  K +R+ L K + KI+  G+ V
Sbjct  204   AEASKLYLCVASMVSNLKDQRSALNKRIVKINELGVPV  241



>ref|XP_008450994.1| PREDICTED: uncharacterized protein LOC103492410 [Cucumis melo]
Length=241

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 108/189 (57%), Gaps = 0/189 (0%)
 Frame = -1

Query  979  SSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPR  800
            SS+H     D +    +++  YED  F ++ + + IA  HP  T G  ++ G L ++ PR
Sbjct  51   SSSHIRSFQDFVPRATSQFKTYEDAFFRKLTDELKIAREHPAATIGVAVTAGLLIMRGPR  110

Query  799  RFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKL  620
            RFL+      F +EEA   KA+  VKEL  S+D +K ES+K  + A  AE+++  G  +L
Sbjct  111  RFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDLMKNESKKLLERAALAEKDMKYGHNEL  170

Query  619  RQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKE  440
              AG QI+ + RS YK E QAA L D L+E+  R+A   R++V+++ +  K++R  L   
Sbjct  171  MNAGSQIQHLSRSIYKAEAQAADLMDGLREISGRDALKLRAEVASMTTFLKRQRTLLENR  230

Query  439  VTKISNHGI  413
              K+S+ GI
Sbjct  231  AMKVSDMGI  239



>ref|XP_007014648.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
 gb|EOY32267.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
Length=238

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 4/208 (2%)
 Frame = -1

Query  1030  ESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLI  851
             ESAI   +S    +   SS H     D +    + Y  YED    ++KE +  A  HP  
Sbjct  35    ESAIQSARS----LHHNSSTHLRSLQDFVPHAFSRYKSYEDAFVNKLKEELMSAKEHPAA  90

Query  850   TTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWE  671
               G  ++     +  PRR L+      F SEEA   +A+  VKEL  S+D +K ES K  
Sbjct  91    AIGITVTAALFLMPGPRRLLFRNTLGRFQSEEAQFLRAEKNVKELNLSVDMMKKESSKLL  150

Query  670   KNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQV  491
             + A  AE+++ RG  +L  AG QI+ + +S YK E QAA L D L+E+P REA   R++V
Sbjct  151   ERAALAEKDMKRGHKELMNAGGQIQHLAKSVYKAEAQAADLMDGLREIPGREALKLRAEV  210

Query  490   SNLASEAKKERNFLTKEVTKISNHGISV  407
             +++AS  +++R  L K + KIS  GI V
Sbjct  211   ASMASLLRQQRVSLDKRIMKISELGIPV  238



>ref|XP_010921336.1| PREDICTED: uncharacterized protein LOC105044929 [Elaeis guineensis]
Length=250

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 113/188 (60%), Gaps = 4/188 (2%)
 Frame = -1

Query  958  TLDSLQD----VKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFL  791
            +L SLQD    V+A+Y ++ED    ++K+ + IA  HP  T G  ++ G + ++ PRRFL
Sbjct  63   SLRSLQDYMTRVQAQYKVHEDAFVQKVKDQLMIAREHPTETFGIVVAAGLVLMQGPRRFL  122

Query  790  YYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQA  611
                    VSE+   +KA+  +KEL +S++ LK +S+     A   EQ+L RG  K+R A
Sbjct  123  LRNTFGRLVSEQDRSAKAELCLKELSQSVEKLKKDSKNMLLKASWGEQDLQRGHAKIRAA  182

Query  610  GKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTK  431
            G++I+ + +S YKIE +A  L D L+ LP R A   R++V+++AS+ K +R  L + + K
Sbjct  183  GREIQRLAKSIYKIESEATDLMDGLRALPGRTALQLRAEVASMASDLKNQRRELNERIMK  242

Query  430  ISNHGISV  407
            IS  GI V
Sbjct  243  ISELGIRV  250



>gb|KHN42956.1| hypothetical protein glysoja_007486 [Glycine soja]
Length=264

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 117/211 (55%), Gaps = 13/211 (6%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + I+SA TV  S ++        HF    + L +   +Y  YED    ++K+G+ IA  +
Sbjct  67    SAIQSARTVQHSTIN--------HFRAFQNFLPEAVPQYRTYEDAFVNKVKDGLMIAKEN  118

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P ++ G  +S   L ++ PRRFL+      F SEE   ++ +  VK+L  S+D LK ES 
Sbjct  119   PALSAGLAVSGALLAMRAPRRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSVDLLKKESV  178

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G T+L  AG Q + + +SAYK+E +AA L D L+ +P REA    
Sbjct  179   KLLQRTALAEKEMKYGHTELVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREA----  234

Query  499   SQVSNLASEAKKERNFLTKEVTKISNHGISV  407
               V+++AS  K++R+ L K + KI+  G+ V
Sbjct  235   -LVASMASNLKRQRSSLNKRIMKINELGVPV  264



>ref|XP_010651409.1| PREDICTED: uncharacterized protein LOC100250144 isoform X1 [Vitis 
vinifera]
Length=252

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 123/217 (57%), Gaps = 7/217 (3%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             TV ESA +  +S L  +   SS+H     + +  ++++Y  YED  F ++K+ +  A  H
Sbjct  37    TVSESADSAIRSALS-LQQNSSSHLRSLQEFIPQMESQYRTYEDAFFKKVKDELTSAKEH  95

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P++     ++ G + L+ PRRFL++     F SEEA   +A+  VKEL  S+D +K ES 
Sbjct  96    PVVVGAVAVTAGLIFLRGPRRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESR  155

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAA------GLKDVLKELPRR  518
             K  + A  AE+++  G T+L   G Q++ + ++ +K+E QAA       L D L+E P R
Sbjct  156   KLLERAALAEKDMKCGHTELMNTGSQLKRLAKTVFKVEAQAAVIIHFVDLMDGLRETPGR  215

Query  517   EASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             EA   RS+V+++ S  K++R  L K + KIS  G+ V
Sbjct  216   EALKLRSEVASMTSLLKQQRIALDKRIMKISELGVPV  252



>gb|KFK29159.1| hypothetical protein AALP_AA7G096800 [Arabis alpina]
Length=229

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 124/236 (53%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+DD  +       TV+   +SAI   +S    +   S++ F    D +   
Sbjct  5     EAVGGAEKWVDDFSR-------TVKESTDSAIRSARS----LRENSTSQFRSIQDFIPHA  53

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  L+   + ++ PRRFL+      F SEE
Sbjct  54    LTQYKTYENAFFSKVTEELVNAKEHPAAAAGIGLTAALVLMRGPRRFLFRNTLGRFQSEE  113

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES K  + A  AE+++ RG ++L  +G  I  + +S +
Sbjct  114   AQFLRAEKHVQELNMSVDLMKKESRKLLERAALAEKDMKRGLSELMDSGNNIHRLAKSVH  173

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +A  L D L+++P REA   R++V+++ S  +++R  L K + ++S  G+ V
Sbjct  174   KVECEATDLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMRMSELGVPV  229



>ref|XP_009393907.1| PREDICTED: uncharacterized protein LOC103979471 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 107/187 (57%), Gaps = 4/187 (2%)
 Frame = -1

Query  955  LDSLQD----VKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLY  788
            L+  QD    V++ +  YED      K+ + +A  HPL   G  +  G L L+ PRRFLY
Sbjct  26   LEKFQDLMLRVRSHWQAYEDALVHNAKDELLVAYDHPLEACGVVVVAGILLLRGPRRFLY  85

Query  787  YKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAG  608
             K    F +EE  L+ A++ ++E+ +S+  LK ES+         E++L RG+TK+R AG
Sbjct  86   RKTLGRFKTEEERLTDAESFLREINESVTKLKKESKNLLTKVSYGEEDLHRGRTKIRAAG  145

Query  607  KQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKI  428
             +I+ + +S YKIE +AA L + L+ +P R A   R++V+ + S  K +R  L + VTKI
Sbjct  146  HEIQRLNKSIYKIESEAADLMEELRTIPGRTALELRAEVAPMTSSLKNQRLELNERVTKI  205

Query  427  SNHGISV  407
            S  GI V
Sbjct  206  SELGIRV  212



>ref|XP_003558009.1| PREDICTED: uncharacterized protein LOC100838509 [Brachypodium 
distachyon]
Length=214

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 103/179 (58%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMK----EGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            + Y  YED+   R K    + + +A+ H     G     GF+ L+ PRRFLY      F 
Sbjct  36   SHYKAYEDVFVERAKVTISDALVLASGHQAEAIGCATVAGFILLRGPRRFLYRNTLGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E K SI+ L+ ES+      V  E +L RG+T LR  GKQI+SVI 
Sbjct  96   TEKDLLNDAEQSMIEYKTSIENLRKESKYTLDKVVIGESDLQRGRTDLRSTGKQIQSVIS  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  AAGL D L+ +P R++   R++V+++AS+ K +R  L + V +IS +G+ V
Sbjct  156  SIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKSQRYVLEERVNRISEYGVRV  214



>emb|CDY42739.1| BnaA03g48000D [Brassica napus]
Length=254

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 123/236 (52%), Gaps = 14/236 (6%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+D              TV ES    T S +  +   S++ F    D +   
Sbjct  33    EAIGGAEKWVDGFQ----------RTVKES----TDSAIRSLRENSTSQFRSIQDLIPHA  78

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
                Y  YE+  F ++ E +  A  HP  + G  L+ G + ++ PRRFL+ +    F SEE
Sbjct  79    LTHYKTYENAFFSKVTEELVNAKEHPAASAGIGLAAGLVLMRGPRRFLFRRTLGRFQSEE  138

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES K  + +  AE+++ RG ++L  +G  I  + +S +
Sbjct  139   AQFLRAEKHVQELNMSVDLMKKESMKLLERSALAEKDMKRGLSELMDSGNNIHRLAKSVH  198

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AAGL D L+++P REA   R++V+++ S  +++R  L K +  +S  G+ V
Sbjct  199   KVECEAAGLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMGMSELGVPV  254



>ref|XP_002869612.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45871.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 123/231 (53%), Gaps = 11/231 (5%)
 Frame = -1

Query  1099  AAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYH  920
             A  W+DD  +       TV+   +SA+   +S    +   S++ F    D +     +Y 
Sbjct  44    AEKWVDDFQR-------TVKESTDSAMRSARS----LRENSTSQFRSIQDFIPHALTQYK  92

Query  919   LYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSK  740
              YE+  F ++ E +  A  HP  T G  ++ G + ++ PRRFL+      F SEEA   K
Sbjct  93    TYENAFFSKVTEELIYAKEHPAATVGIGVAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLK  152

Query  739   ADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQ  560
             A+  V+EL  S+D +K ES K  +    AE+++ RG ++L  +G  I  + +S +K+E +
Sbjct  153   AEKHVQELNMSVDLMKKESRKLLERTALAEKDMKRGLSELMNSGNDIHRLAKSVHKVECE  212

Query  559   AAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             AA L D L+++P REA   R++V+++ S  +++R  L K +  +S  G+ V
Sbjct  213   AADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMSMSELGVPV  263



>ref|XP_004294933.1| PREDICTED: uncharacterized protein LOC101308945 [Fragaria vesca 
subsp. vesca]
Length=249

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 103/175 (59%), Gaps = 0/175 (0%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
            ++Y  YE   F ++KEG+  AA +P  T G  L+  F+ L+ PRRFL+      F S EA
Sbjct  75   SKYRTYEHAFFHKIKEGVKRAAENPASTIGIGLTAAFIFLRGPRRFLFRNTLGRFQSLEA  134

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
              +KA+  V +L  S+D +K ES+K  + A  AE+ +  G+T L   G +I+S+ +S  K
Sbjct  135  KYAKAEKNVNQLNLSVDLMKQESKKLLERAGYAEKHMKVGQTDLMDVGSRIQSLSKSMRK  194

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            ++ QAA L D L+E+P  EA   RSQV+ + SE K ++  + K + KIS  G+ V
Sbjct  195  VDSQAADLMDGLREIPSGEALKLRSQVAAMTSELKTQKAVMDKHIMKISELGLPV  249



>dbj|BAK05826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 104/179 (58%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMK----EGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y  YED+   R K    + + +A+ H +   G     GF+  + PRRFLY      F 
Sbjct  36   SQYKAYEDVFVERAKVTISDAVVLASEHQVEAIGCATVAGFILFRGPRRFLYRNTLGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+  +  + E K SI+ L+ +S+      V  E +L RG+T LR  GKQI+SVI 
Sbjct  96   TEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGRTDLRSTGKQIQSVIS  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  AAGL D L+ +P R++   R++V+++AS+ K +R+ L + V +IS +G+ V
Sbjct  156  SIYKAESTAAGLMDRLRIIPTRQSLELRAEVASMASDLKNQRHVLEERVNRISEYGVRV  214



>ref|XP_006284348.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
 gb|EOA17246.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
Length=263

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 127/236 (54%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E++     W+DD  +       TV+   +SA+   +S    +   S++HF    D +   
Sbjct  39    ESIGGTEKWVDDLQR-------TVKDTTDSAMRSARS----LRENSTSHFRSIQDFIPHA  87

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  ++ G + ++ PRRFL+ +    F SEE
Sbjct  88    LTQYKTYENAFFSKVTEELIYAKEHPAAAVGIGVAAGLVLMRGPRRFLFRQTLGRFQSEE  147

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES+K  +    AE+++ RG ++L  +G  +  + +S +
Sbjct  148   AQFLRAEKHVQELNMSVDLMKKESKKLLERTALAEKDMKRGLSELMNSGNDVHRLAKSVH  207

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E QAA L D L+++P REA   R++V+++ S  +++R  L K +  +S  G+ V
Sbjct  208   KVECQAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMSMSELGVPV  263



>ref|NP_001049981.1| Os03g0324800 [Oryza sativa Japonica Group]
 gb|ABF95704.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11895.1| Os03g0324800 [Oryza sativa Japonica Group]
 dbj|BAG92495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87177.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58974.1| hypothetical protein OsJ_10675 [Oryza sativa Japonica Group]
Length=214

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 100/179 (56%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYE----DLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y  YE    D+  G + + + +   H     G     GF+ L+ PRRFLY      F 
Sbjct  36   SQYKAYENAFVDMAKGTISDAMVLVNEHQTEAIGCATVAGFILLRGPRRFLYRNTLGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E K SI+ LK +S+         E +L RG+T LR  GKQIRS+I 
Sbjct  96   TEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQTDLRSTGKQIRSLIG  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  A GL D L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  156  SIYKAESTATGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCVLQERINKISEYGVRV  214



>ref|XP_009617840.1| PREDICTED: uncharacterized protein LOC104110119, partial [Nicotiana 
tomentosiformis]
Length=133

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = -1

Query  805  PRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKT  626
            PRRFL+ +      SEEA  SKA+  VKEL  S+D +K ES+K  + A  AE+++ RG +
Sbjct  1    PRRFLFRQTLGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLS  60

Query  625  KLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLT  446
            +L  AG QI+SV ++ YK+E QAA L DVL+E+P REA   R++V+++AS  +++R  + 
Sbjct  61   ELMDAGNQIQSVGKTVYKVEAQAADLMDVLREIPGREALKLRAEVASMASHLRQQRTAID  120

Query  445  KEVTKISNHGISV  407
            K + K+S  G+ +
Sbjct  121  KRIVKVSELGVPI  133



>ref|XP_004984525.1| PREDICTED: uncharacterized protein LOC101782823 isoform X2 [Setaria 
italica]
Length=210

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 98/175 (56%), Gaps = 0/175 (0%)
 Frame = -1

Query  931  AEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
            ++Y +YE+      K+ + +   H     G     GF+  + PRRFLY      F +E+ 
Sbjct  36   SQYKVYENAVVESTKDALVLVKEHQAEAIGCATVAGFILFRGPRRFLYRNTFGRFKTEKD  95

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K SI  LK ES+         E +L RG+T LR  GKQI+S+I S YK
Sbjct  96   LLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQRGQTDLRSTGKQIQSLIGSIYK  155

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             E  AAGL D L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  156  AESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRYALQERINKISEYGVRV  210



>ref|XP_002465337.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
 gb|EER92335.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
Length=214

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 99/179 (55%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYEDL----TFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y  YED     T G + + + +   H     G     GF+  + PRRFLY      F 
Sbjct  36   SQYKAYEDAVVEGTKGTIADALVLVREHQTEAIGCATVAGFILFRGPRRFLYRNTFGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E K SI  LK ES+         E +L RG+T LR  GKQI+S+I 
Sbjct  96   TEKDLLNDAEQSMMEYKTSIQNLKKESKYTLDKVAVGESDLQRGRTDLRSTGKQIQSLIG  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  AAGL D L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  156  SIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCALQERINKISEYGVRV  214



>emb|CDX92771.1| BnaC07g40290D [Brassica napus]
Length=263

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 127/252 (50%), Gaps = 29/252 (12%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+D   +       TV+   +SAI   +S    +   S++ F    D +   
Sbjct  25    EAIGGAEKWVDGFQR-------TVKESTDSAIRSARS----LRENSTSQFRSVQDLIPHA  73

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPL----------------ITTGAFLSLGFLGLKRP  803
               +Y  YE+  F ++ E +  A  HP                 ITT + +   FL L  P
Sbjct  74    LTQYKTYENAFFSKVTEELINAKEHPAAAAGIGLAAGLVLMRGITTSSLIY--FLNLFCP  131

Query  802   RRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTK  623
             RRFL+ +    F SEEA   +A+  V+EL  S+D +K ES K  + +  AE+++ RG ++
Sbjct  132   RRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESSKLLERSALAEKDMKRGLSE  191

Query  622   LRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTK  443
             L  +G  I  + +S +K+E +AAGL D L+++P REA   R++V+++ S  +++R  L K
Sbjct  192   LMNSGNNIHRLAKSVHKVECEAAGLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  251

Query  442   EVTKISNHGISV  407
              +  +S  G+ V
Sbjct  252   RIMGMSELGVPV  263



>gb|KEH30817.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
Length=240

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 101/184 (55%), Gaps = 8/184 (4%)
 Frame = -1

Query  1039  TVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASH  860
             + IESA TV  +        S+ HF    + L    ++Y  YED  F ++K+G+ +A  +
Sbjct  64    SAIESARTVQHN--------STTHFRTFQNFLPGAVSQYRTYEDAFFNKVKDGVMVAREN  115

Query  859   PLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESE  680
             P I  G  +S   L ++ PRRFL+      F SEEA  + A+  VK+L  S+D LK ES 
Sbjct  116   PAIGVGLAVSTALLVMRGPRRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESI  175

Query  679   KWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
             K  +    AE+E+  G ++L   G Q++ + +S+YK E +A  L D L+++P REA   R
Sbjct  176   KLLQRTALAEKEMKYGHSELMNTGAQLQRLAKSSYKAEARATDLIDRLRDIPSREALTLR  235

Query  499   SQVS  488
             ++ S
Sbjct  236   AEAS  239



>gb|KHN10117.1| hypothetical protein glysoja_048900 [Glycine soja]
Length=144

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 91/156 (58%), Gaps = 12/156 (8%)
 Frame = -1

Query  1216  MAIIAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVET  1037
             MA++AES + +S    S             ++N +TL + AP++D AL QA+   +    
Sbjct  1     MAMVAESPESDSDNNSSK------------TNNPQTLNETAPFLDYALAQAQLYHKAFND  48

Query  1036  VIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHP  857
              ++S I   KSR  +I +TSSAHF+QTLDSL D+K++Y  YE L FG++KEG+ +AASHP
Sbjct  49    AVDSTIDTAKSRFSQIRSTSSAHFHQTLDSLDDLKSQYTAYEGLLFGKIKEGVVVAASHP  108

Query  856   LITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAM  749
             +IT GA  SLG L LK   R        IF S   M
Sbjct  109   VITCGATASLGLLVLKSEIRCFLLCCVLIFHSLGGM  144



>ref|XP_009137593.1| PREDICTED: uncharacterized protein LOC103861626 [Brassica rapa]
Length=254

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 120/236 (51%), Gaps = 14/236 (6%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+D              TV ES    T S +  +   S++ F    D +   
Sbjct  33    EAIGGAEKWVDGFQ----------RTVKES----TDSAIRSLRENSTSQFRSIQDLIPHA  78

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
                Y  YE+  F ++ E +  A  HP  + G  L+ G + ++ PRRFL+ +    F SEE
Sbjct  79    LTHYKTYENAFFSKVTEELVNAKEHPAASAGIGLAAGLVLMRGPRRFLFRRTLGRFQSEE  138

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES K  + +  AE+++ RG ++L  +G  I  + +S  
Sbjct  139   AQFLRAEKHVQELNMSVDLMKKESSKLLERSALAEKDMKRGLSELMDSGNNIHRLAKSVQ  198

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L   L+++P REA   R++V+++ S  +++R  L K +  +S  G+ V
Sbjct  199   KVECEAADLIHGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMGMSELGVPV  254



>ref|XP_004984524.1| PREDICTED: uncharacterized protein LOC101782823 isoform X1 [Setaria 
italica]
Length=214

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 100/179 (56%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYEDL----TFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y +YE+     T G + + + +   H     G     GF+  + PRRFLY      F 
Sbjct  36   SQYKVYENAVVESTKGTIADALVLVKEHQAEAIGCATVAGFILFRGPRRFLYRNTFGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E K SI  LK ES+         E +L RG+T LR  GKQI+S+I 
Sbjct  96   TEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQRGQTDLRSTGKQIQSLIG  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  AAGL D L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  156  SIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRYALQERINKISEYGVRV  214



>ref|XP_010448277.1| PREDICTED: uncharacterized protein LOC104730768 [Camelina sativa]
Length=263

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 125/236 (53%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+ D  Q       TV+   +SA+   +S        S++ F    D +   
Sbjct  39    EAMGGAEKWVGDLQQ-------TVKESTDSAMRSARS----FRENSTSQFRSIQDFIPHA  87

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  ++   + ++ PRRFL+ +    F SEE
Sbjct  88    LTQYKNYENAFFSKVTEELTYAKEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEE  147

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+ +V+EL  S+D +K ES+K  + A  AE+++ RG ++L  +G  I  + +S +
Sbjct  148   AQFLRAEKQVQELNMSVDLMKKESKKLLERATLAEKDMKRGHSELMNSGNDIHRLAKSVH  207

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L D L+++P R+A   R++V+++ S  K++R  L K +  +S  G+ V
Sbjct  208   KVECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLKQKRIALNKRILSMSELGLPV  263



>ref|XP_006650015.1| PREDICTED: uncharacterized protein LOC102714271 [Oryza brachyantha]
Length=214

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 98/179 (55%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYED----LTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y  YED    +  G + + + +   H     G     GF+ L+ PRRFLY      F 
Sbjct  36   SQYKAYEDAFVHMAKGTVSDALVLVNEHQAEAIGCATVAGFILLRGPRRFLYRNTLGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E K SI  LK +S+         E +L RG+T  R  GKQIRS+I 
Sbjct  96   TEKDLLNDAEQSMMEYKTSIKQLKKDSKYTLDKIAIGESDLQRGQTDFRSTGKQIRSLIS  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  A GL D L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  156  SIYKAESTATGLMDRLRTIPTRQSLELRAEVASMASDLKGQRYVLEERINKISEYGVRV  214



>ref|XP_010105296.1| hypothetical protein L484_002346 [Morus notabilis]
 gb|EXC04261.1| hypothetical protein L484_002346 [Morus notabilis]
Length=226

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/267 (33%), Positives = 134/267 (50%), Gaps = 41/267 (15%)
 Frame = -1

Query  1207  IAESSDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIE  1028
             +AE++ E+S      V+P+   ++   ++  +TLA  A  +           + V +  +
Sbjct  1     MAETATESSSGEDLSVSPASESKKKERNER-QTLASMAEDLQ----------RNVISSTD  49

Query  1027  SAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLIT  848
             SAI   +S    +   SSAHF    + + + K+ Y  YED TF                 
Sbjct  50    SAIRSARS----LHHNSSAHFRNLQEFVANAKSHYKTYED-TF-----------------  87

Query  847   TGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEK  668
                     F  +K PRRFL+        SEEA   KA+  VKEL  S+D +K ES K  +
Sbjct  88    --------FNTVKGPRRFLFRHTLGRLRSEEAQFVKAEKNVKELSLSVDVMKNESRKLLE  139

Query  667   NAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVS  488
              A  AE+++  G T+L +AG QI+ + +S YK+E QAA L D L+E P REA   R++V+
Sbjct  140   RAALAEKDMKYGHTELMKAGNQIQHLAKSVYKVEAQAADLVDGLRETPGREALKLRAEVA  199

Query  487   NLASEAKKERNFLTKEVTKISNHGISV  407
             ++ S  KK+R  L K + +IS+ G+ V
Sbjct  200   SVLSHLKKQRVELDKRIMQISDLGVPV  226



>ref|XP_006413188.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54641.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=261

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 124/236 (53%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+DD  +       TV+   +SAI   +S    +   S++ F    D +   
Sbjct  37    EAIGGAEKWVDDFQR-------TVKESKDSAIRSARS----LRENSTSQFRSIQDFIPHA  85

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  L+ G + ++ PRRFL+      F SEE
Sbjct  86    LTQYKTYENAFFSKVTEELIYAKEHPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEE  145

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   KA+  V+EL  S+D +K ES K  + +  AE+++ RG ++L  +G  I  +  S +
Sbjct  146   AQFLKAEKHVQELNMSVDLMKKESRKLLERSALAEKDMKRGLSELMDSGNNIHRLANSVH  205

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +A  L D L+++P REA   R++V+++ S  +++R  L K + ++S  G+ V
Sbjct  206   KVECEATDLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMRMSELGVPV  261



>ref|XP_010438763.1| PREDICTED: uncharacterized protein LOC104722317 [Camelina sativa]
Length=263

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/236 (30%), Positives = 124/236 (53%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+ D  Q       TV+   +SA+   +S        S++ F    D +   
Sbjct  39    EAMGGAEKWVGDLQQ-------TVKESTDSAMRSARS----FRENSTSQFRSIQDFIPHA  87

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  ++   + ++ PRRFL+ +    F SEE
Sbjct  88    LTQYKTYENAFFSKVTEELTYAKEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEE  147

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES+K  + A  AE+++ RG ++L  +G  I  + +S +
Sbjct  148   AQFLRAEKHVQELNMSVDLMKKESKKLLERATLAEKDMKRGLSELMNSGNDIHRLAKSVH  207

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L D L+++P R+A   R++V+++ S  +++R  L K +  +S  G+ V
Sbjct  208   KVECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLRQKRIALNKRIMSMSELGLPV  263



>gb|EMS64683.1| hypothetical protein TRIUR3_01262 [Triticum urartu]
Length=211

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 105/195 (54%), Gaps = 13/195 (7%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            + L+ VK EY   E +  G++KEG+ +A  HP I  G+    G + LKRPR +L  + R 
Sbjct  17   EELEWVKKEYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRR  76

Query  772  IFVSEEAMLSKADAKV---------KELKKSIDFLKAESEKWEKNAVQAE----QELIRG  632
            +FVS+E +      K          K++ + +++ +A S  ++   +         +   
Sbjct  77   VFVSKENINDHDFMKFVYGSSCNSRKKIPERMEYTQACSSLFDPVIISVSIYFSYNIGMD  136

Query  631  KTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNF  452
               LR+ G+ I++ ++    IE QA GLK +L +LPR  AS FRS++S LAS+ KKE+  
Sbjct  137  VHLLREEGRAIQTELKQISDIENQAVGLKGILDQLPRAHASEFRSEISGLASQVKKEKRV  196

Query  451  LTKEVTKISNHGISV  407
            L   +TKI N+G+ +
Sbjct  197  LNSALTKIVNYGVPI  211



>ref|XP_010433511.1| PREDICTED: uncharacterized protein LOC104717609 [Camelina sativa]
Length=263

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/236 (30%), Positives = 123/236 (52%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+ D  Q       TV+   +SA+   +S        S++ F    D +   
Sbjct  39    EAMGGAEKWVGDLQQ-------TVKESTDSAMRSARS----FRENSTSQFRSIQDFIPHA  87

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  ++   + ++ PRRFL+ +    F SEE
Sbjct  88    LTQYKTYENAFFSKVTEELTYAKEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEE  147

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES+K  + A  AE+++ RG ++L  +G  I  + +S +
Sbjct  148   AQFLRAEKHVQELNMSVDLMKKESKKLLERATLAEKDMKRGLSELMNSGNDIHRLAKSVH  207

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L D L+++P R+A   R++V+++ S   ++R  L K +  +S  G+ V
Sbjct  208   KVECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLGQKRIALNKRIMSMSELGLPV  263



>ref|XP_009142234.1| PREDICTED: uncharacterized protein LOC103866109 [Brassica rapa]
Length=261

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 127/236 (54%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+DD  +       TV+   +SA+   +S    +   S++ F    D +   
Sbjct  37    EAVGGAEKWVDDLQR-------TVKESTDSAMRSARS----LRENSTSQFRSIQDFIPHA  85

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE++ F ++ E +  A  +P    G  L+ G + ++ PRRFL+      F SEE
Sbjct  86    LNQYKTYENVFFSKVTEELRNAKENPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEE  145

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES K  + +  AE+++ RG ++L  +G  I  + +S +
Sbjct  146   AQFLRAEKHVQELNMSVDLMKKESVKLLERSALAEKDMKRGLSELMDSGNNIHRLAKSVH  205

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L D L+++P REA   R++V+++ S  K++R  L K + ++S  G+ V
Sbjct  206   KVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLKQKRIALNKRIMRMSELGVPV  261



>ref|XP_008670078.1| PREDICTED: uncharacterized protein LOC100276044 isoform X1 [Zea 
mays]
 gb|ACF85910.1| unknown [Zea mays]
 gb|ACG28462.1| hypothetical protein [Zea mays]
 gb|ACG32171.1| hypothetical protein [Zea mays]
 tpg|DAA45114.1| TPA: hypothetical protein ZEAMMB73_628651 [Zea mays]
Length=214

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 97/179 (54%), Gaps = 4/179 (2%)
 Frame = -1

Query  931  AEYHLYEDLTF----GRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y  YED       G + + + +   H     G     GF+  + PRRFLY        
Sbjct  36   SQYKAYEDAVVENIKGTIADALVLVREHQAEAIGCATVAGFILFRGPRRFLYRNTFGRLK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E + SI  LK ES+         E ++ RG+T LR  GKQI+S+I 
Sbjct  96   TEKDLLNDAEQSMMEYQTSIQNLKKESKYTLDKVAIGESDVQRGRTDLRSTGKQIQSLIG  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
            S YK E  AAGL D L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  156  SIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCALQERINKISEYGVRV  214



>emb|CDX89342.1| BnaA01g15510D [Brassica napus]
Length=261

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 127/236 (54%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+DD  +       TV+   +SA+   +S    +   S++ F    D +   
Sbjct  37    EAVGGAEKWVDDLQR-------TVKESTDSAMRSARS----LRENSTSQFRSIQDFIPHA  85

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE++ F ++ E +  A  +P    G  L+ G + ++ PRRFL+      F SEE
Sbjct  86    LNQYKTYENVFFSKVTEELRNAKENPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEE  145

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES K  + +  AE+++ RG ++L  +G  I  + +S +
Sbjct  146   AQFLRAEKHVQELNMSVDLMKKESMKLLERSALAEKDMKRGLSELMDSGNNIHRLAKSVH  205

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L D L+++P REA   R++V+++ S  +++R  L K + ++S  G+ V
Sbjct  206   KVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMRMSELGVPV  261



>gb|KDO54525.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=255

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 112/217 (52%), Gaps = 23/217 (11%)
 Frame = -1

Query  1195  SDENSKAPPSPVAPSLPRQRGNYSDNLETLAQAAPWIDDalqqarqaqQTVETVIESAIT  1016
             S++    P    AP++  +  +          A  W++D             +VI+S  +
Sbjct  2     SEQGESTPTVAAAPAITTRTKD----------AKEWVEDLQ----------RSVIQSKDS  41

Query  1015  VTKSRLDRILTTSSAHFNQTL-DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGA  839
               +S   R    +S+ + QTL D +    ++Y  YED  F ++K+ +  A  HP   TG 
Sbjct  42    AIRSA--RSFQHNSSTYLQTLQDFVLHGVSQYQTYEDAFFSKVKDELVSAREHPAAATGV  99

Query  838   FLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAV  659
              L+ G L ++ PRRFL+        SEEAM  +A+  V EL  S + +K ES+K  + A 
Sbjct  100   ALTAGLLFMRGPRRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAA  159

Query  658   QAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGL  548
              AE+E+IRG+T+L+ AG Q++ + +  YK+E QAAG+
Sbjct  160   LAEKEMIRGETELKNAGNQVQRLAKQVYKVETQAAGI  196



>emb|CDX94341.1| BnaC01g18430D [Brassica napus]
Length=261

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 127/236 (54%), Gaps = 11/236 (5%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+DD  +       TV+   +SA+   +S    +   S++ F    D +   
Sbjct  37    EAVGGAEKWVDDLQR-------TVKESKDSAMRSARS----LRENSTSQFRSIQDFIPHA  85

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  +P    G  L+ G L ++ PRRFL+      F SEE
Sbjct  86    LTQYKTYENAFFSKVTEELRNAKENPAAAAGIGLAAGLLLMRGPRRFLFRHTLGRFQSEE  145

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   +A+  V+EL  S+D +K ES K  + +  AE+++ RG ++L  +G  I  +++S +
Sbjct  146   AQFLRAEKHVQELNMSVDLMKKESMKLLERSALAEKDMKRGLSELMDSGNNIHRLVKSVH  205

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +AA L D L+++P REA   R++V+++ S  +++R  L K + ++S  G+ V
Sbjct  206   KVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMRMSELGVPV  261



>gb|EPS63583.1| hypothetical protein M569_11194 [Genlisea aurea]
Length=236

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 110/193 (57%), Gaps = 1/193 (1%)
 Frame = -1

Query  985  TTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKR  806
            +TSS   N   + +  +   Y  YE+  F + K+ +     +P +  G  ++  FL ++ 
Sbjct  45   STSSIGRNLFQEFIPQIGPTYRYYEEAFFNKAKDEVVYLRDNPPLAAGLAVACLFL-MRG  103

Query  805  PRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKT  626
            PRRFL  +      SEEA   +A+  V EL  S++ +K E  K  + ++ AE+++  G +
Sbjct  104  PRRFLLRQTLHRLQSEEARFVRAEKNVNELNLSVELMKKEGVKLFQRSMLAEKDMKHGYS  163

Query  625  KLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLT  446
             L  AG QI+++ +S YK E +A  L D+L+++P REA   R++V+++AS+ +++R+ + 
Sbjct  164  SLMNAGTQIQTLAKSVYKAEAEAKDLMDLLRQIPGREAIKLRAEVASMASQLRQQRSAMD  223

Query  445  KEVTKISNHGISV  407
            K + +IS  G+ V
Sbjct  224  KRLLRISEFGVPV  236



>ref|XP_004144065.1| PREDICTED: uncharacterized protein LOC101216418 isoform 2 [Cucumis 
sativus]
 ref|XP_004159355.1| PREDICTED: uncharacterized LOC101216418 isoform 2 [Cucumis sativus]
Length=217

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 86/151 (57%), Gaps = 0/151 (0%)
 Frame = -1

Query  979  SSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPR  800
            SS+H     D +    +++  YED  F ++ + + IA  HP  T G  ++ G L ++ PR
Sbjct  51   SSSHIRSLQDFVPQATSQFKTYEDTFFRKLTDELKIAREHPAATIGVAVTAGLLIMRGPR  110

Query  799  RFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKL  620
            RFL+      F +EEA   KA+  VKEL  S+D +K ES+K  + A  AE+++  G  +L
Sbjct  111  RFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDLMKNESKKLLERAALAEKDMKYGHNEL  170

Query  619  RQAGKQIRSVIRSAYKIERQAAGLKDVLKEL  527
              AG QI+ + RS YK E QAA L D L+E+
Sbjct  171  MNAGSQIQRLSRSIYKAEAQAADLMDGLREI  201



>ref|NP_194371.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22774.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42434.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85195.1| uncharacterized protein AT4G26410 [Arabidopsis thaliana]
Length=263

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 106/192 (55%), Gaps = 0/192 (0%)
 Frame = -1

Query  982  TSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRP  803
             S++ F    D +     +Y  YE+  F ++ + +  A  HP    G  ++   + ++ P
Sbjct  72   NSTSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYAKEHPAAAIGIGVAASLVLMRGP  131

Query  802  RRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTK  623
            RRFL+      F SEEA   KA+  V+EL  S+D +K ES K  +    AE+++ RG ++
Sbjct  132  RRFLFRNTLGRFQSEEAQFLKAEKHVQELNMSVDLMKKESRKLLERTALAEKDMKRGLSE  191

Query  622  LRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTK  443
            L  +G  I  + +S +K E +AA L D L+++P R+A   R++V+++ S  +++R  L K
Sbjct  192  LMNSGNDIHRLAKSVHKAECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLRQKRIALNK  251

Query  442  EVTKISNHGISV  407
             +  +S+ G+SV
Sbjct  252  RIMGMSDLGVSV  263



>ref|XP_006375269.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53066.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=168

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (66%), Gaps = 7/117 (6%)
 Frame = -1

Query  1102  QAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEY  923
             + APWID+A+QQA   Q+ ++  +++AI  +KSR   I +TS AHF+QT+       +E 
Sbjct  41    ETAPWIDNAMQQALIYQKNIQYSLDTAIEASKSRFSEITSTSQAHFSQTI-------SEI  93

Query  922   HLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEA  752
              +YE   FG++KE I +AASHPLIT+   + LG + LKRPR+ LYYK   +F SEE 
Sbjct  94    GVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEEV  150



>ref|XP_002983323.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
 gb|EFJ15665.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
Length=403

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 137/238 (58%), Gaps = 8/238 (3%)
 Frame = -1

Query  1108  LAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKA  929
             +A AAP+++ A+ QA+  +  +    + A+    ++L  +  +S+  +    D     K 
Sbjct  170   MAVAAPFVEFAVAQAQFLKNGMSETTDVAVRAACNQLSELQDSSTTQYYYAKDMFWRFKR  229

Query  928   EYHLYEDLTFGRMKEGICIAASHP----LITTGAFLSLGFLGLKRPRRFLYYKARSIFVS  761
             EY  YE++ F  +K+G+  A + P    ++ TGA     FL L+RPRR L+      F S
Sbjct  230   EYREYENVFFSTLKDGVKAATASPGMAAMVATGA----AFLFLRRPRRLLFKYTLGRFRS  285

Query  760   EEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRS  581
             +EAM + A  KV EL+++++  K E  K E+    AE E +RG++K+  AG QIRS+++S
Sbjct  286   QEAMAASAQKKVVELREALELQKNEKRKLEERFRLAEDEFLRGQSKMANAGSQIRSLVKS  345

Query  580   AYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              YK E  A GL + L+++  + A   R++V+++ASEAK  R+ L + + +I++H I V
Sbjct  346   MYKTENHAQGLLEKLRDMSGKPAFHLRAEVASMASEAKAHRSSLDRNLYRIASHNIRV  403



>gb|EEC75159.1| hypothetical protein OsI_11373 [Oryza sativa Indica Group]
Length=195

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 0/133 (0%)
 Frame = -1

Query  805  PRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKT  626
            PRRFLY      F +E+ +L+ A+  + E K SI+ LK +S+         E +L RG+T
Sbjct  63   PRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQT  122

Query  625  KLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLT  446
             LR  GKQIRS+I S YK E  A GL D L+ +P R++   R++V+++AS+ K +R  L 
Sbjct  123  DLRSTGKQIRSLIGSIYKAESTATGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCVLQ  182

Query  445  KEVTKISNHGISV  407
            + + KIS +G+ V
Sbjct  183  ERINKISEYGVRV  195



>ref|XP_002987624.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
 gb|EFJ11199.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
Length=403

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 136/238 (57%), Gaps = 8/238 (3%)
 Frame = -1

Query  1108  LAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKA  929
             +A AAP+++ A+ QA+  +  +    + A+    ++L  +  +S+  +    D     K 
Sbjct  170   MAVAAPFVEFAVAQAQFLKNGMSETTDVAVRAACNQLSELQDSSTTQYYYAKDMFWRFKR  229

Query  928   EYHLYEDLTFGRMKEGICIAASHP----LITTGAFLSLGFLGLKRPRRFLYYKARSIFVS  761
             EY  YE++ F  +K+G+  A   P    ++ TGA     FL L+RPRR L+      F S
Sbjct  230   EYREYENVFFSTLKDGVKAATVSPGMAAMVATGA----AFLFLRRPRRLLFKYTLGRFRS  285

Query  760   EEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRS  581
             +EAM + A  KV EL+++++  K E  K E+    AE E +RG++K+  AG QIRS+++S
Sbjct  286   QEAMAASAQKKVVELREALELQKNERRKLEERFRLAEDEFLRGQSKMANAGSQIRSLVKS  345

Query  580   AYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
              YK E  A GL + L+++  + A   R++V+++ASEAK  R+ L + + +I++H I V
Sbjct  346   MYKTENHAQGLLEKLRDMSGKPAFHLRAEVASMASEAKAHRSSLDRNLYRIASHNIRV  403



>gb|EEC75161.1| hypothetical protein OsI_11375 [Oryza sativa Indica Group]
Length=192

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 83/155 (54%), Gaps = 4/155 (3%)
 Frame = -1

Query  931  AEYHLYE----DLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFV  764
            ++Y  YE    D+  G + + + +   H     G     GF+ L+ PRRFLY      F 
Sbjct  36   SQYKAYENAFVDMAKGTISDAMVLVNEHQTEAIGCATVAGFILLRGPRRFLYRNTLGRFK  95

Query  763  SEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIR  584
            +E+ +L+ A+  + E K SI+ LK +S+         E +L RG+T LR  GKQIRS+I 
Sbjct  96   TEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQTDLRSTGKQIRSLIG  155

Query  583  SAYKIERQAAGLKDVLKELPRREASLFRSQVSNLA  479
            S YK E  A GL D L+ +P R++   R++ SN A
Sbjct  156  SIYKAESTATGLMDRLRTIPTRQSLELRAETSNHA  190



>gb|EMT05527.1| hypothetical protein F775_07413 [Aegilops tauschii]
Length=193

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 94/185 (51%), Gaps = 11/185 (6%)
 Frame = -1

Query  952  DSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARS  773
            +  + VK EY   E +  G++KEG+ +A  HP I  G+    G + LKRPR +L  + R 
Sbjct  17   EEFEWVKKEYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRR  76

Query  772  IFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAG---KQ  602
            +FVS+E +LS   A+V  ++++++ +  ES+K    A  AE+   +G   LR       Q
Sbjct  77   VFVSKETLLSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNTLRHVVPCLTQ  136

Query  601  IRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISN  422
            +  +    + I  +        K +P +        +S LAS+ KKE+  L   +TKI N
Sbjct  137  LSFLFLFVFNITLEWMYTFSGKKGVPFK--------ISGLASQVKKEKRVLNSALTKIVN  188

Query  421  HGISV  407
            +G+ +
Sbjct  189  YGVPI  193



>ref|XP_006413187.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54640.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=245

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 114/236 (48%), Gaps = 27/236 (11%)
 Frame = -1

Query  1114  ETLAQAAPWIDDalqqarqaqQTVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDV  935
             E +  A  W+DD  +       TV+   +SAI   +S    +   S++ F    D +   
Sbjct  37    EAIGGAEKWVDDFQR-------TVKESKDSAIRSARS----LRENSTSQFRSIQDFIPHA  85

Query  934   KAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEE  755
               +Y  YE+  F ++ E +  A  HP    G  L+ G + ++ PRRFL+      F SEE
Sbjct  86    LTQYKTYENAFFSKVTEELIYAKEHPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEE  145

Query  754   AMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAY  575
             A   KA+  V+EL  S+D +K ES K  +                R +G  I  +  S +
Sbjct  146   AQFLKAEKHVQELNMSVDLMKKESRKLLE----------------RDSGNNIHRLANSVH  189

Query  574   KIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             K+E +A  L D L+++P REA   R++V+++ S  +++R  L K + ++S  G+ V
Sbjct  190   KVECEATDLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNKRIMRMSELGVPV  245



>gb|AIA26010.1| hypothetical protein, partial [Phyllostachys edulis]
Length=116

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K SI+ LK +S+         E +L RG+T LR  GKQI+S+I S YK
Sbjct  2    LLNDAEQCMMEYKTSIETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             E  AAGL   L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  62   AESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRCVLEERINKISEYGVPV  116



>gb|AIA26008.1| hypothetical protein, partial [Phyllostachys nidularia]
Length=116

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K SI+ LK +S+         E +L RG+T LR  GKQI+S+I S YK
Sbjct  2    LLNDAEQCMMEYKTSIETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             E  AAGL   L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  62   AESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRYVLEERINKISEYGVPV  116



>gb|EMT21115.1| hypothetical protein F775_32566 [Aegilops tauschii]
Length=211

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = -1

Query  805  PRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKT  626
            PRRFLY      F +E+ +L+  +  + E K SI+ L+ +S+      V  E +L RG+T
Sbjct  101  PRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGRT  160

Query  625  KLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLA  479
             LR  GKQI+SVIRS YK E  AAGL D L+ +P R++   R++ S +A
Sbjct  161  DLRSTGKQIQSVIRSIYKAESTAAGLMDQLRIIPTRQSLELRAEASEIA  209



>gb|AIA26006.1| hypothetical protein, partial [Fargesia nitida]
Length=116

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K S++ LK +S+         E +L RG+T LR  GKQI+S+I S YK
Sbjct  2    LLNDAEQSMMEYKTSLETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             E  AAGL   L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  62   AESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRYVLEERINKISEYGVPV  116



>gb|AIA26007.1| hypothetical protein, partial [Fargesia spathacea]
Length=116

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K S++ LK +S+         E +L RG+T LR  GKQI+S+I S YK
Sbjct  2    LLNDAEQSMMEYKTSLESLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             E  AAGL   L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  62   AESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRYVLEERINKISEYGVPV  116



>emb|CAA18229.1| putative protein [Arabidopsis thaliana]
 emb|CAB79496.1| putative protein [Arabidopsis thaliana]
Length=266

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 102/194 (53%), Gaps = 3/194 (2%)
 Frame = -1

Query  979  SSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPR  800
            S++ F    D +     +Y  YE+  F ++ + +  A  HP    G  ++   + ++   
Sbjct  73   STSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYAKEHPAAAIGIGVAASLVLMRVAL  132

Query  799  RF---LYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGK  629
                 L + + S   S +A   KA+  V+EL  S+D +K ES K  +    AE+++ RG 
Sbjct  133  VCVPSLIFTSTSKSSSLQAQFLKAEKHVQELNMSVDLMKKESRKLLERTALAEKDMKRGL  192

Query  628  TKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQVSNLASEAKKERNFL  449
            ++L  +G  I  + +S +K E +AA L D L+++P R+A   R++V+++ S  +++R  L
Sbjct  193  SELMNSGNDIHRLAKSVHKAECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLRQKRIAL  252

Query  448  TKEVTKISNHGISV  407
             K +  +S+ G+SV
Sbjct  253  NKRIMGMSDLGVSV  266



>ref|NP_001143401.1| uncharacterized protein LOC100276044 [Zea mays]
 gb|ACF83116.1| unknown [Zea mays]
 gb|ACG31730.1| hypothetical protein [Zea mays]
 tpg|DAA45115.1| TPA: hypothetical protein ZEAMMB73_628651 [Zea mays]
Length=107

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = -1

Query  721  ELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKD  542
            E + SI  LK ES+         E ++ RG+T LR  GKQI+S+I S YK E  AAGL D
Sbjct  3    EYQTSIQNLKKESKYTLDKVAIGESDVQRGRTDLRSTGKQIQSLIGSIYKAESTAAGLMD  62

Query  541  VLKELPRREASLFRSQVSNLASEAKKERNFLTKEVTKISNHGISV  407
             L+ +P R++   R++V+++AS+ K +R  L + + KIS +G+ V
Sbjct  63   RLRTIPTRQSLELRAEVASMASDLKNQRCALQERINKISEYGVRV  107



>gb|EMS57790.1| hypothetical protein TRIUR3_22595 [Triticum urartu]
Length=122

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  805  PRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKT  626
            PRRFLY      F +E+ +L+  +  + E K SI+ L+ +S+      V  E +L RG+T
Sbjct  16   PRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGRT  75

Query  625  KLRQAGKQIRSVIRSAYKIERQAAG  551
             LR  GKQI+SVIRS YK E  AAG
Sbjct  76   DLRSTGKQIQSVIRSIYKAESTAAG  100



>gb|AIA25954.1| hypothetical protein, partial [Fargesia spathacea]
Length=96

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K S++ LK +S+         E +L RG+T LR  GKQI+S+  S YK
Sbjct  2    LLNDAEQSMMEYKTSLETLKKDSKYTLDKIAIGESDLQRGRTDLRSTGKQIQSLGSSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAK  467
             E  AAGL D L+ +P R++   R++V+++AS+ K
Sbjct  62   AESTAAGLMDRLRTIPTRQSLELRAEVASMASDLK  96



>gb|AIA25947.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25948.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25949.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25950.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25952.1| hypothetical protein, partial [Phyllostachys edulis]
Length=96

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K SI+ L+ +S+         E +L RG+T LR  GKQI+S+  S YK
Sbjct  2    LLNDAEQSMMEYKTSIENLQKDSKYTLDKIAIGESDLQRGQTDLRSTGKQIQSLGSSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAK  467
             E  AAGL D L+ +P R++   R++V+++AS+ K
Sbjct  62   AESTAAGLMDRLRTIPTRQSLELRAEVASMASDLK  96



>gb|AIA25953.1| hypothetical protein, partial [Fargesia spathacea]
Length=96

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K S + LK +S+         E +L RG+T LR  GKQI+S+  S YK
Sbjct  2    LLNDAEQSMMEYKTSFENLKKDSKYTLDKIAIGESDLQRGRTDLRSTGKQIQSLGSSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQVSNLASEAK  467
             E  AAGL D L+ +P R++   R++V+++AS+ K
Sbjct  62   AESTAAGLMDRLRTIPTRQSLELRAEVASMASDLK  96



>gb|KFM24094.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
Length=254

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/216 (24%), Positives = 99/216 (46%), Gaps = 11/216 (5%)
 Frame = -1

Query  1048  TVETVIESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIA  869
             T   V+ S+  V  S  ++  + +   ++Q        + +Y   E   FG +KEG+   
Sbjct  46    TASDVVRSSTAVATSEANKAASQAKDLYSQ-------AELQYKQGEAAAFGYLKEGVRTV  98

Query  868   ASHPLITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKA  689
               +   +    + +  +GL+ PRRFL+        SEEA+   A+ +   L + ++    
Sbjct  99    VDNKETSIAMAIGVAAIGLRGPRRFLWRHTLGRLRSEEAVFKSAELRSVVLAEKVEGQAL  158

Query  688   ESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAA----GLKDVLKELPR  521
             E +K ++    A+ E  RG +KL+    +++S+       ++ A+    GL   L+ LP 
Sbjct  159   ELKKLQERLGLAQAEYTRGLSKLKATASELQSLSSRIGGTQQTASGMWQGLVQDLRSLPS  218

Query  520   REASLFRSQVSNLASEAKKERNFLTKEVTKISNHGI  413
             + A   RS+V+   + A+ +R  + K V  ++  GI
Sbjct  219   KHALSLRSEVAQKLAVAETQRKAVDKLVLGLARQGI  254



>gb|AIA26009.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
Length=87

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K SI+ LK +S+         E +L RG+T LR  GKQI+S+I S YK
Sbjct  2    LLNDAEQCMMEYKTSIETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYK  61

Query  571  IERQAAGLKDVLKELPRREASLFRSQ  494
             E  AAGL   L+ +P R++   R++
Sbjct  62   AESTAAGLVAQLRTIPTRQSLELRAE  87



>ref|XP_005846915.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
 gb|EFN54813.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
Length=289

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 85/207 (41%), Gaps = 22/207 (11%)
 Frame = -1

Query  1015  VTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGI-CIAASHPLITTGA  839
               KSRL R   T  AH+  T              E      MK+G+  +   HP  +   
Sbjct  94    AVKSRLQRFYDTGLAHYQAT--------------EQQALELMKQGVRFVRKEHPEASMAT  139

Query  838   FLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKWEKNAV  659
              ++  F+ L  PRRFL       F SEEAM   A+ +   LK+  +    E +K + +  
Sbjct  140   GVAAFFVLLPGPRRFLLRHTIGRFRSEEAMFKSAEQRYAGLKEKAEGHNGELQKLQASTA  199

Query  658   Q-------AEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFR  500
                     AE E  RG+ KL+    ++ S+        + A  L   L+ELP ++A   R
Sbjct  200   VTQERLQLAELEYQRGRAKLKSTAGELESLASRVRGSSKAAKRLITDLRELPSKQALQLR  259

Query  499   SQVSNLASEAKKERNFLTKEVTKISNH  419
             S  +N A+    +   L K + +++  
Sbjct  260   SDAANTANTVGNQAKVLDKALRRVAKQ  286



>gb|KDD75675.1| hypothetical protein H632_c557p1 [Helicosporidium sp. ATCC 50920]
Length=259

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 95/207 (46%), Gaps = 7/207 (3%)
 Frame = -1

Query  1033  IESAITVTKSRLDRILTTSSAHFNQTLDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPL  854
             +  A     +++   L  +  + +Q   +L  ++A+        FG +KEG+  A  H  
Sbjct  60    LRGATAAAGAQVGEALAHAQGYVDQGRGTLAGLEAQ-------AFGLLKEGVRTAYEHQE  112

Query  853   ITTGAFLSLGFLGLKRPRRFLYYKARSIFVSEEAMLSKADAKVKELKKSIDFLKAESEKW  674
              T    L+   + L  PRR L+        S EA L  A+ + K L +++ F K E  K 
Sbjct  113   ATAAVALAAAAVLLPGPRRLLWRMTLGRLQSPEAGLRSAEQRAKALSEAVTFQKQEVSKL  172

Query  673   EKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYKIERQAAGLKDVLKELPRREASLFRSQ  494
             ++    A+ E  RG+ KL  + +++  + R   +    AA L+D L+ +   ++   RS 
Sbjct  173   QERVALAQAEYERGRNKLEASAEELAKLSRRMRRAHEGAAELQDDLRRMRLPQSVPLRSA  232

Query  493   VSNLASEAKKERNFLTKEVTKISNHGI  413
             V+  AS A+ +R  + + +  ++  GI
Sbjct  233   VAQHASTAEGQRKVVERMILDLARQGI  259



>emb|CDY35478.1| BnaC03g61820D [Brassica napus]
Length=110

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  955  LDSLQDVKAEYHLYEDLTFGRMKEGICIAASHPLITTGAFLSLGFLGLKRPRRF  794
            LDS++++ +EY++YE +   ++K+G+ +AASHPLI  G    +G   LK   +F
Sbjct  48   LDSIREIVSEYNVYEHMVITKIKDGVNVAASHPLIPGGLAFGVGVFALKSVLKF  101



>gb|AIA25951.1| hypothetical protein, partial [Phyllostachys nidularia]
Length=76

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -1

Query  751  MLSKADAKVKELKKSIDFLKAESEKWEKNAVQAEQELIRGKTKLRQAGKQIRSVIRSAYK  572
            +L+ A+  + E K SI+ L+ +S+         E +L RG+T LR  GKQI+S+  S YK
Sbjct  2    LLNDAEQSMMEYKTSIENLQKDSKYTLDKIAIGESDLQRGQTDLRSTGKQIQSLGSSIYK  61

Query  571  IERQAAGLKDVLKEL  527
             E  AAGL D L+ +
Sbjct  62   AESTAAGLMDRLRTI  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3416741294824