BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78192_g1_i1 len=2568 path=[2546:0-2567]

Length=2568
                                                                      Score     E

ref|XP_009589735.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1202   0.0      
ref|XP_009787011.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1190   0.0      
ref|XP_002532894.1|  Cyclic nucleotide-gated ion channel, putative     1181   0.0      Ricinus communis
ref|XP_006338398.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1178   0.0      
ref|XP_004232184.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1175   0.0      
ref|XP_004232185.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1172   0.0      
ref|XP_006373345.1|  hypothetical protein POPTR_0017s12550g            1168   0.0      
ref|XP_011035830.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1165   0.0      
gb|KDP27204.1|  hypothetical protein JCGZ_19903                        1161   0.0      
ref|XP_007032653.1|  Cyclic nucleotide-regulated ion channel fami...   1153   0.0      
gb|AAX18166.2|  CNGC2                                                  1139   0.0      Gossypium hirsutum [American cotton]
ref|XP_011085713.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1139   0.0      
ref|XP_006482709.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1138   0.0      
ref|XP_006431246.1|  hypothetical protein CICLE_v10011184mg            1137   0.0      
gb|EYU34629.1|  hypothetical protein MIMGU_mgv1a002175mg               1125   0.0      
ref|XP_003552549.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1116   0.0      
ref|XP_007139515.1|  hypothetical protein PHAVU_008G036200g            1111   0.0      
emb|CDP02281.1|  unnamed protein product                               1109   0.0      
ref|XP_010258180.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1105   0.0      
ref|XP_006585762.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1105   0.0      
ref|XP_008365415.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1103   0.0      
ref|XP_004491863.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1103   0.0      
ref|XP_004306106.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1101   0.0      
ref|XP_003531840.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1101   0.0      
ref|XP_009360567.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1100   0.0      
ref|XP_008341626.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1098   0.0      
ref|XP_007217012.1|  hypothetical protein PRUPE_ppa002126mg            1098   0.0      
ref|XP_009365836.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1094   0.0      
ref|XP_007032654.1|  Cyclic nucleotide-regulated ion channel fami...   1093   0.0      
gb|AIT39758.1|  cyclic nucleotide gated ion channel 2 like             1093   0.0      
ref|XP_009365837.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1090   0.0      
ref|XP_010258957.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1089   0.0      
ref|XP_002284164.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1086   0.0      Vitis vinifera
ref|XP_010029345.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1081   0.0      
gb|KCW56239.1|  hypothetical protein EUGRSUZ_I01988                    1079   0.0      
ref|XP_010089586.1|  hypothetical protein L484_020976                  1073   0.0      
ref|XP_003621352.1|  Cyclic nucleotide-gated ion channel               1069   0.0      
ref|XP_008230836.1|  PREDICTED: LOW QUALITY PROTEIN: cyclic nucle...   1064   0.0      
ref|XP_011098700.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1063   0.0      
gb|ACA58352.1|  putative cyclic nucleotide-gated cation channel        1051   0.0      Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_006287115.1|  hypothetical protein CARUB_v10000276mg            1048   0.0      
ref|XP_010550023.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1045   0.0      
ref|XP_006400062.1|  hypothetical protein EUTSA_v10012798mg            1041   0.0      
ref|XP_010420197.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1040   0.0      
ref|XP_002873723.1|  hypothetical protein ARALYDRAFT_488387            1040   0.0      
ref|XP_010453677.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1039   0.0      
ref|XP_010492375.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1037   0.0      
emb|CDY26422.1|  BnaC09g42460D                                         1033   0.0      
ref|XP_009416822.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1032   0.0      
ref|NP_197045.1|  cyclic nucleotide-gated ion channel 2                1030   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99132.1|  cyclic nucleotide-gated cation channel                1030   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU44163.1|  hypothetical protein MIMGU_mgv1a0024531mg              1029   0.0      
ref|XP_009121575.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1027   0.0      
emb|CDX69525.1|  BnaA10g18740D                                         1026   0.0      
ref|XP_008777824.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1025   0.0      
ref|NP_974783.2|  cyclic nucleotide-gated ion channel 2                1025   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK25788.1|  hypothetical protein AALP_AA8G160300                   1023   0.0      
ref|XP_008785947.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1018   0.0      
ref|XP_009419077.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1015   0.0      
ref|XP_008379847.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1015   0.0      
ref|XP_004141458.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1014   0.0      
gb|KGN52496.1|  hypothetical protein Csa_5G638350                      1014   0.0      
ref|XP_010939040.1|  PREDICTED: LOW QUALITY PROTEIN: cyclic nucle...   1010   0.0      
gb|KDO72686.1|  hypothetical protein CISIN_1g007897mg                  1010   0.0      
ref|XP_008459361.1|  PREDICTED: cyclic nucleotide-gated ion chann...   1008   0.0      
ref|XP_010923647.1|  PREDICTED: cyclic nucleotide-gated ion chann...    998   0.0      
gb|KHG01341.1|  Cyclic nucleotide-gated ion channel 2 -like protein     989   0.0      
ref|XP_010674211.1|  PREDICTED: cyclic nucleotide-gated ion chann...    976   0.0      
ref|XP_002323883.2|  hypothetical protein POPTR_0017s12570g             972   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010229618.1|  PREDICTED: cyclic nucleotide-gated ion chann...    971   0.0      
ref|XP_010229614.1|  PREDICTED: cyclic nucleotide-gated ion chann...    971   0.0      
ref|XP_011035831.1|  PREDICTED: cyclic nucleotide-gated ion chann...    970   0.0      
ref|XP_010936396.1|  PREDICTED: cyclic nucleotide-gated ion chann...    964   0.0      
ref|XP_004981703.1|  PREDICTED: cyclic nucleotide-gated ion chann...    963   0.0      
ref|XP_010904936.1|  PREDICTED: cyclic nucleotide-gated ion chann...    962   0.0      
gb|EEC76211.1|  hypothetical protein OsI_13606                          959   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAJ99130.1|  predicted protein                                      959   0.0      
ref|XP_002466423.1|  hypothetical protein SORBIDRAFT_01g007550          956   0.0      Sorghum bicolor [broomcorn]
ref|XP_007032655.1|  Cyclic nucleotide-regulated ion channel fami...    955   0.0      
ref|XP_008666390.1|  PREDICTED: uncharacterized protein LOC100272...    950   0.0      
dbj|BAM44886.1|  cyclic nucleotide gated channel 2                      950   0.0      
dbj|BAM44885.1|  cyclic nucleotide gated channel 2                      949   0.0      
dbj|BAM44884.1|  cyclic nucleotide gated channel 2                      945   0.0      
dbj|BAM44881.1|  cyclic nucleotide gated channel 2                      945   0.0      
dbj|BAM44883.1|  cyclic nucleotide gated channel 2                      945   0.0      
ref|XP_008792776.1|  PREDICTED: cyclic nucleotide-gated ion chann...    944   0.0      
ref|XP_008680983.1|  PREDICTED: uncharacterized protein LOC100191...    938   0.0      
gb|AFW67569.1|  hypothetical protein ZEAMMB73_354655                    938   0.0      
ref|XP_010034400.1|  PREDICTED: cyclic nucleotide-gated ion chann...    915   0.0      
gb|AAK16188.1|AC079887_20  putative cyclic nucleotide and calmodu...    912   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KCW51913.1|  hypothetical protein EUGRSUZ_J01368                     908   0.0      
ref|XP_009405110.1|  PREDICTED: cyclic nucleotide-gated ion chann...    906   0.0      
ref|NP_001051331.1|  Os03g0758300                                       895   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008666400.1|  PREDICTED: uncharacterized protein LOC100272...    889   0.0      
dbj|BAM44882.1|  cyclic nucleotide gated channel 2                      882   0.0      
gb|KHM98806.1|  Cyclic nucleotide-gated ion channel 2                   880   0.0      
emb|CDP02280.1|  unnamed protein product                                877   0.0      
ref|XP_011085714.1|  PREDICTED: cyclic nucleotide-gated ion chann...    870   0.0      
ref|XP_011085717.1|  PREDICTED: cyclic nucleotide-gated ion chann...    870   0.0      
gb|AAY58313.1|  cyclic nucleotide-gated ion channel 2                   868   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_006373346.1|  hypothetical protein POPTR_0017s12550g             831   0.0      
ref|XP_009370501.1|  PREDICTED: cyclic nucleotide-gated ion chann...    833   0.0      
ref|XP_009372825.1|  PREDICTED: cyclic nucleotide-gated ion chann...    831   0.0      
ref|XP_006482704.1|  PREDICTED: cyclic nucleotide-gated ion chann...    828   0.0      
ref|XP_006482706.1|  PREDICTED: cyclic nucleotide-gated ion chann...    828   0.0      
ref|XP_006431245.1|  hypothetical protein CICLE_v10011242mg             828   0.0      
ref|XP_010551825.1|  PREDICTED: cyclic nucleotide-gated ion chann...    825   0.0      
ref|XP_007220842.1|  hypothetical protein PRUPE_ppa024719mg             822   0.0      
ref|XP_008234503.1|  PREDICTED: cyclic nucleotide-gated ion chann...    810   0.0      
ref|XP_006651833.1|  PREDICTED: cyclic nucleotide-gated ion chann...    801   0.0      
ref|XP_004309022.1|  PREDICTED: cyclic nucleotide-gated ion chann...    775   0.0      
ref|XP_006482708.1|  PREDICTED: cyclic nucleotide-gated ion chann...    764   0.0      
gb|KHN13581.1|  Cyclic nucleotide-gated ion channel 2                   757   0.0      
gb|KHG13041.1|  Cyclic nucleotide-gated ion channel 2 -like protein     758   0.0      
ref|XP_010551827.1|  PREDICTED: cyclic nucleotide-gated ion chann...    761   0.0      
ref|XP_004156212.1|  PREDICTED: cyclic nucleotide-gated ion chann...    742   0.0      
gb|EPS58125.1|  hypothetical protein M569_16691                         721   0.0      
ref|XP_007032657.1|  Cyclic nucleotide-regulated ion channel fami...    671   0.0      
ref|NP_001130650.1|  uncharacterized protein LOC100191751               665   0.0      Zea mays [maize]
ref|XP_002980676.1|  hypothetical protein SELMODRAFT_112824             672   0.0      
ref|XP_002976933.1|  hypothetical protein SELMODRAFT_416791             670   0.0      
gb|KDP27205.1|  hypothetical protein JCGZ_19904                         657   0.0      
ref|XP_008785948.1|  PREDICTED: cyclic nucleotide-gated ion chann...    654   0.0      
gb|EPS68288.1|  cyclic nucleotide-gated ion channel 2                   650   0.0      
ref|XP_006841828.1|  hypothetical protein AMTR_s00003p00270020          654   0.0      
ref|XP_008805117.1|  PREDICTED: cyclic nucleotide-gated ion chann...    641   0.0      
ref|XP_010268849.1|  PREDICTED: cyclic nucleotide-gated ion chann...    640   0.0      
ref|XP_011085718.1|  PREDICTED: cyclic nucleotide-gated ion chann...    636   0.0      
emb|CDP05851.1|  unnamed protein product                                639   0.0      
ref|XP_009334580.1|  PREDICTED: cyclic nucleotide-gated ion chann...    639   0.0      
ref|XP_004149297.1|  PREDICTED: cyclic nucleotide-gated ion chann...    633   0.0      
ref|XP_004167598.1|  PREDICTED: cyclic nucleotide-gated ion chann...    634   0.0      
ref|XP_008366405.1|  PREDICTED: cyclic nucleotide-gated ion chann...    634   0.0      
ref|XP_008452299.1|  PREDICTED: cyclic nucleotide-gated ion chann...    633   0.0      
ref|XP_002525760.1|  Cyclic nucleotide-gated ion channel, putative      633   0.0      Ricinus communis
ref|XP_007213607.1|  hypothetical protein PRUPE_ppa002333mg             633   0.0      
ref|XP_011095264.1|  PREDICTED: cyclic nucleotide-gated ion chann...    632   0.0      
ref|XP_008386094.1|  PREDICTED: cyclic nucleotide-gated ion chann...    631   0.0      
ref|XP_008226715.1|  PREDICTED: cyclic nucleotide-gated ion chann...    629   0.0      
ref|XP_003634689.2|  PREDICTED: cyclic nucleotide-gated ion chann...    629   0.0      
gb|KDP38949.1|  hypothetical protein JCGZ_00706                         628   0.0      
ref|XP_007021254.1|  Cyclic nucleotide-gated ion channel 4 isoform 1    632   0.0      
ref|XP_004294484.1|  PREDICTED: cyclic nucleotide-gated ion chann...    627   0.0      
ref|XP_006452002.1|  hypothetical protein CICLE_v10010507mg             627   0.0      
gb|KEH19596.1|  cyclic nucleotide-gated ion channel-like protein        625   0.0      
ref|XP_010101777.1|  hypothetical protein L484_018733                   625   0.0      
ref|XP_010062911.1|  PREDICTED: cyclic nucleotide-gated ion chann...    623   0.0      
gb|EYU19163.1|  hypothetical protein MIMGU_mgv1a002305mg                620   0.0      
ref|XP_009613618.1|  PREDICTED: cyclic nucleotide-gated ion chann...    620   0.0      
ref|XP_009765747.1|  PREDICTED: cyclic nucleotide-gated ion chann...    620   0.0      
ref|XP_007149641.1|  hypothetical protein PHAVU_005G086600g             619   0.0      
ref|XP_010904922.1|  PREDICTED: cyclic nucleotide-gated ion chann...    619   0.0      
gb|KFK27042.1|  hypothetical protein AALP_AA8G326400                    618   0.0      
ref|XP_006401592.1|  hypothetical protein EUTSA_v10012835mg             618   0.0      
ref|XP_011044529.1|  PREDICTED: cyclic nucleotide-gated ion chann...    617   0.0      
ref|XP_009792554.1|  PREDICTED: cyclic nucleotide-gated ion chann...    615   0.0      
ref|XP_008812641.1|  PREDICTED: cyclic nucleotide-gated ion chann...    614   0.0      
ref|XP_004510076.1|  PREDICTED: cyclic nucleotide-gated ion chann...    615   0.0      
ref|XP_006370343.1|  hypothetical protein POPTR_0001s41830g             616   0.0      
ref|XP_003539580.1|  PREDICTED: cyclic nucleotide-gated ion chann...    615   0.0      
ref|XP_006367652.1|  PREDICTED: cyclic nucleotide-gated ion chann...    613   0.0      
ref|XP_007132934.1|  hypothetical protein PHAVU_011G137200g             616   0.0      
emb|CDY18313.1|  BnaC09g30630D                                          613   0.0      
ref|XP_006362932.1|  PREDICTED: cyclic nucleotide-gated ion chann...    611   0.0      
ref|XP_009119956.1|  PREDICTED: cyclic nucleotide-gated ion chann...    612   0.0      
ref|XP_010443001.1|  PREDICTED: cyclic nucleotide-gated ion chann...    611   0.0      
ref|NP_200236.1|  cyclic nucleotide-gated ion channel 4                 610   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248279.1|  PREDICTED: cyclic nucleotide-gated ion chann...    608   0.0      
gb|KHG27716.1|  Cyclic nucleotide-gated ion channel 4 -like protein     610   0.0      
ref|XP_004251491.1|  PREDICTED: cyclic nucleotide-gated ion chann...    609   0.0      
emb|CDY14322.1|  BnaA10g07330D                                          609   0.0      
ref|XP_009792556.1|  PREDICTED: cyclic nucleotide-gated ion chann...    607   0.0      
ref|XP_010538051.1|  PREDICTED: LOW QUALITY PROTEIN: cyclic nucle...    609   0.0      
ref|XP_002866035.1|  ATCNGC4                                            608   0.0      
ref|XP_010482832.1|  PREDICTED: cyclic nucleotide-gated ion chann...    608   0.0      
ref|XP_008777136.1|  PREDICTED: cyclic nucleotide-gated ion chann...    607   0.0      
gb|AAP38213.1|  putative cyclic nucleotide and calmodulin-regulat...    597   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_010446700.1|  PREDICTED: cyclic nucleotide-gated ion chann...    608   0.0      
ref|XP_009589775.1|  PREDICTED: cyclic nucleotide-gated ion chann...    605   0.0      
ref|XP_009127107.1|  PREDICTED: cyclic nucleotide-gated ion chann...    607   0.0      
ref|XP_008376367.1|  PREDICTED: cyclic nucleotide-gated ion chann...    598   0.0      
ref|XP_003526201.1|  PREDICTED: cyclic nucleotide-gated ion chann...    606   0.0      
ref|XP_010904933.1|  PREDICTED: cyclic nucleotide-gated ion chann...    604   0.0      
emb|CDY28787.1|  BnaA02g09790D                                          602   0.0      
ref|XP_003541002.1|  PREDICTED: cyclic nucleotide-gated ion chann...    604   0.0      
gb|EPS70503.1|  hypothetical protein M569_04242                         600   0.0      
ref|XP_006280133.1|  hypothetical protein CARUB_v10026031mg             602   0.0      
ref|XP_010694435.1|  PREDICTED: cyclic nucleotide-gated ion chann...    602   0.0      
ref|XP_009392575.1|  PREDICTED: cyclic nucleotide-gated ion chann...    598   0.0      
ref|NP_001190536.1|  cyclic nucleotide-gated ion channel 4              596   0.0      
ref|XP_002989263.1|  hypothetical protein SELMODRAFT_129465             595   0.0      
ref|XP_010277927.1|  PREDICTED: cyclic nucleotide-gated ion chann...    595   0.0      
ref|XP_009402606.1|  PREDICTED: cyclic nucleotide-gated ion chann...    593   0.0      
ref|XP_002965652.1|  hypothetical protein SELMODRAFT_84488              593   0.0      
ref|XP_007032656.1|  Cyclic nucleotide-regulated ion channel fami...    590   0.0      
ref|XP_001768026.1|  predicted protein                                  584   0.0      
ref|XP_004487653.1|  PREDICTED: cyclic nucleotide-gated ion chann...    580   0.0      
ref|XP_003568162.1|  PREDICTED: cyclic nucleotide-gated ion chann...    576   0.0      
ref|XP_002458600.1|  hypothetical protein SORBIDRAFT_03g036490          571   0.0      Sorghum bicolor [broomcorn]
ref|XP_004972200.1|  PREDICTED: cyclic nucleotide-gated ion chann...    567   0.0      
gb|KHN47873.1|  Cyclic nucleotide-gated ion channel 4                   563   0.0      
gb|AES66743.2|  cyclic nucleotide-gated ion channel-like protein        566   0.0      
gb|ACN33282.1|  unknown                                                 565   0.0      Zea mays [maize]
emb|CDM84450.1|  unnamed protein product                                565   0.0      
gb|EAY98601.1|  hypothetical protein OsI_20517                          564   0.0      Oryza sativa Indica Group [Indian rice]
gb|ACF84256.1|  unknown                                                 552   0.0      Zea mays [maize]
ref|XP_008655080.1|  PREDICTED: cyclic nucleotide-gated ion chann...    563   0.0      
ref|NP_001141448.1|  uncharacterized protein LOC100273558               563   0.0      Zea mays [maize]
gb|AAY58304.1|  cyclic nucleotide-gated ion channel 4                   563   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_009419614.1|  PREDICTED: cyclic nucleotide-gated ion chann...    561   0.0      
dbj|BAJ97059.1|  predicted protein                                      563   0.0      
dbj|BAK01648.1|  predicted protein                                      563   0.0      
ref|NP_001055973.1|  Os05g0502000                                       563   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655079.1|  PREDICTED: cyclic nucleotide-gated ion chann...    560   0.0      
emb|CBI20380.3|  unnamed protein product                                556   0.0      
ref|XP_003567182.1|  PREDICTED: cyclic nucleotide-gated ion chann...    557   0.0      
ref|XP_004961594.1|  PREDICTED: cyclic nucleotide-gated ion chann...    556   0.0      
ref|XP_003596492.1|  Cyclic nucleotide-gated ion channel                553   0.0      
ref|XP_009765748.1|  PREDICTED: cyclic nucleotide-gated ion chann...    550   0.0      
ref|NP_001172593.1|  Os01g0782700                                       548   1e-180   
ref|XP_006646393.1|  PREDICTED: cyclic nucleotide-gated ion chann...    547   1e-180   
gb|EAY76065.1|  hypothetical protein OsI_03993                          548   1e-180   Oryza sativa Indica Group [Indian rice]
gb|AAP38210.1|  putative cyclic nucleotide and calmodulin-regulat...    528   5e-174   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002526068.1|  Cyclic nucleotide-gated ion channel, putative      514   4e-172   Ricinus communis
ref|XP_001767134.1|  predicted protein                                  513   5e-169   
ref|XP_010661110.1|  PREDICTED: cyclic nucleotide-gated ion chann...    512   2e-167   
gb|AFW84890.1|  cyclic nucleotide-gated ion channel 2                   506   8e-167   
gb|KHN28017.1|  Cyclic nucleotide-gated ion channel 4                   504   1e-166   
ref|XP_002440030.1|  hypothetical protein SORBIDRAFT_09g024770          507   8e-165   Sorghum bicolor [broomcorn]
gb|ACL53896.1|  unknown                                                 498   1e-163   Zea mays [maize]
gb|AAY58309.1|  cyclic nucleotide-gated ion channel 4                   496   3e-163   Hordeum vulgare subsp. vulgare [barley]
gb|EEE64270.1|  hypothetical protein OsJ_19103                          494   2e-162   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151488.1|  cyclic nucleotide-gated ion channel 2              492   1e-161   Zea mays [maize]
gb|ACG46083.1|  cyclic nucleotide-gated ion channel 2                   492   2e-161   Zea mays [maize]
gb|KHG15403.1|  Cyclic nucleotide-gated ion channel 2 -like protein     459   3e-150   
dbj|BAJ33894.1|  unnamed protein product                                457   6e-146   
ref|XP_007021255.1|  Cyclic nucleotide-gated ion channel 4 isoform 2    452   1e-143   
emb|CAN75352.1|  hypothetical protein VITISV_031046                     448   2e-141   Vitis vinifera
ref|XP_009792557.1|  PREDICTED: cyclic nucleotide-gated ion chann...    443   2e-141   
ref|XP_006655461.1|  PREDICTED: cyclic nucleotide-gated ion chann...    432   6e-139   
emb|CDY66570.1|  BnaC02g44680D                                          429   2e-136   
ref|XP_006848731.1|  hypothetical protein AMTR_s00177p00063110          411   2e-133   
ref|NP_001140335.1|  uncharacterized protein LOC100272382               407   4e-132   Zea mays [maize]
gb|KHN31833.1|  Putative cyclic nucleotide-gated ion channel 17         406   5e-126   
ref|XP_003522943.1|  PREDICTED: probable cyclic nucleotide-gated ...    407   9e-126   
dbj|BAK06788.1|  predicted protein                                      393   2e-125   
ref|XP_007138411.1|  hypothetical protein PHAVU_009G206600g             403   2e-124   
gb|KHN08735.1|  Putative cyclic nucleotide-gated ion channel 17         402   4e-124   
ref|XP_010278052.1|  PREDICTED: probable cyclic nucleotide-gated ...    403   5e-124   
ref|XP_006582102.1|  PREDICTED: probable cyclic nucleotide-gated ...    402   5e-124   
ref|XP_010671493.1|  PREDICTED: cyclic nucleotide-gated ion chann...    400   2e-123   
ref|XP_002984030.1|  hypothetical protein SELMODRAFT_119500             398   5e-123   
ref|XP_010251499.1|  PREDICTED: probable cyclic nucleotide-gated ...    398   5e-123   
ref|XP_002960111.1|  hypothetical protein SELMODRAFT_266514             397   6e-123   
ref|XP_010692997.1|  PREDICTED: probable cyclic nucleotide-gated ...    400   7e-123   
ref|XP_004507742.1|  PREDICTED: probable cyclic nucleotide-gated ...    399   8e-123   
ref|XP_004507740.1|  PREDICTED: probable cyclic nucleotide-gated ...    400   8e-123   
ref|XP_007016780.1|  Cyclic nucleotide-gated channel 15                 399   9e-123   
ref|XP_010251498.1|  PREDICTED: probable cyclic nucleotide-gated ...    398   3e-122   
gb|AAD23886.1|  putative cyclic nucleotide-regulated ion channel ...    397   3e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788856.1|  PREDICTED: cyclic nucleotide-gated ion chann...    397   4e-122   
gb|KEH38064.1|  cyclic nucleotide-gated ion channel-like protein        396   4e-122   
ref|XP_010048378.1|  PREDICTED: probable cyclic nucleotide-gated ...    397   6e-122   
ref|XP_007154880.1|  hypothetical protein PHAVU_003G155800g             397   6e-122   
ref|NP_850056.1|  cyclic nucleotide-gated channel 14                    397   7e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251495.1|  PREDICTED: probable cyclic nucleotide-gated ...    397   7e-122   
gb|EPS66346.1|  hypothetical protein M569_08426                         394   9e-122   
ref|XP_006280134.1|  hypothetical protein CARUB_v10026031mg             389   1e-121   
ref|XP_006488071.1|  PREDICTED: putative cyclic nucleotide-gated ...    394   3e-121   
ref|XP_002878771.1|  hypothetical protein ARALYDRAFT_481319             395   3e-121   
ref|XP_006424547.1|  hypothetical protein CICLE_v10027932mg             394   3e-121   
ref|XP_011082041.1|  PREDICTED: probable cyclic nucleotide-gated ...    394   7e-121   
ref|XP_006581411.1|  PREDICTED: probable cyclic nucleotide-gated ...    394   9e-121   
ref|XP_011034555.1|  PREDICTED: putative cyclic nucleotide-gated ...    394   2e-120   
ref|XP_003540100.1|  PREDICTED: probable cyclic nucleotide-gated ...    393   2e-120   
ref|XP_003610314.1|  CNGC5-like protein                                 393   3e-120   
ref|XP_006368503.1|  cyclic nucleotide gated channel 7 family pro...    392   5e-120   
ref|XP_008242994.1|  PREDICTED: probable cyclic nucleotide-gated ...    390   6e-120   
ref|NP_001151461.1|  LOC100285094                                       391   7e-120   Zea mays [maize]
emb|CBI16330.3|  unnamed protein product                                391   7e-120   
ref|XP_002282455.1|  PREDICTED: putative cyclic nucleotide-gated ...    391   7e-120   
ref|XP_009368463.1|  PREDICTED: probable cyclic nucleotide-gated ...    391   8e-120   
ref|XP_008677361.1|  PREDICTED: LOC100285094 isoform X1                 391   8e-120   
ref|XP_008783842.1|  PREDICTED: cyclic nucleotide-gated ion chann...    390   1e-119   
ref|XP_008242993.1|  PREDICTED: probable cyclic nucleotide-gated ...    391   1e-119   
ref|XP_011018128.1|  PREDICTED: probable cyclic nucleotide-gated ...    391   2e-119   
ref|XP_011077699.1|  PREDICTED: probable cyclic nucleotide-gated ...    390   2e-119   
ref|XP_010474728.1|  PREDICTED: probable cyclic nucleotide-gated ...    390   2e-119   
ref|XP_008367750.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   2e-119   
gb|KDP38683.1|  hypothetical protein JCGZ_04036                         390   2e-119   
ref|XP_002304729.2|  hypothetical protein POPTR_0003s18120g             391   2e-119   
ref|XP_008443796.1|  PREDICTED: probable cyclic nucleotide-gated ...    390   2e-119   
gb|EPS63081.1|  hypothetical protein M569_11705                         389   3e-119   
ref|XP_002512726.1|  Cyclic nucleotide-gated ion channel, putative      397   3e-119   
ref|XP_009366181.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   3e-119   
ref|XP_004245310.1|  PREDICTED: probable cyclic nucleotide-gated ...    390   3e-119   
ref|XP_002529385.1|  Cyclic nucleotide-gated ion channel, putative      390   3e-119   
ref|XP_010063578.1|  PREDICTED: putative cyclic nucleotide-gated ...    391   3e-119   
emb|CDP02921.1|  unnamed protein product                                390   4e-119   
ref|XP_008348631.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   5e-119   
ref|XP_006343649.1|  PREDICTED: probable cyclic nucleotide-gated ...    390   5e-119   
ref|XP_007137129.1|  hypothetical protein PHAVU_009G102100g             389   5e-119   
ref|XP_010462522.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   6e-119   
ref|XP_004169067.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   6e-119   
ref|XP_011020599.1|  PREDICTED: putative cyclic nucleotide-gated ...    389   7e-119   
ref|XP_006453463.1|  hypothetical protein CICLE_v10007594mg             389   7e-119   
ref|XP_001776829.1|  predicted protein                                  384   8e-119   
ref|XP_009405709.1|  PREDICTED: cyclic nucleotide-gated ion chann...    387   8e-119   
ref|XP_003549541.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   1e-118   
ref|XP_008466292.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   1e-118   
ref|XP_007038982.1|  Cyclic nucleotide gated channel 1 isoform 1        388   1e-118   
ref|XP_002278464.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   1e-118   
ref|XP_010656612.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   1e-118   
ref|XP_009366180.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   1e-118   
ref|XP_010234108.1|  PREDICTED: cyclic nucleotide-gated ion chann...    387   1e-118   
ref|XP_009787244.1|  PREDICTED: probable cyclic nucleotide-gated ...    389   1e-118   
ref|XP_010929223.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   1e-118   
ref|XP_008794413.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   1e-118   
ref|XP_010914081.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   1e-118   
ref|XP_009787468.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   2e-118   
ref|XP_004242592.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   2e-118   
ref|XP_010941336.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   2e-118   
ref|XP_007204256.1|  hypothetical protein PRUPE_ppa001993mg             388   2e-118   
gb|KDO62388.1|  hypothetical protein CISIN_1g004506mg                   389   2e-118   
ref|XP_009379504.1|  PREDICTED: probable cyclic nucleotide-gated ...    388   2e-118   
ref|XP_003572098.1|  PREDICTED: cyclic nucleotide-gated ion chann...    387   2e-118   
ref|XP_009600937.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   3e-118   
emb|CDP10239.1|  unnamed protein product                                388   3e-118   
ref|XP_008384360.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   3e-118   
gb|KDP41965.1|  hypothetical protein JCGZ_26983                         387   3e-118   
gb|AHN53203.1|  cyclic nucleotide-gated ion channel 5                   387   4e-118   
ref|XP_010915663.1|  PREDICTED: cyclic nucleotide-gated ion chann...    386   4e-118   
ref|XP_008343895.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   4e-118   
ref|XP_009616554.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   4e-118   
ref|XP_008809584.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   5e-118   
emb|CDY33362.1|  BnaC05g12210D                                          387   5e-118   
ref|XP_008787797.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   5e-118   
ref|XP_007225213.1|  hypothetical protein PRUPE_ppa001990mg             387   6e-118   
gb|KHN04121.1|  Cyclic nucleotide-gated ion channel 1                   384   7e-118   
ref|XP_006416856.1|  hypothetical protein EUTSA_v10009463mg             386   7e-118   
ref|XP_004149882.1|  PREDICTED: probable cyclic nucleotide-gated ...    387   7e-118   
ref|XP_003519149.1|  PREDICTED: probable cyclic nucleotide-gated ...    386   7e-118   
emb|CBI24092.3|  unnamed protein product                                386   7e-118   
ref|XP_008340634.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyc...    386   8e-118   
emb|CDY35058.1|  BnaA06g10680D                                          386   9e-118   
ref|XP_006355198.1|  PREDICTED: probable cyclic nucleotide-gated ...    386   1e-117   
ref|XP_007161376.1|  hypothetical protein PHAVU_001G063700g             385   1e-117   
ref|XP_003544128.1|  PREDICTED: cyclic nucleotide-gated ion chann...    385   1e-117   
ref|XP_009358434.1|  PREDICTED: probable cyclic nucleotide-gated ...    386   1e-117   
ref|XP_009103668.1|  PREDICTED: putative cyclic nucleotide-gated ...    384   1e-117   
ref|XP_010542584.1|  PREDICTED: putative cyclic nucleotide-gated ...    384   2e-117   
ref|XP_010546020.1|  PREDICTED: probable cyclic nucleotide-gated ...    384   2e-117   
ref|XP_004242662.1|  PREDICTED: probable cyclic nucleotide-gated ...    385   2e-117   
pir||T10541  cyclic nucleotide gated channel homolog F3I3.30 - Ar...    384   3e-117
ref|XP_009336790.1|  PREDICTED: cyclic nucleotide-gated ion chann...    384   3e-117   
ref|XP_010525915.1|  PREDICTED: probable cyclic nucleotide-gated ...    385   3e-117   
gb|KHG10918.1|  Cyclic nucleotide-gated ion channel 1 -like protein     384   3e-117   
gb|KDP34243.1|  hypothetical protein JCGZ_07814                         384   3e-117   
ref|XP_002264416.2|  PREDICTED: probable cyclic nucleotide-gated ...    384   4e-117   
ref|XP_010925731.1|  PREDICTED: cyclic nucleotide-gated ion chann...    384   4e-117   
ref|XP_004145926.1|  PREDICTED: cyclic nucleotide-gated ion chann...    384   4e-117   
ref|XP_009593887.1|  PREDICTED: probable cyclic nucleotide-gated ...    384   4e-117   
ref|NP_173051.1|  cyclic nucleotide gated channel 7                     384   4e-117   
ref|XP_010648838.1|  PREDICTED: probable cyclic nucleotide-gated ...    385   4e-117   
ref|XP_010253719.1|  PREDICTED: putative cyclic nucleotide-gated ...    384   5e-117   
sp|Q9S9N5.1|CNGC7_ARATH  RecName: Full=Putative cyclic nucleotide...    384   5e-117   
ref|XP_008223544.1|  PREDICTED: probable cyclic nucleotide-gated ...    384   5e-117   
ref|XP_004136445.1|  PREDICTED: probable cyclic nucleotide-gated ...    384   5e-117   
emb|CAN83465.1|  hypothetical protein VITISV_038667                     384   6e-117   
ref|XP_006578923.1|  PREDICTED: cyclic nucleotide-gated ion chann...    384   6e-117   
ref|XP_007011917.1|  Cyclic nucleotide gated channel 5 isoform 1        384   6e-117   
ref|XP_008223542.1|  PREDICTED: probable cyclic nucleotide-gated ...    384   6e-117   
ref|XP_009401285.1|  PREDICTED: putative cyclic nucleotide-gated ...    384   6e-117   
ref|NP_192010.2|  cyclic nucleotide-gated channel 13                    383   7e-117   
gb|EYU34343.1|  hypothetical protein MIMGU_mgv1a001946mg                384   9e-117   
gb|EMT15005.1|  hypothetical protein F775_21988                         371   9e-117   
gb|KEH40404.1|  cyclic nucleotide-gated ion channel-like protein        383   1e-116   
ref|XP_004291702.1|  PREDICTED: putative cyclic nucleotide-gated ...    382   1e-116   
ref|XP_006412715.1|  hypothetical protein EUTSA_v10024525mg             383   1e-116   
ref|XP_010048796.1|  PREDICTED: probable cyclic nucleotide-gated ...    382   1e-116   
ref|NP_180393.1|  cyclic nucleotide-gated channel 15                    382   1e-116   
ref|XP_011079403.1|  PREDICTED: probable cyclic nucleotide-gated ...    383   1e-116   
ref|XP_010268357.1|  PREDICTED: probable cyclic nucleotide-gated ...    383   1e-116   
ref|XP_009383566.1|  PREDICTED: putative cyclic nucleotide-gated ...    382   2e-116   
ref|XP_009614625.1|  PREDICTED: probable cyclic nucleotide-gated ...    382   2e-116   
ref|XP_006843330.1|  hypothetical protein AMTR_s00053p00015490          382   2e-116   
ref|XP_004308001.1|  PREDICTED: cyclic nucleotide-gated ion chann...    382   2e-116   
ref|NP_001184885.1|  cyclic nucleotide gated channel 10                 382   2e-116   
ref|XP_010476698.1|  PREDICTED: putative cyclic nucleotide-gated ...    383   2e-116   
ref|XP_010459135.1|  PREDICTED: putative cyclic nucleotide-gated ...    383   2e-116   
ref|NP_563625.1|  cyclic nucleotide gated channel 10                    382   2e-116   
ref|XP_011001886.1|  PREDICTED: cyclic nucleotide-gated ion chann...    382   2e-116   
ref|XP_006401149.1|  hypothetical protein EUTSA_v10012803mg             382   2e-116   
gb|KCW81116.1|  hypothetical protein EUGRSUZ_C02494                     380   3e-116   
ref|XP_002892890.1|  predicted protein                                  382   3e-116   
ref|XP_006845498.1|  hypothetical protein AMTR_s00019p00152360          382   3e-116   
ref|XP_010472393.1|  PREDICTED: probable cyclic nucleotide-gated ...    382   3e-116   
ref|XP_006306900.1|  hypothetical protein CARUB_v10008459mg             381   4e-116   
ref|XP_010555719.1|  PREDICTED: cyclic nucleotide-gated ion chann...    382   4e-116   
ref|XP_010048794.1|  PREDICTED: probable cyclic nucleotide-gated ...    382   4e-116   
ref|XP_009409792.1|  PREDICTED: probable cyclic nucleotide-gated ...    381   4e-116   
gb|KGN59614.1|  hypothetical protein Csa_3G829040                       380   5e-116   
ref|XP_008680847.1|  PREDICTED: cyclic nucleotide-gated ion chann...    379   5e-116   
ref|XP_010251302.1|  PREDICTED: putative cyclic nucleotide-gated ...    380   5e-116   
ref|XP_009149039.1|  PREDICTED: putative cyclic nucleotide-gated ...    382   5e-116   
ref|NP_173408.2|  cyclic nucleotide gated channel 8                     382   5e-116   
ref|XP_003526699.1|  PREDICTED: cyclic nucleotide-gated ion chann...    381   6e-116   
emb|CDX68651.1|  BnaC01g08020D                                          381   6e-116   
emb|CDP12464.1|  unnamed protein product                                382   6e-116   
ref|XP_010923827.1|  PREDICTED: probable cyclic nucleotide-gated ...    381   7e-116   
ref|XP_002325129.2|  cyclic nucleotide-gated ion channel 5 family...    381   7e-116   
ref|NP_194765.2|  cyclic nucleotide-gated channel 17                    381   7e-116   
gb|KCW51375.1|  hypothetical protein EUGRSUZ_J00919                     377   7e-116   
ref|XP_002872915.1|  ATCNGC13                                           380   7e-116   
ref|XP_009409791.1|  PREDICTED: probable cyclic nucleotide-gated ...    381   8e-116   
ref|XP_009795112.1|  PREDICTED: probable cyclic nucleotide-gated ...    380   8e-116   
ref|XP_010103211.1|  Cyclic nucleotide-gated ion channel 1              380   8e-116   
gb|KGN46846.1|  hypothetical protein Csa_6G146420                       380   8e-116   
ref|XP_010275105.1|  PREDICTED: probable cyclic nucleotide-gated ...    382   9e-116   
ref|XP_004145808.1|  PREDICTED: putative cyclic nucleotide-gated ...    380   9e-116   
ref|XP_008443457.1|  PREDICTED: putative cyclic nucleotide-gated ...    380   9e-116   
emb|CDY28182.1|  BnaA01g06670D                                          380   1e-115   
ref|XP_004287136.1|  PREDICTED: probable cyclic nucleotide-gated ...    381   1e-115   
ref|XP_004147453.1|  PREDICTED: putative cyclic nucleotide-gated ...    381   1e-115   
ref|XP_008443456.1|  PREDICTED: putative cyclic nucleotide-gated ...    380   1e-115   
ref|XP_010048747.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyc...    380   1e-115   
ref|XP_002880939.1|  ATCNGC15                                           379   1e-115   
ref|XP_011089272.1|  PREDICTED: putative cyclic nucleotide-gated ...    380   1e-115   
gb|AES73805.2|  cyclic nucleotide-gated ion channel-like protein        380   1e-115   
ref|NP_565560.1|  cyclic nucleotide-gated channel 6                     381   1e-115   
ref|XP_006656134.1|  PREDICTED: cyclic nucleotide-gated ion chann...    379   1e-115   
gb|EYU25206.1|  hypothetical protein MIMGU_mgv1a024404mg                380   2e-115   
ref|XP_010510648.1|  PREDICTED: putative cyclic nucleotide-gated ...    379   2e-115   
ref|XP_006396313.1|  hypothetical protein EUTSA_v10028473mg             380   2e-115   
ref|XP_006409852.1|  hypothetical protein EUTSA_v10016341mg             379   2e-115   
ref|XP_010055024.1|  PREDICTED: cyclic nucleotide-gated ion chann...    380   2e-115   
emb|CDX71365.1|  BnaC04g16000D                                          379   2e-115   
ref|XP_008443455.1|  PREDICTED: putative cyclic nucleotide-gated ...    380   2e-115   
gb|EPS68056.1|  hypothetical protein M569_06716                         380   3e-115   
ref|XP_011018037.1|  PREDICTED: probable cyclic nucleotide-gated ...    380   3e-115   
ref|XP_009788225.1|  PREDICTED: putative cyclic nucleotide-gated ...    379   3e-115   
ref|XP_010417136.1|  PREDICTED: probable cyclic nucleotide-gated ...    380   3e-115   
emb|CDX72251.1|  BnaC07g42730D                                          380   3e-115   
ref|XP_006306882.1|  hypothetical protein CARUB_v10008437mg             379   3e-115   
ref|XP_009363632.1|  PREDICTED: probable cyclic nucleotide-gated ...    380   4e-115   
emb|CDY32737.1|  BnaA02g07990D                                          379   4e-115   
ref|XP_002893066.1|  hypothetical protein ARALYDRAFT_335228             380   4e-115   
ref|XP_008463957.1|  PREDICTED: putative cyclic nucleotide-gated ...    378   4e-115   
ref|XP_003563795.1|  PREDICTED: cyclic nucleotide-gated ion chann...    378   5e-115   
ref|XP_009126802.1|  PREDICTED: probable cyclic nucleotide-gated ...    379   5e-115   
gb|EYU27176.1|  hypothetical protein MIMGU_mgv1a001945mg                379   5e-115   
ref|XP_010483350.1|  PREDICTED: probable cyclic nucleotide-gated ...    379   5e-115   
ref|XP_008463956.1|  PREDICTED: putative cyclic nucleotide-gated ...    379   5e-115   
ref|XP_006474002.1|  PREDICTED: probable cyclic nucleotide-gated ...    379   5e-115   
ref|XP_002324941.1|  cyclic nucleotide-regulated ion channel fami...    379   5e-115   
ref|XP_002867353.1|  ATCNGC17                                           379   6e-115   
ref|XP_011044977.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyc...    379   6e-115   
gb|KDO59462.1|  hypothetical protein CISIN_1g004711mg                   379   6e-115   
ref|XP_006453609.1|  hypothetical protein CICLE_v10007576mg             379   6e-115   
ref|XP_004160370.1|  PREDICTED: cyclic nucleotide-gated ion chann...    378   7e-115   
ref|XP_006343703.1|  PREDICTED: probable cyclic nucleotide-gated ...    385   7e-115   
ref|XP_009611941.1|  PREDICTED: putative cyclic nucleotide-gated ...    378   9e-115   
ref|XP_002889372.1|  ATCNGC10                                           378   9e-115   
ref|NP_001190873.1|  cyclic nucleotide gated channel 9                  378   9e-115   
ref|XP_009137935.1|  PREDICTED: putative cyclic nucleotide-gated ...    378   9e-115   
ref|XP_011076015.1|  PREDICTED: cyclic nucleotide-gated ion chann...    378   1e-114   
ref|XP_002880536.1|  ATCNGC6                                            379   1e-114   
ref|XP_010548626.1|  PREDICTED: probable cyclic nucleotide-gated ...    378   1e-114   
ref|XP_010676638.1|  PREDICTED: putative cyclic nucleotide-gated ...    379   1e-114   
emb|CDY02780.1|  BnaC02g11090D                                          378   1e-114   
ref|XP_004965514.1|  PREDICTED: cyclic nucleotide-gated ion chann...    376   1e-114   
ref|XP_010470108.1|  PREDICTED: putative cyclic nucleotide-gated ...    376   1e-114   
ref|XP_010677822.1|  PREDICTED: probable cyclic nucleotide-gated ...    378   1e-114   
ref|XP_007136556.1|  hypothetical protein PHAVU_009G054700g             377   1e-114   
ref|XP_004951291.1|  PREDICTED: cyclic nucleotide-gated ion chann...    377   1e-114   
gb|KFK29609.1|  hypothetical protein AALP_AA7G156300                    378   1e-114   
gb|EYU29181.1|  hypothetical protein MIMGU_mgv1a001982mg                378   1e-114   
ref|XP_006389841.1|  hypothetical protein EUTSA_v10018178mg             379   1e-114   
ref|XP_009137931.1|  PREDICTED: putative cyclic nucleotide-gated ...    378   1e-114   
ref|NP_194785.1|  cyclic nucleotide gated channel 9                     378   1e-114   
emb|CDY39213.1|  BnaA03g50250D                                          378   2e-114   
ref|XP_010438188.1|  PREDICTED: probable cyclic nucleotide-gated ...    378   2e-114   
ref|XP_006647126.1|  PREDICTED: cyclic nucleotide-gated ion chann...    377   2e-114   
gb|KHG03806.1|  hypothetical protein F383_27172                         376   2e-114   
gb|EYU42461.1|  hypothetical protein MIMGU_mgv1a003043mg                374   2e-114   
ref|XP_009352037.1|  PREDICTED: cyclic nucleotide-gated ion chann...    376   2e-114   
ref|XP_008393928.1|  PREDICTED: probable cyclic nucleotide-gated ...    378   2e-114   
ref|XP_006280090.1|  hypothetical protein CARUB_v10025973mg             377   2e-114   
ref|XP_002865954.1|  hypothetical protein ARALYDRAFT_918383             377   2e-114   
ref|XP_007011625.1|  Cyclic nucleotide-gated channel 14 isoform 1       377   2e-114   
ref|XP_006293792.1|  hypothetical protein CARUB_v10022774mg             375   2e-114   
ref|XP_008437585.1|  PREDICTED: cyclic nucleotide-gated ion chann...    377   3e-114   
ref|XP_010112119.1|  putative cyclic nucleotide-gated ion channel 14    377   3e-114   
ref|XP_004251749.1|  PREDICTED: probable cyclic nucleotide-gated ...    376   3e-114   
ref|XP_010692996.1|  PREDICTED: probable cyclic nucleotide-gated ...    377   3e-114   
ref|XP_007226902.1|  hypothetical protein PRUPE_ppa016327mg             375   3e-114   
ref|XP_009398871.1|  PREDICTED: probable cyclic nucleotide-gated ...    377   3e-114   
ref|XP_010432994.1|  PREDICTED: probable cyclic nucleotide-gated ...    377   3e-114   
ref|XP_010920462.1|  PREDICTED: putative cyclic nucleotide-gated ...    376   3e-114   
ref|XP_006286176.1|  hypothetical protein CARUB_v10007740mg             377   3e-114   



>ref|XP_009589735.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Nicotiana tomentosiformis]
Length=709

 Score =  1202 bits (3110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/714 (86%), Positives = 654/714 (92%), Gaps = 9/714 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  412
             M S   L F LSRWFG I RR+SVQPDNSDD  D++ P   S ECYACTQVGVPVFHSTS
Sbjct  1     MSSRQDLRFFLSRWFG-IFRRRSVQPDNSDDNDDDSNPISNSIECYACTQVGVPVFHSTS  59

Query  413   CDNAHQPEWEASAGSSLIPIKNRPGSV---THRSTQDFHRSGPFGRVLDPRSKRVQRWNR  583
             CD AHQPEWEASAGSSL+PI+NR  +      RS+++ H+SGPFGRVLDPRSKRVQRWNR
Sbjct  60    CDGAHQPEWEASAGSSLVPIQNRTNNSRTGKSRSSRNRHQSGPFGRVLDPRSKRVQRWNR  119

Query  584   AFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFR  763
               LLARGMALA+DPLFFYALSIGR G+PCLYMDGGLAAIVTV+RTCLDAVH+ HLWLQFR
Sbjct  120   IILLARGMALAVDPLFFYALSIGRGGSPCLYMDGGLAAIVTVIRTCLDAVHLLHLWLQFR  179

Query  764   LAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREE  943
             LAYVSRESLVVGCGKLVWDARA+A+HYVRS+KGFWFDAFV+LP+PQ VFWLVVPKLIREE
Sbjct  180   LAYVSRESLVVGCGKLVWDARAIAAHYVRSVKGFWFDAFVVLPVPQVVFWLVVPKLIREE  239

Query  944   QVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVA  1123
             Q+KLIMTILLL+FLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVA
Sbjct  240   QIKLIMTILLLMFLFQFLPKVYHSISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVA  299

Query  1124  GGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAA  1303
             GGCWYVL+IQRVASCLRQ+C  QK++CNL LSCSEEVCY+ LLP G  GN CAGNST   
Sbjct  300   GGCWYVLSIQRVASCLRQQCE-QKASCNLSLSCSEEVCYQFLLPTGTVGNPCAGNSTT--  356

Query  1304  LMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWL  1483
             +MRKPLCLDVNGPF +GIYKWALPVVSSRS+ VKILYPIFWGLMTLSTFGNDLEPTS+WL
Sbjct  357   VMRKPLCLDVNGPFPYGIYKWALPVVSSRSVTVKILYPIFWGLMTLSTFGNDLEPTSHWL  416

Query  1484  EVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQR  1663
             EVIFSIC+VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LRQR
Sbjct  417   EVIFSICLVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSQLRQR  476

Query  1664  VRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  1843
             VR+FE QRWA MGGEDEMEL+KDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD
Sbjct  477   VRHFEHQRWAMMGGEDEMELVKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  536

Query  1844  RIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSW  2023
             R+KPLVFSKDEKIIREGDPV RVVFIVRGRVKSSQNLSKG+VATSILEPGGF GDELLSW
Sbjct  537   RVKPLVFSKDEKIIREGDPVHRVVFIVRGRVKSSQNLSKGMVATSILEPGGFFGDELLSW  596

Query  2024  CLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANW  2203
             CLRRPFIDRLPASSATFTCI+STEAFGLDANHLRFITDHFRYKFANERLKRTARYYS+NW
Sbjct  597   CLRRPFIDRLPASSATFTCIESTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSSNW  656

Query  2204  RTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             RTWAAVN+QLAWRRY +RT    N V EN D+ D RLR+YAAMFLSIRPHDHLE
Sbjct  657   RTWAAVNIQLAWRRYMVRTSRPVNQVTENGDN-DHRLRKYAAMFLSIRPHDHLE  709



>ref|XP_009787011.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Nicotiana sylvestris]
Length=709

 Score =  1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/714 (85%), Positives = 648/714 (91%), Gaps = 9/714 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  412
             M S   L F LSRWFG I RR+SVQPDNSDD  D++ P   S ECYACTQVGVPVFHSTS
Sbjct  1     MSSRQDLRFFLSRWFG-IFRRRSVQPDNSDDNEDDSNPISNSIECYACTQVGVPVFHSTS  59

Query  413   CDNAHQPEWEASAGSSLIPIKNRPGSV---THRSTQDFHRSGPFGRVLDPRSKRVQRWNR  583
             CD A+ PEWEASAGSSL+PI+NR  +      RS+ + H SGPFG VLDPRSKRVQRWNR
Sbjct  60    CDQANPPEWEASAGSSLVPIQNRTNNSRTGKSRSSHNRHPSGPFGSVLDPRSKRVQRWNR  119

Query  584   AFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFR  763
               LLARGMALA+DPLFFYALSIGR G+PCLYMDGGLAAIVTV+RTCLDAVH+ HLWLQFR
Sbjct  120   FILLARGMALAVDPLFFYALSIGRGGSPCLYMDGGLAAIVTVIRTCLDAVHLFHLWLQFR  179

Query  764   LAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREE  943
             LAYVSRESLVVGCGKLVWDARA+A+HYVRS+KGFWFD FV+LP+PQ VFWLVVPKLIREE
Sbjct  180   LAYVSRESLVVGCGKLVWDARAIAAHYVRSVKGFWFDTFVVLPVPQVVFWLVVPKLIREE  239

Query  944   QVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVA  1123
             Q+KLIMTILLL+FLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVA
Sbjct  240   QIKLIMTILLLMFLFQFLPKVYHSISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVA  299

Query  1124  GGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAA  1303
             GGCWYVL+IQRVASCLRQ+C  QK++CNL LSCSEEVCY+ LLP G  GN CAGNST   
Sbjct  300   GGCWYVLSIQRVASCLRQQCE-QKASCNLSLSCSEEVCYQFLLPTGTVGNPCAGNSTT--  356

Query  1304  LMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWL  1483
             +MRKPLCLDVNGPF +GIYKWALPVVSSRS+ VKILYPIFWGLMTLSTFGNDLEPTS+WL
Sbjct  357   VMRKPLCLDVNGPFPYGIYKWALPVVSSRSVTVKILYPIFWGLMTLSTFGNDLEPTSHWL  416

Query  1484  EVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQR  1663
             EVIFSIC+VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LRQR
Sbjct  417   EVIFSICLVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSQLRQR  476

Query  1664  VRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  1843
             VR+FE QRWA MGGEDEMEL+KDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD
Sbjct  477   VRHFEHQRWAMMGGEDEMELVKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  536

Query  1844  RIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSW  2023
             R+KPLVFSKDEKIIREGDPV RVVFIVRGRVKSSQNLSKG+VATSILEPGGF GDELLSW
Sbjct  537   RVKPLVFSKDEKIIREGDPVHRVVFIVRGRVKSSQNLSKGMVATSILEPGGFFGDELLSW  596

Query  2024  CLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANW  2203
             CLRRPFIDRLPASSATFTCI+STEAFGLDANHLRFITDHFRYKFANERLKRTARYYS+NW
Sbjct  597   CLRRPFIDRLPASSATFTCIESTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSSNW  656

Query  2204  RTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             RTWAAVN+QLAWRRY +RT    N V EN D  D RLR+YAAMFLSIRPHDHLE
Sbjct  657   RTWAAVNIQLAWRRYMVRTSRPVNQVTENGDS-DHRLRKYAAMFLSIRPHDHLE  709



>ref|XP_002532894.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF29474.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=715

 Score =  1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/721 (82%), Positives = 650/721 (90%), Gaps = 17/721 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDT--------YDENPNFIST-ECYACTQVG  388
             MPS P  HFSL RW G +L  K+ Q DNSD +         D+N N  S+ ECYACTQVG
Sbjct  1     MPSQPDFHFSLQRWIG-LLCGKNGQNDNSDSSGGDSTVRNIDDNNNISSSVECYACTQVG  59

Query  389   VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRV  568
             VPVFHSTSCD+AHQP+W ASAGSSLIPI+N+PG+    +      +GPFG VLDPRSKRV
Sbjct  60    VPVFHSTSCDHAHQPQWVASAGSSLIPIQNQPGAKKPPTIISRFPAGPFGAVLDPRSKRV  119

Query  569   QRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHL  748
             Q+WNRAFLLARGMALAIDPLFFY+LSIGR G PCLYMDGGLAAIVTVLRTC+DA+H+CHL
Sbjct  120   QKWNRAFLLARGMALAIDPLFFYSLSIGRGGAPCLYMDGGLAAIVTVLRTCVDAIHLCHL  179

Query  749   WLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPK  928
             WLQFRLAYVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWL++PK
Sbjct  180   WLQFRLAYVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLILPK  239

Query  929   LIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFI  1108
             LIREEQ+KLIMTILLLIFLFQFLP++YH IYLMR+MQKVTGYIFGTIWWGF LNLIAYFI
Sbjct  240   LIREEQIKLIMTILLLIFLFQFLPKVYHCIYLMRKMQKVTGYIFGTIWWGFGLNLIAYFI  299

Query  1109  ASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGN  1288
             ASHVAGGCWYVLAIQR ASCLRQ+C  ++  C+L LSCSEEVCY+LL+P G  GNSC GN
Sbjct  300   ASHVAGGCWYVLAIQRAASCLRQQCQ-RRPNCDLFLSCSEEVCYQLLVPTGTIGNSCGGN  358

Query  1289  STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEP  1468
             STAA  +RKP+CLD+ GPF++GIYK ALPV++S S+AVKILYPIFWGLMTLSTFGNDLEP
Sbjct  359   STAA--VRKPMCLDIAGPFKYGIYKTALPVIASNSLAVKILYPIFWGLMTLSTFGNDLEP  416

Query  1469  TSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS  1648
             TSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS
Sbjct  417   TSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPS  476

Query  1649  NLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLIL  1828
              LRQRVR+FERQ+W AMGGEDEMELIKDLPEGLRRDIKR+LCLDLIK+VPLFH+LDDLIL
Sbjct  477   RLRQRVRHFERQKWTAMGGEDEMELIKDLPEGLRRDIKRYLCLDLIKEVPLFHNLDDLIL  536

Query  1829  DNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGD  2008
             DNICDR+KPLVFSKDEKIIREGDPVQR+VFIVRGR+K SQ+LSKG+VATS+LEPGG+LGD
Sbjct  537   DNICDRVKPLVFSKDEKIIREGDPVQRIVFIVRGRIKRSQSLSKGMVATSVLEPGGYLGD  596

Query  2009  ELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARY  2188
             ELLSWCLRRPFIDR PASSATF C++STEAFGLDANHLR+ITDHFRYKFANERLKRTARY
Sbjct  597   ELLSWCLRRPFIDRRPASSATFVCLESTEAFGLDANHLRYITDHFRYKFANERLKRTARY  656

Query  2189  YSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDG--DRRLRQYAAMFLSIRPHDHL  2362
             YS+NWRTWAAVN+Q AWRRYR+RTRG    +P   ++G  DRRL QYAAMF+SIRPHDHL
Sbjct  657   YSSNWRTWAAVNIQFAWRRYRMRTRGP--VIPVTTENGGTDRRLLQYAAMFMSIRPHDHL  714

Query  2363  E  2365
             E
Sbjct  715   E  715



>ref|XP_006338398.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Solanum 
tuberosum]
Length=708

 Score =  1178 bits (3047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/713 (85%), Positives = 645/713 (90%), Gaps = 8/713 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  412
             M S+  + F LSRWFG I RR+SVQPDNSDD  D+N P   S ECYACTQVGVPVFHSTS
Sbjct  1     MSSHQDVRFFLSRWFG-IFRRRSVQPDNSDDNDDDNNPISNSIECYACTQVGVPVFHSTS  59

Query  413   CDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDF--HRSGPFGRVLDPRSKRVQRWNRA  586
             CD A+QPEWEASAGSSLIPI+NR    T +S      H SGPFGRVLDPRSKRVQRWNR 
Sbjct  60    CDGANQPEWEASAGSSLIPIQNRTDLKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWNRM  119

Query  587   FLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL  766
              LLARGMALA+DPLFFYALSIGR G+PCLYMDGGLAAIVTV+RT +DAVH+ HLWLQFRL
Sbjct  120   ILLARGMALAVDPLFFYALSIGRGGSPCLYMDGGLAAIVTVIRTSVDAVHLFHLWLQFRL  179

Query  767   AYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQ  946
             AYVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWLVVPKLIREEQ
Sbjct  180   AYVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLVVPKLIREEQ  239

Query  947   VKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAG  1126
             +KLIMTILLL+FLFQFLP++YH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAG
Sbjct  240   IKLIMTILLLMFLFQFLPKVYHCISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAG  299

Query  1127  GCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAAL  1306
             GCWYVLAIQRVASCLRQ+C  +  +CNL LSCSEEVCY+ LLP G  GN CAGNST    
Sbjct  300   GCWYVLAIQRVASCLRQQCE-RNPSCNLSLSCSEEVCYQFLLPTGTVGNPCAGNSTTVT-  357

Query  1307  MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLE  1486
              RKP+CLDVNGPF +GIY+WALPVVSSRS+ VKILYPIFWGLMTLSTFGNDLEPTS+WLE
Sbjct  358   -RKPMCLDVNGPFPYGIYQWALPVVSSRSVTVKILYPIFWGLMTLSTFGNDLEPTSHWLE  416

Query  1487  VIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRV  1666
             VIFSIC+VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRV
Sbjct  417   VIFSICLVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSQLRQRV  476

Query  1667  RYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
             R+FE QRWA MGGEDEMEL+KDLPEGLRRDIKRFLCLDLIKKVPLF SLDDLILDNICDR
Sbjct  477   RHFEHQRWAMMGGEDEMELVKDLPEGLRRDIKRFLCLDLIKKVPLFQSLDDLILDNICDR  536

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             +KPLVFSKDEKIIREGDPV RVVFIVRGRVKSSQNLSKGV+ATSILEPGGF GDELLSWC
Sbjct  537   VKPLVFSKDEKIIREGDPVHRVVFIVRGRVKSSQNLSKGVIATSILEPGGFFGDELLSWC  596

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPFIDRLPASSATFTCI+STEAFGLDANHLRFITDHFRYKFANERLKRTARYYS+NWR
Sbjct  597   LRRPFIDRLPASSATFTCIESTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSSNWR  656

Query  2207  TWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             TWAAVN+QLAWRRY +RT      V EN D+ D+RLR+YAAMFLSIRPHDHLE
Sbjct  657   TWAAVNIQLAWRRYMMRTSRPTIHVIENGDN-DQRLRKYAAMFLSIRPHDHLE  708



>ref|XP_004232184.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Solanum 
lycopersicum]
Length=708

 Score =  1175 bits (3040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/713 (84%), Positives = 643/713 (90%), Gaps = 8/713 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTS  412
             M S+  + F LS+WFG I RR+SVQPDNSDD  D+  P   S ECYACTQVGVPVFHSTS
Sbjct  1     MSSHQDVRFFLSKWFG-IFRRRSVQPDNSDDNDDDINPISNSIECYACTQVGVPVFHSTS  59

Query  413   CDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDF--HRSGPFGRVLDPRSKRVQRWNRA  586
             CD A+QPEWEASAGSSL+PI+NR  S T +S      H SGPFGRVLDPRSKRVQRWNR 
Sbjct  60    CDGANQPEWEASAGSSLVPIQNRTDSKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWNRM  119

Query  587   FLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL  766
              LLARGMALA+DPLFFYALSIGR G+PCLYMDG LAAIVTV+RT +DAVH+ HLWLQFRL
Sbjct  120   ILLARGMALAVDPLFFYALSIGRGGSPCLYMDGSLAAIVTVIRTSVDAVHLFHLWLQFRL  179

Query  767   AYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQ  946
             AYVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWLVVPKLIREEQ
Sbjct  180   AYVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLVVPKLIREEQ  239

Query  947   VKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAG  1126
             +KLIMTILLL+FLFQFLP++YH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAG
Sbjct  240   IKLIMTILLLMFLFQFLPKVYHCISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAG  299

Query  1127  GCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAAL  1306
             GCWYVLAIQRVASCLRQ+C  +  +CNL LSCSEEVCY+ LLP G  GN CAGNST    
Sbjct  300   GCWYVLAIQRVASCLRQQCE-RNPSCNLSLSCSEEVCYQFLLPTGTVGNPCAGNSTTVT-  357

Query  1307  MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLE  1486
              RKP+CLDVNGPF +GIY+WALPVVSSRS+ VKILYPIFWGLMTLSTFGNDLEPTS+WLE
Sbjct  358   -RKPMCLDVNGPFPYGIYQWALPVVSSRSVTVKILYPIFWGLMTLSTFGNDLEPTSHWLE  416

Query  1487  VIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRV  1666
             VIFSIC+VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRV
Sbjct  417   VIFSICLVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSQLRQRV  476

Query  1667  RYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
             R+FE QRWA MGGEDEMEL+KDLPEGLRRDIKRFLCLDLIKKVPLF SLDDLILDNICDR
Sbjct  477   RHFEHQRWAMMGGEDEMELVKDLPEGLRRDIKRFLCLDLIKKVPLFESLDDLILDNICDR  536

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             +KPLVFSKDEKIIREGDPV RVVFIVRGRVKSSQNLSKGV+ATSILEPGGF GDELLSWC
Sbjct  537   VKPLVFSKDEKIIREGDPVHRVVFIVRGRVKSSQNLSKGVIATSILEPGGFFGDELLSWC  596

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPFIDRLPASSATFTCI+STEAFGLDANHLRFITDHFRYKFANERLKRTARYYS+NWR
Sbjct  597   LRRPFIDRLPASSATFTCIESTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSSNWR  656

Query  2207  TWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             TWAAVN+QLAWRRY +RT      V EN D+ D RLR+YAAMFLSIRPHDHLE
Sbjct  657   TWAAVNIQLAWRRYMMRTSRPTIHVIENGDN-DHRLRKYAAMFLSIRPHDHLE  708



>ref|XP_004232185.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Solanum 
lycopersicum]
Length=704

 Score =  1172 bits (3032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/707 (85%), Positives = 640/707 (91%), Gaps = 9/707 (1%)
 Frame = +2

Query  257   HFSL-SRWFGTILRRKSVQPDNSDDTYDEN-PNFISTECYACTQVGVPVFHSTSCDNAHQ  430
             HF L SRWFG I RR+SVQPDNSDD  D+  P   S ECYACTQVGVPVFHSTSCD A+Q
Sbjct  3     HFLLNSRWFG-IFRRRSVQPDNSDDNDDDINPISNSIECYACTQVGVPVFHSTSCDGANQ  61

Query  431   PEWEASAGSSLIPIKNRPGSVTHRSTQDF--HRSGPFGRVLDPRSKRVQRWNRAFLLARG  604
             PEWEASAGSSL+PI+NR  S T +S      H SGPFGRVLDPRSKRVQRWNR  LLARG
Sbjct  62    PEWEASAGSSLVPIQNRTDSKTGKSRSSRSRHTSGPFGRVLDPRSKRVQRWNRMILLARG  121

Query  605   MALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRE  784
             MALA+DPLFFYALSIGR G+PCLYMDG LAAIVTV+RT +DAVH+ HLWLQFRLAYVSRE
Sbjct  122   MALAVDPLFFYALSIGRGGSPCLYMDGSLAAIVTVIRTSVDAVHLFHLWLQFRLAYVSRE  181

Query  785   SLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimt  964
             SLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWLVVPKLIREEQ+KLIMT
Sbjct  182   SLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLVVPKLIREEQIKLIMT  241

Query  965   illliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVL  1144
             ILLL+FLFQFLP++YH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVL
Sbjct  242   ILLLMFLFQFLPKVYHCISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVL  301

Query  1145  AIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLC  1324
             AIQRVASCLRQ+C  +  +CNL LSCSEEVCY+ LLP G  GN CAGNST     RKP+C
Sbjct  302   AIQRVASCLRQQCE-RNPSCNLSLSCSEEVCYQFLLPTGTVGNPCAGNSTTVT--RKPMC  358

Query  1325  LDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSIC  1504
             LDVNGPF +GIY+WALPVVSSRS+ VKILYPIFWGLMTLSTFGNDLEPTS+WLEVIFSIC
Sbjct  359   LDVNGPFPYGIYQWALPVVSSRSVTVKILYPIFWGLMTLSTFGNDLEPTSHWLEVIFSIC  418

Query  1505  IVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQ  1684
             +VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR+FE Q
Sbjct  419   LVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSQLRQRVRHFEHQ  478

Query  1685  RWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVF  1864
             RWA MGGEDEMEL+KDLPEGLRRDIKRFLCLDLIKKVPLF SLDDLILDNICDR+KPLVF
Sbjct  479   RWAMMGGEDEMELVKDLPEGLRRDIKRFLCLDLIKKVPLFESLDDLILDNICDRVKPLVF  538

Query  1865  SKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFI  2044
             SKDEKIIREGDPV RVVFIVRGRVKSSQNLSKGV+ATSILEPGGF GDELLSWCLRRPFI
Sbjct  539   SKDEKIIREGDPVHRVVFIVRGRVKSSQNLSKGVIATSILEPGGFFGDELLSWCLRRPFI  598

Query  2045  DRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVN  2224
             DRLPASSATFTCI+STEAFGLDANHLRFITDHFRYKFANERLKRTARYYS+NWRTWAAVN
Sbjct  599   DRLPASSATFTCIESTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSSNWRTWAAVN  658

Query  2225  VQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             +QLAWRRY +RT      V EN D+ D RLR+YAAMFLSIRPHDHLE
Sbjct  659   IQLAWRRYMMRTSRPTIHVIENGDN-DHRLRKYAAMFLSIRPHDHLE  704



>ref|XP_006373345.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
 gb|ERP51142.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
Length=718

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/722 (81%), Positives = 638/722 (88%), Gaps = 16/722 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQP--DNSDDTY--------DENPNFISTECYACTQV  385
             MPS P  HFSL RW G +  + S     DNSD++         D NP   S ECYACTQV
Sbjct  1     MPSQPNSHFSLPRWIGLLCHKNSQSETGDNSDNSNLNSTNNIDDSNPISNSIECYACTQV  60

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRS  559
             GVPVFHSTSCD AHQPEWEASAGSSL+PIKNR GS    + +   R  +GP G VLDPRS
Sbjct  61    GVPVFHSTSCDQAHQPEWEASAGSSLVPIKNRLGSRKSPANRAQSRRPAGPLGTVLDPRS  120

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHI  739
             KRVQ+WNRAFLLARGMALA+DPLFFYALSIGR+G PCLYMDGGLAAIVTVLRT +DA+H+
Sbjct  121   KRVQKWNRAFLLARGMALAVDPLFFYALSIGRNGAPCLYMDGGLAAIVTVLRTSVDAIHL  180

Query  740   CHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLV  919
             CHLWLQFRLAYVSRESLVVGCG LVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWL+
Sbjct  181   CHLWLQFRLAYVSRESLVVGCGNLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLL  240

Query  920   VPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIA  1099
             VPKLIREEQ+KLIMTILLLIFLFQFLP++YH I LM+RMQKVTGYIFGTIWWGF LNLIA
Sbjct  241   VPKLIREEQIKLIMTILLLIFLFQFLPKVYHCICLMKRMQKVTGYIFGTIWWGFGLNLIA  300

Query  1100  YFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC  1279
             YFIASHVAGGCWYVLAIQRVASCL+Q C   +  C+L L+CSEEVCY+ LL  G  GN C
Sbjct  301   YFIASHVAGGCWYVLAIQRVASCLKQSCE-SRPNCDLSLACSEEVCYQFLLRAGTIGNPC  359

Query  1280  AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGND  1459
              GN+T    +RKP+CLDVNG F +GIYKWALPV+SS S++VKILYPIFWGLMTLSTFGND
Sbjct  360   VGNTTHT--VRKPMCLDVNGAFNYGIYKWALPVISSNSLSVKILYPIFWGLMTLSTFGND  417

Query  1460  LEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQ  1639
             LEPTS+WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQ
Sbjct  418   LEPTSHWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQ  477

Query  1640  LPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDD  1819
             LPS LRQRVR++ERQRWA MGGEDE+ELIKDLPEGLRRDIKR+LCLDLIKKVPLFH+LDD
Sbjct  478   LPSRLRQRVRHYERQRWATMGGEDEIELIKDLPEGLRRDIKRYLCLDLIKKVPLFHNLDD  537

Query  1820  LILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGF  1999
             LILDNICDR+KPLVFSKDEKIIREGDPVQR+VFIVRGR++SSQ LSKG+VATS+LEPGGF
Sbjct  538   LILDNICDRVKPLVFSKDEKIIREGDPVQRMVFIVRGRIRSSQTLSKGMVATSVLEPGGF  597

Query  2000  LGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRT  2179
             LGDELLSWCLRRPFIDRLPASSATF CI+STEAFGLDANHLR+ITDHFRYKFANERLKRT
Sbjct  598   LGDELLSWCLRRPFIDRLPASSATFACIESTEAFGLDANHLRYITDHFRYKFANERLKRT  657

Query  2180  ARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDH  2359
             ARYYS+NWRTWAAVN+Q AWRRYR+RTRG    V E+    DRRL QYAAMF+SIRPHDH
Sbjct  658   ARYYSSNWRTWAAVNIQFAWRRYRMRTRGPVIPVTESGGT-DRRLLQYAAMFMSIRPHDH  716

Query  2360  LE  2365
             LE
Sbjct  717   LE  718



>ref|XP_011035830.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Populus euphratica]
Length=718

 Score =  1165 bits (3013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/722 (81%), Positives = 639/722 (89%), Gaps = 16/722 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQP--DNSDDTY--------DENPNFISTECYACTQV  385
             MPS P  HFSL RW G +  + S     D SD++         D NP   S ECYACTQV
Sbjct  1     MPSQPNSHFSLPRWIGLLCHKNSQSETGDKSDNSNLNSTNNIDDSNPISNSIECYACTQV  60

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRS  559
             GVPVFHSTSCD AHQPEWEASAGSSL+PIKNR GS    + +   R  +GP G VLDPRS
Sbjct  61    GVPVFHSTSCDQAHQPEWEASAGSSLVPIKNRLGSRKSPANRAQSRWPAGPLGTVLDPRS  120

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHI  739
             KRVQ+WNRAFLLARGMALA+DPLFFYALSIGR+G PCLYMDGGLAAIVTVLRT +DA+H+
Sbjct  121   KRVQKWNRAFLLARGMALAVDPLFFYALSIGRNGAPCLYMDGGLAAIVTVLRTSVDAIHL  180

Query  740   CHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLV  919
             CHLWLQFRLAYVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWL+
Sbjct  181   CHLWLQFRLAYVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLL  240

Query  920   VPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIA  1099
             VPKLIREEQ+KLIMTILLLIFLFQFLP++YH I LM+RMQKVTGYIFGTIWWGF LNLIA
Sbjct  241   VPKLIREEQIKLIMTILLLIFLFQFLPKVYHCICLMKRMQKVTGYIFGTIWWGFGLNLIA  300

Query  1100  YFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC  1279
             YFIASHVAGGCWYVLAIQRVA CLRQ C  ++  C+L L+CSEE+CY+ LLP    GN C
Sbjct  301   YFIASHVAGGCWYVLAIQRVALCLRQSCE-RRPNCDLSLACSEEICYQFLLPADTIGNPC  359

Query  1280  AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGND  1459
             AGN+T    +RKP+CLDVNG F +GIYKWALPV+SS S++VKILYPIFWGLMTLSTFGND
Sbjct  360   AGNTTHT--VRKPMCLDVNGAFNYGIYKWALPVISSNSLSVKILYPIFWGLMTLSTFGND  417

Query  1460  LEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQ  1639
             LEPTS+WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQ
Sbjct  418   LEPTSHWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQ  477

Query  1640  LPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDD  1819
             LPS LRQRVR++ERQRWA MGGEDE+ELI DLPEGLRRDIKR+LCLDLIKKVPLFH+LDD
Sbjct  478   LPSRLRQRVRHYERQRWATMGGEDEIELITDLPEGLRRDIKRYLCLDLIKKVPLFHNLDD  537

Query  1820  LILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGF  1999
             LILDNICDR+KPLVFSK+EKIIREGDPVQR+VFIVRGR+KSSQ+LSKG+VATS+LEPGGF
Sbjct  538   LILDNICDRVKPLVFSKEEKIIREGDPVQRMVFIVRGRIKSSQSLSKGMVATSVLEPGGF  597

Query  2000  LGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRT  2179
             LGDELLSWCLRRPFIDRLPASSATF CI+STEAFGLDANHLR+ITDHFRYKFANERLKRT
Sbjct  598   LGDELLSWCLRRPFIDRLPASSATFACIESTEAFGLDANHLRYITDHFRYKFANERLKRT  657

Query  2180  ARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDH  2359
             ARYYS+NWRTWAAVN+Q AWRRYR+RTRG    V E+    +RRL QYAAMF+SIRPHDH
Sbjct  658   ARYYSSNWRTWAAVNIQFAWRRYRMRTRGPVIPVTESGGT-ERRLLQYAAMFMSIRPHDH  716

Query  2360  LE  2365
             LE
Sbjct  717   LE  718



>gb|KDP27204.1| hypothetical protein JCGZ_19903 [Jatropha curcas]
Length=770

 Score =  1161 bits (3003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/736 (78%), Positives = 641/736 (87%), Gaps = 15/736 (2%)
 Frame = +2

Query  191   LNSLISHPYGFPPPKMPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFI-----  355
             L + +   +GF    MPS P   FSL RW G + ++K       +    EN N I     
Sbjct  39    LTTFLLSSHGFALSIMPSPPNFSFSLLRWIGLLCQKKGESESGDNSGRGENNNSIVDDNS  98

Query  356   ----STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR  523
                 + ECYACTQVGVPVFHSTSCD+AHQPEW ASAGS L+PI++R G     STQ   R
Sbjct  99    VPNNTVECYACTQVGVPVFHSTSCDHAHQPEWVASAGSYLVPIQSRTGPKKCPSTQTHSR  158

Query  524   --SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAA  697
               +GPFG VLDPRSKRVQ+WNRAFLLARGMALAIDPLFFY+LSIGR G PCLYMDG LAA
Sbjct  159   LPTGPFGTVLDPRSKRVQKWNRAFLLARGMALAIDPLFFYSLSIGRGGAPCLYMDGWLAA  218

Query  698   IVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDA  877
             IVTVLRTC+DA+H+CHLWLQFRLAYVSRESLV+GCGKLVWDAR++ASHYVRSLKGFWFDA
Sbjct  219   IVTVLRTCVDAIHLCHLWLQFRLAYVSRESLVIGCGKLVWDARSIASHYVRSLKGFWFDA  278

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQAVFWLV+PKLIREEQ+KLIMTILL+IF+FQFLP++YH IYLMR+MQKVTGYI
Sbjct  279   FVILPVPQAVFWLVLPKLIREEQIKLIMTILLIIFMFQFLPKVYHCIYLMRKMQKVTGYI  338

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVC  1237
             FGTIWWGF LNLIAYFIASHVAGGCWYVLAIQR ASCLRQ+C  ++  C+L LSCSEE+C
Sbjct  339   FGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQRAASCLRQQCD-RRPKCDLSLSCSEEIC  397

Query  1238  YELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYP  1417
             Y+ L+     GN C GNST    +RKP+CLD++GPF +GIYK ALPV+SS S+AVKILYP
Sbjct  398   YQFLVNTDTIGNPCVGNSTTT--VRKPMCLDMSGPFNYGIYKTALPVISSNSLAVKILYP  455

Query  1418  IFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ  1597
             IFWGLMTLSTFGNDL+PTSNWLEV+FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ
Sbjct  456   IFWGLMTLSTFGNDLDPTSNWLEVVFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ  515

Query  1598  LRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCL  1777
             LRCRDMEWWM+RRQLPS LRQRVR+FERQRWAAMGGEDE+EL+KDLPEGLRRDIKR+LCL
Sbjct  516   LRCRDMEWWMRRRQLPSRLRQRVRHFERQRWAAMGGEDELELVKDLPEGLRRDIKRYLCL  575

Query  1778  DLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS  1957
             DLIKKVPLFH+LDDLILDNICDR++PLVFSKDEKIIREGDPVQR+VFIVRGR+K SQ+LS
Sbjct  576   DLIKKVPLFHNLDDLILDNICDRVRPLVFSKDEKIIREGDPVQRMVFIVRGRIKRSQSLS  635

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
             KG++ATS+LEPGGFLGDELLSWCLRRPF+DRLPASSATF CI+STEAFGLDANHLR+ITD
Sbjct  636   KGMLATSVLEPGGFLGDELLSWCLRRPFMDRLPASSATFVCIESTEAFGLDANHLRYITD  695

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLR  2317
             HFRYKFANERLKRTARYYS+NWRTWAAVN+Q AWRRYR RTRG P   P +    DRRL 
Sbjct  696   HFRYKFANERLKRTARYYSSNWRTWAAVNLQFAWRRYRTRTRG-PVITPTDNGSSDRRLL  754

Query  2318  QYAAMFLSIRPHDHLE  2365
             QYAAMF+SIRPHDHLE
Sbjct  755   QYAAMFMSIRPHDHLE  770



>ref|XP_007032653.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
 gb|EOY03579.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
Length=707

 Score =  1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/712 (82%), Positives = 637/712 (89%), Gaps = 7/712 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKS--VQPDNSDDTYDENPNFISTECYACTQVGVPVFHST  409
             MPS   L  SLSRW G    + S     D+S D  ++NP   + ECYACTQVGVPVFHST
Sbjct  1     MPSPSNL--SLSRWIGLCQLQNSPGENSDHSGDISEDNPISNTVECYACTQVGVPVFHST  58

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD+AHQPEWEASAGSSL+PI+ R G    ++    H SGP GRVLDPRSKRVQ+WNRAF
Sbjct  59    SCDHAHQPEWEASAGSSLVPIQARAGQKKTQAAASRHPSGPLGRVLDPRSKRVQKWNRAF  118

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARGMALAIDPLFFYALSIGR G PCLYMDGGLAAIVT+LRTC+DAVH+ HLWLQFRLA
Sbjct  119   LLARGMALAIDPLFFYALSIGRGGFPCLYMDGGLAAIVTILRTCVDAVHLFHLWLQFRLA  178

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWLVVPKLIREEQ+
Sbjct  179   YVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLVVPKLIREEQI  238

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             KLIMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGG
Sbjct  239   KLIMTILLLIFLFQFLPKVYHSICLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGG  298

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ+C  +   C L LSCSEEVCY+ L P    GN C GNST   ++
Sbjct  299   CWYVLAIQRVASCLRQQCE-RSERCKLSLSCSEEVCYQFLFPAEAVGNPCGGNSTK--VV  355

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
              KPLCLDV+GPF +GIY+WALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPTS+WLEV
Sbjct  356   GKPLCLDVHGPFNYGIYQWALPVVSSNSVAVKILYPIFWGLMTLSTFGNDLEPTSHWLEV  415

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             +FSICIVL+GL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LRQRVR
Sbjct  416   MFSICIVLAGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSRLRQRVR  475

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             +FERQ+WA +GGEDEMELIKDLPEGLRRDIKR+LCLDLIKKVPLFH+LDDLILDNICDR+
Sbjct  476   HFERQKWATLGGEDEMELIKDLPEGLRRDIKRYLCLDLIKKVPLFHNLDDLILDNICDRV  535

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             KPLVFSKDEKIIREGDPVQR+VFIVRGR+K SQ+LSKG+VATSI+EPGGFLGDELLSWCL
Sbjct  536   KPLVFSKDEKIIREGDPVQRMVFIVRGRIKRSQSLSKGMVATSIIEPGGFLGDELLSWCL  595

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPFIDRLPASSATF C++S EAFGLDAN+LR+ITDHFRYKFANERLKRTARYYS+NWRT
Sbjct  596   RRPFIDRLPASSATFVCVESIEAFGLDANNLRYITDHFRYKFANERLKRTARYYSSNWRT  655

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+QLAWRRYR RTRG   +V EN +  DRRL QYAAMF+SIRPHDHLE
Sbjct  656   WAAVNIQLAWRRYRTRTRGPMISVTENGNSSDRRLLQYAAMFMSIRPHDHLE  707



>gb|AAX18166.2| CNGC2 [Gossypium hirsutum]
Length=715

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/721 (79%), Positives = 631/721 (88%), Gaps = 17/721 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSD------DTYDENPNFISTECYACTQVGVPV  397
             MPS    +FSLSRWFG + +  +  P+ SD      +  +ENP   + ECYACTQVGVPV
Sbjct  1     MPSQS--NFSLSRWFG-LFQLPNSMPERSDNGSVSGEGNEENPISYTVECYACTQVGVPV  57

Query  398   FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDF-----HRSGPFGRVLDPRSK  562
             FHSTSCD AH PEWEASAGSSL+PI+ R  S   ++ Q         SGPFGRVLDPR+K
Sbjct  58    FHSTSCDQAHPPEWEASAGSSLVPIQARTASKQKKTQQPAAPNTRRPSGPFGRVLDPRTK  117

Query  563   RVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHIC  742
             RVQ WNRAFLLAR MALAIDPLFFYALSIGR G+PCLYMDGGLAAIVTVLRTC+DAVH+ 
Sbjct  118   RVQNWNRAFLLARAMALAIDPLFFYALSIGRGGSPCLYMDGGLAAIVTVLRTCVDAVHLF  177

Query  743   HLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVV  922
             HLWLQFRLAYVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFD FVILP+PQAVFWLVV
Sbjct  178   HLWLQFRLAYVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDVFVILPVPQAVFWLVV  237

Query  923   PKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAY  1102
             PKLIREEQ+K+IMTILLLIFLFQFLP++YH I LMRR+QKVTGYIFGTIWWGF LNLIAY
Sbjct  238   PKLIREEQIKIIMTILLLIFLFQFLPKVYHIICLMRRLQKVTGYIFGTIWWGFGLNLIAY  297

Query  1103  FIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCA  1282
             FIASHVAGGCWYVLAIQRVASCLRQ+C   K  C L LSCSEEVCY+ L P    GN+C 
Sbjct  298   FIASHVAGGCWYVLAIQRVASCLRQQCARNKQ-CKLSLSCSEEVCYQFLFPAEAVGNTCG  356

Query  1283  GNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDL  1462
             GNST   ++ KPLCL+V+GPF +GIY+WALPVVSS S+AV+ILYPI+WGLM+LSTFGNDL
Sbjct  357   GNSTN--VIGKPLCLEVHGPFNYGIYQWALPVVSSNSVAVRILYPIYWGLMSLSTFGNDL  414

Query  1463  EPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQL  1642
             EPTS+WLEV+FSICIVL+GLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQL
Sbjct  415   EPTSHWLEVMFSICIVLAGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQL  474

Query  1643  PSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDL  1822
             PS LRQRVR++ERQ+WA +GGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFH+L+DL
Sbjct  475   PSCLRQRVRHYERQKWATLGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHNLNDL  534

Query  1823  ILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFL  2002
             ILDNICDR+KPLVFSKDEKIIREGDPVQR+VF+VRGR+K  Q+LSKGVVATS++E GGFL
Sbjct  535   ILDNICDRVKPLVFSKDEKIIREGDPVQRMVFVVRGRIKRIQSLSKGVVATSLIESGGFL  594

Query  2003  GDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTA  2182
             GDELLSWCLRRPFI+RLPASSATF C++  EAF LD+NHL++ITDHFRYKFANERLKRTA
Sbjct  595   GDELLSWCLRRPFINRLPASSATFVCVEPIEAFSLDSNHLKYITDHFRYKFANERLKRTA  654

Query  2183  RYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHL  2362
             RYYS+NWRTWAAVN+QL WRRYR RTRG   +  EN +  DRRL QYAAMF+SIRP DHL
Sbjct  655   RYYSSNWRTWAAVNIQLGWRRYRTRTRGPMISAAENGNSSDRRLLQYAAMFMSIRPQDHL  714

Query  2363  E  2365
             E
Sbjct  715   E  715



>ref|XP_011085713.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Sesamum 
indicum]
Length=692

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/706 (81%), Positives = 626/706 (89%), Gaps = 20/706 (3%)
 Frame = +2

Query  248   PGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAH  427
             P LHFSL RWFG + RR S   D++DDT          ECYACTQVGVP FHSTSCD AH
Sbjct  7     PDLHFSLPRWFG-LFRRDS---DDADDTRFSTFG----ECYACTQVGVPAFHSTSCDKAH  58

Query  428   QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGM  607
             QPEWEASAGSSL+PIKNRPG     S +         RVLDPRSKRVQRWNRA LLARGM
Sbjct  59    QPEWEASAGSSLLPIKNRPGPKNRTSFR--------SRVLDPRSKRVQRWNRALLLARGM  110

Query  608   ALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRES  787
             ALA+DPLFFYALSIGR G+PCLYMDGGLAA+VTVLRTC+DAVH+CHLWLQFRLAYVSRES
Sbjct  111   ALAVDPLFFYALSIGRGGSPCLYMDGGLAAVVTVLRTCVDAVHLCHLWLQFRLAYVSRES  170

Query  788   LVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimti  967
             LVVGCGKLVWD RA+A+HY+RS+KGFWFDAFVILPIPQAVFWLVVP+LI+EEQ+KLIMTI
Sbjct  171   LVVGCGKLVWDTRAIAAHYLRSVKGFWFDAFVILPIPQAVFWLVVPRLIKEEQIKLIMTI  230

Query  968   llliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLA  1147
             LLLIFLFQFLP++YHSI LMR+MQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLA
Sbjct  231   LLLIFLFQFLPKVYHSICLMRKMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLA  290

Query  1148  IQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCL  1327
             I RVASCL+Q+C  +  TCNL LSCSEEVCY+ LLP G   N C GNST   ++RKPLCL
Sbjct  291   INRVASCLKQQC-VRSGTCNLSLSCSEEVCYQFLLPSGTLNNPCGGNSTV--VLRKPLCL  347

Query  1328  DVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICI  1507
             DVNGPFR+GIYKWALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPTS+WLEV+FSIC 
Sbjct  348   DVNGPFRYGIYKWALPVVSSNSVAVKILYPIFWGLMTLSTFGNDLEPTSHWLEVMFSICT  407

Query  1508  VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQR  1687
             VLSGLMLFTLLIGNIQVFLH+VMA+KRKMQLRCRDMEWWM+RRQLPS LRQRVR +ERQR
Sbjct  408   VLSGLMLFTLLIGNIQVFLHSVMARKRKMQLRCRDMEWWMRRRQLPSQLRQRVRRYERQR  467

Query  1688  WAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFS  1867
             WA MGG+DEMELI+DLPEGLRRDIKRFLCLDLI+KV LFHSLDDLILDNICDR+KPLVFS
Sbjct  468   WAVMGGDDEMELIQDLPEGLRRDIKRFLCLDLIRKVALFHSLDDLILDNICDRVKPLVFS  527

Query  1868  KDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFID  2047
             KDEKIIREGDPV R++FI+RG VKSSQNLS+G+VAT+IL+PGGF GDELLSWCLRRPFID
Sbjct  528   KDEKIIREGDPVPRIIFIMRGSVKSSQNLSRGIVATNILKPGGFFGDELLSWCLRRPFID  587

Query  2048  RLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNV  2227
             RLPASSATFTCI+ TEAF L AN LR+IT+HFRYKFANERL+RTARYYS+NWRTWAAVN+
Sbjct  588   RLPASSATFTCIELTEAFALKANDLRYITEHFRYKFANERLRRTARYYSSNWRTWAAVNI  647

Query  2228  QLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             QLAWRRY LRTR   +   +N  D DRRLRQYAA F+SIRPHDHLE
Sbjct  648   QLAWRRYILRTRRAVSFHSDNG-DSDRRLRQYAAFFMSIRPHDHLE  692



>ref|XP_006482709.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Citrus 
sinensis]
Length=713

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/721 (79%), Positives = 629/721 (87%), Gaps = 19/721 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYD----------ENPNFISTECYACTQV  385
             MPS+P L FSL RW   + R K V  D + +  +           N NF   ECYACTQV
Sbjct  1     MPSHPNLPFSLPRWIIELFRSKKVDGDQNGENNNDGNSDDNNPISNHNF---ECYACTQV  57

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  565
             GVPVFHSTSCD AHQPEWEASAGSSL+PI+ R   +  +  +    S  F  V DPRSKR
Sbjct  58    GVPVFHSTSCDQAHQPEWEASAGSSLVPIQARSKILGPKDGRP--ASATFAHVFDPRSKR  115

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICH  745
             VQR NRAFLLARGM+LA+DPLFFYALSIGR G PCLYMDG LAAIVTVLRTC+DAVH+ H
Sbjct  116   VQRLNRAFLLARGMSLAVDPLFFYALSIGRGGAPCLYMDGALAAIVTVLRTCVDAVHLFH  175

Query  746   LWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVP  925
             LWLQFRLAYVSRESLVVGCGKLVWD RA+ASHYVRSLKGFWFD FVILP+PQAVFWLVVP
Sbjct  176   LWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYVRSLKGFWFDVFVILPVPQAVFWLVVP  235

Query  926   KLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYF  1105
             KLIREE++K+IMTILL+IFLFQFLP++YHSIYLMRRMQKVTGYIFGTIWWGF LNLIAYF
Sbjct  236   KLIREEKIKMIMTILLIIFLFQFLPKVYHSIYLMRRMQKVTGYIFGTIWWGFGLNLIAYF  295

Query  1106  IASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAG  1285
             IASHVAGGCWYVLAIQRVASCLRQ+CH Q + CNL LSCSEEVCY+ L+P G  GN+C G
Sbjct  296   IASHVAGGCWYVLAIQRVASCLRQQCHRQ-ANCNLYLSCSEEVCYQFLVPSGAIGNTCGG  354

Query  1286  NSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLE  1465
             NST    +RK LCLDVNGPF +GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLE
Sbjct  355   NSTTT--VRKSLCLDVNGPFHYGIYQWALPVISSNSVAVKILYPIFWGLMTLSTFGNDLE  412

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
             PTS+WLEV+FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLP
Sbjct  413   PTSHWLEVMFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLP  472

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
             S LRQRVR++ERQRWA MGGEDEMELIKDLPEGLRR IKR+LCLDLIKKVPLFH+LDDLI
Sbjct  473   SRLRQRVRHYERQRWATMGGEDEMELIKDLPEGLRRGIKRYLCLDLIKKVPLFHNLDDLI  532

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLG  2005
             LDNICDR++PLV+SKDEKIIREGDPV R+VFIVRGR+K  Q+LSKG+VATS+LEPGGFLG
Sbjct  533   LDNICDRVRPLVYSKDEKIIREGDPVPRMVFIVRGRIKRCQSLSKGMVATSVLEPGGFLG  592

Query  2006  DELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTAR  2185
             DELLSWCLRRPFIDRLPASSATF C++S EAFGLDA +LR+ITDHFRYKFANERLKRTAR
Sbjct  593   DELLSWCLRRPFIDRLPASSATFFCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTAR  652

Query  2186  YYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGD-RRLRQYAAMFLSIRPHDHL  2362
             YYS+NWRTWAAVN+Q AWRRYR+RTRG   +V EN +  +  RL +YAAMF+SIRPHDHL
Sbjct  653   YYSSNWRTWAAVNIQFAWRRYRMRTRGPVISVTENGEGNESNRLMRYAAMFMSIRPHDHL  712

Query  2363  E  2365
             E
Sbjct  713   E  713



>ref|XP_006431246.1| hypothetical protein CICLE_v10011184mg [Citrus clementina]
 gb|ESR44486.1| hypothetical protein CICLE_v10011184mg [Citrus clementina]
Length=713

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/721 (79%), Positives = 628/721 (87%), Gaps = 19/721 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYD----------ENPNFISTECYACTQV  385
             MPS+P   FSL RW   + R K V  D + +  +           N NF   ECYACTQV
Sbjct  1     MPSHPNFPFSLPRWIIELFRSKKVDGDQNGENNNDGNSDDNNPISNHNF---ECYACTQV  57

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  565
             GVPVFHSTSCD AHQPEWEASAGSSL+PI+ R   +  +  +    S  F  V DPRSKR
Sbjct  58    GVPVFHSTSCDQAHQPEWEASAGSSLVPIQARSKILGPKDGRP--ASATFAHVFDPRSKR  115

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICH  745
             VQR NRAFLLARGM+LA+DPLFFYALSIGR G PCLYMDG LAAIVTVLRTC+DAVH+ H
Sbjct  116   VQRLNRAFLLARGMSLAVDPLFFYALSIGRGGAPCLYMDGALAAIVTVLRTCVDAVHLFH  175

Query  746   LWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVP  925
             LWLQFRLAYVSRESLVVGCGKLVWD RA+ASHYVRSLKGFWFD FVILP+PQAVFWLVVP
Sbjct  176   LWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYVRSLKGFWFDVFVILPVPQAVFWLVVP  235

Query  926   KLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYF  1105
             KLIREE++K+IMTILL+IFLFQFLP++YHSIYLMRRMQKVTGYIFGTIWWGF LNLIAYF
Sbjct  236   KLIREEKIKMIMTILLIIFLFQFLPKVYHSIYLMRRMQKVTGYIFGTIWWGFGLNLIAYF  295

Query  1106  IASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAG  1285
             IASHVAGGCWYVLAIQRVASCLRQ+CH Q + CNL LSCSEEVCY+ L+P G  GN+C G
Sbjct  296   IASHVAGGCWYVLAIQRVASCLRQQCHRQ-ANCNLYLSCSEEVCYQFLVPSGAIGNTCGG  354

Query  1286  NSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLE  1465
             NST    +RK LCLDVNGPF +GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLE
Sbjct  355   NSTTT--VRKSLCLDVNGPFHYGIYQWALPVISSNSVAVKILYPIFWGLMTLSTFGNDLE  412

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
             PTS+WLEV+FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLP
Sbjct  413   PTSHWLEVMFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLP  472

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
             S LRQRVR++ERQRWA MGGEDEMELIKDLPEGLRR IKR+LCLDLIKKVPLFH+LDDLI
Sbjct  473   SRLRQRVRHYERQRWATMGGEDEMELIKDLPEGLRRGIKRYLCLDLIKKVPLFHNLDDLI  532

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLG  2005
             LDNICDR++PLV+SKDEKIIREGDPV R+VFIVRGR+K  Q+LSKG+VATS+LEPGGFLG
Sbjct  533   LDNICDRVRPLVYSKDEKIIREGDPVPRMVFIVRGRIKRCQSLSKGMVATSVLEPGGFLG  592

Query  2006  DELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTAR  2185
             DELLSWCLRRPFIDRLPASSATF C++S EAFGLDA +LR+ITDHFRYKFANERLKRTAR
Sbjct  593   DELLSWCLRRPFIDRLPASSATFVCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTAR  652

Query  2186  YYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGD-RRLRQYAAMFLSIRPHDHL  2362
             YYS+NWRTWAAVN+Q AWRRYR+RTRG   +V EN +  +  RL +YAAMF+SIRPHDHL
Sbjct  653   YYSSNWRTWAAVNIQFAWRRYRMRTRGPVISVTENGEGNESNRLMRYAAMFMSIRPHDHL  712

Query  2363  E  2365
             E
Sbjct  713   E  713



>gb|EYU34629.1| hypothetical protein MIMGU_mgv1a002175mg [Erythranthe guttata]
Length=705

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/703 (81%), Positives = 618/703 (88%), Gaps = 10/703 (1%)
 Frame = +2

Query  260   FSLSRWFGTILRRKSVQPDNSDDTY-DENPNFISTECYACTQVGVPVFHSTSCDNAHQPE  436
             FS+SRWFG I RR+S   D +DDT  +++PN  S ECYACTQVG PVFHSTSCD AHQPE
Sbjct  12    FSISRWFG-IFRRES---DITDDTSSNQSPN--SGECYACTQVGAPVFHSTSCDKAHQPE  65

Query  437   WEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALA  616
             WEASAGSSL+PIK R  S T           P   V DPR+KRVQRWNRAFL+ARGMALA
Sbjct  66    WEASAGSSLLPIKYRSTSETRTDGAGGGGRRPSAGVYDPRTKRVQRWNRAFLMARGMALA  125

Query  617   IDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVV  796
             +DPLFFYALSIGR G PCLYMDGGLA IVTVLRTC+DAVH+CH+WLQFRLAYVSRESLVV
Sbjct  126   VDPLFFYALSIGRGGWPCLYMDGGLAIIVTVLRTCVDAVHLCHMWLQFRLAYVSRESLVV  185

Query  797   GCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtilll  976
             GCGKLVWD RA+A HY+RS KGFWFD FVILP+PQAVFWLVVPKLI+EEQ+KLIMTILLL
Sbjct  186   GCGKLVWDTRAIARHYLRSFKGFWFDIFVILPVPQAVFWLVVPKLIKEEQIKLIMTILLL  245

Query  977   iflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQR  1156
             IFLFQFLP+++H I LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQR
Sbjct  246   IFLFQFLPKVFHIICLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQR  305

Query  1157  VASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVN  1336
             VASCL+Q C+    TC++ LSCSEEVCY+ LLP G   N C G ++   ++RKPLCLDVN
Sbjct  306   VASCLKQHCNIN-GTCDVSLSCSEEVCYQFLLPSGTLDNPCGGGNSTV-VIRKPLCLDVN  363

Query  1337  GPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLS  1516
             GPFR+GIYKWALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPTS+WLEVIFSI  VLS
Sbjct  364   GPFRYGIYKWALPVVSSNSVAVKILYPIFWGLMTLSTFGNDLEPTSHWLEVIFSIITVLS  423

Query  1517  GLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAA  1696
             GLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR +E QRWA 
Sbjct  424   GLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSELRQRVRRYEHQRWAV  483

Query  1697  MGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDE  1876
             MGG+DEMELI+DLPEGLRRDIKRFLCLDL+KKVPLFHSLDDLILDNICDR+KPLVFSK+E
Sbjct  484   MGGDDEMELIQDLPEGLRRDIKRFLCLDLVKKVPLFHSLDDLILDNICDRVKPLVFSKNE  543

Query  1877  KIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLP  2056
             KIIREGDPVQR+VFIV GRV SSQNLS+G+VATS LEPGGF GDELLSWCLRRPF DRLP
Sbjct  544   KIIREGDPVQRIVFIVHGRVGSSQNLSRGIVATSQLEPGGFFGDELLSWCLRRPFTDRLP  603

Query  2057  ASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLA  2236
             ASSATFTCI+STEAF LDAN LR+ITDHFRYKFANERLKRTARYYS+NWRTWAAVNVQLA
Sbjct  604   ASSATFTCIESTEAFSLDANSLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNVQLA  663

Query  2237  WRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WRRY  R+R Q  T     DD DRRLRQYA+ F+SIRPHDHLE
Sbjct  664   WRRYIERSR-QAVTFRSVNDDSDRRLRQYASFFMSIRPHDHLE  705



>ref|XP_003552549.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Glycine 
max]
Length=714

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/712 (79%), Positives = 631/712 (89%), Gaps = 15/712 (2%)
 Frame = +2

Query  263   SLSRWFGTILRRKSV--QPDNSDDTY--------DENPNFISTECYACTQVGVPVFHSTS  412
             SL RW    LRR++     D+  D++        D+NP     ECYACTQVGVPVFHSTS
Sbjct  7     SLLRWISKKLRRRNSISNGDSGSDSFQNGAATVVDDNPFSSGVECYACTQVGVPVFHSTS  66

Query  413   CDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             CD+A HQ +WEASAGSSL+PI++RP  V    T      GPFGRVLDPRSKRVQRWNRA 
Sbjct  67    CDSAFHQLQWEASAGSSLVPIQSRPNKVLGFRTVSGSSRGPFGRVLDPRSKRVQRWNRAL  126

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARG+ALAIDPLFFY+LSIGR G+PCLYMDGGLAA+VTV RTC+DAVH+ H+WLQFRLA
Sbjct  127   LLARGVALAIDPLFFYSLSIGREGSPCLYMDGGLAAMVTVARTCVDAVHLLHVWLQFRLA  186

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWDAR +ASHY+RSLKGFWFDAFVILP+PQ VFWL+VPKL+REE++
Sbjct  187   YVSRESLVVGCGKLVWDAREIASHYLRSLKGFWFDAFVILPVPQVVFWLLVPKLLREEKI  246

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K+IMTI+LLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGG
Sbjct  247   KIIMTIMLLIFLFQFLPKVYHSICMMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGG  306

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ+C  + + CNL +SCSEE+CY+ LLP    G+SC GNST   ++
Sbjct  307   CWYVLAIQRVASCLRQQCE-RTNGCNLSVSCSEEICYQSLLPASAIGDSCGGNST---VV  362

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             RKPLCLDV GPF++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTS+WLEV
Sbjct  363   RKPLCLDVEGPFKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSHWLEV  422

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR
Sbjct  423   IFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLRQRVR  482

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             +FERQRWAAMGGEDEME+IKDLPEGLRRDIKR LCLDLI+KVPLFH+LDDLILDNICDR+
Sbjct  483   HFERQRWAAMGGEDEMEMIKDLPEGLRRDIKRHLCLDLIRKVPLFHNLDDLILDNICDRV  542

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             KPLVFSKDEKIIREGDPV R+VFIVRGR+K +Q+LSKG+VA+SILEPGGFLGDELLSWCL
Sbjct  543   KPLVFSKDEKIIREGDPVPRMVFIVRGRIKRNQSLSKGMVASSILEPGGFLGDELLSWCL  602

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPFIDRLPASSATF C++S+EAFGLDANHLR+ITDHFRYKFANERLKRTARYYS+NWRT
Sbjct  603   RRPFIDRLPASSATFVCLESSEAFGLDANHLRYITDHFRYKFANERLKRTARYYSSNWRT  662

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+Q AWRRYR RT+G    V +     +RRL QYAAMF+SIRPHDHLE
Sbjct  663   WAAVNIQFAWRRYRQRTKGPVTPVRDTNGGTERRLLQYAAMFMSIRPHDHLE  714



>ref|XP_007139515.1| hypothetical protein PHAVU_008G036200g [Phaseolus vulgaris]
 gb|ESW11509.1| hypothetical protein PHAVU_008G036200g [Phaseolus vulgaris]
Length=709

 Score =  1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/711 (79%), Positives = 626/711 (88%), Gaps = 15/711 (2%)
 Frame = +2

Query  260   FSLSRWFGTILRRKSVQPDNSDDT---------YDENPNFISTECYACTQVGVPVFHSTS  412
             FSL  W G  LRR++   +    +          D+NP   + ECYACTQVGVPVFHSTS
Sbjct  5     FSLLWWIGKKLRRRNTVSNGESGSNENVVGAVVVDDNPFGSTVECYACTQVGVPVFHSTS  64

Query  413   CDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFL  592
             CD+ +QP+WEASAGSSL+PI+NRP  V    T      GPFGRVLDPRSKRVQ+WNRA L
Sbjct  65    CDSFNQPQWEASAGSSLVPIQNRPNKVLGFRTVSGSNIGPFGRVLDPRSKRVQKWNRALL  124

Query  593   LARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAY  772
             LARG+ALAIDPLFFY+LSIGR G+PCLYMDGGLAA+VTV RTC+DAVH+ H+WLQFRLAY
Sbjct  125   LARGVALAIDPLFFYSLSIGREGSPCLYMDGGLAAMVTVARTCVDAVHLLHVWLQFRLAY  184

Query  773   VSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVK  952
             VSRESLVVGCGKLVWDAR +ASHY+RSLKGFWFDAFVILP+PQAVFWLVVPKLIREE++K
Sbjct  185   VSRESLVVGCGKLVWDAREIASHYLRSLKGFWFDAFVILPVPQAVFWLVVPKLIREERIK  244

Query  953   limtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGC  1132
             +IMTI+LLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGC
Sbjct  245   IIMTIMLLIFLFQFLPKVYHSICMMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGC  304

Query  1133  WYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR  1312
             WYVLAIQRVASCLRQ+C  + + CNL +SCSEEVCY+ L   G  G+SC GNST   L++
Sbjct  305   WYVLAIQRVASCLRQQCE-RTNGCNLSVSCSEEVCYQSL--AGAIGSSCGGNSTV--LLK  359

Query  1313  KPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI  1492
             KP CLDV GPF++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI
Sbjct  360   KPYCLDVEGPFKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI  419

Query  1493  FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRY  1672
             FSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR+
Sbjct  420   FSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLRQRVRH  479

Query  1673  FERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIK  1852
             FERQRWAAMGGEDEME+IKDLPEGLRRDIKR LCLDLIKKVPLFH+LDDLILDNICDR++
Sbjct  480   FERQRWAAMGGEDEMEMIKDLPEGLRRDIKRHLCLDLIKKVPLFHNLDDLILDNICDRVR  539

Query  1853  PLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLR  2032
             PLVFSKDEKIIREGDPV R++FIVRGR+K SQ+LSKG+VA SILEPGGFLGDELLSWCLR
Sbjct  540   PLVFSKDEKIIREGDPVPRMMFIVRGRIKRSQSLSKGMVALSILEPGGFLGDELLSWCLR  599

Query  2033  RPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTW  2212
             RPFIDRLPASSATF C++S EAFGLDA HLR+ITDHFRYKFANERLKRTARYYS+NWRTW
Sbjct  600   RPFIDRLPASSATFVCLESAEAFGLDAEHLRYITDHFRYKFANERLKRTARYYSSNWRTW  659

Query  2213  AAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             AAVN+Q AWRRYR RTRG P T        +RRL QYAAMF+SIRPHDHLE
Sbjct  660   AAVNIQFAWRRYRQRTRG-PVTPVREIGGTERRLLQYAAMFMSIRPHDHLE  709



>emb|CDP02281.1| unnamed protein product [Coffea canephora]
Length=703

 Score =  1109 bits (2868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/713 (81%), Positives = 632/713 (89%), Gaps = 13/713 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYD-ENPNFISTECYACTQVGVPVFHSTS  412
             MPS P LH+S+ RWFG I RR+SVQPDN +D  D  NP   S ECYACTQVGVPVFHSTS
Sbjct  1     MPSSPDLHYSIPRWFG-IFRRRSVQPDNGEDADDYNNPFSNSGECYACTQVGVPVFHSTS  59

Query  413   CDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF--GRVLDPRSKRVQRWNRA  586
             CD AHQP+WEASAGSSLIPI+NRPG +   STQ   RS P   GRVLDPRSK VQ WNRA
Sbjct  60    CDKAHQPQWEASAGSSLIPIRNRPGQL---STQK--RSIPISRGRVLDPRSKTVQSWNRA  114

Query  587   FLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL  766
             FLLARGMALA+DPLFFYALS+   G PCLYMDGGLA +VTVLRT +DAVH+CHLWLQFRL
Sbjct  115   FLLARGMALAVDPLFFYALSVSTGGWPCLYMDGGLAVVVTVLRTGVDAVHLCHLWLQFRL  174

Query  767   AYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQ  946
             AYVSRESLVVGCGKLVWDARA+A HY+RSLKGFWFDAFVILPIPQAVFWL+VP+LIR+EQ
Sbjct  175   AYVSRESLVVGCGKLVWDARAIAFHYLRSLKGFWFDAFVILPIPQAVFWLLVPRLIRDEQ  234

Query  947   VKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAG  1126
             +KLIMT+LLLIFLFQFLP++YHSI LMRRMQKVTGY+FG+IWWGF LNLIAYFIASHVAG
Sbjct  235   IKLIMTVLLLIFLFQFLPKVYHSISLMRRMQKVTGYVFGSIWWGFGLNLIAYFIASHVAG  294

Query  1127  GCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAAL  1306
             GCWY+LA+QRV SCLRQ+C   KSTCN  L+CS  VCY+  LP G  G+ C GNSTA   
Sbjct  295   GCWYILAVQRVVSCLRQQCD-GKSTCNFSLTCSNGVCYQFPLPAGTLGSPCGGNSTAT--  351

Query  1307  MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLE  1486
             + K LCLDVNGPFR+GIYKWALPVVSS+S++VK+LYPIFWGLM+LSTFGNDLEPTS+WLE
Sbjct  352   VGKSLCLDVNGPFRYGIYKWALPVVSSKSVSVKLLYPIFWGLMSLSTFGNDLEPTSHWLE  411

Query  1487  VIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRV  1666
             VIFSICIVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRD+EWWMKRRQLP  LRQRV
Sbjct  412   VIFSICIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDLEWWMKRRQLPFQLRQRV  471

Query  1667  RYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
             R++ERQRW AMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK PLFHS+DDLILDNICDR
Sbjct  472   RHYERQRWRAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKGPLFHSMDDLILDNICDR  531

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             + PLVFS+DEKI REGDPVQR+VFIVRGRVKS Q LSKG+VATSILEPGG+LGDELLSWC
Sbjct  532   VHPLVFSRDEKITREGDPVQRIVFIVRGRVKSHQRLSKGMVATSILEPGGYLGDELLSWC  591

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPFI+RLPASSATFTC++ TEAF L A  LR+ITDHFRYKF NERLKRTARYYS+NWR
Sbjct  592   LRRPFIERLPASSATFTCLEPTEAFALYAPDLRYITDHFRYKFNNERLKRTARYYSSNWR  651

Query  2207  TWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             TWAAVN+QLAWRR+R RTR   N V EN  D D RLRQYAA+F+SIRPHDHLE
Sbjct  652   TWAAVNIQLAWRRHRTRTRPPLNHVMENG-DADSRLRQYAAVFMSIRPHDHLE  703



>ref|XP_010258180.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Nelumbo nucifera]
Length=709

 Score =  1105 bits (2859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/713 (78%), Positives = 613/713 (86%), Gaps = 7/713 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  415
             MP      FSL RW G  LR ++   ++ DD  ++NP+  S ECYACTQ+G P FHSTSC
Sbjct  1     MPELSEFFFSLPRWIGESLRLRNNLGEDDDD--EDNPSSHSVECYACTQLGAPAFHSTSC  58

Query  416   DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWNRA  586
             D  H PEWEASAGSSLIPI+ R  ++  R ++   R      FGRVLDPRSKRV RWNRA
Sbjct  59    DRVHPPEWEASAGSSLIPIQYRADNLKPRGSESNRRRTSTWVFGRVLDPRSKRVHRWNRA  118

Query  587   FLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL  766
             FLLARGMALA+DPLFFYALSIGR G PCLYMDGGLAAIVTVLRT +DAVH+ HLWLQFRL
Sbjct  119   FLLARGMALAVDPLFFYALSIGRDGAPCLYMDGGLAAIVTVLRTVVDAVHLFHLWLQFRL  178

Query  767   AYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQ  946
             AYVSRESLV+GCGKLVWDAR++ SHYVRSLKGFWFDA VILP+PQ VFWLVVPKLIREE+
Sbjct  179   AYVSRESLVIGCGKLVWDARSIVSHYVRSLKGFWFDALVILPVPQTVFWLVVPKLIREEK  238

Query  947   VKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAG  1126
             +KLIMTILLLIFLFQFLP++YHSIYLMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAG
Sbjct  239   IKLIMTILLLIFLFQFLPKVYHSIYLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAG  298

Query  1127  GCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAAL  1306
             GCWYVLAIQRVA CL Q C   +  CNL LSC++EVCY L LP  +  + C  NST   +
Sbjct  299   GCWYVLAIQRVAQCLGQHCQRGRK-CNLSLSCAKEVCYRLPLPSDMIESPCRDNSTTIGV  357

Query  1307  MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLE  1486
                P+CL+ +GPFRFGIYKWALPVVSS SIAVKILYPIFWGLMTLSTFGNDLEPTS+WLE
Sbjct  358   PNLPVCLNGDGPFRFGIYKWALPVVSSNSIAVKILYPIFWGLMTLSTFGNDLEPTSHWLE  417

Query  1487  VIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRV  1666
             VIFSI IVLSGLMLFTLLIGNIQVFLH+VMAKKRKMQLRCRDMEWWMKRRQLPS LR RV
Sbjct  418   VIFSIIIVLSGLMLFTLLIGNIQVFLHSVMAKKRKMQLRCRDMEWWMKRRQLPSRLRHRV  477

Query  1667  RYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
             R+FERQRWAAMGGEDEME+IKDLPEGLRRDIKR+LCLDLI++VPLF +LDDLILDNICDR
Sbjct  478   RHFERQRWAAMGGEDEMEVIKDLPEGLRRDIKRYLCLDLIRQVPLFQNLDDLILDNICDR  537

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             +KPL FSKDEKIIREGDPVQR+VFIV G +KSSQ LSKG+VAT +L PG FLGDELLSWC
Sbjct  538   VKPLFFSKDEKIIREGDPVQRMVFIVHGHIKSSQGLSKGMVATCMLGPGNFLGDELLSWC  597

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPFIDRLPASSATF C+++TEAFGLDA+HLR+IT HFRYKFAN+RLKRTARYYS+NWR
Sbjct  598   LRRPFIDRLPASSATFICVEATEAFGLDAHHLRYITQHFRYKFANDRLKRTARYYSSNWR  657

Query  2207  TWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             TWAAVN+Q +WRRY+LR RG P   P    D DR LRQYAAMF+++RPHDHLE
Sbjct  658   TWAAVNIQFSWRRYKLRARG-PALQPTENGDADRLLRQYAAMFMALRPHDHLE  709



>ref|XP_006585762.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Glycine max]
Length=716

 Score =  1105 bits (2858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/715 (78%), Positives = 630/715 (88%), Gaps = 18/715 (3%)
 Frame = +2

Query  263   SLSRWFGTILR-RKSV-QPDNSDDTY-----------DENPNFISTECYACTQVGVPVFH  403
             SL RW    LR R S+   D+S DT+           D+NP     ECYACTQVGVPVFH
Sbjct  6     SLLRWISKKLRPRNSISNGDSSSDTFHNGASTDTVVVDDNPFSSGVECYACTQVGVPVFH  65

Query  404   STSCDNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWN  580
             STSCD+A HQ +WEASAGSSL+PI++RP  V    T      GPFGRVLDPRSKRVQRWN
Sbjct  66    STSCDSAYHQLQWEASAGSSLVPIQSRPKKVLGFRTVSGLTRGPFGRVLDPRSKRVQRWN  125

Query  581   RAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQF  760
             RA LLARG+ALAIDPLFFY+LSIGR G+PCLYMDGGLAA+VTV RTC+DAVH+ H+WLQF
Sbjct  126   RALLLARGVALAIDPLFFYSLSIGREGSPCLYMDGGLAAMVTVARTCVDAVHLLHVWLQF  185

Query  761   RLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIRE  940
             RLAYVSRESLVVGCGKLVWDAR +ASHY+RSLKGFWFDAFVILP+PQ VFWL+VPKL+RE
Sbjct  186   RLAYVSRESLVVGCGKLVWDARDIASHYLRSLKGFWFDAFVILPVPQVVFWLIVPKLLRE  245

Query  941   EQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHV  1120
             E++K+IMTI+LLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIASHV
Sbjct  246   EKIKIIMTIMLLIFLFQFLPKVYHSICMMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHV  305

Query  1121  AGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAA  1300
             AGGCWYVLAIQRVASCLRQ+C  + + CNL +SCSEE+CY+ LLP     +SC GNST  
Sbjct  306   AGGCWYVLAIQRVASCLRQQCE-RTNGCNLSVSCSEEICYQSLLPASAIADSCGGNST--  362

Query  1301  ALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNW  1480
              ++RKPLCLDV GPF++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSNW
Sbjct  363   -VVRKPLCLDVQGPFKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSNW  421

Query  1481  LEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQ  1660
             LEVIFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQ
Sbjct  422   LEVIFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLRQ  481

Query  1661  RVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNIC  1840
             RVR+FERQRWAAMGGEDEME+IKDLPEGLRRDIKR LCLDLI+KVPLFH++DDLILDNIC
Sbjct  482   RVRHFERQRWAAMGGEDEMEMIKDLPEGLRRDIKRHLCLDLIRKVPLFHNMDDLILDNIC  541

Query  1841  DRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLS  2020
             DR+KPLVFSKDEKIIREGDPV R+VF+VRGR+K +Q+LSKG+VA+SIL+PGGFLGDELLS
Sbjct  542   DRVKPLVFSKDEKIIREGDPVPRMVFVVRGRIKRNQSLSKGMVASSILDPGGFLGDELLS  601

Query  2021  WCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSAN  2200
             WCLRRPFIDRLPASSATF C++S EAFGLDAN+LR+ITDHFRYKFANERLKRTARYYS+N
Sbjct  602   WCLRRPFIDRLPASSATFVCLESAEAFGLDANNLRYITDHFRYKFANERLKRTARYYSSN  661

Query  2201  WRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WRTWAAVN+Q AWRRYR RT+G    V +     +RRL QYAA+F+S+RPHDHLE
Sbjct  662   WRTWAAVNIQFAWRRYRQRTKGPVIPVRDTNGGTERRLLQYAALFMSLRPHDHLE  716



>ref|XP_008365415.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Malus 
domestica]
Length=712

 Score =  1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/712 (78%), Positives = 623/712 (88%), Gaps = 13/712 (2%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFI-------STECYACTQVGVPVFHST  409
             HFSL RW   +LRR++ Q D++D+ ++ N   + I       S ECYACTQVGVP FHST
Sbjct  5     HFSLPRW-TRVLRRQNSQIDDADNNHNSNNIEDIINAPIISNSVECYACTQVGVPAFHST  63

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQP+WEASAGSSLIPI++R  S   +       +GPFG VLDPRSKRVQRWNRAF
Sbjct  64    SCDGAHQPQWEASAGSSLIPIQSR--SDLKKGISRHRPAGPFGPVLDPRSKRVQRWNRAF  121

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARGMALA+DPLFFYALS GRSGTPCLYMDGGLAAIVTVLRT +DAVH+CHLWLQFRLA
Sbjct  122   LLARGMALAVDPLFFYALSFGRSGTPCLYMDGGLAAIVTVLRTSVDAVHLCHLWLQFRLA  181

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWD RA++ HY+RSLKGFWFDAFVILP+PQAVFWLV+PKLI+EE+V
Sbjct  182   YVSRESLVVGCGKLVWDPRAISYHYLRSLKGFWFDAFVILPVPQAVFWLVLPKLIKEEKV  241

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K+IMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGG
Sbjct  242   KVIMTILLLIFLFQFLPKVYHSISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGG  301

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ C  Q   CNL LSCS+EVCY+ LLP    GN C GN+T + + 
Sbjct  302   CWYVLAIQRVASCLRQHCD-QNVNCNLSLSCSDEVCYZFLLPAATIGNPCGGNTTTSVMR  360

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             + PLCLDVNG F +GIY+WALPV+SS S+A+KILYPIFWGLMTL TFGNDLEPTS+WLEV
Sbjct  361   KPPLCLDVNGTFNYGIYQWALPVISSNSLAIKILYPIFWGLMTLGTFGNDLEPTSHWLEV  420

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LR+RVR
Sbjct  421   IFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSGLRRRVR  480

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             ++ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCLDLIKKVPLFH+LDDLILDN+CDR+
Sbjct  481   HYERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLDLIKKVPLFHNLDDLILDNMCDRV  540

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             +PLVFSKDEKIIREGDPV +++FIVRGR+K +Q LSKG+V T++LEPGGF GDELLSWCL
Sbjct  541   RPLVFSKDEKIIREGDPVPKMLFIVRGRIKRTQGLSKGMVGTNVLEPGGFFGDELLSWCL  600

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPF+DRLPASSATFTCI+STEAFGL+A  LR++TDHFRYKFANERLKRTARYYS+NWRT
Sbjct  601   RRPFMDRLPASSATFTCIESTEAFGLNAXDLRYMTDHFRYKFANERLKRTARYYSSNWRT  660

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+Q AWRRYRLRT G P          +R+L QYAAMFLS+RPHDHLE
Sbjct  661   WAAVNIQFAWRRYRLRTNGGPVIPVIPNGSSERKLLQYAAMFLSLRPHDHLE  712



>ref|XP_004491863.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Cicer 
arietinum]
Length=712

 Score =  1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/714 (79%), Positives = 622/714 (87%), Gaps = 18/714 (3%)
 Frame = +2

Query  260   FSLSRWFGTILRRKS-------VQPDNSDDT-----YDENPNFISTECYACTQVGVPVFH  403
             +SL RW G  L  ++       V   NSD T      D+NP     ECYACTQVGVPVFH
Sbjct  5     YSLPRWIGGKLLGRNPKSTINNVGDSNSDTTGVVVVTDDNPVTSVVECYACTQVGVPVFH  64

Query  404   STSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNR  583
             STSCD+ HQPEWEASAGS L+PI+NRPG      T+     GP G VLDPRSKRVQ WNR
Sbjct  65    STSCDSCHQPEWEASAGSYLVPIQNRPGKFARAVTR--ANWGPLGSVLDPRSKRVQIWNR  122

Query  584   AFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFR  763
               LLARG+ALAIDPLFFYALSIGR G+PCLYMDGGLAA+VT  RTC+DAVH+ H+WLQFR
Sbjct  123   VLLLARGVALAIDPLFFYALSIGREGSPCLYMDGGLAAMVTAARTCVDAVHLIHVWLQFR  182

Query  764   LAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREE  943
             LAYVSRESLVVGCGKLVWDAR +ASHY+R+ KGFWFD FVILP+PQAVFWLVVPKLIRE+
Sbjct  183   LAYVSRESLVVGCGKLVWDARTIASHYLRNSKGFWFDLFVILPVPQAVFWLVVPKLIRED  242

Query  944   QVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVA  1123
             ++K+IMT +LLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVA
Sbjct  243   KIKIIMTTMLLIFLFQFLPKVYHSICMMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVA  302

Query  1124  GGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAA  1303
             GGCWYVLAIQRVASCL+Q+C  +   CNL LSCSEEVCY+ LL  G  GN C GNST   
Sbjct  303   GGCWYVLAIQRVASCLQQQCD-RTIGCNLSLSCSEEVCYQSLLSPGTIGNPCGGNSTL--  359

Query  1304  LMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWL  1483
             ++ KPLCLDV+GPF++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSNWL
Sbjct  360   MISKPLCLDVDGPFKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSNWL  419

Query  1484  EVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQR  1663
             EVIFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LRQR
Sbjct  420   EVIFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSRLRQR  479

Query  1664  VRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  1843
             VR+FERQRW AMGGEDEMELIKDLPEGLRRDIKR+LCLDLIKKVPLFH+LDDLILDNICD
Sbjct  480   VRHFERQRWVAMGGEDEMELIKDLPEGLRRDIKRYLCLDLIKKVPLFHNLDDLILDNICD  539

Query  1844  RIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSW  2023
             R+KPLVFSKDEKIIREGDPV R+VFIVRGR++ +Q+LSKG+VATS+LEPGGFLGDELLSW
Sbjct  540   RVKPLVFSKDEKIIREGDPVPRMVFIVRGRIRRNQSLSKGMVATSVLEPGGFLGDELLSW  599

Query  2024  CLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANW  2203
             CLRRPFIDRLPASSATF C++STEAFGLDA +LR+ITDHFRYKFANERLKRTARYYS+NW
Sbjct  600   CLRRPFIDRLPASSATFICLESTEAFGLDAQNLRYITDHFRYKFANERLKRTARYYSSNW  659

Query  2204  RTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             RTWAAVN+QLAWRRYR RTRG P T        +RRL QYAAMF+S+RPHDHLE
Sbjct  660   RTWAAVNIQLAWRRYRQRTRG-PVTPVREIGGSERRLLQYAAMFMSLRPHDHLE  712



>ref|XP_004306106.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Fragaria 
vesca subsp. vesca]
Length=709

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/711 (78%), Positives = 627/711 (88%), Gaps = 13/711 (2%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQP---DNSDDTYDENPNFIST---ECYACTQVGVPVFHSTSCD  418
             +FSL RW     R++S  P   DNS++  ++NP  IST   ECYACTQVGVPVFHSTSCD
Sbjct  4     NFSLPRW-TVFHRQQSSGPSDSDNSNNVVEDNPISISTSVVECYACTQVGVPVFHSTSCD  62

Query  419   NAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLA  598
              AHQP+WEASAGSSL+PI++R   +     ++    GPFG VLDPR+KRVQRWNRAFLLA
Sbjct  63    GAHQPQWEASAGSSLVPIQSR-SDLKKGLRRNRLPVGPFGEVLDPRTKRVQRWNRAFLLA  121

Query  599   RGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVS  778
             RGMALAIDPLFFYALSIGR GTPCLYMDGGLAAIVTVLRTC+DAVH+CHLWLQFRLAYVS
Sbjct  122   RGMALAIDPLFFYALSIGRGGTPCLYMDGGLAAIVTVLRTCVDAVHLCHLWLQFRLAYVS  181

Query  779   RESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKli  958
             RESLVVGCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWLV+PKLIREE++K+I
Sbjct  182   RESLVVGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLVLPKLIREEKIKVI  241

Query  959   mtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWY  1138
             MTILL+IFLFQFLP++YHSI LMRRM KVTGYIFGTIWWGF LNLIAYFIASHVAGGCWY
Sbjct  242   MTILLVIFLFQFLPKVYHSICLMRRMAKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWY  301

Query  1139  VLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKP  1318
             VLAIQRVASCL+Q+C      CNL LSCS+EVCY+ L+P  +E   C GN T    +RKP
Sbjct  302   VLAIQRVASCLKQQCEL-GGNCNLSLSCSQEVCYQSLIPDSMEAAPCGGNVTNG--LRKP  358

Query  1319  LCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFS  1498
              CLDVNG F +GIY+WALPV+SS S+A+KILYPIFWGLMTLSTFGNDLEPTS+WLEVIFS
Sbjct  359   SCLDVNGTFNYGIYQWALPVISSNSLAIKILYPIFWGLMTLSTFGNDLEPTSHWLEVIFS  418

Query  1499  ICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFE  1678
             ICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LR+RVR++E
Sbjct  419   ICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSGLRRRVRHYE  478

Query  1679  RQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPL  1858
             R RW  MGGEDEM+LIKDLPEGLRR+IKR LC+DLIKKVPLFH+LD+LILDNICDR++PL
Sbjct  479   RHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCIDLIKKVPLFHNLDELILDNICDRVRPL  538

Query  1859  VFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRP  2038
             VFSKDEKIIREGDPV +++FIVRGR+K SQ LSKG+V T++LEPGGFLGDELLSWCLRRP
Sbjct  539   VFSKDEKIIREGDPVPKMLFIVRGRIKRSQGLSKGMVGTNVLEPGGFLGDELLSWCLRRP  598

Query  2039  FIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAA  2218
             FIDRLPASSATF C++STEAFGL+A+ LR+ITDHFRYKFANERLKRTARYYS+NWRTWAA
Sbjct  599   FIDRLPASSATFACLESTEAFGLNASDLRYITDHFRYKFANERLKRTARYYSSNWRTWAA  658

Query  2219  VNVQLAWRRYRLRTRGQ--PNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             VN+Q AWRRYRLRTRG   P    E     DRRL QYAA+F+S++PHDHLE
Sbjct  659   VNIQFAWRRYRLRTRGPVIPVVTTEQNGGADRRLLQYAALFMSLKPHDHLE  709



>ref|XP_003531840.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Glycine max]
Length=718

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/711 (78%), Positives = 627/711 (88%), Gaps = 18/711 (3%)
 Frame = +2

Query  275   WFGTILR-RKSV-QPDNSDDTY-----------DENPNFISTECYACTQVGVPVFHSTSC  415
             W    LR R S+   D+S DT+           D+NP     ECYACTQVGVPVFHSTSC
Sbjct  12    WISKKLRPRNSISNGDSSSDTFHNGASTDTVVVDDNPFSSGVECYACTQVGVPVFHSTSC  71

Query  416   DNA-HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFL  592
             D+A HQ +WEASAGSSL+PI++RP  V    T      GPFGRVLDPRSKRVQRWNRA L
Sbjct  72    DSAYHQLQWEASAGSSLVPIQSRPKKVLGFRTVSGLTRGPFGRVLDPRSKRVQRWNRALL  131

Query  593   LARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAY  772
             LARG+ALAIDPLFFY+LSIGR G+PCLYMDGGLAA+VTV RTC+DAVH+ H+WLQFRLAY
Sbjct  132   LARGVALAIDPLFFYSLSIGREGSPCLYMDGGLAAMVTVARTCVDAVHLLHVWLQFRLAY  191

Query  773   VSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVK  952
             VSRESLVVGCGKLVWDAR +ASHY+RSLKGFWFDAFVILP+PQ VFWL+VPKL+REE++K
Sbjct  192   VSRESLVVGCGKLVWDARDIASHYLRSLKGFWFDAFVILPVPQVVFWLIVPKLLREEKIK  251

Query  953   limtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGC  1132
             +IMTI+LLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGC
Sbjct  252   IIMTIMLLIFLFQFLPKVYHSICMMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGC  311

Query  1133  WYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR  1312
             WYVLAIQRVASCLRQ+C  + + CNL +SCSEE+CY+ LLP     +SC GNST   ++R
Sbjct  312   WYVLAIQRVASCLRQQCE-RTNGCNLSVSCSEEICYQSLLPASAIADSCGGNST---VVR  367

Query  1313  KPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI  1492
             KPLCLDV GPF++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI
Sbjct  368   KPLCLDVQGPFKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI  427

Query  1493  FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRY  1672
             FSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR+
Sbjct  428   FSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLRQRVRH  487

Query  1673  FERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIK  1852
             FERQRWAAMGGEDEME+IKDLPEGLRRDIKR LCLDLI+KVPLFH++DDLILDNICDR+K
Sbjct  488   FERQRWAAMGGEDEMEMIKDLPEGLRRDIKRHLCLDLIRKVPLFHNMDDLILDNICDRVK  547

Query  1853  PLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLR  2032
             PLVFSKDEKIIREGDPV R+VF+VRGR+K +Q+LSKG+VA+SIL+PGGFLGDELLSWCLR
Sbjct  548   PLVFSKDEKIIREGDPVPRMVFVVRGRIKRNQSLSKGMVASSILDPGGFLGDELLSWCLR  607

Query  2033  RPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTW  2212
             RPFIDRLPASSATF C++S EAFGLDAN+LR+ITDHFRYKFANERLKRTARYYS+NWRTW
Sbjct  608   RPFIDRLPASSATFVCLESAEAFGLDANNLRYITDHFRYKFANERLKRTARYYSSNWRTW  667

Query  2213  AAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             AAVN+Q AWRRYR RT+G    V +     +RRL QYAA+F+S+RPHDHLE
Sbjct  668   AAVNIQFAWRRYRQRTKGPVIPVRDTNGGTERRLLQYAALFMSLRPHDHLE  718



>ref|XP_009360567.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Pyrus 
x bretschneideri]
Length=712

 Score =  1100 bits (2845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/713 (78%), Positives = 631/713 (88%), Gaps = 15/713 (2%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFIST-------ECYACTQVGVPVFHST  409
             +F L RW   +LRR++ Q D++++T++ N   + ++T       ECYACTQVGVP FHST
Sbjct  5     YFFLPRW-TRVLRRQNSQSDDTNNTHNSNNIEDIMNTPIISNSVECYACTQVGVPAFHST  63

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQP+WEASAGSSLIPI++R  S   +       + PFG VLDPRSKRVQRWNRAF
Sbjct  64    SCDAAHQPQWEASAGSSLIPIQSR--SDLKKGLSRHRPASPFGPVLDPRSKRVQRWNRAF  121

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARGMALA+DPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC+DAVH+CHLWLQFRLA
Sbjct  122   LLARGMALAVDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCVDAVHLCHLWLQFRLA  181

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWD RA++SHY+RSLKGFWFDAFVILP+PQAVFWLV+PKLI+EE++
Sbjct  182   YVSRESLVVGCGKLVWDPRAISSHYLRSLKGFWFDAFVILPVPQAVFWLVLPKLIKEEKI  241

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K+IMTILLL+FLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGG
Sbjct  242   KVIMTILLLMFLFQFLPKVYHSISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGG  301

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ C  Q   CNL LSCS+EVCY+LLLP    G++C GN+TA+ + 
Sbjct  302   CWYVLAIQRVASCLRQHCD-QNVNCNLSLSCSDEVCYQLLLPAATSGSTCGGNTTASVVR  360

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             + PLCLDVNG F +GIY+ ALPV+SS S+A+KILYPIFWGLMTLSTFGNDLEPTS+WLEV
Sbjct  361   KPPLCLDVNGTFNYGIYQLALPVISSNSLAIKILYPIFWGLMTLSTFGNDLEPTSHWLEV  420

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSIC+VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LR+RVR
Sbjct  421   IFSICVVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSGLRRRVR  480

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             ++ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCLDLIKKVPLF +LDDLILDNICDR+
Sbjct  481   HYERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLDLIKKVPLFDNLDDLILDNICDRV  540

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             +PLVFSKDEKIIREGDPV +++FIVRGR+K +Q LSKG+V T++LEPGGF GDELLSWCL
Sbjct  541   RPLVFSKDEKIIREGDPVPKMLFIVRGRIKRTQGLSKGMVGTNVLEPGGFFGDELLSWCL  600

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPFIDRLPASSATFTCI+STEAFGL+A  LR+ITDHFRYKFANERLKRTARYYS+NWRT
Sbjct  601   RRPFIDRLPASSATFTCIESTEAFGLNAVDLRYITDHFRYKFANERLKRTARYYSSNWRT  660

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+Q AWRRYRLRT   P  +P   + G +R+L QYAAMF+S+RPHDHLE
Sbjct  661   WAAVNIQFAWRRYRLRTNRGP-VIPVIPNGGSERKLLQYAAMFMSLRPHDHLE  712



>ref|XP_008341626.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Malus domestica]
Length=712

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/713 (78%), Positives = 628/713 (88%), Gaps = 15/713 (2%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQPDNSDDTYDEN--PNFIST-------ECYACTQVGVPVFHST  409
              F L RW   +LRR++ Q D++D+T++ N   + I+T       ECYACTQVGVP FHST
Sbjct  5     QFFLPRW-TRVLRRQNSQSDDTDNTHNSNNIEDIINTPIISNSVECYACTQVGVPAFHST  63

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQP+WEASAGSSL PI++R  S   +       + PFG VLDPRSKRVQRWNRAF
Sbjct  64    SCDAAHQPQWEASAGSSLXPIQSR--SDLKKGLSRHRPASPFGPVLDPRSKRVQRWNRAF  121

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARGMALA+DPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC+DAVH+CHLWLQFRLA
Sbjct  122   LLARGMALAVDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCVDAVHLCHLWLQFRLA  181

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWDARA++SHY+RSLKGFWFDAFVILP+PQAVFWLV+PKLI+EE++
Sbjct  182   YVSRESLVVGCGKLVWDARAISSHYLRSLKGFWFDAFVILPVPQAVFWLVLPKLIKEEKI  241

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K+IMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGG
Sbjct  242   KVIMTILLLIFLFQFLPKVYHSISLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGG  301

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ C  Q   CNL LSCS+EVCY+ LLP    G++C GN+TA+ + 
Sbjct  302   CWYVLAIQRVASCLRQHCD-QNVNCNLSLSCSDEVCYQFLLPASTSGSTCGGNTTASVMR  360

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             + PLCLDVNG F +GIY+ ALPV+SS S+A+KILYPIFWGLMTLSTFGNDLEPTS+WLEV
Sbjct  361   KPPLCLDVNGTFNYGIYQLALPVISSNSLAIKILYPIFWGLMTLSTFGNDLEPTSHWLEV  420

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LR+RVR
Sbjct  421   IFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSGLRRRVR  480

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             ++ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCL+LIKKVPLF +LDDLILDNICDR+
Sbjct  481   HYERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLELIKKVPLFDNLDDLILDNICDRV  540

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             +PLVFSKDEKIIREGDPV R++FIVRGR+K +Q LSKG+V T++LEPGGF GDELLSWCL
Sbjct  541   RPLVFSKDEKIIREGDPVPRMLFIVRGRIKRTQGLSKGMVGTNVLEPGGFFGDELLSWCL  600

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPFIDRLPASSATFTCI+STEAFGL+A  LR+ITDHFRYKFANERLKRTARYYS+NWRT
Sbjct  601   RRPFIDRLPASSATFTCIESTEAFGLNAVDLRYITDHFRYKFANERLKRTARYYSSNWRT  660

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+Q  WRRYRLRT   P  +P   + G +R+L QYAAMF+S+RPHDHLE
Sbjct  661   WAAVNIQFTWRRYRLRTNRGP-VIPVIPNGGSERKLLQYAAMFMSLRPHDHLE  712



>ref|XP_007217012.1| hypothetical protein PRUPE_ppa002126mg [Prunus persica]
 gb|EMJ18211.1| hypothetical protein PRUPE_ppa002126mg [Prunus persica]
Length=712

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/711 (78%), Positives = 626/711 (88%), Gaps = 14/711 (2%)
 Frame = +2

Query  260   FSLSRWFGTILRRKSVQPDNSDDTYDEN--------PNFISTECYACTQVGVPVFHSTSC  415
             FSLSRW    LRR+S + D++D++++ N        P   S ECYACTQVGVPVFHSTSC
Sbjct  7     FSLSRW-TRALRRQSSRADDTDNSHNSNNIEDIINAPISNSVECYACTQVGVPVFHSTSC  65

Query  416   DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLL  595
             D AHQ +WEASAGSSL+PI++R  S   +       +GPFG VLDPRSKRVQRWNRAFLL
Sbjct  66    DGAHQLQWEASAGSSLVPIQSR--SDLKKGLSRGLPAGPFGHVLDPRSKRVQRWNRAFLL  123

Query  596   ARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYV  775
             ARGMALA+DPLFFYALSIGR GTPCLYMDGGLAAIVTVLRTC+DAVH+CHLWLQFRLAYV
Sbjct  124   ARGMALAVDPLFFYALSIGRGGTPCLYMDGGLAAIVTVLRTCVDAVHLCHLWLQFRLAYV  183

Query  776   SRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKl  955
             SRESLVVGCGKLVWD  A+ASHYVRSLKGFWFDAFVILP+PQAVFWLV+PKLIREE++K+
Sbjct  184   SRESLVVGCGKLVWDPHAIASHYVRSLKGFWFDAFVILPVPQAVFWLVLPKLIREEKIKV  243

Query  956   imtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCW  1135
             IMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCW
Sbjct  244   IMTILLLIFLFQFLPKVYHSICLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCW  303

Query  1136  YVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRK  1315
             YVLAIQRVASCLRQ C    + CNL LSCSEEVCY+ L P     N C GN+TA+ + + 
Sbjct  304   YVLAIQRVASCLRQHCELSVN-CNLSLSCSEEVCYQFLSPADTMQNPCGGNTTASVVRKP  362

Query  1316  PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIF  1495
             PLCLDVNG F +GIY+WALPV+SS S+A+KILYPIFWGLMTLSTFGNDLEPTS+WLEVIF
Sbjct  363   PLCLDVNGTFNYGIYQWALPVISSNSLAIKILYPIFWGLMTLSTFGNDLEPTSHWLEVIF  422

Query  1496  SICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYF  1675
             SICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LR+RVR++
Sbjct  423   SICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSGLRRRVRHY  482

Query  1676  ERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKP  1855
             ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCLDLIKKVPLFH+LDDLILDNICDR++P
Sbjct  483   ERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLDLIKKVPLFHNLDDLILDNICDRVRP  542

Query  1856  LVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRR  2035
             LVFSKDEKIIREGDPV +++FIVRG +K SQ LSKG+V T++LEPGGFLGDELLSWCLRR
Sbjct  543   LVFSKDEKIIREGDPVPKMLFIVRGHIKRSQGLSKGMVGTNVLEPGGFLGDELLSWCLRR  602

Query  2036  PFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWA  2215
             PFIDRLPASSATF C++STEAFGL+A+ LR+ITDHFRYKFANERLKRTARYYS+NWRTWA
Sbjct  603   PFIDRLPASSATFVCLESTEAFGLNADDLRYITDHFRYKFANERLKRTARYYSSNWRTWA  662

Query  2216  AVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYAAMFLSIRPHDHLE  2365
             AVN+Q AWRRYRLRT   P  +P   + G ++RL QYAAMF+S++PHDHLE
Sbjct  663   AVNIQFAWRRYRLRTNRGP-VIPVVQNGGTEQRLLQYAAMFMSLKPHDHLE  712



>ref|XP_009365836.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=712

 Score =  1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/713 (78%), Positives = 625/713 (88%), Gaps = 15/713 (2%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQPDNSDDTYDE-------NPNFIST--ECYACTQVGVPVFHST  409
             HFSL RW   +LRR++ Q D++++ ++        N   +S   ECYACTQVGVP FHST
Sbjct  5     HFSLPRW-TRVLRRQNSQIDDAENNHNSSNIEDIINAPIVSNSVECYACTQVGVPAFHST  63

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQP+WEASAGSSLIPI++R  S   +       +GPFG VLDPRSK VQRWNRAF
Sbjct  64    SCDGAHQPQWEASAGSSLIPIQSR--SDLKKGISRRRPAGPFGPVLDPRSKLVQRWNRAF  121

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARGMALA+DPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT +DAVH+CHLWLQFRLA
Sbjct  122   LLARGMALAVDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTSVDAVHLCHLWLQFRLA  181

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWD RA++ HY+RSLKGFWFDAFVILP+PQAVFWLV+PKLI+EE+V
Sbjct  182   YVSRESLVVGCGKLVWDPRAISYHYLRSLKGFWFDAFVILPVPQAVFWLVLPKLIKEEKV  241

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K+IMTILLLIFLFQFLP++YHSI LMRRMQKVTGY+FGTIWWGF LNLIAYFIASHVAGG
Sbjct  242   KVIMTILLLIFLFQFLPKVYHSISLMRRMQKVTGYVFGTIWWGFGLNLIAYFIASHVAGG  301

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ C  Q   CNL LSCS+EVCY+ LLP    GN C GN+T + + 
Sbjct  302   CWYVLAIQRVASCLRQHCD-QNVKCNLSLSCSDEVCYQFLLPSATIGNPCGGNTTTSVMR  360

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             + PLCLDVNG F +GIY+WALPV+SS S+A+KILYPIFWGLMTL TFGNDLEPTS+WLEV
Sbjct  361   KPPLCLDVNGTFNYGIYQWALPVISSNSLAIKILYPIFWGLMTLGTFGNDLEPTSHWLEV  420

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LR+RVR
Sbjct  421   IFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSGLRRRVR  480

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             ++ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCLDLIKKVPLFH+LDDLILDN+CDR+
Sbjct  481   HYERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLDLIKKVPLFHNLDDLILDNMCDRV  540

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             +PLVFSKDEKIIREGDPV +++FIVRGR+K +Q LSKG+V T++LEPGGF GDELLSWCL
Sbjct  541   RPLVFSKDEKIIREGDPVPKMLFIVRGRIKRTQGLSKGMVGTNVLEPGGFFGDELLSWCL  600

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPF+DRLPASSATFTCI+STEAFGL+A  LR++TDHFRYKFANERLKRTARYYS+NWRT
Sbjct  601   RRPFMDRLPASSATFTCIESTEAFGLNAVDLRYMTDHFRYKFANERLKRTARYYSSNWRT  660

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENAD-DGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+Q AWRRYRLRT   P  +P N +   +R+L QYAAMFLS+RPHDHLE
Sbjct  661   WAAVNIQFAWRRYRLRTNRGP-VIPVNPNGSSERKLLQYAAMFLSLRPHDHLE  712



>ref|XP_007032654.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY03580.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2, partial [Theobroma cacao]
Length=660

 Score =  1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/656 (84%), Positives = 600/656 (91%), Gaps = 8/656 (1%)
 Frame = +2

Query  314   DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  493
             D+S D  ++NP   + ECYACTQVGVPVFHSTSCD+AHQPEWEASAGSSL+PI+ R G  
Sbjct  7     DHSGDISEDNPISNTVECYACTQVGVPVFHSTSCDHAHQPEWEASAGSSLVPIQARAGQK  66

Query  494   THRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCL  673
               ++    H SGP GRVLDPRSKRVQ+WNRAFLLARGMALAIDPLFFYALSIGR G PCL
Sbjct  67    KTQAAASRHPSGPLGRVLDPRSKRVQKWNRAFLLARGMALAIDPLFFYALSIGRGGFPCL  126

Query  674   YMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRS  853
             YMDGGLAAIVT+LRTC+DAVH+ HLWLQFRLAYVSRESLVVGCGKLVWDARA+ASHYVRS
Sbjct  127   YMDGGLAAIVTILRTCVDAVHLFHLWLQFRLAYVSRESLVVGCGKLVWDARAIASHYVRS  186

Query  854   LKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRR  1033
             LKGFWFDAFVILP+PQAVFWLVVPKLIREEQ+KLIMTILLLIFLFQFLP++YHSI LMRR
Sbjct  187   LKGFWFDAFVILPVPQAVFWLVVPKLIREEQIKLIMTILLLIFLFQFLPKVYHSICLMRR  246

Query  1034  MQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR  1213
             MQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASCLRQ+C  +   C L 
Sbjct  247   MQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQRVASCLRQQCE-RSERCKLS  305

Query  1214  LSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRS  1393
             LSCSEEVCY+ L P    GN C GNST   ++ KPLCLDV+GPF +GIY+WALPVVSS S
Sbjct  306   LSCSEEVCYQFLFPAEAVGNPCGGNST--KVVGKPLCLDVHGPFNYGIYQWALPVVSSNS  363

Query  1394  IAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAV  1573
             +AVKILYPIFWGLMTLSTFGNDLEPTS+WLEV+FSICIVL+GL+LFTLLIGNIQVFLHAV
Sbjct  364   VAVKILYPIFWGLMTLSTFGNDLEPTSHWLEVMFSICIVLAGLLLFTLLIGNIQVFLHAV  423

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
             MAKKRKMQLRCRDMEWWMKRRQLPS LRQRVR+FERQ+WA +GGEDEMELIKDLPEGLRR
Sbjct  424   MAKKRKMQLRCRDMEWWMKRRQLPSRLRQRVRHFERQKWATLGGEDEMELIKDLPEGLRR  483

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEK-----IIREGDPVQRVVF  1918
             DIKR+LCLDLIKKVPLFH+LDDLILDNICDR+KPLVFSKDEK     IIREGDPVQR+VF
Sbjct  484   DIKRYLCLDLIKKVPLFHNLDDLILDNICDRVKPLVFSKDEKVQAYEIIREGDPVQRMVF  543

Query  1919  IVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEA  2098
             IVRGR+K SQ+LSKG+VATSI+EPGGFLGDELLSWCLRRPFIDRLPASSATF C++S EA
Sbjct  544   IVRGRIKRSQSLSKGMVATSIIEPGGFLGDELLSWCLRRPFIDRLPASSATFVCVESIEA  603

Query  2099  FGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRG  2266
             FGLDAN+LR+ITDHFRYKFANERLKRTARYYS+NWRTWAAVN+QLAWRRYR RTRG
Sbjct  604   FGLDANNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQLAWRRYRTRTRG  659



>gb|AIT39758.1| cyclic nucleotide gated ion channel 2 like, partial [Chrysanthemum 
boreale]
Length=688

 Score =  1093 bits (2826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/688 (78%), Positives = 608/688 (88%), Gaps = 11/688 (2%)
 Frame = +2

Query  314   DNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSV  493
             D++D+  D+NP   +TECYACTQVGVPVFHSTSCDNA+QP+WEASAGSSL+PI++RPGS 
Sbjct  3     DSADELEDDNPISNTTECYACTQVGVPVFHSTSCDNANQPQWEASAGSSLVPIRDRPGSK  62

Query  494   T--------HRSTQDFHRS-GPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALS  646
                       RS ++  R+   F RV DPRSK+VQRWNR FLLARG+ALA+DPLFFY LS
Sbjct  63    IVPNLAANDGRSRRESQRNRNFFSRVYDPRSKQVQRWNRFFLLARGVALAVDPLFFYTLS  122

Query  647   IGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR  826
             IGR G PCLYMDG LAA+V V+RT +DAVH+ H+WLQF +AYVSRESLVVGCGKLVWD +
Sbjct  123   IGRGGVPCLYMDGALAAVVAVMRTIVDAVHLLHMWLQFHVAYVSRESLVVGCGKLVWDPQ  182

Query  827   AVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRI  1006
             +++SHYVRSLKGFW+DAFVILP+PQAVFWLVVP+LIREE++K IMT LLLIFLFQFLP++
Sbjct  183   SISSHYVRSLKGFWYDAFVILPVPQAVFWLVVPRLIREERIKEIMTTLLLIFLFQFLPKV  242

Query  1007  YHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCH  1186
             YHSI LMRRM KVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRV  CLRQ+C 
Sbjct  243   YHSISLMRRMAKVTGYIFGTIWWGFALNLIAYFIASHVAGGCWYVLAIQRVVLCLRQQCS  302

Query  1187  YQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKW  1366
              +K+ CNL LSC++EVCY+ LLP    G+ CAGNST   L+RKPLCLDVNGP+ +GIY+W
Sbjct  303   -RKAVCNLALSCADEVCYQFLLPEDTFGDRCAGNSTIG-LVRKPLCLDVNGPYHYGIYRW  360

Query  1367  ALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIG  1546
             ALPV+SS S+ VKILYPIFWGLM+LSTFGNDLEPTS+W+EV+FSIC+VLSGLMLFTLLIG
Sbjct  361   ALPVISSNSLTVKILYPIFWGLMSLSTFGNDLEPTSHWVEVMFSICVVLSGLMLFTLLIG  420

Query  1547  NIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELI  1726
             NIQVFL AVMAKKRKMQLRCRDMEWWMKRRQLPS LRQRVR++ERQ WA MGGEDEMELI
Sbjct  421   NIQVFLQAVMAKKRKMQLRCRDMEWWMKRRQLPSILRQRVRHYERQNWALMGGEDEMELI  480

Query  1727  KDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQ  1906
             KDLPEGLRRDIKRFLCL L++ VPLFH+LDDLILDNICDR+KPLVFSKDEKIIREGDPVQ
Sbjct  481   KDLPEGLRRDIKRFLCLQLVRMVPLFHNLDDLILDNICDRVKPLVFSKDEKIIREGDPVQ  540

Query  1907  RVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCID  2086
             R+VFIV+GRVKSSQNLSKGVVATS L+PGG+LGDELLSWCLRRPFI+RLPASSATFTC++
Sbjct  541   RMVFIVQGRVKSSQNLSKGVVATSTLDPGGYLGDELLSWCLRRPFINRLPASSATFTCVE  600

Query  2087  STEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRG  2266
              TEAFGLDANHLR++TDHFRYKFANERLKRT RYYS+NWRTWAAVN+Q+ WRRY  + R 
Sbjct  601   PTEAFGLDANHLRYVTDHFRYKFANERLKRTVRYYSSNWRTWAAVNIQIGWRRYVAKMRR  660

Query  2267  QPNTVPENADDGDRRLRQYAAMFLSIRP  2350
               N V E  D  +R LRQYAA+F+SIRP
Sbjct  661   PVNHVTEEDDGSNRMLRQYAAIFMSIRP  688



>ref|XP_009365837.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Pyrus x bretschneideri]
Length=713

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/714 (78%), Positives = 625/714 (88%), Gaps = 16/714 (2%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQPDNSDDTYDE-------NPNFIST--ECYACTQVGVPVFHST  409
             HFSL RW   +LRR++ Q D++++ ++        N   +S   ECYACTQVGVP FHST
Sbjct  5     HFSLPRW-TRVLRRQNSQIDDAENNHNSSNIEDIINAPIVSNSVECYACTQVGVPAFHST  63

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQP+WEASAGSSLIPI++R  S   +       +GPFG VLDPRSK VQRWNRAF
Sbjct  64    SCDGAHQPQWEASAGSSLIPIQSR--SDLKKGISRRRPAGPFGPVLDPRSKLVQRWNRAF  121

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LLARGMALA+DPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT +DAVH+CHLWLQFRLA
Sbjct  122   LLARGMALAVDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTSVDAVHLCHLWLQFRLA  181

Query  770   YVSRE-SLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQ  946
             YVSRE SLVVGCGKLVWD RA++ HY+RSLKGFWFDAFVILP+PQAVFWLV+PKLI+EE+
Sbjct  182   YVSREESLVVGCGKLVWDPRAISYHYLRSLKGFWFDAFVILPVPQAVFWLVLPKLIKEEK  241

Query  947   VKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAG  1126
             VK+IMTILLLIFLFQFLP++YHSI LMRRMQKVTGY+FGTIWWGF LNLIAYFIASHVAG
Sbjct  242   VKVIMTILLLIFLFQFLPKVYHSISLMRRMQKVTGYVFGTIWWGFGLNLIAYFIASHVAG  301

Query  1127  GCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAAL  1306
             GCWYVLAIQRVASCLRQ C  Q   CNL LSCS+EVCY+ LLP    GN C GN+T + +
Sbjct  302   GCWYVLAIQRVASCLRQHCD-QNVKCNLSLSCSDEVCYQFLLPSATIGNPCGGNTTTSVM  360

Query  1307  MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLE  1486
              + PLCLDVNG F +GIY+WALPV+SS S+A+KILYPIFWGLMTL TFGNDLEPTS+WLE
Sbjct  361   RKPPLCLDVNGTFNYGIYQWALPVISSNSLAIKILYPIFWGLMTLGTFGNDLEPTSHWLE  420

Query  1487  VIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRV  1666
             VIFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS LR+RV
Sbjct  421   VIFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSGLRRRV  480

Query  1667  RYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
             R++ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCLDLIKKVPLFH+LDDLILDN+CDR
Sbjct  481   RHYERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLDLIKKVPLFHNLDDLILDNMCDR  540

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             ++PLVFSKDEKIIREGDPV +++FIVRGR+K +Q LSKG+V T++LEPGGF GDELLSWC
Sbjct  541   VRPLVFSKDEKIIREGDPVPKMLFIVRGRIKRTQGLSKGMVGTNVLEPGGFFGDELLSWC  600

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPF+DRLPASSATFTCI+STEAFGL+A  LR++TDHFRYKFANERLKRTARYYS+NWR
Sbjct  601   LRRPFMDRLPASSATFTCIESTEAFGLNAVDLRYMTDHFRYKFANERLKRTARYYSSNWR  660

Query  2207  TWAAVNVQLAWRRYRLRTRGQPNTVPENAD-DGDRRLRQYAAMFLSIRPHDHLE  2365
             TWAAVN+Q AWRRYRLRT   P  +P N +   +R+L QYAAMFLS+RPHDHLE
Sbjct  661   TWAAVNIQFAWRRYRLRTNRGP-VIPVNPNGSSERKLLQYAAMFLSLRPHDHLE  713



>ref|XP_010258957.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Nelumbo 
nucifera]
Length=713

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/719 (76%), Positives = 615/719 (86%), Gaps = 15/719 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  415
             MP+ P    SL RW G +L+ +  Q    DD  +ENP+  S ECYACTQVG P FHSTSC
Sbjct  1     MPALPESLISLRRWPGVLLQFRKNQLGAGDDEEEENPSSHSVECYACTQVGAPAFHSTSC  60

Query  416   DNAHQPEWEASAGSSLIPIKNR------PGSVTHRSTQDFHRSGP---FGRVLDPRSKRV  568
             D AH PEWEASAGSSLIPI++       P   + R T    R      FGRVLDPRSKRV
Sbjct  61    DRAHTPEWEASAGSSLIPIQSHSDDGASPDRKSLRKTVSNKRRTSRWVFGRVLDPRSKRV  120

Query  569   QRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHL  748
             QRWNRA LLAR MALAIDPLFFYALSIGR G PCLY+DGGLAAI+TVLRT +DAVH+CHL
Sbjct  121   QRWNRAILLARAMALAIDPLFFYALSIGRGGAPCLYIDGGLAAILTVLRTFVDAVHLCHL  180

Query  749   WLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPK  928
             WLQFRLAYVSRESLV+GCGKLVWDARA+ASHYVRSLKGFWFDAFVILP+PQ +FWLV+PK
Sbjct  181   WLQFRLAYVSRESLVIGCGKLVWDARAIASHYVRSLKGFWFDAFVILPVPQTIFWLVLPK  240

Query  929   LIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFI  1108
             L+REE++K+IMTI++L FLFQFLP+IYHSIYLMR+MQKVTGY+FGTIWWGF LN+IAYFI
Sbjct  241   LLREERIKMIMTIVILAFLFQFLPKIYHSIYLMRKMQKVTGYVFGTIWWGFGLNVIAYFI  300

Query  1109  ASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGN  1288
             ASHV GGCWY+LAIQRVASCL+Q C  + +TCNL L+C++EVCY L L   +  +SC G+
Sbjct  301   ASHVTGGCWYILAIQRVASCLKQHCR-RDTTCNLSLACAKEVCYRLPLASTLMKSSCHGD  359

Query  1289  STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEP  1468
             S  A+L   P+CLD +GPF +GIY+WALPVVSS S+AVKILYPI+WGL+TLST GN LEP
Sbjct  360   SAIASL---PVCLDSDGPFPYGIYEWALPVVSSNSVAVKILYPIYWGLITLSTMGNILEP  416

Query  1469  TSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS  1648
             TS  LEVIFSI  VLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRDMEWWMKRRQLPS
Sbjct  417   TSECLEVIFSIITVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDMEWWMKRRQLPS  476

Query  1649  NLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLIL  1828
              LRQRVR+FERQRWAAMGGEDEME+IKDLPEGLRRDIKR LCLDLIK+VPLFH+LDDLIL
Sbjct  477   RLRQRVRHFERQRWAAMGGEDEMEVIKDLPEGLRRDIKRHLCLDLIKQVPLFHNLDDLIL  536

Query  1829  DNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGD  2008
             DNICDR++PL +SKDEKIIREGDPVQR+VFIVRG +KSSQ LSKG+VAT +L PG FLGD
Sbjct  537   DNICDRVRPLFYSKDEKIIREGDPVQRMVFIVRGHIKSSQGLSKGMVATCMLGPGNFLGD  596

Query  2009  ELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARY  2188
             ELLSWCLRRPFI RLPASSATF C+++TEAFGLDA+HLR+ITDHFRYKFAN++LKRT RY
Sbjct  597   ELLSWCLRRPFIGRLPASSATFVCVEATEAFGLDAHHLRYITDHFRYKFANDKLKRTTRY  656

Query  2189  YSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             YS+NWRTWAAVN+QLAWRRY +RTR       EN D  DRRLRQYAA+F+++RPHDHLE
Sbjct  657   YSSNWRTWAAVNIQLAWRRYMVRTRRLVVQPQENGD--DRRLRQYAAIFMALRPHDHLE  713



>ref|XP_002284164.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Vitis 
vinifera]
 emb|CBI22277.3| unnamed protein product [Vitis vinifera]
Length=701

 Score =  1086 bits (2809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/712 (78%), Positives = 613/712 (86%), Gaps = 13/712 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFIST--ECYACTQVGVPVFHST  409
             M + P    SL RW G   RRK+    NSD+ Y+E+   IS   ECYACTQVGVPVFHST
Sbjct  1     MDAPPNFQISLPRWIGIFRRRKA----NSDENYEEDDGPISNSIECYACTQVGVPVFHST  56

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQPEWEASAGSSLIPI++R    T ++  +   SGPFG VLDPR+K VQRWNRAF
Sbjct  57    SCDQAHQPEWEASAGSSLIPIQDRR---TGKARSNGRPSGPFGPVLDPRTKPVQRWNRAF  113

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LL RGM+LA+DPLFFY +SIG  G PCLYMDGGLAAIVTVLRTC+DAVH+ HLWLQFRLA
Sbjct  114   LLVRGMSLAVDPLFFYVISIGGEGGPCLYMDGGLAAIVTVLRTCVDAVHLFHLWLQFRLA  173

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFD FVILP+PQ VFWLVVPKLI++E++
Sbjct  174   YVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDLFVILPVPQVVFWLVVPKLIKQEEI  233

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             KL+MTILLL+FLFQFLP++YHS+ LMRRMQKV GYIFGTIWW F LNLIAY IASHVAGG
Sbjct  234   KLMMTILLLMFLFQFLPKVYHSVCLMRRMQKVMGYIFGTIWWRFVLNLIAYLIASHVAGG  293

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCLRQ+C   ++ CN  LSCS EVCY+ LLP G  GN C  NST   L 
Sbjct  294   CWYVLAIQRVASCLRQQC--DRNRCNFSLSCSREVCYQFLLPAGTVGNPCVDNSTI--LT  349

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             RKPLCLDVNGPF +GIY  ALPV+SS+SIAVKILYPIFWGL+ LSTF N+L PTSNWLEV
Sbjct  350   RKPLCLDVNGPFEYGIYDIALPVISSQSIAVKILYPIFWGLLNLSTFANELAPTSNWLEV  409

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSICIVLSGL+LFTLLIGNIQVFL +VMAKKRKMQLR R++EWWM+RRQLPS+LRQRVR
Sbjct  410   IFSICIVLSGLLLFTLLIGNIQVFLQSVMAKKRKMQLRYREIEWWMRRRQLPSHLRQRVR  469

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
              FER  WAAMGGEDEMELI+DLPEGLRRDIKR LCLDLIKKVPLF SLDDLILDNICDR+
Sbjct  470   RFERHSWAAMGGEDEMELIQDLPEGLRRDIKRHLCLDLIKKVPLFQSLDDLILDNICDRV  529

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             KPLVF KDEKIIREGDPV R+VFI RG +KSSQNLSKG+VATS+LEPG FLGDELLSWC+
Sbjct  530   KPLVFCKDEKIIREGDPVHRMVFITRGHIKSSQNLSKGMVATSLLEPGDFLGDELLSWCI  589

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPFIDR PASSATF C++STEAFGLDANHLRFIT+HFRYKFANERLKRTARYYS+NWRT
Sbjct  590   RRPFIDRHPASSATFVCVESTEAFGLDANHLRFITEHFRYKFANERLKRTARYYSSNWRT  649

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+QLAWRRY +RTRG P          DRRLRQ AAMF+S+RPHDHLE
Sbjct  650   WAAVNIQLAWRRYIIRTRGAPAIPVIENGGSDRRLRQCAAMFMSLRPHDHLE  701



>ref|XP_010029345.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Eucalyptus 
grandis]
 gb|KCW56240.1| hypothetical protein EUGRSUZ_I01988 [Eucalyptus grandis]
Length=719

 Score =  1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/721 (78%), Positives = 616/721 (85%), Gaps = 13/721 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTIL-------RRKSVQPDNSDDTYDENPNFISTECYACTQVGVP  394
             MP  P   F L RW G  L                   + DENP   S ECYACTQVGVP
Sbjct  1     MPPRPAFLFFLPRWIGRQLGLLPGPGSDGGGGGGGGGSSGDENPVSHSIECYACTQVGVP  60

Query  395   VFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSG---PFGRVLDPRSK  562
             VFHSTSCD AH QPEWEASAGSSL+PI+ R G    +            PFGRVLDPRSK
Sbjct  61    VFHSTSCDRAHEQPEWEASAGSSLVPIQARAGPGAGKGAGRRGGQQQRGPFGRVLDPRSK  120

Query  563   RVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHIC  742
             RVQRWNR FLLARGMALA+DPLFFYALSIGR G+PCLYMDGGLAAIVTVLRTC+DAVH+ 
Sbjct  121   RVQRWNRGFLLARGMALAVDPLFFYALSIGRGGSPCLYMDGGLAAIVTVLRTCVDAVHLF  180

Query  743   HLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVV  922
             HLWLQFRLAYVSRESLVVGCGKLVWDARA+AS+YV S+KGFWFD FVILP+PQAVFWLVV
Sbjct  181   HLWLQFRLAYVSRESLVVGCGKLVWDARAIASNYVGSVKGFWFDVFVILPVPQAVFWLVV  240

Query  923   PKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAY  1102
             PKLIREE++KLIMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAY
Sbjct  241   PKLIREEKIKLIMTILLLIFLFQFLPKVYHSICLMRRMQKVTGYIFGTIWWGFGLNLIAY  300

Query  1103  FIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCA  1282
             FIASHVAGGCWYVLAIQRVASCLRQ+C  +   C+  LSC+EEVCY+LLLP G  G+ C 
Sbjct  301   FIASHVAGGCWYVLAIQRVASCLRQQCE-RNVNCDFSLSCAEEVCYQLLLPAGTIGDECG  359

Query  1283  GNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDL  1462
             GN TAA + RKPLCLD NGPF +GIY+WALPV+SS S+ VKILYPIFWGLMTLSTFGNDL
Sbjct  360   GNRTAA-MARKPLCLDKNGPFHYGIYQWALPVISSDSVVVKILYPIFWGLMTLSTFGNDL  418

Query  1463  EPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQL  1642
             EPTS+W+EV+FSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQL
Sbjct  419   EPTSHWMEVVFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQL  478

Query  1643  PSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDL  1822
             PS+LRQRVR++E QRW  MGGEDEMELIK+LPEGLRRDIKR+LCLDLI KVPLFH+LDDL
Sbjct  479   PSHLRQRVRHYEHQRWTTMGGEDEMELIKELPEGLRRDIKRYLCLDLIMKVPLFHNLDDL  538

Query  1823  ILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFL  2002
             ILDNICDR+KPLVFS+DEKIIREGDPVQR+VFI+RGR+K  Q LSKG+VATS+LEPGGFL
Sbjct  539   ILDNICDRVKPLVFSRDEKIIREGDPVQRIVFILRGRIKRMQGLSKGMVATSLLEPGGFL  598

Query  2003  GDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTA  2182
             GDELLSWCLRRPFIDR PASSATF C+DS EAFGLDA+ LR+ITDHFRYKF NERLK  A
Sbjct  599   GDELLSWCLRRPFIDRRPASSATFECMDSIEAFGLDADSLRYITDHFRYKFLNERLKWRA  658

Query  2183  RYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHL  2362
             RYYS+NWRTWAAVN+QLAWRR+RLRTRG  +   E+   G R L QYAAMF+S+RPHDHL
Sbjct  659   RYYSSNWRTWAAVNIQLAWRRHRLRTRGPMSPASEDGGSGRRNLLQYAAMFMSLRPHDHL  718

Query  2363  E  2365
             E
Sbjct  719   E  719



>gb|KCW56239.1| hypothetical protein EUGRSUZ_I01988 [Eucalyptus grandis]
Length=719

 Score =  1079 bits (2791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/721 (78%), Positives = 615/721 (85%), Gaps = 13/721 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTIL-------RRKSVQPDNSDDTYDENPNFISTECYACTQVGVP  394
             MP  P   F L RW G  L                   + DENP   S ECYACTQVGVP
Sbjct  1     MPPRPAFLFFLPRWIGRQLGLLPGPGSDGGGGGGGGGSSGDENPVSHSIECYACTQVGVP  60

Query  395   VFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSG---PFGRVLDPRSK  562
             VFHSTSCD AH QPEWEASAGSSL+PI+ R G    +            PFGRVLDPRSK
Sbjct  61    VFHSTSCDRAHEQPEWEASAGSSLVPIQARAGPGAGKGAGRRGGQQQRGPFGRVLDPRSK  120

Query  563   RVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHIC  742
             RVQRWNR FLLARGMALA+DPLFFYALSIGR G+PCLYMDGGLAAIVTVLRTC+DAVH+ 
Sbjct  121   RVQRWNRGFLLARGMALAVDPLFFYALSIGRGGSPCLYMDGGLAAIVTVLRTCVDAVHLF  180

Query  743   HLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVV  922
             HLWLQFRLAYVSRESLVVGCGKLVWDARA+AS+YV S+KGFWFD FVILP+PQAVFWLVV
Sbjct  181   HLWLQFRLAYVSRESLVVGCGKLVWDARAIASNYVGSVKGFWFDVFVILPVPQAVFWLVV  240

Query  923   PKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAY  1102
             PKLIREE++KLIMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAY
Sbjct  241   PKLIREEKIKLIMTILLLIFLFQFLPKVYHSICLMRRMQKVTGYIFGTIWWGFGLNLIAY  300

Query  1103  FIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCA  1282
             FIASHV GGCWYVLAIQRVASCLRQ+C  +   C+  LSC+EEVCY+LLLP G  G+ C 
Sbjct  301   FIASHVTGGCWYVLAIQRVASCLRQQCE-RNVNCDFSLSCAEEVCYQLLLPAGTIGDECG  359

Query  1283  GNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDL  1462
             GN TAA + RKPLCLD NGPF +GIY+WALPV+SS S+ VKILYPIFWGLMTLSTFGNDL
Sbjct  360   GNRTAA-MARKPLCLDKNGPFHYGIYQWALPVISSDSVVVKILYPIFWGLMTLSTFGNDL  418

Query  1463  EPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQL  1642
             EPTS+W+EV+FSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQL
Sbjct  419   EPTSHWMEVVFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQL  478

Query  1643  PSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDL  1822
             PS+LRQRVR++E QRW  MGGEDEMELIK+LPEGLRRDIKR+LCLDLI KVPLFH+LDDL
Sbjct  479   PSHLRQRVRHYEHQRWTTMGGEDEMELIKELPEGLRRDIKRYLCLDLIMKVPLFHNLDDL  538

Query  1823  ILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFL  2002
             ILDNICDR+KPLVFS+DEKIIREGDPVQR+VFI+RGR+K  Q LSKG+VATS+LEPGGFL
Sbjct  539   ILDNICDRVKPLVFSRDEKIIREGDPVQRIVFILRGRIKRMQGLSKGMVATSLLEPGGFL  598

Query  2003  GDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTA  2182
             GDELLSWCLRRPFIDR PASSATF C+DS EAFGLDA+ LR+ITDHFRYKF NERLK  A
Sbjct  599   GDELLSWCLRRPFIDRRPASSATFECMDSIEAFGLDADSLRYITDHFRYKFLNERLKWRA  658

Query  2183  RYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHL  2362
             RYYS+NWRTWAAVN+QLAWRR+RLRTRG  +   E+   G R L QYAAMF+S+RPHDHL
Sbjct  659   RYYSSNWRTWAAVNIQLAWRRHRLRTRGPMSPASEDGGSGRRNLLQYAAMFMSLRPHDHL  718

Query  2363  E  2365
             E
Sbjct  719   E  719



>ref|XP_010089586.1| hypothetical protein L484_020976 [Morus notabilis]
 gb|EXB38057.1| hypothetical protein L484_020976 [Morus notabilis]
Length=717

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/734 (74%), Positives = 612/734 (83%), Gaps = 41/734 (6%)
 Frame = +2

Query  236   MPSYPG-LHFSLSRWFGTI------------------LRRKSVQPDNSDDTYDENPNFIS  358
             MPS+   L  SLSRW GT+                   +  +   D+       +P   +
Sbjct  1     MPSHSNPLLSSLSRWIGTLCSHNFKNDYSSSSSSNNNNKNIAAAADHDISATVSSP---A  57

Query  359   TECYACTQVGVPVFHSTSCDNA-HQPEWEASAGSSLIPIKNR----PGSVTHRSTQDFHR  523
              ECYACTQVGVP FHSTSCD A HQP+WEA AG+SLIPI +R             Q    
Sbjct  58    GECYACTQVGVPAFHSTSCDRAGHQPQWEACAGTSLIPISSRTDLKKDLFVAAKKQQRPP  117

Query  524   SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIV  703
             +G FGRV+DPRSKRV RWNRAFLLARGMALA+DPLFFYALSIGR G PCLYMDG LAA+V
Sbjct  118   AGAFGRVIDPRSKRVHRWNRAFLLARGMALAVDPLFFYALSIGRGGAPCLYMDGALAAVV  177

Query  704   TVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFV  883
             TVLRTC+DAVH+CHLWLQFRLAYVSR+SLVVGCGKLVWDARA+ASHYVRS KGFWFDAFV
Sbjct  178   TVLRTCVDAVHLCHLWLQFRLAYVSRDSLVVGCGKLVWDARAIASHYVRSFKGFWFDAFV  237

Query  884   ILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFG  1063
             ILP+PQAVFWLV+PKLIREE++KLIMTILLLIFLFQFLP++YHSI LMR MQKVTGYIFG
Sbjct  238   ILPVPQAVFWLVLPKLIREEKIKLIMTILLLIFLFQFLPKVYHSICLMRSMQKVTGYIFG  297

Query  1064  TIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYE  1243
             TIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASCLR  C  +   CNL L+C EEVCY+
Sbjct  298   TIWWGFGLNLIAYFIASHVAGGCWYVLAIQRVASCLRTHCE-RNMNCNLSLACREEVCYQ  356

Query  1244  LLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIF  1423
              LLP G  GN C GN+T   ++RKPLCLDVNG + +GIYKWALPV+SS S+AVK LYPIF
Sbjct  357   FLLPTGTFGNPCGGNAT---VVRKPLCLDVNGTYNYGIYKWALPVISSNSVAVKTLYPIF  413

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGLMTLSTFGNDLEPTS+WLEVIFSICIVL+GLMLFTLLIGNIQ         KRK+QLR
Sbjct  414   WGLMTLSTFGNDLEPTSHWLEVIFSICIVLAGLMLFTLLIGNIQ---------KRKLQLR  464

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
             CRDMEWWMKRRQLPS LRQRVR++ERQ+WAA+GGEDEME++KDLPEGLRRDIKR+LCLDL
Sbjct  465   CRDMEWWMKRRQLPSRLRQRVRHYERQKWAALGGEDEMEMLKDLPEGLRRDIKRYLCLDL  524

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKG  1963
             IKKVPLFH+LDDLILDNICDR+KPLVF+KDEKIIREGDPV R+VFIVRGR++ +QNLSKG
Sbjct  525   IKKVPLFHNLDDLILDNICDRVKPLVFTKDEKIIREGDPVPRMVFIVRGRIRRNQNLSKG  584

Query  1964  VVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHF  2143
             +VATS+LEPGGFLGDELLSWCLRRPF+DRLP SSATF C+++TEAFGL++  L++ITDHF
Sbjct  585   MVATSVLEPGGFLGDELLSWCLRRPFLDRLPPSSATFVCVETTEAFGLNSEDLKYITDHF  644

Query  2144  RYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQY  2323
             RYKF NERLKRTARYYS+NWRTWA+VN+QLAWRRYR RTRG    V E+    +RRL QY
Sbjct  645   RYKFNNERLKRTARYYSSNWRTWASVNIQLAWRRYRTRTRGPVIPVAESGST-ERRLMQY  703

Query  2324  AAMFLSIRPHDHLE  2365
             AAMF+SI+PHDHLE
Sbjct  704   AAMFMSIKPHDHLE  717



>ref|XP_003621352.1| Cyclic nucleotide-gated ion channel [Medicago truncatula]
 gb|AES77570.1| cyclic nucleotide-gated ion channel protein, putative [Medicago 
truncatula]
Length=710

 Score =  1069 bits (2765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/722 (78%), Positives = 626/722 (87%), Gaps = 24/722 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFG-TILRRKSVQP-----DNSDD-----TYDENPNFISTECYACTQ  382
             MP++     SL RW G   L R          D+SDD       D+NP     ECYACTQ
Sbjct  1     MPTFS----SLPRWIGGKFLGRNPSNTINNVGDSSDDPGVAVIADDNPVISMVECYACTQ  56

Query  383   VGVPVFHSTSC-DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRS  559
             VGVPVFHSTSC D+ HQPEWEASAGS L+PI+NRPG      ++     G  G+VLDPRS
Sbjct  57    VGVPVFHSTSCADSCHQPEWEASAGSYLVPIQNRPGKFARAVSKP--NWGVLGKVLDPRS  114

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHI  739
             KRVQ  NRA LLARG+ALAIDPLFFYALSIGR G+PCLYMDGGLAA+VTV RT +DAVH+
Sbjct  115   KRVQLSNRALLLARGVALAIDPLFFYALSIGREGSPCLYMDGGLAAVVTVARTVVDAVHL  174

Query  740   CHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLV  919
              H+WLQFRLAYVSRESLVVGCGKLVWDARA+ASHY+RS KGFWFD FVILP+PQ VFWLV
Sbjct  175   FHVWLQFRLAYVSRESLVVGCGKLVWDARAIASHYMRSFKGFWFDVFVILPVPQVVFWLV  234

Query  920   VPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIA  1099
             VPKLIREE++K+IMT LLLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIA
Sbjct  235   VPKLIREERIKIIMTTLLLIFLFQFLPKVYHSISMMRRMQKVTGYIFGTIWWGFGLNLIA  294

Query  1100  YFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC  1279
             YFIASHVAGGCWYVLAIQRVASCL+Q+C  +   CNL L+CSEEVCY+ LLP  + GN C
Sbjct  295   YFIASHVAGGCWYVLAIQRVASCLQQQCE-RTIGCNLSLACSEEVCYKSLLPETI-GNPC  352

Query  1280  AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGND  1459
              GNST   +M KP+CLD++GP+++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGND
Sbjct  353   GGNST---MMSKPVCLDIDGPYKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGND  409

Query  1460  LEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQ  1639
             LEPTSNWLEVIFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQ
Sbjct  410   LEPTSNWLEVIFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQ  469

Query  1640  LPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDD  1819
             LPS LRQRVR+FERQRWAAMGGEDEMELIKDLPEGLRRDIKR LCLDLIKKVPLFH+LDD
Sbjct  470   LPSRLRQRVRHFERQRWAAMGGEDEMELIKDLPEGLRRDIKRHLCLDLIKKVPLFHNLDD  529

Query  1820  LILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGF  1999
             LILDNICDR+KPLVFS+DEKIIREGDPV R+VFIVRGR+K +Q+LSKG+VATS+LEPGGF
Sbjct  530   LILDNICDRVKPLVFSRDEKIIREGDPVPRMVFIVRGRIKRNQSLSKGIVATSVLEPGGF  589

Query  2000  LGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRT  2179
             LGDELLSWCLRRPFIDRLPASSATF C++STEAFGLDA +LR+ITDHFRYKFANERLKRT
Sbjct  590   LGDELLSWCLRRPFIDRLPASSATFVCLESTEAFGLDAQNLRYITDHFRYKFANERLKRT  649

Query  2180  ARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDH  2359
             ARYYS+NWRTWAAVN+QLA+RRYR RTRG    V +N    +RRL QYAAMF+SIRPHDH
Sbjct  650   ARYYSSNWRTWAAVNIQLAYRRYRQRTRGPVTPVRDNGGT-ERRLMQYAAMFMSIRPHDH  708

Query  2360  LE  2365
             LE
Sbjct  709   LE  710



>ref|XP_008230836.1| PREDICTED: LOW QUALITY PROTEIN: cyclic nucleotide-gated ion channel 
2 [Prunus mume]
Length=707

 Score =  1064 bits (2751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/714 (77%), Positives = 616/714 (86%), Gaps = 21/714 (3%)
 Frame = +2

Query  257   HFS--LSRWFGTILRRKSVQPDNSDDTYDEN--------PNFISTECYACTQVGVPVFHS  406
             HFS  LSRW    LRR+S + D++D++ + N        P   S ECYACTQVGVPVFHS
Sbjct  4     HFSFFLSRW-TRALRRQSSRADDTDNSSNLNNIEDIINAPISNSVECYACTQVGVPVFHS  62

Query  407   TSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRA  586
             TSCD AHQ +WEASAGSSL+PI++R  S   +       +GPFG VLDPRSKRVQRWNRA
Sbjct  63    TSCDGAHQLQWEASAGSSLVPIQSR--SDLKKGLSRGRPAGPFGHVLDPRSKRVQRWNRA  120

Query  587   FLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL  766
             FLLARGMALA+DPL    LSI        +MDGG AAIVTVLRTC+DAVH+CHLWLQFRL
Sbjct  121   FLLARGMALAVDPLCVAGLSIAXR-----WMDGGRAAIVTVLRTCVDAVHLCHLWLQFRL  175

Query  767   AYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQ  946
             AYVSRESLVVGCGKLVWD  A+ASHYVRSLKGFWFDAFVILP+PQAVFWLV+PKLIREE+
Sbjct  176   AYVSRESLVVGCGKLVWDPHAIASHYVRSLKGFWFDAFVILPVPQAVFWLVLPKLIREEK  235

Query  947   VKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAG  1126
             +K+IMTILLLIFLFQFLP++YHSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAG
Sbjct  236   IKVIMTILLLIFLFQFLPKVYHSICLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAG  295

Query  1127  GCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAAL  1306
             GCWYVLAIQRVASCLRQ C    + CNL LSCSEEVCY+ L P G  GN C GN+TA+ +
Sbjct  296   GCWYVLAIQRVASCLRQHCELS-ANCNLSLSCSEEVCYQFLSPAGTMGNPCGGNTTASVV  354

Query  1307  MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLE  1486
              + PLCLDVNG F +GIY+WALPV+SS S+A+KILYPIFWGLMTLSTFGNDLEPTS+WLE
Sbjct  355   RKPPLCLDVNGTFNYGIYQWALPVISSNSLAIKILYPIFWGLMTLSTFGNDLEPTSHWLE  414

Query  1487  VIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRV  1666
             VIFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LR+RV
Sbjct  415   VIFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSGLRRRV  474

Query  1667  RYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
             R++ER RW  MGGEDEM+LIKDLPEGLRR+IKR LCLDLIKKVPLFH+LDDLILDNICDR
Sbjct  475   RHYERHRWVTMGGEDEMDLIKDLPEGLRREIKRHLCLDLIKKVPLFHNLDDLILDNICDR  534

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             ++PLVFSKDEKIIREGDPV +++FIVRG +K SQ LSKG+V T++LEPGGFLGDELLSWC
Sbjct  535   VRPLVFSKDEKIIREGDPVPKMLFIVRGHIKRSQGLSKGMVGTNVLEPGGFLGDELLSWC  594

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPFIDRLPASSATF C++STEAFGL+A+ LR+ITDHFRYKFANERLKRTARYYS+NWR
Sbjct  595   LRRPFIDRLPASSATFVCLESTEAFGLNADDLRYITDHFRYKFANERLKRTARYYSSNWR  654

Query  2207  TWAAVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYAAMFLSIRPHDHLE  2365
             TWAAVN+Q AWRRYRLRT   P  +P   + G ++RL QYAAMF+S++PHDHLE
Sbjct  655   TWAAVNIQFAWRRYRLRTNRGP-VIPVVQNGGTEQRLLQYAAMFMSLKPHDHLE  707



>ref|XP_011098700.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Sesamum 
indicum]
Length=706

 Score =  1063 bits (2749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/714 (78%), Positives = 621/714 (87%), Gaps = 11/714 (2%)
 Frame = +2

Query  230   PKMPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHST  409
             P +   P  HFS SR  G ILR++S +        ++N    + ECYACTQVGVPVFHST
Sbjct  2     PSLDQQP--HFSFSRCCG-ILRQESSE---DSSESEDNQVSAAGECYACTQVGVPVFHST  55

Query  410   SCDNAHQPEWEASAGSSLIPIKNR-PGSVTHRSTQDFHRSGP-FGRVLDPRSKRVQRWNR  583
             SCD AHQP WEASAGSSL+PIK+R PG     +        P FGRVLDPRSKRVQRWNR
Sbjct  56    SCDKAHQPVWEASAGSSLLPIKHRSPGQKASSAQSSTSPEKPTFGRVLDPRSKRVQRWNR  115

Query  584   AFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFR  763
             A LLARGMALA+DPLFFY+LSIGR G+PCLYMDGGLAA+VTV+RTCLDAVH+ HLWLQFR
Sbjct  116   AVLLARGMALAVDPLFFYSLSIGRGGSPCLYMDGGLAAVVTVVRTCLDAVHLYHLWLQFR  175

Query  764   LAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREE  943
             LAYVSRESLV GCGKLVWD RA+A+HY+RS+KGFWFD FVILP+PQAVFW  VP+LI+EE
Sbjct  176   LAYVSRESLVTGCGKLVWDRRAIAAHYLRSIKGFWFDVFVILPVPQAVFWFAVPRLIKEE  235

Query  944   QVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVA  1123
             ++KL+MTILLLIFLFQFLP++YHSI LMRRMQ+VTGYIFGTIWWGF LNLIAYFIASHVA
Sbjct  236   RIKLVMTILLLIFLFQFLPKVYHSICLMRRMQEVTGYIFGTIWWGFGLNLIAYFIASHVA  295

Query  1124  GGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAA  1303
             GGCWY+LAIQRVASCL+Q+C  +   C+L LSCSEEVC + LLP    GN C  N+TAA 
Sbjct  296   GGCWYLLAIQRVASCLKQQCS-RYGFCSLSLSCSEEVCSQFLLPSSTIGNPCGTNTTAA-  353

Query  1304  LMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWL  1483
              +RKPLCLDVNGPF +GIY+WALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPTS WL
Sbjct  354   -LRKPLCLDVNGPFPYGIYEWALPVVSSSSVAVKILYPIFWGLMTLSTFGNDLEPTSQWL  412

Query  1484  EVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQR  1663
             EV+FSIC VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQR
Sbjct  413   EVMFSICAVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSQLRQR  472

Query  1664  VRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  1843
             VR +ER RWAAMGG+DEMELIKDLPEGLRRDIKRFLCLDLIKKV LFH+LDDLILDNICD
Sbjct  473   VRRYERHRWAAMGGDDEMELIKDLPEGLRRDIKRFLCLDLIKKVALFHNLDDLILDNICD  532

Query  1844  RIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSW  2023
             R+KPLVFSKDEKIIREGDPVQR+VFIVRGRV+SSQNLS+G+VATS+L+PGGF GDELLSW
Sbjct  533   RVKPLVFSKDEKIIREGDPVQRIVFIVRGRVRSSQNLSRGMVATSLLKPGGFFGDELLSW  592

Query  2024  CLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANW  2203
             CLRRPF+DRLPASSATFTC++ T+A+ LDANHLR+ITDHFRYKFANERL+RTARYYS+NW
Sbjct  593   CLRRPFLDRLPASSATFTCLEPTDAYALDANHLRYITDHFRYKFANERLRRTARYYSSNW  652

Query  2204  RTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             RTWAAVN+QLAWRRY  R R    +      D DRRLRQYAA+F+SIRPHD+LE
Sbjct  653   RTWAAVNIQLAWRRYLQRMRPAEISYGSPNVDSDRRLRQYAALFMSIRPHDNLE  706



>gb|ACA58352.1| putative cyclic nucleotide-gated cation channel [Sandersonia 
aurantiaca]
Length=712

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/717 (73%), Positives = 598/717 (83%), Gaps = 13/717 (2%)
 Frame = +2

Query  233   KMPSYPGLHFSLSRWFGTILRR---KSVQPDNSDDTYDENPNFISTECYACTQVGVPVFH  403
             ++P  P  +  LS   G+IL R   +S   D  + T        + ECYACTQ GVP FH
Sbjct  3     RLPRLPSGNPRLS---GSILSRDHQRSRSSDEDNSTAAAAAQSPTAECYACTQAGVPAFH  59

Query  404   STSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNR  583
             STSCD AH PEWEA AGSSLIPIKNR  S+ +R       +  FGRVLDPRSKRVQRWNR
Sbjct  60    STSCDKAHAPEWEAGAGSSLIPIKNRSSSIKNR----LRPTWVFGRVLDPRSKRVQRWNR  115

Query  584   AFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFR  763
               LLAR ++LAIDPLFFYALSIGR G PCLYMDGGLAA+VTVLRTC DA H+ H+WLQ R
Sbjct  116   GLLLARAVSLAIDPLFFYALSIGRGGAPCLYMDGGLAAVVTVLRTCADAGHLVHVWLQLR  175

Query  764   LAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREE  943
             +AYVSRESLVVGCGKLVWDAR VA+HY+RSLKGFWFD FVILP+PQ VFWL +PKLIREE
Sbjct  176   MAYVSRESLVVGCGKLVWDARTVAAHYLRSLKGFWFDLFVILPVPQTVFWLALPKLIREE  235

Query  944   QVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVA  1123
             ++KLIMT++LLIFLFQFLP++YHSI +MRRMQKVTGY+FGTIWWGF LNLIAYFIASHVA
Sbjct  236   EIKLIMTMMLLIFLFQFLPKVYHSICVMRRMQKVTGYVFGTIWWGFALNLIAYFIASHVA  295

Query  1124  GGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAA  1303
             GGCWYVLAIQRVASCL+Q+C    +   + L+CS+EVCY L LP G++  SC  N TA+ 
Sbjct  296   GGCWYVLAIQRVASCLQQQCEKNNNCDLVSLACSKEVCYHLPLPSGLDELSCETNLTASV  355

Query  1304  LMRK--PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSN  1477
               +   P CL+ NGP+ +GIY WALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPTSN
Sbjct  356   GSQNYNPTCLNPNGPYPYGIYNWALPVVSSNSLAVKILYPIFWGLMTLSTFGNDLEPTSN  415

Query  1478  WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLR  1657
             WLEVIFSI I L GLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRDMEWWMKRRQLPS LR
Sbjct  416   WLEVIFSIIITLCGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDMEWWMKRRQLPSRLR  475

Query  1658  QRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNI  1837
             QRVR +ERQ+WAA  GEDEME+++DLPEGLRRDIKR+LCLDL+K+VPLFH+LDDLILDNI
Sbjct  476   QRVRQYERQKWAATRGEDEMEMVRDLPEGLRRDIKRYLCLDLVKQVPLFHNLDDLILDNI  535

Query  1838  CDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELL  2017
             CDR+KPLVFS DEK+IREGDPVQR+VFIVRG +KSSQ LSKG+VAT +L PG FLGDELL
Sbjct  536   CDRVKPLVFSMDEKVIREGDPVQRMVFIVRGHLKSSQCLSKGIVATCMLGPGNFLGDELL  595

Query  2018  SWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSA  2197
             SWCLRRPFIDRLPASSATF C+++TEAF L+AN LR+IT+HFRYKFANERLKRTARYYS+
Sbjct  596   SWCLRRPFIDRLPASSATFECVEATEAFALNANDLRYITEHFRYKFANERLKRTARYYSS  655

Query  2198  NWRTWAAVNVQLAWRRYRLRTRGQPNTV-PENADDGDRRLRQYAAMFLSIRPHDHLE  2365
              WRTWAA+N+QLAWRRY+ RTRG    V P      + RL QYAAMF+S+RP DHL+
Sbjct  656   TWRTWAAINIQLAWRRYKKRTRGVVIQVQPSEIGGSENRLWQYAAMFMSLRPQDHLD  712



>ref|XP_006287115.1| hypothetical protein CARUB_v10000276mg, partial [Capsella rubella]
 gb|EOA20013.1| hypothetical protein CARUB_v10000276mg, partial [Capsella rubella]
Length=774

 Score =  1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/732 (75%), Positives = 611/732 (83%), Gaps = 30/732 (4%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTI---LRRKS--VQPDNSDDTY----DENPNFISTECYACTQVG  388
             MPS+P     +SRW G      RR++  +  +N  D+     DE P   S ECYACTQVG
Sbjct  51    MPSHPNF---ISRWIGLFSDKFRRQTTGIDENNGGDSTSSGSDETPVLSSVECYACTQVG  107

Query  389   VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSKR  565
             VP FHSTSCD AH PEW ASAGSSL+PI+   GS+ +     F R  GPFG VLDPRSKR
Sbjct  108   VPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSLPNPLRARFRRLKGPFGEVLDPRSKR  165

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGR-SGTPCLYMDGGLAAIVTVLRTCLDAVHIC  742
             VQRWNRA LLARGMALA+DPLFFYALSIGR SG  CLYMDG  AA+VTVLRT LDAVH+ 
Sbjct  166   VQRWNRALLLARGMALAVDPLFFYALSIGRTSGPACLYMDGAFAAVVTVLRTFLDAVHLW  225

Query  743   HLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVV  922
             H+WLQFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVV
Sbjct  226   HVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVV  285

Query  923   PKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAY  1102
             PKLIREE+VKLIMTILLLIFLFQFLP+IYH   LMRRMQKVTGYIFGTIWWGF LNLIAY
Sbjct  286   PKLIREEKVKLIMTILLLIFLFQFLPKIYHCFCLMRRMQKVTGYIFGTIWWGFALNLIAY  345

Query  1103  FIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-  1279
             FIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL LSC EEVCY+ + P    G  C 
Sbjct  346   FIASHVAGGCWYVLAIQRVASCIRQQC-MRTGNCNLSLSCKEEVCYQFVSPTSTIGYPCL  404

Query  1280  AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGND  1459
             +GN T+  +++KP+CLD NGPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF ND
Sbjct  405   SGNLTS--VVKKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFAND  462

Query  1460  LEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQ  1639
             LEPTSNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQ
Sbjct  463   LEPTSNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQ  522

Query  1640  LPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDD  1819
             LPS +RQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIKR+LC DLI KVPLF  +DD
Sbjct  523   LPSRIRQRVRRFERQRWTALGGEDELELIQDLPPGLRRDIKRYLCFDLINKVPLFRGMDD  582

Query  1820  LILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGF  1999
             LILDNICDR K  VFSKDEKIIREGDPVQR++FI+RGR K  Q+LSKGV+ATS+LEPGG+
Sbjct  583   LILDNICDRAKSRVFSKDEKIIREGDPVQRMIFIMRGRAKRIQSLSKGVIATSMLEPGGY  642

Query  2000  LGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRT  2179
             LGDELLSWCLRRPFIDRLP SSATF C+D+ EAF L ++ L++ITDHFRYKFANERLKRT
Sbjct  643   LGDELLSWCLRRPFIDRLPPSSATFVCLDNIEAFSLGSDDLKYITDHFRYKFANERLKRT  702

Query  2180  ARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT--------VPENADDG--DRRLRQYAA  2329
             ARYYS+NWRTWAAVN+Q+AWRRYR RTRG+ N         V EN+ +G  +RRL QYAA
Sbjct  703   ARYYSSNWRTWAAVNIQMAWRRYRKRTRGEINGGGGGSMSPVSENSVEGNSERRLLQYAA  762

Query  2330  MFLSIRPHDHLE  2365
             MF+SIRPHDHLE
Sbjct  763   MFMSIRPHDHLE  774



>ref|XP_010550023.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Tarenaya hassleriana]
Length=728

 Score =  1045 bits (2701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/732 (74%), Positives = 601/732 (82%), Gaps = 26/732 (4%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDE----------NPNFISTECYACTQV  385
             MPS P   F     F    RR++   D++                 P   S ECYACTQ 
Sbjct  1     MPSQPNFLFRWLGLFSRKFRRETTATDSNTGGEVGGGGDSGGGDETPVLNSVECYACTQA  60

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSK  562
             GVP FHSTSCD AH PEW ASAGSSL+PI+  PGS        + R SGPFG VLDPR+K
Sbjct  61    GVPAFHSTSCDQAHAPEWRASAGSSLVPIQ--PGSEAEPVRIRYRRPSGPFGEVLDPRTK  118

Query  563   RVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHI  739
             R QRWNR  LLARG ALA+DPLFFYALS+GR+  P CLYMDG  AA+VTVLRTC+DA+H+
Sbjct  119   RAQRWNRTLLLARGTALAVDPLFFYALSVGRTTGPACLYMDGAFAAVVTVLRTCVDALHL  178

Query  740   CHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLV  919
              H+WLQFR+AY+SRESLVVGCGKLVWD RAVASHY RSL+GFWFD  VILP+PQAVFWL+
Sbjct  179   WHVWLQFRMAYISRESLVVGCGKLVWDPRAVASHYARSLRGFWFDLLVILPVPQAVFWLI  238

Query  920   VPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIA  1099
             +PKLIREE++KLIMTILLLIFLFQFLP++YH I +MRRMQK TGYIFGTIWWGF LNLIA
Sbjct  239   LPKLIREEKIKLIMTILLLIFLFQFLPKVYHCICMMRRMQKATGYIFGTIWWGFALNLIA  298

Query  1100  YFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP-GGVEGNS  1276
             YFIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL LSC EEVCY+ + P G   G  
Sbjct  299   YFIASHVAGGCWYVLAIQRVASCIRQQCMRKGGNCNLSLSCKEEVCYQFISPTGSTVGYP  358

Query  1277  C-AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             C +GN T   ++RKPLCLD NGPFR+GIYKWALPV+SS S+AVKILYPIFWGLMTLSTFG
Sbjct  359   CLSGNLTN--VVRKPLCLDANGPFRYGIYKWALPVISSNSLAVKILYPIFWGLMTLSTFG  416

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             NDLEPTSNWLEVIFSI  VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+R
Sbjct  417   NDLEPTSNWLEVIFSIITVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRR  476

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             RQLPS LRQRVR FERQRW A+GGEDEM LI+DLP+GLRRDIKR+LCLDLI KVPLF  +
Sbjct  477   RQLPSRLRQRVRRFERQRWTALGGEDEMNLIRDLPQGLRRDIKRYLCLDLINKVPLFSGM  536

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDLILDNICDR KP+VFSKDEKIIREGDPVQR++FIVRGR K SQ+LSKGVVATS LEPG
Sbjct  537   DDLILDNICDRAKPIVFSKDEKIIREGDPVQRMIFIVRGRAKRSQSLSKGVVATSTLEPG  596

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
             G+LGDELLSWCLRRPF+DRLPASSATF C D+ EAF L ++ LR+ITDHFRYKFANERLK
Sbjct  597   GYLGDELLSWCLRRPFLDRLPASSATFVCTDNIEAFSLGSDDLRYITDHFRYKFANERLK  656

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRT---RGQPNTVP-----ENADDGDRRLRQYAA  2329
             RTARYYS+NWRTWAAVN+Q AWRRYR RT   RG  ++ P     EN  D DRRL QYAA
Sbjct  657   RTARYYSSNWRTWAAVNIQFAWRRYRKRTMSGRGSGDSGPMSHGRENGSDCDRRLLQYAA  716

Query  2330  MFLSIRPHDHLE  2365
             MF+SIRPHDHLE
Sbjct  717   MFMSIRPHDHLE  728



>ref|XP_006400062.1| hypothetical protein EUTSA_v10012798mg [Eutrema salsugineum]
 dbj|BAJ33868.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41515.1| hypothetical protein EUTSA_v10012798mg [Eutrema salsugineum]
Length=722

 Score =  1041 bits (2692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/729 (75%), Positives = 605/729 (83%), Gaps = 26/729 (4%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRK-------SVQPDNSDDTY--DENPNFISTECYACTQVG  388
             MPS P   F     F    RRK       S+  +NS ++   D+ P   S ECYACTQVG
Sbjct  1     MPSQPNFIFRWIGLFSDKFRRKTPGIEEISIVQNNSGESSSGDDTPVLSSVECYACTQVG  60

Query  389   VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSKR  565
             VP FHSTSCD AH PEW ASAGSSL+PI+   GS  + +   F R  GPFG VLDPRSKR
Sbjct  61    VPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSAPNPTRTRFRRLKGPFGEVLDPRSKR  118

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHIC  742
             VQRWNRA L+ARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VT +RTCLDAVH+ 
Sbjct  119   VQRWNRALLIARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTAVRTCLDAVHLW  178

Query  743   HLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVV  922
             H+WLQFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVV
Sbjct  179   HVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVV  238

Query  923   PKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAY  1102
             PKLIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAY
Sbjct  239   PKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAY  298

Query  1103  FIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCA  1282
             FIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL LSC EEVCY+ + P G      +
Sbjct  299   FIASHVAGGCWYVLAIQRVASCIRQQC-MRAGNCNLSLSCKEEVCYQFVSPIGYP--CLS  355

Query  1283  GNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDL  1462
             GN T+  ++ KP+CLD NGPFR+GIY WALPV+SS S+AVKILYPIFWGLMTLSTFGNDL
Sbjct  356   GNLTS--VVNKPMCLDSNGPFRYGIYGWALPVISSNSLAVKILYPIFWGLMTLSTFGNDL  413

Query  1463  EPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQL  1642
             EPTSNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQL
Sbjct  414   EPTSNWLEVMFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQL  473

Query  1643  PSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDL  1822
             PS LRQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIKR+LC DLI KVPLF  +DDL
Sbjct  474   PSRLRQRVRRFERQRWTALGGEDELELIQDLPPGLRRDIKRYLCFDLINKVPLFRGMDDL  533

Query  1823  ILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFL  2002
             ILDNICDR K  VFSKDEKIIREGDPVQR++FI+RGRVK +Q+LSKGVVATS LE GG+L
Sbjct  534   ILDNICDRAKHRVFSKDEKIIREGDPVQRMIFIMRGRVKRNQSLSKGVVATSTLEQGGYL  593

Query  2003  GDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTA  2182
             GDELLSWCLRRPFIDRLP SSATF C+D+ EAF L +  LR+ITDHFRYKFANERLKRTA
Sbjct  594   GDELLSWCLRRPFIDRLPPSSATFVCLDNIEAFSLGSEDLRYITDHFRYKFANERLKRTA  653

Query  2183  RYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT------VPENADDG--DRRLRQYAAMFL  2338
             RYYS+NWRTWAAVN+Q+AWRRYR RTRG  N       V EN+ +G  +RRL QYAAMF+
Sbjct  654   RYYSSNWRTWAAVNIQMAWRRYRKRTRGGENNGGSMSPVSENSVEGNSERRLLQYAAMFM  713

Query  2339  SIRPHDHLE  2365
             SIRPHDHLE
Sbjct  714   SIRPHDHLE  722



>ref|XP_010420197.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Camelina 
sativa]
Length=718

 Score =  1040 bits (2689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/725 (74%), Positives = 604/725 (83%), Gaps = 22/725 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSV---QPDNSDDTY---DENPNFISTECYACTQVGVPV  397
             MPS+P   F     F    RR++    + +  D TY   DE P   S ECYACTQVGVP 
Sbjct  1     MPSHPDFIFRWIGLFSEKFRRQTTGIEENNGGDSTYSGSDETPVLSSVECYACTQVGVPA  60

Query  398   FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRW  577
             FHSTSCD AH PEW ASAGSSL+PI++  GS      +     GPFG VLDPRSKRVQRW
Sbjct  61    FHSTSCDQAHAPEWRASAGSSLVPIQD--GSSVRARVRRL--KGPFGEVLDPRSKRVQRW  116

Query  578   NRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             NRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTVLRT LDAVH+ H+WL
Sbjct  117   NRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTFLDAVHLWHVWL  176

Query  755   QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLI  934
             QFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQ VFWLVVPKLI
Sbjct  177   QFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQTVFWLVVPKLI  236

Query  935   REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIAS  1114
             REE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIAS
Sbjct  237   REEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAYFIAS  296

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-AGNS  1291
             HVAGGCWYVLAIQRVASC+R++C  +   CNL L+C EEVCY+ + P    G  C +GN 
Sbjct  297   HVAGGCWYVLAIQRVASCIREQC-MRAGKCNLSLACKEEVCYQFVSPTSTFGYPCVSGNL  355

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPT  1471
             T+  ++ KP+CLD +GPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF NDLEPT
Sbjct  356   TS--VVNKPMCLDSDGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFANDLEPT  413

Query  1472  SNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSN  1651
             SNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQLPS 
Sbjct  414   SNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPSR  473

Query  1652  LRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILD  1831
             LRQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIKR+LC DLI KVPLF  +DDLILD
Sbjct  474   LRQRVRRFERQRWNALGGEDELELIQDLPPGLRRDIKRYLCFDLINKVPLFRGMDDLILD  533

Query  1832  NICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDE  2011
             NICDR KP VFSKDEKIIREGDPVQR++FI+RGR K  Q+LSKGVVATS+LEPGG+LGDE
Sbjct  534   NICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRAKRIQSLSKGVVATSMLEPGGYLGDE  593

Query  2012  LLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYY  2191
             LLSWCLRRPF DRLP SSATF C+D+ EAF L +N L++ITDHFRYKFANERLK+TARYY
Sbjct  594   LLSWCLRRPFTDRLPPSSATFVCLDNIEAFSLGSNDLKYITDHFRYKFANERLKQTARYY  653

Query  2192  SANWRTWAAVNVQLAWRRYRLRTR-----GQPNTVPENADDG--DRRLRQYAAMFLSIRP  2350
             S+NWRTWAAVN+Q+AWRRYR RTR     G  + V EN+ +G  +RRL QYAAMF+SIRP
Sbjct  654   SSNWRTWAAVNIQMAWRRYRKRTRDGGGNGSMSPVSENSVEGNSERRLLQYAAMFMSIRP  713

Query  2351  HDHLE  2365
             HDHLE
Sbjct  714   HDHLE  718



>ref|XP_002873723.1| hypothetical protein ARALYDRAFT_488387 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49982.1| hypothetical protein ARALYDRAFT_488387 [Arabidopsis lyrata subsp. 
lyrata]
Length=726

 Score =  1040 bits (2689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/731 (74%), Positives = 605/731 (83%), Gaps = 26/731 (4%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTY-----------DENPNFISTECYACTQ  382
             MPS+P   F     F    RR++   D +   +           DE P   S ECYACTQ
Sbjct  1     MPSHPNFIFRWIGMFSEKFRRQTTGIDENSILHINGGDSSSSGSDETPVLSSVECYACTQ  60

Query  383   VGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRS  559
             VGVP FHSTSCD AH PEW ASAGSSL+PI+    SV + +   F R  GPFG VLDPRS
Sbjct  61    VGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--ASVPNPARTRFRRLKGPFGEVLDPRS  118

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVH  736
             KRVQRWNRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTVLRTCLDAVH
Sbjct  119   KRVQRWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTCLDAVH  178

Query  737   ICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWL  916
             + H+WLQFRLAY+SRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWL
Sbjct  179   LWHVWLQFRLAYISRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWL  238

Query  917   VVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLI  1096
             VVPKLIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLI
Sbjct  239   VVPKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLI  298

Query  1097  AYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNS  1276
             AYFIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL L+C EEVCY+ + P    G  
Sbjct  299   AYFIASHVAGGCWYVLAIQRVASCIRQQC-MRAGGCNLSLACKEEVCYQFVSPTSTVGYP  357

Query  1277  C-AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             C +GN T+  ++ KP+CLD NGPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF 
Sbjct  358   CLSGNLTS--VVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFA  415

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             NDLEPTSNWLEVIFSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKR
Sbjct  416   NDLEPTSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKR  475

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             RQLPS LRQRVR FERQRW A+GGEDE+EL++DLP GLRRDIKR+LC DLI KVPLF  +
Sbjct  476   RQLPSRLRQRVRRFERQRWNALGGEDELELVQDLPPGLRRDIKRYLCFDLINKVPLFRGM  535

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDLILDNICDR KP VFSKDEKIIREGDPVQR++FI+RGRVK  Q+LSKGV+ATS LEPG
Sbjct  536   DDLILDNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQSLSKGVIATSTLEPG  595

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
             G+LGDELLSWCLRRPF+DRLP SSATF C+D+ EAF L    LR+ITDHFRYKFANERLK
Sbjct  596   GYLGDELLSWCLRRPFLDRLPPSSATFVCLDNIEAFSLGCEDLRYITDHFRYKFANERLK  655

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-----NTVPENADDG--DRRLRQYAAM  2332
             RTARYYS+NWRTWAAVN+Q+AWRR R RTRG+      + V EN+ +G  +RRL QYAAM
Sbjct  656   RTARYYSSNWRTWAAVNIQMAWRRCRKRTRGENIGGSMSPVSENSIEGNSERRLLQYAAM  715

Query  2333  FLSIRPHDHLE  2365
             F+SIRPHDHLE
Sbjct  716   FMSIRPHDHLE  726



>ref|XP_010453677.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Camelina sativa]
Length=722

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/725 (74%), Positives = 603/725 (83%), Gaps = 18/725 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKS--VQPDNSDDTY----DENPNFISTECYACTQVGVPV  397
             MPS+P   F     F    RR++  ++ +N  D+     DE P   S ECYACTQVGVP 
Sbjct  1     MPSHPNFIFRWIGLFSEKFRRQTTGIEENNGGDSTSSGSDETPVLSSVECYACTQVGVPA  60

Query  398   FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRW  577
             FHSTSCD AH PEW ASAGSSL+PI+           +     GPFG VLDPRSKRVQRW
Sbjct  61    FHSTSCDQAHAPEWRASAGSSLVPIQEGSSVPNPVRARVRRLKGPFGEVLDPRSKRVQRW  120

Query  578   NRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             NRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTVLRT LDAVH+ H+WL
Sbjct  121   NRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTFLDAVHLWHVWL  180

Query  755   QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLI  934
             QFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVVPKLI
Sbjct  181   QFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVVPKLI  240

Query  935   REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIAS  1114
             REE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIAS
Sbjct  241   REEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAYFIAS  300

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-AGNS  1291
             HVAGGCWYVLAIQRVASC+R++C  +   CNL L+C EEVCY+ + P    G  C +GN 
Sbjct  301   HVAGGCWYVLAIQRVASCIREQC-MRAGKCNLSLACKEEVCYQFVSPTSTFGYPCVSGNL  359

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPT  1471
             T+  ++ KP+CLD +GPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF NDLEPT
Sbjct  360   TS--VVNKPMCLDSDGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFANDLEPT  417

Query  1472  SNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSN  1651
             SNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQLPS 
Sbjct  418   SNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPSR  477

Query  1652  LRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILD  1831
             LRQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIKR+LC DLI KVPLF  +DDLILD
Sbjct  478   LRQRVRRFERQRWNALGGEDELELIQDLPPGLRRDIKRYLCFDLINKVPLFRGMDDLILD  537

Query  1832  NICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDE  2011
             NICDR KP VFSKDEKIIREGDPVQR++FI+RGR K  Q+LSKGVVATS+LEPGG+LGDE
Sbjct  538   NICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRAKRIQSLSKGVVATSMLEPGGYLGDE  597

Query  2012  LLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYY  2191
             LLSWCLRRPF DRLP SSATF C+D+ EAF L +N L++ITDHFRYKFANERLK+TARYY
Sbjct  598   LLSWCLRRPFTDRLPPSSATFVCLDNIEAFSLGSNDLKYITDHFRYKFANERLKQTARYY  657

Query  2192  SANWRTWAAVNVQLAWRRYRLRTR-----GQPNTVPENADDG--DRRLRQYAAMFLSIRP  2350
             S+NWRTWAAVN+Q+AWRRYR RTR     G  + V EN+ +G  +RRL QYAAMF+SIRP
Sbjct  658   SSNWRTWAAVNIQMAWRRYRKRTRDGGGNGSMSPVSENSVEGNSERRLLQYAAMFMSIRP  717

Query  2351  HDHLE  2365
             HDHLE
Sbjct  718   HDHLE  722



>ref|XP_010492375.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Camelina 
sativa]
Length=718

 Score =  1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/725 (74%), Positives = 603/725 (83%), Gaps = 22/725 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTY------DENPNFISTECYACTQVGVPV  397
             MPS+P   F     F    RR++   + ++  Y      DE P   S ECYACTQVGVP 
Sbjct  1     MPSHPNFIFRWIGLFSEKFRRQTTGIEENNGGYSTSSGSDETPVLSSVECYACTQVGVPA  60

Query  398   FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRW  577
             FHSTSCD AH PEW ASAGSSL+PI+   GS      +  +  GPFG VLDPRSKRVQRW
Sbjct  61    FHSTSCDQAHAPEWRASAGSSLVPIQE--GSSVRARVRRLN--GPFGEVLDPRSKRVQRW  116

Query  578   NRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             NRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTVLRT LDAVH+ H+WL
Sbjct  117   NRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTFLDAVHLWHVWL  176

Query  755   QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLI  934
             QFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVVPKLI
Sbjct  177   QFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVVPKLI  236

Query  935   REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIAS  1114
             REE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIAS
Sbjct  237   REEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAYFIAS  296

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-AGNS  1291
             HVAGGCWYVLAIQRVASC+R++C  +   CNL L+C EEVCY+ + P    G  C +GN 
Sbjct  297   HVAGGCWYVLAIQRVASCIREQC-MRAGKCNLSLACKEEVCYQFVSPTSTFGYPCVSGNL  355

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPT  1471
             T+  ++ KP+CLD +GPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF NDLEPT
Sbjct  356   TS--VVNKPMCLDSDGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFANDLEPT  413

Query  1472  SNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSN  1651
             SNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQLPS 
Sbjct  414   SNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPSR  473

Query  1652  LRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILD  1831
             LRQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIK++LC DLI KVPLF  +DDLILD
Sbjct  474   LRQRVRRFERQRWNALGGEDELELIQDLPPGLRRDIKQYLCFDLINKVPLFRGMDDLILD  533

Query  1832  NICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDE  2011
             NICDR KP VFSKDEKIIREGDPVQR++FI+RGR K  Q+LSKGVVATS+LEPGG+LGDE
Sbjct  534   NICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRAKRIQSLSKGVVATSMLEPGGYLGDE  593

Query  2012  LLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYY  2191
             LLSWCLRRPF DRLP SSATF C+D+ EAF L +N L++ITDHFRYKFANERLK+T RYY
Sbjct  594   LLSWCLRRPFTDRLPPSSATFVCLDNIEAFSLGSNDLKYITDHFRYKFANERLKQTTRYY  653

Query  2192  SANWRTWAAVNVQLAWRRYRLRTR-----GQPNTVPENADDG--DRRLRQYAAMFLSIRP  2350
             S+NWRTWAAVN+Q+AWRRYR RTR     G  + V EN+ +G  +RRL QYAAMF+SIRP
Sbjct  654   SSNWRTWAAVNIQMAWRRYRKRTRDGGGNGSMSPVSENSVEGNSERRLLQYAAMFMSIRP  713

Query  2351  HDHLE  2365
             HDHLE
Sbjct  714   HDHLE  718



>emb|CDY26422.1| BnaC09g42460D [Brassica napus]
Length=719

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/724 (75%), Positives = 605/724 (84%), Gaps = 19/724 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSV-------QPDNSDDTYDENPNFISTECYACTQVGVP  394
             MPS+    F     F   LRR++           +S  + D+ P   S ECYACTQVGVP
Sbjct  1     MPSHTNFLFRWIGLFSQKLRRETTGISENNGGESSSSSSSDDTPVLSSGECYACTQVGVP  60

Query  395   VFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSKRVQ  571
              FHSTSCD A+ PEW ASAGSSL+PI+   GS          R  GPFG VLDPRSKRVQ
Sbjct  61    AFHSTSCDQANTPEWRASAGSSLVPIQE--GSAPDPVRARLRRLKGPFGEVLDPRSKRVQ  118

Query  572   RWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHICHL  748
             RWNRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTV+RTCLDA+H+ H+
Sbjct  119   RWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVVRTCLDALHLWHV  178

Query  749   WLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPK  928
             WLQFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVVPK
Sbjct  179   WLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVVPK  238

Query  929   LIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFI  1108
             LIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAYFI
Sbjct  239   LIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAYFI  298

Query  1109  ASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-AG  1285
             ASHVAGGCWYVLAIQRVASC+RQ+C  + + CNL LSC EEVCY+ + P    G  C +G
Sbjct  299   ASHVAGGCWYVLAIQRVASCIRQQC-MRTANCNLSLSCQEEVCYQFVSPTSTIGFPCLSG  357

Query  1286  NSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLE  1465
             N T+  +++KP+CLD NGPFR+GIY WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLE
Sbjct  358   NLTS--VVKKPMCLDSNGPFRYGIYGWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLE  415

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
             PTSNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQLP
Sbjct  416   PTSNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLP  475

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
             S LRQRVR FERQRW A+GGEDE+ELI DLP GLRRDIKR+LC+DLI KVPLF  +DDLI
Sbjct  476   SRLRQRVRRFERQRWTALGGEDELELIHDLPPGLRRDIKRYLCVDLINKVPLFRGMDDLI  535

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLG  2005
             LDNICDR KP V+SKDEKIIREGDPVQR++FI+RGRVK +Q+LSKGVVATS LEPGG+LG
Sbjct  536   LDNICDRAKPRVYSKDEKIIREGDPVQRMIFIMRGRVKRNQSLSKGVVATSTLEPGGYLG  595

Query  2006  DELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTAR  2185
             DELLSWCLRRPFIDRLP SSATF C+D+ EAF L +  LR+ITDHFRYKFANERLKRTAR
Sbjct  596   DELLSWCLRRPFIDRLPPSSATFVCLDNIEAFSLGSEDLRYITDHFRYKFANERLKRTAR  655

Query  2186  YYSANWRTWAAVNVQLAWRRYRLRT--RGQPNTVPENADDG--DRRLRQYAAMFLSIRPH  2353
             YYS+NWRTWAAVN+Q++WRRYR RT   G  + V E++ +G  +RRL QYAAMF+SIRPH
Sbjct  656   YYSSNWRTWAAVNIQMSWRRYRKRTCVGGSMSPVSEHSVEGNSERRLLQYAAMFMSIRPH  715

Query  2354  DHLE  2365
             DHLE
Sbjct  716   DHLE  719



>ref|XP_009416822.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Musa acuminata 
subsp. malaccensis]
Length=718

 Score =  1032 bits (2669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/720 (73%), Positives = 599/720 (83%), Gaps = 14/720 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDEN-----PNFISTECYACTQVGVPVF  400
             +P    L   LSR  G + RRK V   +++D   E      P+  + ECYACTQ G P F
Sbjct  3     LPVTKLLRSFLSRSAGLLWRRKEVVSSDTEDGDYEGGNRTPPSVAAAECYACTQPGAPAF  62

Query  401   HSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF---GRVLDPRSKRVQ  571
             HST+CD AH PEWEASAGSSLIPI  RP       +    +SG     G+VLDPRS++V+
Sbjct  63    HSTTCDRAHSPEWEASAGSSLIPI--RPSQTNVLRSLRPGKSGASLLGGQVLDPRSEKVR  120

Query  572   RWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLW  751
             RWNR  LLAR +A+A+DPLFFY LSIGR G PCLYM+GGL AIVT LRT  DAVH+ H+W
Sbjct  121   RWNRLILLARAVAVAVDPLFFYVLSIGRRGAPCLYMNGGLLAIVTALRTAADAVHLVHVW  180

Query  752   LQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKL  931
             LQFR+AYVSRESLVVGCGKLVWDAR VA HY+RSL+GFWFD FVILP+PQAVFWLVVPKL
Sbjct  181   LQFRVAYVSRESLVVGCGKLVWDARMVAVHYLRSLRGFWFDVFVILPVPQAVFWLVVPKL  240

Query  932   IREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIA  1111
             I+E+++KL+MTILLLIF+FQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIA
Sbjct  241   IKEDKIKLMMTILLLIFVFQFLPKVYHSICVMRRMQKVTGYIFGTIWWGFGLNLIAYFIA  300

Query  1112  SHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLLPGGVEGNSCAGN  1288
             SHVAGGCWYVLAIQRVASCL+Q+C  QK+ C+L  L+CS+EVCY   L  G+  ++C GN
Sbjct  301   SHVAGGCWYVLAIQRVASCLQQQCE-QKNDCDLVSLACSKEVCYPFTLRSGMAASACEGN  359

Query  1289  STAAALMRK-PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLE  1465
               A+  M+   +CL  NGPF +GIY WALPVVSS S+AVKILYPIFWGLMTLSTFGNDLE
Sbjct  360   LMASTGMQNTSVCLSGNGPFPYGIYNWALPVVSSSSLAVKILYPIFWGLMTLSTFGNDLE  419

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
             PTS+WLEVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLR RDMEWWMKRRQLP
Sbjct  420   PTSHWLEVIFSIVIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRSRDMEWWMKRRQLP  479

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
             S LRQRVR +ERQRWAA  GE+EME+IKD PEGLRRDIKR LC+DLIK+VPLFH+LDDLI
Sbjct  480   SRLRQRVRQYERQRWAATRGEEEMEMIKDFPEGLRRDIKRDLCVDLIKQVPLFHNLDDLI  539

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLG  2005
             LDNIC+R+KPLVFSK EK+IREGDPVQR+VF+VRG +KSSQ LSKG+VAT +L PG FLG
Sbjct  540   LDNICERVKPLVFSKGEKVIREGDPVQRMVFVVRGHLKSSQCLSKGMVATCMLGPGNFLG  599

Query  2006  DELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTAR  2185
             DELLSWCLRRPF+DRLPASSATF C++  EAFGLDA  LR+IT+HFRYKFANERLKRTAR
Sbjct  600   DELLSWCLRRPFVDRLPASSATFECLEPAEAFGLDAPDLRYITEHFRYKFANERLKRTAR  659

Query  2186  YYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             +YS+NWRTWAAVN+QLAWRRY+ RT G  N  PE   DG+RRLR YAAMF+S+RP DHLE
Sbjct  660   FYSSNWRTWAAVNIQLAWRRYKTRTGGAANGPPEQ-RDGERRLRMYAAMFMSLRPQDHLE  718



>ref|NP_197045.1| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
 sp|O65718.1|CNGC2_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 2; Short=AtCNGC2; 
AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 2; AltName: Full=Protein DEFENSE NO DEATH 1 
[Arabidopsis thaliana]
 gb|AAF86351.1|AF280939_1 DND1 [Arabidopsis thaliana]
 emb|CAA76179.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis 
thaliana]
 gb|AAC78613.1| cyclic nucleotide-gated cation channel [Arabidopsis thaliana]
 emb|CAC01740.1| cyclic nucleotide-gated cation channel [Arabidopsis thaliana]
 gb|AED92158.1| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
Length=726

 Score =  1030 bits (2663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/731 (75%), Positives = 606/731 (83%), Gaps = 26/731 (4%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDD-----------TYDENPNFISTECYACTQ  382
             MPS+P   F     F    RR++   D + +             DE P   S ECYACTQ
Sbjct  1     MPSHPNFIFRWIGLFSDKFRRQTTGIDENSNLQINGGDSSSSGSDETPVLSSVECYACTQ  60

Query  383   VGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRS  559
             VGVP FHSTSCD AH PEW ASAGSSL+PI+   GSV + +   F R  GPFG VLDPRS
Sbjct  61    VGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSVPNPARTRFRRLKGPFGEVLDPRS  118

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVH  736
             KRVQRWNRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTVLRTCLDAVH
Sbjct  119   KRVQRWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTCLDAVH  178

Query  737   ICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWL  916
             + H+WLQFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWL
Sbjct  179   LWHVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWL  238

Query  917   VVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLI  1096
             VVPKLIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLI
Sbjct  239   VVPKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLI  298

Query  1097  AYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNS  1276
             AYFIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL L+C EEVCY+ + P    G  
Sbjct  299   AYFIASHVAGGCWYVLAIQRVASCIRQQC-MRTGNCNLSLACKEEVCYQFVSPTSTVGYP  357

Query  1277  C-AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             C +GN T+  ++ KP+CLD NGPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF 
Sbjct  358   CLSGNLTS--VVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFA  415

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             NDLEPTSNWLEVIFSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKR
Sbjct  416   NDLEPTSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKR  475

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             RQLPS LRQRVR FERQRW A+GGEDE+ELI DLP GLRRDIKR+LC DLI KVPLF  +
Sbjct  476   RQLPSRLRQRVRRFERQRWNALGGEDELELIHDLPPGLRRDIKRYLCFDLINKVPLFRGM  535

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDLILDNICDR KP VFSKDEKIIREGDPVQR++FI+RGRVK  Q+LSKGV+ATS LEPG
Sbjct  536   DDLILDNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQSLSKGVLATSTLEPG  595

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
             G+LGDELLSWCLRRPF+DRLP SSATF C+++ EAF L +  LR+ITDHFRYKFANERLK
Sbjct  596   GYLGDELLSWCLRRPFLDRLPPSSATFVCLENIEAFSLGSEDLRYITDHFRYKFANERLK  655

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-----NTVPENADDG--DRRLRQYAAM  2332
             RTARYYS+NWRTWAAVN+Q+AWRR R RTRG+      + V EN+ +G  +RRL QYAAM
Sbjct  656   RTARYYSSNWRTWAAVNIQMAWRRRRKRTRGENIGGSMSPVSENSIEGNSERRLLQYAAM  715

Query  2333  FLSIRPHDHLE  2365
             F+SIRPHDHLE
Sbjct  716   FMSIRPHDHLE  726



>dbj|BAE99132.1| cyclic nucleotide-gated cation channel [Arabidopsis thaliana]
Length=726

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/731 (75%), Positives = 606/731 (83%), Gaps = 26/731 (4%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDD-----------TYDENPNFISTECYACTQ  382
             MPS+P   F     F    RR++   D + +             DE P   S ECYACTQ
Sbjct  1     MPSHPNFIFRWIGLFSDKFRRQTTGIDENSNLQINGGDSSSSGSDETPVLSSIECYACTQ  60

Query  383   VGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRS  559
             VGVP FHSTSCD AH PEW ASAGSSL+PI+   GSV + +   F R  GPFG VLDPRS
Sbjct  61    VGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSVPNPARTRFRRLKGPFGEVLDPRS  118

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVH  736
             KRVQRWNRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTVLRTCLDAVH
Sbjct  119   KRVQRWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTCLDAVH  178

Query  737   ICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWL  916
             + H+WLQFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWL
Sbjct  179   LWHVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWL  238

Query  917   VVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLI  1096
             VVPKLIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLI
Sbjct  239   VVPKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLI  298

Query  1097  AYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNS  1276
             AYFIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL L+C EEVCY+ + P    G  
Sbjct  299   AYFIASHVAGGCWYVLAIQRVASCIRQQC-MRTGNCNLSLACKEEVCYQFVSPTSTVGYP  357

Query  1277  C-AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             C +GN T+  ++ KP+CLD NGPFR+GIY+WALPV+SS S+AVKILYPIFWGLMTLSTF 
Sbjct  358   CLSGNLTS--VVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFA  415

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             NDLEPTSNWLEVIFSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKR
Sbjct  416   NDLEPTSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKR  475

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             RQLPS LRQRVR FERQRW A+GGEDE+ELI DLP GLRRDIKR+LC DLI KVPLF  +
Sbjct  476   RQLPSRLRQRVRRFERQRWNALGGEDELELIHDLPPGLRRDIKRYLCFDLINKVPLFRGM  535

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDLILDNICDR KP VFSKDEKIIREGDPVQR++FI+RGRVK  Q+LSKGV+ATS LEPG
Sbjct  536   DDLILDNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQSLSKGVLATSTLEPG  595

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
             G+LGDELLSWCLRRPF+DRLP SSATF C+++ EAF L +  LR+ITDHFRYKFANERLK
Sbjct  596   GYLGDELLSWCLRRPFLDRLPPSSATFVCLENIEAFSLGSEDLRYITDHFRYKFANERLK  655

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-----NTVPENADDG--DRRLRQYAAM  2332
             RTARYYS+NWRTWAAVN+Q+AWRR R RTRG+      + V EN+ +G  +RRL QYAAM
Sbjct  656   RTARYYSSNWRTWAAVNIQMAWRRRRKRTRGENIGGSMSPVSENSIEGNSERRLLQYAAM  715

Query  2333  FLSIRPHDHLE  2365
             F+SIRPHDHLE
Sbjct  716   FMSIRPHDHLE  726



>gb|EYU44163.1| hypothetical protein MIMGU_mgv1a0024531mg, partial [Erythranthe 
guttata]
Length=669

 Score =  1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/680 (79%), Positives = 583/680 (86%), Gaps = 26/680 (4%)
 Frame = +2

Query  257   HFSLSRWFGTILRRKSVQPDNSDDTYDENPNFIST----ECYACTQVGVPVFHSTSCDNA  424
             +FSLS  FG   R   + PDN  D  +EN   IST    ECYACTQVG PVFHSTSCD A
Sbjct  3     NFSLSSCFGIFRRESVLTPDNGGDESEENQT-ISTGGGGECYACTQVGAPVFHSTSCDKA  61

Query  425   HQPEWEASAGSSLIPIKNRPGS--VTHRSTQDFHRSGPFGR-VLDPRSKRVQRWNRAFLL  595
             H+PEWEASAGSSL+PI+NR G      RS+       PFG  VLDPR KRVQRWNRAFLL
Sbjct  62    HRPEWEASAGSSLLPIRNRAGQNPAGTRSSSARGAGQPFGGGVLDPRRKRVQRWNRAFLL  121

Query  596   ARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYV  775
             ARGMALA+DPLFFYALSIGR G+PCLYM+GGLAA VTV+RTC+DAVH+CHLWLQ RLAYV
Sbjct  122   ARGMALAVDPLFFYALSIGRGGSPCLYMNGGLAAAVTVVRTCVDAVHLCHLWLQLRLAYV  181

Query  776   SRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKl  955
             SRESLVVGCGKLVWD RA+A+HY+RSLKGFWFD FVILP+PQAVFWLVVPKLI+EEQ+KL
Sbjct  182   SRESLVVGCGKLVWDPRAIAAHYLRSLKGFWFDVFVILPVPQAVFWLVVPKLIKEEQIKL  241

Query  956   imtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCW  1135
             IMTILLLIFLFQFLP+IYH I LMRRMQ VTGYIFGTIWWGF LNLIAYFIASHVAGGCW
Sbjct  242   IMTILLLIFLFQFLPKIYHIICLMRRMQTVTGYIFGTIWWGFGLNLIAYFIASHVAGGCW  301

Query  1136  YVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRK  1315
             YVLAIQRVA CL+Q+C    S CNL LSCS+EVCY+                  +++  K
Sbjct  302   YVLAIQRVALCLKQQCIGNSSLCNLSLSCSDEVCYQ---------------CETSSINYK  346

Query  1316  PL--CLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
             PL  CLDVNGPFR+GIYKWALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPTSNWLEV
Sbjct  347   PLSSCLDVNGPFRYGIYKWALPVVSSNSVAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  406

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             +FSIC VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LR+RVR
Sbjct  407   MFSICAVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSQLRRRVR  466

Query  1670  YFERQRWAAM-GGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDR  1846
              +ERQRWAAM GG+DEMELIKDLPEGLRRDIKRFLCLDLIKKVPLF SLDDLILDNICDR
Sbjct  467   RYERQRWAAMGGGDDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFDSLDDLILDNICDR  526

Query  1847  IKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWC  2026
             +KPLVFSKDEKIIREGDPV R++FIVRGRVKSSQNLS+G VA+++L+PGGF GDEL SWC
Sbjct  527   VKPLVFSKDEKIIREGDPVPRMLFIVRGRVKSSQNLSRGAVASALLDPGGFFGDELFSWC  586

Query  2027  LRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWR  2206
             LRRPF+DRLPASSATF CI+ TEAF LDA  LR+I DHFRYKFANERL RTARYYS+NWR
Sbjct  587   LRRPFVDRLPASSATFECIEPTEAFALDAGDLRYIVDHFRYKFANERLTRTARYYSSNWR  646

Query  2207  TWAAVNVQLAWRRYRLRTRG  2266
             TWAAVN+Q+ WRRY  RTRG
Sbjct  647   TWAAVNIQMGWRRYMHRTRG  666



>ref|XP_009121575.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Brassica rapa]
Length=719

 Score =  1027 bits (2655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/724 (74%), Positives = 605/724 (84%), Gaps = 19/724 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQ-----PDNSDDTYDENPNFISTECYACTQVGVPVF  400
             MPS+    F     F   LRR++ +        S  + D+ P   S ECYACTQVGVP F
Sbjct  1     MPSHTNFLFRWIGLFSQKLRRETTEISENNGGESSSSSDDTPVLSSGECYACTQVGVPAF  60

Query  401   HSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSKRVQRW  577
             HSTSCD A+ PEW ASAGSSL+PI+   GS          R  GPFG VLDPRSKRVQRW
Sbjct  61    HSTSCDQANAPEWRASAGSSLVPIQE--GSAPSPVRARIRRLKGPFGEVLDPRSKRVQRW  118

Query  578   NRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             NRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTV+RTCLDA+H+ H+WL
Sbjct  119   NRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVVRTCLDALHLWHVWL  178

Query  755   QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLI  934
             QFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVVPKLI
Sbjct  179   QFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVVPKLI  238

Query  935   REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIAS  1114
             REE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIAS
Sbjct  239   REEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAYFIAS  298

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-AGNS  1291
             HVAGGCWYVLAIQRVASC+RQ+C  + + CNL LSC EEVCY+ + P    G  C +GN 
Sbjct  299   HVAGGCWYVLAIQRVASCIRQQC-MRTANCNLSLSCQEEVCYQFVSPSSTIGFPCVSGNL  357

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPT  1471
             T+  +++KP+CLD +GPFR+GIY WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPT
Sbjct  358   TS--VVKKPMCLDSDGPFRYGIYGWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPT  415

Query  1472  SNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSN  1651
             SNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQLPS 
Sbjct  416   SNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPSR  475

Query  1652  LRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILD  1831
             LRQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIKR+LC+DLI  VPLF  +DDLILD
Sbjct  476   LRQRVRRFERQRWTALGGEDELELIQDLPPGLRRDIKRYLCVDLINNVPLFRGMDDLILD  535

Query  1832  NICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDE  2011
             NICDR KP V+SKDEKIIREGDPVQR++FI+RGRVK +Q+LSKGVVATS LEPGG+LGDE
Sbjct  536   NICDRAKPRVYSKDEKIIREGDPVQRMIFIMRGRVKRNQSLSKGVVATSTLEPGGYLGDE  595

Query  2012  LLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYY  2191
             LLSWCLRRPFIDRLP SSATF C+D+ EAF L +  LR+ITDHFRYKFANERLKRTARYY
Sbjct  596   LLSWCLRRPFIDRLPPSSATFVCLDNIEAFSLGSEDLRYITDHFRYKFANERLKRTARYY  655

Query  2192  SANWRTWAAVNVQLAWRRYRLRT----RGQPNTVPENADDG--DRRLRQYAAMFLSIRPH  2353
             S+NWRTWAAVN+Q++WRRYR RT     G  + V E++ +G  +RRL QYAAMF+SIRPH
Sbjct  656   SSNWRTWAAVNIQMSWRRYRKRTCGGVGGSMSPVSEHSVEGNSERRLLQYAAMFMSIRPH  715

Query  2354  DHLE  2365
             DHLE
Sbjct  716   DHLE  719



>emb|CDX69525.1| BnaA10g18740D [Brassica napus]
Length=719

 Score =  1026 bits (2652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/724 (74%), Positives = 604/724 (83%), Gaps = 19/724 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSV-----QPDNSDDTYDENPNFISTECYACTQVGVPVF  400
             MPS+    F     F   LRR++          S  + D+ P   S ECYACTQVGVP F
Sbjct  1     MPSHTNFLFRWIGLFSQKLRRETTGISENNGGESSSSSDDTPVLSSGECYACTQVGVPAF  60

Query  401   HSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR-SGPFGRVLDPRSKRVQRW  577
             HSTSCD A+ PEW ASAGSSL+PI+   GS          R  GPFG VLDPRSKRVQRW
Sbjct  61    HSTSCDQANAPEWRASAGSSLVPIQE--GSAPSPVRARIRRLKGPFGEVLDPRSKRVQRW  118

Query  578   NRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             NRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  AA+VTV+RTCLDA+H+ H+WL
Sbjct  119   NRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVVRTCLDALHLWHVWL  178

Query  755   QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLI  934
             QFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWFD  VILP+PQAVFWLVVPKLI
Sbjct  179   QFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVVPKLI  238

Query  935   REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIAS  1114
             REE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTGYIFGTIWWGF LNLIAYFIAS
Sbjct  239   REEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAYFIAS  298

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC-AGNS  1291
             HVAGGCWYVLAIQRVASC+RQ+C  + + CNL LSC EEVCY+ + P    G  C +GN 
Sbjct  299   HVAGGCWYVLAIQRVASCIRQQC-MRTANCNLSLSCQEEVCYQFVSPSSTIGFPCVSGNL  357

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPT  1471
             T+  +++KP+CLD +GPFR+GIY WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPT
Sbjct  358   TS--VVKKPMCLDSDGPFRYGIYGWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPT  415

Query  1472  SNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSN  1651
             SNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAVMAKKRKMQ+RCRDMEWWMKRRQLPS 
Sbjct  416   SNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPSR  475

Query  1652  LRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILD  1831
             LRQRVR FERQRW A+GGEDE+ELI+DLP GLRRDIKR+LC+DLI  VPLF  +DDLILD
Sbjct  476   LRQRVRRFERQRWTALGGEDELELIQDLPPGLRRDIKRYLCVDLINNVPLFRGMDDLILD  535

Query  1832  NICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDE  2011
             NICDR KP V+SKDEKIIREGDPVQR++FI+RGRVK +Q+LSKGVVATS LEPGG+LGDE
Sbjct  536   NICDRAKPRVYSKDEKIIREGDPVQRMIFIMRGRVKRNQSLSKGVVATSTLEPGGYLGDE  595

Query  2012  LLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYY  2191
             LLSWCLRRPFIDRLP SSATF C+D+ EAF L +  LR+ITDHFRYKFANERLKRTARYY
Sbjct  596   LLSWCLRRPFIDRLPPSSATFVCLDNIEAFSLGSEDLRYITDHFRYKFANERLKRTARYY  655

Query  2192  SANWRTWAAVNVQLAWRRYRLRT----RGQPNTVPENADDG--DRRLRQYAAMFLSIRPH  2353
             S+NWRTWAAVN+Q++WRRYR RT     G  + V E++ +G  +RRL QYAAMF+SIRPH
Sbjct  656   SSNWRTWAAVNIQMSWRRYRKRTCGGVGGSMSPVSEHSVEGNSERRLLQYAAMFMSIRPH  715

Query  2354  DHLE  2365
             DHLE
Sbjct  716   DHLE  719



>ref|XP_008777824.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Phoenix 
dactylifera]
Length=718

 Score =  1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/672 (75%), Positives = 580/672 (86%), Gaps = 4/672 (1%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  535
             + ECYACTQ GVP FHSTSCD AH PEWEASAGSSLIPI+    +    + +    S  F
Sbjct  49    AVECYACTQPGVPAFHSTSCDRAHTPEWEASAGSSLIPIQAAQPAARPAAHRRRPNSWIF  108

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDPRS+RV+RWNRA LL R +ALA+DPLFFYALSIGR G PCLYMDGGLAA+ TVLR
Sbjct  109   GSVLDPRSQRVRRWNRAILLGRAVALAVDPLFFYALSIGRGGAPCLYMDGGLAAVATVLR  168

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             TC DAVH+ H+WLQFR+AYVSRESLVVGCGKLVWDAR +A+HY+RS KGFW D FVILP+
Sbjct  169   TCADAVHVLHVWLQFRVAYVSRESLVVGCGKLVWDARTIAAHYLRSPKGFWLDIFVILPV  228

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ VFWLV+P LIRE ++KLI TILL +FLFQFLP++YHSI +MR MQKVTGYIFGTIWW
Sbjct  229   PQVVFWLVIPTLIREGEIKLITTILLSVFLFQFLPKVYHSICVMRTMQKVTGYIFGTIWW  288

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLL  1252
             GFCLNLIAYFIASHVAGGCWYVLAIQRVASCL+Q+C  +K+ C+L  L CS+EVCY L L
Sbjct  289   GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLQQQCE-KKNNCDLVSLPCSKEVCYWLPL  347

Query  1253  PGGVEGNSCAGN-STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWG  1429
             P G++  +C    +T   +   P+CL+ +GPFR+GIY WALPVVSS S+AVKILYPIFWG
Sbjct  348   PSGMDKLTCESKLTTTTGIKNIPVCLNGDGPFRYGIYGWALPVVSSNSLAVKILYPIFWG  407

Query  1430  LMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCR  1609
             LMTLSTFGNDLEPTS+W EVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLR R
Sbjct  408   LMTLSTFGNDLEPTSHWTEVIFSIIIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRFR  467

Query  1610  DMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIK  1789
             DMEWWMKRRQLPS LRQRV  +ERQRW AM GEDEM+++KDLPEGLR++IKR+ CLDLIK
Sbjct  468   DMEWWMKRRQLPSRLRQRVHEYERQRWLAMRGEDEMDMVKDLPEGLRKEIKRYFCLDLIK  527

Query  1790  KVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVV  1969
             KVPLFH+LDDLILD ICDR++PLVFSK EK+IREGDPVQR+VFIV G++KSSQ+LSKG+V
Sbjct  528   KVPLFHNLDDLILDTICDRVRPLVFSKGEKVIREGDPVQRMVFIVWGQLKSSQHLSKGMV  587

Query  1970  ATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRY  2149
             AT +L PG FLGDEL SWCLRRPF+DRLPASSATF C++ TEAFGL+A HL++IT+HFRY
Sbjct  588   ATCMLGPGNFLGDELFSWCLRRPFVDRLPASSATFECVEPTEAFGLEAPHLQYITEHFRY  647

Query  2150  KFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAA  2329
             KF+NERLK+TARYYS+NWRTWAAVN+QLAWRRY+ RTRG  N  PE  DD ++RLR YAA
Sbjct  648   KFSNERLKKTARYYSSNWRTWAAVNIQLAWRRYKTRTRGMVNPPPE-LDDSEQRLRLYAA  706

Query  2330  MFLSIRPHDHLE  2365
             MF+S+RPHDHLE
Sbjct  707   MFMSLRPHDHLE  718



>ref|NP_974783.2| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
 gb|AED92157.1| cyclic nucleotide-gated ion channel 2 [Arabidopsis thaliana]
Length=725

 Score =  1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/686 (78%), Positives = 591/686 (86%), Gaps = 15/686 (2%)
 Frame = +2

Query  338   ENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDF  517
             E P   S ECYACTQVGVP FHSTSCD AH PEW ASAGSSL+PI+   GSV + +   F
Sbjct  45    ETPVLSSVECYACTQVGVPAFHSTSCDQAHAPEWRASAGSSLVPIQE--GSVPNPARTRF  102

Query  518   HR-SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLYMDGGL  691
              R  GPFG VLDPRSKRVQRWNRA LLARGMALA+DPLFFYALSIGR+  P CLYMDG  
Sbjct  103   RRLKGPFGEVLDPRSKRVQRWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAF  162

Query  692   AAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWF  871
             AA+VTVLRTCLDAVH+ H+WLQFRLAYVSRESLVVGCGKLVWD RA+ASHY RSL GFWF
Sbjct  163   AAVVTVLRTCLDAVHLWHVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWF  222

Query  872   DAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTG  1051
             D  VILP+PQAVFWLVVPKLIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRMQKVTG
Sbjct  223   DVIVILPVPQAVFWLVVPKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTG  282

Query  1052  YIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEE  1231
             YIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL L+C EE
Sbjct  283   YIFGTIWWGFALNLIAYFIASHVAGGCWYVLAIQRVASCIRQQC-MRTGNCNLSLACKEE  341

Query  1232  VCYELLLPGGVEGNSC-AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
             VCY+ + P    G  C +GN T+  ++ KP+CLD NGPFR+GIY+WALPV+SS S+AVKI
Sbjct  342   VCYQFVSPTSTVGYPCLSGNLTS--VVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKI  399

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             LYPIFWGLMTLSTF NDLEPTSNWLEVIFSI +VLSGL+LFTLLIGNIQVFLHAVMAKKR
Sbjct  400   LYPIFWGLMTLSTFANDLEPTSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKR  459

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
             KMQ+RCRDMEWWMKRRQLPS LRQRVR FERQRW A+GGEDE+ELI DLP GLRRDIKR+
Sbjct  460   KMQIRCRDMEWWMKRRQLPSRLRQRVRRFERQRWNALGGEDELELIHDLPPGLRRDIKRY  519

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LC DLI KVPLF  +DDLILDNICDR KP VFSKDEKIIREGDPVQR++FI+RGRVK  Q
Sbjct  520   LCFDLINKVPLFRGMDDLILDNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQ  579

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
             +LSKGV+ATS LEPGG+LGDELLSWCLRRPF+DRLP SSATF C+++ EAF L +  LR+
Sbjct  580   SLSKGVLATSTLEPGGYLGDELLSWCLRRPFLDRLPPSSATFVCLENIEAFSLGSEDLRY  639

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-----NTVPENA  2293
             ITDHFRYKFANERLKRTARYYS+NWRTWAAVN+Q+AWRR R RTRG+      + V EN+
Sbjct  640   ITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQMAWRRRRKRTRGENIGGSMSPVSENS  699

Query  2294  DDG--DRRLRQYAAMFLSIRPHDHLE  2365
              +G  +RRL QYAAMF+SIRPHDHLE
Sbjct  700   IEGNSERRLLQYAAMFMSIRPHDHLE  725



>gb|KFK25788.1| hypothetical protein AALP_AA8G160300 [Arabis alpina]
Length=726

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/690 (77%), Positives = 588/690 (85%), Gaps = 14/690 (2%)
 Frame = +2

Query  323   DDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHR  502
             +D   + P   S ECYACTQVGVP FHSTSCD A+ PEW ASAGSSL+PI+   GS  + 
Sbjct  42    EDMPVDAPVLTSVECYACTQVGVPAFHSTSCDQANAPEWRASAGSSLVPIQE--GSDPNP  99

Query  503   STQDFHR-SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP-CLY  676
                 F R  GPFG VLDPRSKRVQRWNRA LLARGMALA+DPLFFY+LSIGR+  P CLY
Sbjct  100   IRTRFRRLKGPFGDVLDPRSKRVQRWNRALLLARGMALAVDPLFFYSLSIGRTTGPACLY  159

Query  677   MDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSL  856
             MDG  AA+VTV RTCLDAVH+ H+WLQF+LAYVSRESLVVGCGKLVW+ RA+ASHY RSL
Sbjct  160   MDGAFAAVVTVARTCLDAVHLWHVWLQFKLAYVSRESLVVGCGKLVWNPRAIASHYARSL  219

Query  857   KGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRM  1036
              GFWFD  VILP+PQ VFWLVVPKLIREE+VKLIMTILLLIFLFQFLP+IYH I LMRRM
Sbjct  220   TGFWFDIIVILPVPQVVFWLVVPKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRM  279

Query  1037  QKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL  1216
             QKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASC+RQ+C  +   CNL L
Sbjct  280   QKVTGYIFGTIWWGFALNLIAYFIASHVAGGCWYVLAIQRVASCIRQQC-MRAGNCNLSL  338

Query  1217  SCSEEVCYELLLPGGVEGNSC-AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRS  1393
             SC EEVCY+ + P    G  C  GN T+  ++ KP+CLD +GPFR+GIY WALPV+SS S
Sbjct  339   SCQEEVCYQFVSPASTIGYPCLTGNLTS--VINKPMCLDSDGPFRYGIYHWALPVISSNS  396

Query  1394  IAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAV  1573
             +AVKILYPIFWGLMTLSTFGN+L PTSNWLEV+FSI +VLSGL+LFTLLIGNIQVFLHAV
Sbjct  397   LAVKILYPIFWGLMTLSTFGNELAPTSNWLEVVFSIVMVLSGLLLFTLLIGNIQVFLHAV  456

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
             MAKKRKMQ+RCRDMEWWMKRRQLPS LRQRVR FERQRW A+GGEDE+ELI DLP GLRR
Sbjct  457   MAKKRKMQIRCRDMEWWMKRRQLPSRLRQRVRRFERQRWTALGGEDELELIHDLPPGLRR  516

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGR  1933
             DIKR+LC DLI KVPLF  LDDLILDNICDR KP VFSKDEKIIREGDPVQR++FI+RGR
Sbjct  517   DIKRYLCFDLINKVPLFRGLDDLILDNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGR  576

Query  1934  VKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDA  2113
             VK +Q+LSKGVVATS LEPGG+LGDELLSWCLRRPFIDRLP SSATF C+D+ EAF L +
Sbjct  577   VKRNQSLSKGVVATSTLEPGGYLGDELLSWCLRRPFIDRLPPSSATFVCLDNIEAFSLGS  636

Query  2114  NHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR----GQPNTV  2281
               LR+ITDHFRYKFANERLKRTARYYS+NWRTWAAVN+Q+AWRRYR RTR    G  + V
Sbjct  637   EDLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQMAWRRYRKRTRENNGGSMSPV  696

Query  2282  PENADDG--DRRLRQYAAMFLSIRPHDHLE  2365
              EN+ +G  +RRL QYAAMF+S+RPHDHLE
Sbjct  697   SENSVEGNSERRLLQYAAMFMSLRPHDHLE  726



>ref|XP_008785947.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Phoenix dactylifera]
Length=716

 Score =  1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/718 (74%), Positives = 594/718 (83%), Gaps = 10/718 (1%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRK------SVQPDNSDDTYDENP-NFISTECYACTQVGVP  394
             M  +   H  LSRW G    RK           + +     NP    + ECYACTQ GVP
Sbjct  1     MSLFSEFHSFLSRWVGAFRHRKIRSDDDDDTDSSKESGGGSNPIPPAAVECYACTQPGVP  60

Query  395   VFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQR  574
              FHSTSCD AH PEWEASAGSSLIPI+++P        Q    S  FG VLDPRSK+V+R
Sbjct  61    AFHSTSCDRAHTPEWEASAGSSLIPIRSQPAP-RPAGLQRRPNSWIFGSVLDPRSKQVRR  119

Query  575   WNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             WNRA LLAR  ALA+DPLFFYALSIGR G PCLYMDGGLAA+VTVLRTC DAVH+ H+WL
Sbjct  120   WNRAILLARAAALAVDPLFFYALSIGRGGAPCLYMDGGLAAVVTVLRTCADAVHVMHVWL  179

Query  755   QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLI  934
             Q R+AYVSRESLVVGCGKLVWDAR +A+ Y+RSLKGFWFD FVILP+PQAVFWLV+PKLI
Sbjct  180   QLRVAYVSRESLVVGCGKLVWDARTIAARYLRSLKGFWFDIFVILPVPQAVFWLVIPKLI  239

Query  935   REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIAS  1114
             REE++KLIMTILLLIFLFQFLP++YHSI +M+RMQKVTGYIFGTIWWGFCLNLIAYFIAS
Sbjct  240   REEEIKLIMTILLLIFLFQFLPKVYHSICVMKRMQKVTGYIFGTIWWGFCLNLIAYFIAS  299

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGN-S  1291
             HVAGGCWYVLAIQRVASCLRQ+C    +   + L+CS+EVCY L LP G++  +C  N +
Sbjct  300   HVAGGCWYVLAIQRVASCLRQQCEKNNNCDLVSLACSKEVCYRLPLPLGMDELACKSNLT  359

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPT  1471
             TA  +   P+CL+ NGPFRFGIY  ALPVVSS S+AVKILYPIFWGLMTLSTFGNDLEPT
Sbjct  360   TAIGIQNIPVCLNGNGPFRFGIYNGALPVVSSNSLAVKILYPIFWGLMTLSTFGNDLEPT  419

Query  1472  SNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSN  1651
             S+WLEVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLR RDMEWWMKRRQLPS 
Sbjct  420   SHWLEVIFSIIIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRFRDMEWWMKRRQLPSR  479

Query  1652  LRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILD  1831
             LRQRVR +ERQRW AM GEDEM++I++ PEGLRRDIKR LCLDLIKKVP FH+LDDLILD
Sbjct  480   LRQRVRQYERQRWLAMRGEDEMDIIEEFPEGLRRDIKRHLCLDLIKKVPFFHNLDDLILD  539

Query  1832  NICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDE  2011
              ICDR+KPLVFSK EK+IREGDPV  +VFIVRG++KSSQ+LS+G VAT +L PG FLGDE
Sbjct  540   TICDRVKPLVFSKGEKVIREGDPVHCMVFIVRGQLKSSQHLSQGTVATCMLGPGNFLGDE  599

Query  2012  LLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYY  2191
             LLSWCLRRPF+DRLP SSATF C+D TEAFGLDA HLR+IT+HFRY FANERLKRTARYY
Sbjct  600   LLSWCLRRPFVDRLPPSSATFECVDPTEAFGLDAPHLRYITEHFRYNFANERLKRTARYY  659

Query  2192  SANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             S+NWRTWAAVN+QLAWRR + RT G  N  PE   D +RRLR YAAMF+S+RPHDHLE
Sbjct  660   SSNWRTWAAVNIQLAWRRCKARTGGMVNPPPE-LGDSERRLRLYAAMFMSLRPHDHLE  716



>ref|XP_009419077.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =  1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/676 (74%), Positives = 576/676 (85%), Gaps = 4/676 (1%)
 Frame = +2

Query  344   PNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR  523
             P+  + ECYACTQ GVP FHST+CD  H PEWEASAGSSLIPI+    +V          
Sbjct  44    PSMATAECYACTQRGVPAFHSTTCDRVHSPEWEASAGSSLIPIRPSQTNVLQNLRLSKSA  103

Query  524   SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIV  703
             S   G VLDPRS++VQRWNR  LLAR +A+A+DPLFFYALSIGR G PCLYMDGGLA IV
Sbjct  104   SLLRGPVLDPRSEKVQRWNRVILLARAVAVAVDPLFFYALSIGRRGDPCLYMDGGLAVIV  163

Query  704   TVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFV  883
             T LRT  DAVH+ H+WLQFR+AYVSRESLVVGCGKLVWDAR +A  Y+RSL+GFWFD FV
Sbjct  164   TALRTAADAVHLVHVWLQFRVAYVSRESLVVGCGKLVWDARMIAVQYLRSLRGFWFDVFV  223

Query  884   ILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFG  1063
             ILP+PQAVFWL+VPKLIREE++KLIMTI LLIF+FQFLP++YHSI +MRRMQKVTGYIFG
Sbjct  224   ILPVPQAVFWLIVPKLIREEEIKLIMTICLLIFVFQFLPKVYHSICVMRRMQKVTGYIFG  283

Query  1064  TIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCY  1240
             TIWWGF LNL AYFIASHVAGGCWYVLAIQRVA+CL+Q+C  + + CNL  L+CS+EVCY
Sbjct  284   TIWWGFGLNLFAYFIASHVAGGCWYVLAIQRVAACLQQQCE-KNNNCNLVSLACSKEVCY  342

Query  1241  ELLLPGGVEGNSCAGNSTAAALMRK-PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYP  1417
              L L  G+   SC G+  A+  M+  P+CL+ +GPF +GIY WALPVVSS S+ VKILYP
Sbjct  343   HLPLASGMNNLSCEGDLAASIGMQNTPVCLNADGPFPYGIYNWALPVVSSNSLVVKILYP  402

Query  1418  IFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ  1597
             IFWGLMTLSTFGNDLEPTS+W+EVIFSI +VLSGLMLFTLLIGNIQVFLHAVMA+KRKMQ
Sbjct  403   IFWGLMTLSTFGNDLEPTSHWIEVIFSIIVVLSGLMLFTLLIGNIQVFLHAVMARKRKMQ  462

Query  1598  LRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCL  1777
             LR RDMEWWMKRRQLPS LRQRVR +ERQRWAA  GE+E E++KD PEGL RDIKR LCL
Sbjct  463   LRSRDMEWWMKRRQLPSRLRQRVRQYERQRWAATRGEEETEMVKDFPEGLSRDIKRHLCL  522

Query  1778  DLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS  1957
              LIK+VPLFH+LDDLILDNIC+R+KPLVFSK EK+IREGDPVQR+VF+VRG +KSSQ LS
Sbjct  523   ALIKQVPLFHNLDDLILDNICERVKPLVFSKGEKVIREGDPVQRMVFVVRGHLKSSQCLS  582

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
             KG+VATS L PG FLGDELLSWCLRRPF+DRLPASSATF C++STEAF L+A  LRFIT+
Sbjct  583   KGMVATSALGPGSFLGDELLSWCLRRPFVDRLPASSATFECVESTEAFSLEAPGLRFITE  642

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLR  2317
             HFRYKFANERLKRTAR+YS+NWRTWAAVN+QLAWRRY+ RT G  ++ P+   D +RRLR
Sbjct  643   HFRYKFANERLKRTARFYSSNWRTWAAVNIQLAWRRYKSRTGGTASSPPKQ-HDSERRLR  701

Query  2318  QYAAMFLSIRPHDHLE  2365
             +YAAMF+S+RP DHL+
Sbjct  702   RYAAMFMSLRPQDHLD  717



>ref|XP_008379847.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Malus 
domestica]
Length=649

 Score =  1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/627 (81%), Positives = 562/627 (90%), Gaps = 1/627 (0%)
 Frame = +2

Query  485   GSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGT  664
             G V  R +     +GPFG VLDPRSKRVQRWNRAFLLARGMALA+DPLFFYALS GRSGT
Sbjct  24    GGVALRESPRHRPAGPFGPVLDPRSKRVQRWNRAFLLARGMALAVDPLFFYALSFGRSGT  83

Query  665   PCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHY  844
             PCLYMDGGLAAIVTVLRT +DAVH+CHLWLQFRLAYVSRESLVVGCGKLVWD RA++ HY
Sbjct  84    PCLYMDGGLAAIVTVLRTSVDAVHLCHLWLQFRLAYVSRESLVVGCGKLVWDPRAISYHY  143

Query  845   VRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYL  1024
             +RSLKGFWFDAFVILP+PQAVFWLV+PKLI+EE+VK+IMTILLL FLFQFLP++YHSI L
Sbjct  144   LRSLKGFWFDAFVILPVPQAVFWLVLPKLIKEEKVKVIMTILLLXFLFQFLPKVYHSISL  203

Query  1025  MRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC  1204
             MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASCLRQ C  Q   C
Sbjct  204   MRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQRVASCLRQHCD-QNVNC  262

Query  1205  NLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVS  1384
             NL LSCS+EVCY+ LLP    GN C GN+T + + + PLCLDVNG F +GIY+WALPV+S
Sbjct  263   NLSLSCSDEVCYZFLLPAATIGNPCGGNTTTSVMRKPPLCLDVNGTFNYGIYQWALPVIS  322

Query  1385  SRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFL  1564
             S S+A+KILYPIFWGLMTL TFGNDLEPTS+WLEVIFSICIVLSGL+LFTLLIGNIQVFL
Sbjct  323   SNSLAIKILYPIFWGLMTLGTFGNDLEPTSHWLEVIFSICIVLSGLLLFTLLIGNIQVFL  382

Query  1565  HAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEG  1744
             HAVMAKKRKMQLRCRDMEWWMKRRQLPS LR+RVR++ER RW  MGGEDEM+LIKDLPEG
Sbjct  383   HAVMAKKRKMQLRCRDMEWWMKRRQLPSGLRRRVRHYERHRWVTMGGEDEMDLIKDLPEG  442

Query  1745  LRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIV  1924
             LRR+IKR LCLDLIKKVPLFH+LDDLILDN+CDR++PLVFSKDEKIIREGDPV +++FIV
Sbjct  443   LRREIKRHLCLDLIKKVPLFHNLDDLILDNMCDRVRPLVFSKDEKIIREGDPVPKMLFIV  502

Query  1925  RGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFG  2104
             RGR+K +Q LSKG+V T++LEPGGF GDELLSWCLRRPF+DRLPASSATFTCI+STEAFG
Sbjct  503   RGRIKRTQGLSKGMVGTNVLEPGGFFGDELLSWCLRRPFMDRLPASSATFTCIESTEAFG  562

Query  2105  LDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVP  2284
             L+A  LR++TDHFRYKFANERLKRTARYYS+NWRTWAAVN+Q AWRRYRLRT G P    
Sbjct  563   LNAXDLRYMTDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYRLRTNGGPVIPV  622

Query  2285  ENADDGDRRLRQYAAMFLSIRPHDHLE  2365
                   +R+L QYAAMFLS+RPHDHLE
Sbjct  623   IPNGSSERKLLQYAAMFLSLRPHDHLE  649



>ref|XP_004141458.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Cucumis 
sativus]
Length=684

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/669 (78%), Positives = 586/669 (88%), Gaps = 10/669 (1%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQ-PEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFG  538
             ECYACTQVGVP FHSTSCD+AHQ PEWEASAGSSL+PI+    S   R +     +G FG
Sbjct  25    ECYACTQVGVPAFHSTSCDHAHQQPEWEASAGSSLVPIQPTKSSPAPRHSS----AGCFG  80

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
              VLDPR K VQRWNR  LLARGM+LA+DPL+FYALSIGR G PCLYMDGGLAA VTV+RT
Sbjct  81    TVLDPRKKPVQRWNRVLLLARGMSLAVDPLYFYALSIGRGGWPCLYMDGGLAAGVTVVRT  140

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
             CLD VH+ H+WLQFRLAYVS+ES+V+GCGKLVWDAR +ASHYVRS KGFWFDAFVILP+P
Sbjct  141   CLDIVHLWHVWLQFRLAYVSKESMVIGCGKLVWDARDIASHYVRSFKGFWFDAFVILPVP  200

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V+WLV+PKLIREE++KLIMT++LL+FLFQFLP++YHSI LMRRMQKVTGYIFGTIWWG
Sbjct  201   QIVYWLVLPKLIREERIKLIMTVILLMFLFQFLPKVYHSIILMRRMQKVTGYIFGTIWWG  260

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
             F LNLIAYFIASHVAGGCWYVLAIQRVASC++Q C  +++ CNL LSCSEEVCY+ L   
Sbjct  261   FGLNLIAYFIASHVAGGCWYVLAIQRVASCIQQHC--ERNKCNLSLSCSEEVCYQFLSSD  318

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
                G+SC  NSTA    RKPLCLDVNGPF +GIYKWALPV+SS S+AVKILYPIFWGLMT
Sbjct  319   TTIGSSCGRNSTAT--FRKPLCLDVNGPFAYGIYKWALPVISSNSVAVKILYPIFWGLMT  376

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDLEPTSNWLEV FSIC VLSGL+LFTLLIGNIQV LHAVMA++RKMQLRCRD+E
Sbjct  377   LSTFGNDLEPTSNWLEVCFSICTVLSGLLLFTLLIGNIQVLLHAVMARRRKMQLRCRDLE  436

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS L+ RVR++E QRWAAMGGEDEMELI DLPEGLRRDIKR LC+DLI+KVP
Sbjct  437   WWMRRRQLPSRLKHRVRHYEHQRWAAMGGEDEMELINDLPEGLRRDIKRHLCVDLIRKVP  496

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LF +L++LILDNICD++KPLVFSKDEKIIREGDPV R++FIV GRVK SQ+LSKG+ ATS
Sbjct  497   LFQNLEELILDNICDKVKPLVFSKDEKIIREGDPVPRMLFIVCGRVKRSQSLSKGMTATS  556

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
              +EPGGFLGDELLSWCLRRPF++RLPASSATF CI+ TEAF L A+HL++ITDHFRYKFA
Sbjct  557   FIEPGGFLGDELLSWCLRRPFLERLPASSATFVCIEPTEAFALKADHLKYITDHFRYKFA  616

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFL  2338
             NERLKRTAR+YS+NWRTWAAVN+QLAWRRYR R R     V EN    +RRL QYAAMF+
Sbjct  617   NERLKRTARFYSSNWRTWAAVNIQLAWRRYRKRMRRPVIAVVENGST-ERRLLQYAAMFM  675

Query  2339  SIRPHDHLE  2365
             S RPHDHLE
Sbjct  676   SFRPHDHLE  684



>gb|KGN52496.1| hypothetical protein Csa_5G638350 [Cucumis sativus]
Length=688

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/669 (78%), Positives = 586/669 (88%), Gaps = 10/669 (1%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQ-PEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFG  538
             ECYACTQVGVP FHSTSCD+AHQ PEWEASAGSSL+PI+    S   R +     +G FG
Sbjct  29    ECYACTQVGVPAFHSTSCDHAHQQPEWEASAGSSLVPIQPTKSSPAPRHSS----AGCFG  84

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
              VLDPR K VQRWNR  LLARGM+LA+DPL+FYALSIGR G PCLYMDGGLAA VTV+RT
Sbjct  85    TVLDPRKKPVQRWNRVLLLARGMSLAVDPLYFYALSIGRGGWPCLYMDGGLAAGVTVVRT  144

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
             CLD VH+ H+WLQFRLAYVS+ES+V+GCGKLVWDAR +ASHYVRS KGFWFDAFVILP+P
Sbjct  145   CLDIVHLWHVWLQFRLAYVSKESMVIGCGKLVWDARDIASHYVRSFKGFWFDAFVILPVP  204

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V+WLV+PKLIREE++KLIMT++LL+FLFQFLP++YHSI LMRRMQKVTGYIFGTIWWG
Sbjct  205   QIVYWLVLPKLIREERIKLIMTVILLMFLFQFLPKVYHSIILMRRMQKVTGYIFGTIWWG  264

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
             F LNLIAYFIASHVAGGCWYVLAIQRVASC++Q C  +++ CNL LSCSEEVCY+ L   
Sbjct  265   FGLNLIAYFIASHVAGGCWYVLAIQRVASCIQQHC--ERNKCNLSLSCSEEVCYQFLSSD  322

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
                G+SC  NSTA    RKPLCLDVNGPF +GIYKWALPV+SS S+AVKILYPIFWGLMT
Sbjct  323   TTIGSSCGRNSTAT--FRKPLCLDVNGPFAYGIYKWALPVISSNSVAVKILYPIFWGLMT  380

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDLEPTSNWLEV FSIC VLSGL+LFTLLIGNIQV LHAVMA++RKMQLRCRD+E
Sbjct  381   LSTFGNDLEPTSNWLEVCFSICTVLSGLLLFTLLIGNIQVLLHAVMARRRKMQLRCRDLE  440

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS L+ RVR++E QRWAAMGGEDEMELI DLPEGLRRDIKR LC+DLI+KVP
Sbjct  441   WWMRRRQLPSRLKHRVRHYEHQRWAAMGGEDEMELINDLPEGLRRDIKRHLCVDLIRKVP  500

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LF +L++LILDNICD++KPLVFSKDEKIIREGDPV R++FIV GRVK SQ+LSKG+ ATS
Sbjct  501   LFQNLEELILDNICDKVKPLVFSKDEKIIREGDPVPRMLFIVCGRVKRSQSLSKGMTATS  560

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
              +EPGGFLGDELLSWCLRRPF++RLPASSATF CI+ TEAF L A+HL++ITDHFRYKFA
Sbjct  561   FIEPGGFLGDELLSWCLRRPFLERLPASSATFVCIEPTEAFALKADHLKYITDHFRYKFA  620

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFL  2338
             NERLKRTAR+YS+NWRTWAAVN+QLAWRRYR R R     V EN    +RRL QYAAMF+
Sbjct  621   NERLKRTARFYSSNWRTWAAVNIQLAWRRYRKRMRRPVIAVVENGST-ERRLLQYAAMFM  679

Query  2339  SIRPHDHLE  2365
             S RPHDHLE
Sbjct  680   SFRPHDHLE  688



>ref|XP_010939040.1| PREDICTED: LOW QUALITY PROTEIN: cyclic nucleotide-gated ion channel 
2-like [Elaeis guineensis]
Length=721

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/724 (71%), Positives = 598/724 (83%), Gaps = 17/724 (2%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTY------DENP-NFISTECYACTQVGVP  394
             M  +   H  LSRW G   R ++++ D+ DD          NP    + ECYACTQ GVP
Sbjct  1     MSWFSKFHSFLSRWVGA-FRHQNIRSDDDDDDNESNNESGSNPIPPAAVECYACTQPGVP  59

Query  395   VFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSK----  562
              FHSTSCD AH PEWEA AGSSLIPI+ +P +      +  + S  FG VLDPRS     
Sbjct  60    AFHSTSCDRAHTPEWEAGAGSSLIPIQTQPAARPAVRRRRPN-SWIFGSVLDPRSXXXXX  118

Query  563   --RVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVH  736
               RV+ WNRA LL RG+ALA+DPLFFYALSIGR+G PCL+MDGGLAA+VTVLRTC DAVH
Sbjct  119   XXRVRLWNRAILLGRGVALAVDPLFFYALSIGRAGAPCLHMDGGLAAVVTVLRTCADAVH  178

Query  737   ICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWL  916
             + H+WLQFR+AYVSRES+VVGCGKLVWDAR +A+HY+RSLKGFWFD FVILP+PQ VFWL
Sbjct  179   LLHVWLQFRVAYVSRESMVVGCGKLVWDARTIAAHYLRSLKGFWFDIFVILPVPQVVFWL  238

Query  917   VVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLI  1096
             V+PKLIREE+ K IMTILL +FLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGFCLNLI
Sbjct  239   VIPKLIREEETKFIMTILLFVFLFQFLPKVYHSICVMRRMQKVTGYIFGTIWWGFCLNLI  298

Query  1097  AYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNS  1276
             AYFIASHVAGGCWY LAIQRV SC++Q+C   K+   + L+CS+EVCY L LP G++  +
Sbjct  299   AYFIASHVAGGCWYALAIQRVTSCIQQQCEEIKNCDLVSLACSKEVCYRLPLPSGMDKLA  358

Query  1277  CAGNSTAAALMRK-PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             C    TA   ++  PLCL+ NGPFR+GIY WALPVVSS S+AVKILYPIFWGLMTLSTFG
Sbjct  359   CESKLTATTGIKNIPLCLNGNGPFRYGIYDWALPVVSSNSLAVKILYPIFWGLMTLSTFG  418

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             NDLEPTS+  EVIFSI IVLSGLMLFTLLIGNIQVFLHAVMAKKRK+QLR RDMEWWMKR
Sbjct  419   NDLEPTSHSPEVIFSIIIVLSGLMLFTLLIGNIQVFLHAVMAKKRKIQLRFRDMEWWMKR  478

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             RQLPS LRQRV  +ERQRW AM GEDEM++IKDLPEGLR+DI+R+LCLDLIKKVPLFH+L
Sbjct  479   RQLPSRLRQRVHQYERQRWLAMRGEDEMDMIKDLPEGLRQDIRRYLCLDLIKKVPLFHNL  538

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDLILDNICDR++PLVFSK EK+IREGDPVQR+VFIV G++KSSQ LSKG++AT +L PG
Sbjct  539   DDLILDNICDRVRPLVFSKGEKVIREGDPVQRMVFIVLGQLKSSQRLSKGMMATCMLGPG  598

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
              FLGDELLSWCLRRPF+DRLP SSATF C++ TEAFGLDA HL++I ++FRY+FANERLK
Sbjct  599   NFLGDELLSWCLRRPFVDRLPVSSATFECVEPTEAFGLDALHLQYIIEYFRYQFANERLK  658

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPH  2353
             RTARYYS+NWRTWAAVN+QLAWRR + RTRG  N  P    D ++RLR YAA+F+S+RPH
Sbjct  659   RTARYYSSNWRTWAAVNIQLAWRRCKKRTRGMANP-PSEPGDSEQRLRLYAAIFMSLRPH  717

Query  2354  DHLE  2365
             DHLE
Sbjct  718   DHLE  721



>gb|KDO72686.1| hypothetical protein CISIN_1g007897mg [Citrus sinensis]
Length=585

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/588 (84%), Positives = 545/588 (93%), Gaps = 4/588 (1%)
 Frame = +2

Query  605   MALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRE  784
             M+LA+DPLFFYALSIGR G PCLYMDG LAAIVTVLRTC+DAVH+ HLWLQFRLAYVSRE
Sbjct  1     MSLAVDPLFFYALSIGRGGAPCLYMDGALAAIVTVLRTCVDAVHLFHLWLQFRLAYVSRE  60

Query  785   SLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimt  964
             SLVVGCGKLVWD RA+ASHYVRSLKGFWFD FVILP+PQAVFWLVVPKLIREE++K+IMT
Sbjct  61    SLVVGCGKLVWDPRAIASHYVRSLKGFWFDVFVILPVPQAVFWLVVPKLIREEKIKMIMT  120

Query  965   illliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVL  1144
             ILL+IFLFQFLP++YHSIYLMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVL
Sbjct  121   ILLIIFLFQFLPKVYHSIYLMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVL  180

Query  1145  AIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLC  1324
             AIQRVASCLRQ+CH Q + CNL LSCSEEVCY+ L+P G  GN+C GNST    +RK LC
Sbjct  181   AIQRVASCLRQQCHRQ-ANCNLYLSCSEEVCYQFLVPSGAIGNTCGGNSTTT--VRKSLC  237

Query  1325  LDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSIC  1504
             LDVNGPF +GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTS+WLEV+FSIC
Sbjct  238   LDVNGPFHYGIYQWALPVISSNSVAVKILYPIFWGLMTLSTFGNDLEPTSHWLEVMFSIC  297

Query  1505  IVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQ  1684
             IVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR++ERQ
Sbjct  298   IVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLRQRVRHYERQ  357

Query  1685  RWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVF  1864
             RWA MGGEDEMELIKDLPEGLRR IKR+LCLDLIKKVPLFH+LDDLILDNICDR++PLV+
Sbjct  358   RWATMGGEDEMELIKDLPEGLRRGIKRYLCLDLIKKVPLFHNLDDLILDNICDRVRPLVY  417

Query  1865  SKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFI  2044
             SKDEKIIREGDPV R+VFIVRGR+K  Q+LSKG+VATS+LEPGGFLGDELLSWCLRRPFI
Sbjct  418   SKDEKIIREGDPVPRMVFIVRGRIKRCQSLSKGMVATSVLEPGGFLGDELLSWCLRRPFI  477

Query  2045  DRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVN  2224
             DRLPASSATF C++S EAFGLDA +LR+ITDHFRYKFANERLKRTARYYS+NWRTWAAVN
Sbjct  478   DRLPASSATFVCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVN  537

Query  2225  VQLAWRRYRLRTRGQPNTVPENADDGD-RRLRQYAAMFLSIRPHDHLE  2365
             +Q AWRRYR+RTRG   +V EN +  +  RL +YAAMF+SIRPHDHLE
Sbjct  538   IQFAWRRYRMRTRGPVISVTENGEGNESNRLMRYAAMFMSIRPHDHLE  585



>ref|XP_008459361.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Cucumis melo]
Length=688

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/670 (77%), Positives = 582/670 (87%), Gaps = 10/670 (1%)
 Frame = +2

Query  359   TECYACTQVGVPVFHSTSCDNAHQ-PEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  535
              ECYACTQVGVP FHSTSCD+AHQ PEWEASAGSSL+PI+    S   R +     +G F
Sbjct  28    VECYACTQVGVPAFHSTSCDHAHQQPEWEASAGSSLVPIQPTKSSPPPRHSS----AGCF  83

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDPR K VQRWNR  LLARGMALA+DPL+FYALSIGR G PCLYMDGGLA  VTV+R
Sbjct  84    GTVLDPRKKPVQRWNRVLLLARGMALAVDPLYFYALSIGRGGWPCLYMDGGLAGGVTVVR  143

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             TCLD VH+ H+WLQFRLAYVS+ES+V+GCGKLVW+AR +ASHYVRS KGFWFDAFVILPI
Sbjct  144   TCLDIVHLWHVWLQFRLAYVSKESMVIGCGKLVWNARDIASHYVRSFKGFWFDAFVILPI  203

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V+WLV+PKLIREE++KLIMT++LL+FLFQFLP++YHSI LMRRMQKVTGYIFGTIWW
Sbjct  204   PQIVYWLVLPKLIREERIKLIMTVILLMFLFQFLPKVYHSIILMRRMQKVTGYIFGTIWW  263

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             GF LNLIAYFIASHVAGGCWYVLAIQRVASC++Q C  +++ CNL LSCSEEVCY  L  
Sbjct  264   GFGLNLIAYFIASHVAGGCWYVLAIQRVASCIQQHC--ERNNCNLSLSCSEEVCYRFLSS  321

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
                 G+ C  NSTA    RKPLCLDV GPF +GIYKWALPV+SS S+AVKILYPIFWGLM
Sbjct  322   PTTIGSLCGRNSTAT--FRKPLCLDVKGPFAYGIYKWALPVISSNSVAVKILYPIFWGLM  379

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGNDLEPTSNWLEV FSIC VLSGL+LFTLLIGNIQV LHAVMA++RKMQLRCRD+
Sbjct  380   TLSTFGNDLEPTSNWLEVCFSICTVLSGLLLFTLLIGNIQVLLHAVMARRRKMQLRCRDL  439

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS L+ RVR++E QRWAAMGGEDEMELI DLPEGLRRDIKR LC+DLI+KV
Sbjct  440   EWWMRRRQLPSRLKHRVRHYEHQRWAAMGGEDEMELINDLPEGLRRDIKRHLCVDLIRKV  499

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLF +L++LILDNICDR+KPLVFSKDEKIIREGDPV R++FIV GRVK SQ+LSKG+ AT
Sbjct  500   PLFQNLEELILDNICDRVKPLVFSKDEKIIREGDPVPRMLFIVCGRVKRSQSLSKGMTAT  559

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
             S +EPGGFLGDELLSWCLRRPF++RLPASSATF CI+ TEAF L A+HL++ITDHFRYKF
Sbjct  560   SFIEPGGFLGDELLSWCLRRPFLERLPASSATFVCIEPTEAFALKADHLKYITDHFRYKF  619

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMF  2335
             ANERLKRTAR+YS+NWRTWAAVN+QLAWRRYR R R     V EN    +RRL QYAAMF
Sbjct  620   ANERLKRTARFYSSNWRTWAAVNIQLAWRRYRKRMRRPAIAVVENGST-ERRLLQYAAMF  678

Query  2336  LSIRPHDHLE  2365
             +S RPHDHLE
Sbjct  679   MSFRPHDHLE  688



>ref|XP_010923647.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Elaeis 
guineensis]
Length=683

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/720 (71%), Positives = 576/720 (80%), Gaps = 47/720 (7%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRK---------SVQPDNSDDTYDENPNFISTECYACTQVG  388
             M  +   H  +SRW G    +K             ++     +  P   + ECYACTQ G
Sbjct  1     MSLFSKFHSFISRWVGAFQHQKIRSGDDDDNDSSNESGGGGGNPIPPPAAVECYACTQPG  60

Query  389   VPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRV  568
             VP FHSTSCD AH PEWEASAGSS                                    
Sbjct  61    VPAFHSTSCDRAHTPEWEASAGSS------------------------------------  84

Query  569   QRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHL  748
             +RWNRA LL R +ALA+DPLFFYALSIGR G PCLYMDGGLAA+VT LRTC DAVH+ H+
Sbjct  85    RRWNRAILLGRAVALALDPLFFYALSIGRDGAPCLYMDGGLAAVVTGLRTCADAVHLTHV  144

Query  749   WLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPK  928
             WLQ R+AYVSRESLVVGCGKLVWDAR +A+HY+RSLKGFWFD FVILP+PQAVFWLV+PK
Sbjct  145   WLQLRVAYVSRESLVVGCGKLVWDARTIAAHYLRSLKGFWFDIFVILPVPQAVFWLVIPK  204

Query  929   LIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFI  1108
             LIREE++KLIMTILLLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGFCLNLIAYFI
Sbjct  205   LIREEEIKLIMTILLLIFLFQFLPKVYHSICVMRRMQKVTGYIFGTIWWGFCLNLIAYFI  264

Query  1109  ASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGN  1288
             ASHVAGGCWYVLAIQRVASCL+Q+C    +   + L+CS+EVCY L LP G+ G +C  N
Sbjct  265   ASHVAGGCWYVLAIQRVASCLQQQCEKNNNCDLVSLACSKEVCYRLPLPLGMHGLACESN  324

Query  1289  -STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLE  1465
              +TA  +   P+CL+VNGPFR+GIY WALPVVSS S+AVKI +PIFWGLMTLSTFGNDLE
Sbjct  325   LTTAIGIQNIPVCLNVNGPFRYGIYNWALPVVSSSSLAVKIFFPIFWGLMTLSTFGNDLE  384

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
             PTS+WLEVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLR RDMEWWMKRRQLP
Sbjct  385   PTSHWLEVIFSIIIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRFRDMEWWMKRRQLP  444

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
             S LRQRVR +E QRW AM GEDE+ +I+DLPEGLRRDIKR+LCLDLIKKVP FH+LD+LI
Sbjct  445   SRLRQRVRQYECQRWLAMRGEDEVNMIEDLPEGLRRDIKRYLCLDLIKKVPFFHNLDELI  504

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLG  2005
             LDNICDR+KPLVFSK EK+IREGDPV  +VF+VRG++KSSQ+LS+G+VAT +L PG FLG
Sbjct  505   LDNICDRVKPLVFSKGEKVIREGDPVHCMVFVVRGQLKSSQHLSQGMVATCMLGPGNFLG  564

Query  2006  DELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTAR  2185
             DELLSWCLRRPF+DRLPASSATF CI+ TEAFGL A HLR+IT+HFRY FANERLKRTAR
Sbjct  565   DELLSWCLRRPFVDRLPASSATFECIEPTEAFGLVAPHLRYITEHFRYSFANERLKRTAR  624

Query  2186  YYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             YYS+NWRTWAAVN+QLAW RYR+RT G     P    DG+RRLR YAAMF+S+RPHDHLE
Sbjct  625   YYSSNWRTWAAVNIQLAWHRYRMRTGGMV-IPPSELGDGERRLRLYAAMFMSLRPHDHLE  683



>gb|KHG01341.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
Length=695

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/693 (74%), Positives = 578/693 (83%), Gaps = 33/693 (5%)
 Frame = +2

Query  314   DNSDDTYDEN--PNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPG  487
             + S D  ++N  PN I  ECYACTQVG+PVFHSTSCD AH PEWEA AGSSL+PI  R  
Sbjct  27    NGSGDINEDNLIPNPI--ECYACTQVGLPVFHSTSCDQAHPPEWEAYAGSSLVPIHAR-A  83

Query  488   SVTHRSTQDFHR--SGPFGR---VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIG  652
              +   ST    R  SGPFG    VLDPRSKRVQ+WNR+ LLAR MALAIDPLFFYA+SIG
Sbjct  84    CLEKNSTLAATRQPSGPFGGRRGVLDPRSKRVQKWNRSILLARAMALAIDPLFFYAVSIG  143

Query  653   RSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAV  832
             R G PCLYMD GLA  VTVLRTC+DAVH+ H+WLQFRLAYVSRESLVVGCGKLVWD+R +
Sbjct  144   RGGWPCLYMDSGLAVTVTVLRTCVDAVHLFHIWLQFRLAYVSRESLVVGCGKLVWDSRVI  203

Query  833   ASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYH  1012
             ASHYVRS+KGFWFDAFVILP+PQAVFWLV+PKL+REE ++ IM IL L FLFQFLP+++H
Sbjct  204   ASHYVRSVKGFWFDAFVILPVPQAVFWLVLPKLMREEHIRHIMNILFLSFLFQFLPKVHH  263

Query  1013  SIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQ  1192
             +I LMRRM+KVTGY+FGTIWWGF LNLIAYFIASHVAGGCWYVL +QR+ SCLRQ+C   
Sbjct  264   TICLMRRMKKVTGYVFGTIWWGFGLNLIAYFIASHVAGGCWYVLTMQRITSCLRQQC---  320

Query  1193  KSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWAL  1372
                         E C +L L       SC G ST   +  KPLCLDV GPF +GIY+WAL
Sbjct  321   ---------ARNEQCGKLSL-------SCGGGSTK--VNGKPLCLDVEGPFNYGIYEWAL  362

Query  1373  PVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNI  1552
             PVVSS S+AVKILYPIFWGLMTLSTFGN LEPTSNWLEVIFSIC+VL+GL+LFTLLIGNI
Sbjct  363   PVVSSNSVAVKILYPIFWGLMTLSTFGNILEPTSNWLEVIFSICLVLAGLLLFTLLIGNI  422

Query  1553  QVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKD  1732
             QVFLHAVMAKKR+MQLRCRDMEWWMKRRQLPS LRQRVR FE Q+WA +GGEDEMELIKD
Sbjct  423   QVFLHAVMAKKRQMQLRCRDMEWWMKRRQLPSCLRQRVRRFEHQKWATLGGEDEMELIKD  482

Query  1733  LPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRV  1912
             LPEGLRRDIKR+LCLDLIKKVPLFH+LDDLILDNICDR+KPLV+SKDEKI REGDPVQR+
Sbjct  483   LPEGLRRDIKRYLCLDLIKKVPLFHNLDDLILDNICDRVKPLVYSKDEKIFREGDPVQRM  542

Query  1913  VFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDST  2092
             VFIV GR+K +Q+ SKG+VATSI+E GGF+GDELLSWCLR+ FIDRLPASSATF  ++S 
Sbjct  543   VFIVHGRIKRTQSFSKGMVATSIIEAGGFIGDELLSWCLRQSFIDRLPASSATFVSVESV  602

Query  2093  EAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP  2272
             EAFGLD++HLR+IT HF+YKFA+ERLKRTARYYS+NW+TWAAVN+QLAWRRYR R +GQ 
Sbjct  603   EAFGLDSDHLRYITYHFKYKFASERLKRTARYYSSNWQTWAAVNIQLAWRRYRTRVKGQN  662

Query  2273  NTVP--ENADDGDRRLRQYAAMFLSIRPHDHLE  2365
               +   E     D +L QYA+MF+SI+ HDH E
Sbjct  663   LIISRTEQGSSRDHQLLQYASMFMSIKLHDHQE  695



>ref|XP_010674211.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Beta vulgaris 
subsp. vulgaris]
Length=715

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/689 (71%), Positives = 563/689 (82%), Gaps = 15/689 (2%)
 Frame = +2

Query  320   SDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTH  499
              DD++         ECYACTQVGVPVFHSTSCD A QPEWEASAGSSL P + R  ++  
Sbjct  35    EDDSFYSGSWSNPIECYACTQVGVPVFHSTSCDRADQPEWEASAGSSLYPTRTR-SNLRS  93

Query  500   RSTQDFHR------SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSG  661
             RS Q          SG FG +LDPRS+RV+ WNR  LLAR +ALA+DP+FFYALSIGR G
Sbjct  94    RSKQARGSRLRKWPSGLFGPILDPRSERVRWWNRVILLARAVALAVDPVFFYALSIGRGG  153

Query  662   TPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASH  841
             + CLYMDG LAA+VT++RTC+DAVH+ HLWLQFRLAYVSRESLVVGCGKLVWDARA+ASH
Sbjct  154   S-CLYMDGVLAAVVTLIRTCVDAVHLWHLWLQFRLAYVSRESLVVGCGKLVWDARAIASH  212

Query  842   YVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIY  1021
             YVRSLKGFWFD +VILPIPQ VFW V P L+R++++K++MTILLLIFLFQFLP++YHSIY
Sbjct  213   YVRSLKGFWFDLYVILPIPQVVFWSVAPMLLRQDKIKILMTILLLIFLFQFLPKVYHSIY  272

Query  1022  LMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
             LMR+MQKVTGYIFGTIWWGF LNL+AYFIASHV GGCWYVLAIQRVA+CL Q+C  +   
Sbjct  273   LMRKMQKVTGYIFGTIWWGFGLNLVAYFIASHVVGGCWYVLAIQRVAACLTQQCS-RTGN  331

Query  1202  CNLRLSCSEEVCYELL-LPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPV  1378
             C + LSCS+ +CYE L  P  +    C  NST   +     CLD NGPF +GIY  A+PV
Sbjct  332   CGMSLSCSKGICYEFLKQPDAIA--RCGVNST---ITHTSFCLDDNGPFSYGIYSSAVPV  386

Query  1379  VSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQV  1558
             +SS +I +KILYPI WGL  LSTFGN+L PTS W EV F +C+VL GLMLFTLLIGNIQV
Sbjct  387   ISSNAIVIKILYPISWGLFQLSTFGNNLTPTSQWAEVSFCMCLVLGGLMLFTLLIGNIQV  446

Query  1559  FLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLP  1738
             FLH VMAKKRKMQLRCRDMEWWMKRRQLPS LR+RV +FERQ W   GG DEMELIKDLP
Sbjct  447   FLHTVMAKKRKMQLRCRDMEWWMKRRQLPSRLRRRVSHFERQSWLTTGGVDEMELIKDLP  506

Query  1739  EGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVF  1918
             EGLRRDIKR+LCLDLIKKVPLFH LDDLILDNICDR+KPL++ KDEKI+REGDPVQR+VF
Sbjct  507   EGLRRDIKRYLCLDLIKKVPLFHCLDDLILDNICDRVKPLIYCKDEKIMREGDPVQRMVF  566

Query  1919  IVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEA  2098
             IVRGR+KS+QNLSKG+VAT IL PG FLGDELLSWCLRRPFI RLPASSAT  C++S EA
Sbjct  567   IVRGRIKSNQNLSKGLVATDILGPGAFLGDELLSWCLRRPFIHRLPASSATLVCLESIEA  626

Query  2099  FGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT  2278
             FGLDA  LR+IT+HFRYKFANE L+RT RY+S+NWRTWAAVN+Q AWR+Y  RTRG    
Sbjct  627   FGLDAYDLRYITEHFRYKFANESLRRTLRYHSSNWRTWAAVNIQFAWRKYVKRTRGSATH  686

Query  2279  VPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             V     D ++RL Q+AAMF+S RPHDHL+
Sbjct  687   VASQNGDPEKRLLQFAAMFMSFRPHDHLD  715



>ref|XP_002323883.2| hypothetical protein POPTR_0017s12570g [Populus trichocarpa]
 gb|EEF04016.2| hypothetical protein POPTR_0017s12570g [Populus trichocarpa]
Length=705

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/714 (69%), Positives = 578/714 (81%), Gaps = 19/714 (3%)
 Frame = +2

Query  254   LHFSLSRWFGTILRRKSVQPDNSDD-----TYDENPNFISTECYACTQVGVPVFHSTSCD  418
             + FSLS WF     R SV+  N        +   N  F STECYACTQVGVPVFHSTSCD
Sbjct  1     MSFSLSSWFRQ--SRGSVKYCNESKHSGSGSSSNNAVFDSTECYACTQVGVPVFHSTSCD  58

Query  419   NAHQPEWEASAGSSLIPIKNRPGSVTHRS-TQDFHRSGPFGRVLDPRSKRVQRWNRAFLL  595
             + HQPEW+A AGSSL+PI  +   ++  +  Q  +  GPFG +LDPRSK V++WNR  LL
Sbjct  59    SVHQPEWQALAGSSLVPIHAKSDPISKPARCQTPNTKGPFGSILDPRSKWVKKWNRVLLL  118

Query  596   ARGMALAIDPLFFYALS--IGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
              RG+ALAIDPLFFYALS  IG+ G PCLY++ G AAIVTV R+C+DAVH+ HLWLQFRLA
Sbjct  119   TRGIALAIDPLFFYALSLSIGKGGAPCLYVNIGFAAIVTVARSCVDAVHLWHLWLQFRLA  178

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLV GCGKLVW+ARA+A HYVRSLKGFWFD FVILPIPQA+FWL+VPKLIREE++
Sbjct  179   YVSRESLVFGCGKLVWNARAIAYHYVRSLKGFWFDVFVILPIPQAIFWLLVPKLIREEKI  238

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K ++T+LL+ F FQFLP++YHS  L RRM+KVTGYIFGTIWWGF LNL+AY IASHV GG
Sbjct  239   KQVLTMLLVTFSFQFLPKVYHSFCLARRMRKVTGYIFGTIWWGFGLNLVAYLIASHVTGG  298

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLA +RVA+CL+++C  +   C+L L CS  VCY+ + P    GN C  NST  A  
Sbjct  299   CWYVLATERVATCLKKQCE-RNGNCDLTLQCSMNVCYQFMYPADNYGNPCGRNSTWIA--  355

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
              KPLCLD NGPF +GIY  AL VVSS S+AVKILYPIFWGL+ LS+FGN+L PTSN +EV
Sbjct  356   -KPLCLDDNGPFNYGIYSPALLVVSSNSLAVKILYPIFWGLLNLSSFGNELAPTSNLVEV  414

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             +FSI IVL G  LFTLLIGNIQVFLH VMAK +KMQLR +D+EWWM+RRQLP+ LRQR R
Sbjct  415   MFSIYIVLCGFTLFTLLIGNIQVFLHVVMAKNKKMQLRRQDVEWWMRRRQLPTGLRQRFR  474

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             +FERQ+W  MGGEDEM  I++LPEGLRRDIKR+LCLDLIKKVPLFH+LDDLILDNICDR+
Sbjct  475   HFERQKWRVMGGEDEMSWIEELPEGLRRDIKRYLCLDLIKKVPLFHNLDDLILDNICDRV  534

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             K LV+SKDEKI+REGDPV R+VFIV GRVK SQ LSKG+VATS+LEPGGFLGDELLSWCL
Sbjct  535   KLLVYSKDEKILREGDPVLRMVFIVHGRVKYSQCLSKGMVATSVLEPGGFLGDELLSWCL  594

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPFIDRLPASSATF C++ TEAF LDA  LR+I++HFRY+FA++RLKRT RYYS+NWRT
Sbjct  595   RRPFIDRLPASSATFVCMEPTEAFVLDAYDLRYISEHFRYRFASKRLKRTMRYYSSNWRT  654

Query  2210  WAAVNVQLAWRRYRLRTRG--QPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+Q AWRRYR+R RG   P+ V  + ++   RLR  AAMF+S+RPHDH +
Sbjct  655   WAAVNIQFAWRRYRIRKRGLATPDMVNVSMEN---RLRLCAAMFMSLRPHDHFQ  705



>ref|XP_010229618.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Brachypodium 
distachyon]
Length=731

 Score =   971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/671 (71%), Positives = 559/671 (83%), Gaps = 4/671 (1%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  541
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++++       +         FG 
Sbjct  62    ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQSQQAHPAAGAGAVAAARWLFGP  121

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRTC
Sbjct  122   VLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGRPCMYMDAGLAAAVTALRTC  181

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
              D  H+ H+ +QFRLAYVSRESLVVGCGKLVWD RA+A++Y RSLKG WFD FVILPIPQ
Sbjct  182   ADLGHLAHVLVQFRLAYVSRESLVVGCGKLVWDPRAIAANYARSLKGLWFDLFVILPIPQ  241

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              +FWLV+PKLIREEQVK+IMTILLLIF+ QFLP++YHSI++MR+MQKVTGYIFGT+WWGF
Sbjct  242   IIFWLVIPKLIREEQVKVIMTILLLIFVLQFLPKVYHSIHIMRKMQKVTGYIFGTVWWGF  301

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLLPG  1258
              LNL AYFIASH+AGGCWYVLAIQRVASCL+  C  + + CNL  L+CS+E+C+      
Sbjct  302   GLNLFAYFIASHIAGGCWYVLAIQRVASCLQAECK-KNNNCNLMSLACSKEMCFHFPWSS  360

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
              + G +C  N T+      P CL  NG + +GIYK ALPV+SS S+AVKILYPIFWGLMT
Sbjct  361   DMSGLACDTNLTSFGQQNVPTCLSGNGAYAYGIYKGALPVISSNSLAVKILYPIFWGLMT  420

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDME
Sbjct  421   LSTFGNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDME  480

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VP
Sbjct  481   WWMRRRQLPSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVP  540

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LFH +D+LILDNICDR++PLVF   EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT 
Sbjct  541   LFHGMDELILDNICDRLRPLVFCSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVATC  600

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
             +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LR+IT+HFRYKFA
Sbjct  601   VLGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRYITEHFRYKFA  660

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENA--DDGDRRLRQYAAM  2332
             N++LKRTARYYS+NWRTWAAVNVQLAWRRYR RT       P     +DGDRRLR YAAM
Sbjct  661   NDKLKRTARYYSSNWRTWAAVNVQLAWRRYRARTMATAVLPPPGMGPEDGDRRLRHYAAM  720

Query  2333  FLSIRPHDHLE  2365
             F+S+RPHDHLE
Sbjct  721   FMSLRPHDHLE  731



>ref|XP_010229614.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Brachypodium 
distachyon]
Length=732

 Score =   971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/671 (71%), Positives = 559/671 (83%), Gaps = 4/671 (1%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  541
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++++       +         FG 
Sbjct  63    ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQSQQAHPAAGAGAVAAARWLFGP  122

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRTC
Sbjct  123   VLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGRPCMYMDAGLAAAVTALRTC  182

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
              D  H+ H+ +QFRLAYVSRESLVVGCGKLVWD RA+A++Y RSLKG WFD FVILPIPQ
Sbjct  183   ADLGHLAHVLVQFRLAYVSRESLVVGCGKLVWDPRAIAANYARSLKGLWFDLFVILPIPQ  242

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              +FWLV+PKLIREEQVK+IMTILLLIF+ QFLP++YHSI++MR+MQKVTGYIFGT+WWGF
Sbjct  243   IIFWLVIPKLIREEQVKVIMTILLLIFVLQFLPKVYHSIHIMRKMQKVTGYIFGTVWWGF  302

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLLPG  1258
              LNL AYFIASH+AGGCWYVLAIQRVASCL+  C  + + CNL  L+CS+E+C+      
Sbjct  303   GLNLFAYFIASHIAGGCWYVLAIQRVASCLQAECK-KNNNCNLMSLACSKEMCFHFPWSS  361

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
              + G +C  N T+      P CL  NG + +GIYK ALPV+SS S+AVKILYPIFWGLMT
Sbjct  362   DMSGLACDTNLTSFGQQNVPTCLSGNGAYAYGIYKGALPVISSNSLAVKILYPIFWGLMT  421

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDME
Sbjct  422   LSTFGNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDME  481

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VP
Sbjct  482   WWMRRRQLPSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVP  541

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LFH +D+LILDNICDR++PLVF   EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT 
Sbjct  542   LFHGMDELILDNICDRLRPLVFCSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVATC  601

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
             +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LR+IT+HFRYKFA
Sbjct  602   VLGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRYITEHFRYKFA  661

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENA--DDGDRRLRQYAAM  2332
             N++LKRTARYYS+NWRTWAAVNVQLAWRRYR RT       P     +DGDRRLR YAAM
Sbjct  662   NDKLKRTARYYSSNWRTWAAVNVQLAWRRYRARTMATAVLPPPGMGPEDGDRRLRHYAAM  721

Query  2333  FLSIRPHDHLE  2365
             F+S+RPHDHLE
Sbjct  722   FMSLRPHDHLE  732



>ref|XP_011035831.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Populus 
euphratica]
Length=704

 Score =   970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/710 (69%), Positives = 574/710 (81%), Gaps = 18/710 (3%)
 Frame = +2

Query  263   SLSRWFGTILRRKSVQPDNSDD----TYDENPNFISTECYACTQVGVPVFHSTSCDNAHQ  430
             SLS WF     R SV+  N       +   N    STECYACTQVGVPVFHSTSCD+AHQ
Sbjct  4     SLSGWFRQ--SRGSVKYCNESKHSSSSSSNNAVLDSTECYACTQVGVPVFHSTSCDSAHQ  61

Query  431   PEWEASAGSSLIPIKNRPGSVTHRS-TQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGM  607
             PEW+A AGSSL+PI  +   ++  +  Q     GPFG +LDPRSK V++WNR  LL RG+
Sbjct  62    PEWQALAGSSLVPIHAKSDPISKPARCQTPTTKGPFGSILDPRSKWVKKWNRVLLLTRGI  121

Query  608   ALAIDPLFFYALS--IGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSR  781
             ALAIDPLFFYALS  IG+ G PCLY++ G AAIVTV R+C+DAVH+ HLWLQFRLAYVSR
Sbjct  122   ALAIDPLFFYALSLSIGKGGGPCLYVNIGFAAIVTVARSCVDAVHLWHLWLQFRLAYVSR  181

Query  782   ESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlim  961
             ESLV GCGKLVW+ARA+A HYVRSLKGFWFD FVILPIPQA+FW +VPKLIREE++K ++
Sbjct  182   ESLVFGCGKLVWNARAIAYHYVRSLKGFWFDVFVILPIPQAIFWFLVPKLIREEKIKQVL  241

Query  962   tillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYV  1141
             T+LL+ F FQFLP++YHS  L RRM+KVTGYIFGTIWWGF LNL+AY IASHV GGCWYV
Sbjct  242   TMLLVTFAFQFLPKVYHSFCLARRMRKVTGYIFGTIWWGFGLNLVAYLIASHVTGGCWYV  301

Query  1142  LAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPL  1321
             LA +RVA+CL+++C  +   C+L L CS  VCY+ + P    GN C  NST  A   KPL
Sbjct  302   LATERVATCLKKQCE-RNGNCDLTLQCSMNVCYQFMYPADSYGNPCGRNSTWIA---KPL  357

Query  1322  CLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSI  1501
             CLD NGPF +GIY  AL VVSS S+AVKILYPIFWGL+ LS+FGN+L PTSN +EV+FSI
Sbjct  358   CLDDNGPFNYGIYSPALLVVSSNSLAVKILYPIFWGLLNLSSFGNELAPTSNLVEVMFSI  417

Query  1502  CIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFER  1681
              IVL G  LFTLLIGNIQVFLH VMAK +KMQLR +D+EWWM+RRQLP+ LRQR R+FER
Sbjct  418   YIVLFGFTLFTLLIGNIQVFLHVVMAKNKKMQLRRQDVEWWMRRRQLPTGLRQRFRHFER  477

Query  1682  QRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLV  1861
             Q+W  MGGEDEM  I++LPEGLRRDIKR+LCLDLIKKVPLFH+LDDLILDNICDR+K LV
Sbjct  478   QKWRVMGGEDEMSWIEELPEGLRRDIKRYLCLDLIKKVPLFHNLDDLILDNICDRVKLLV  537

Query  1862  FSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPF  2041
             +SKDEKI+REGDPV R+VFIV GRVK SQ LSKG+VATS+LEPGGFLGDELLSWCLRRPF
Sbjct  538   YSKDEKILREGDPVLRMVFIVHGRVKYSQCLSKGMVATSVLEPGGFLGDELLSWCLRRPF  597

Query  2042  IDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAV  2221
             IDRLPASSATF C++ TEAF LDA  LR+I++HFRY+FA++RLKRT RYYS+NWRTWAAV
Sbjct  598   IDRLPASSATFVCMEPTEAFVLDAYDLRYISEHFRYRFASKRLKRTMRYYSSNWRTWAAV  657

Query  2222  NVQLAWRRYRLRTRG--QPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             N+Q AWRRYR+R RG   P+ V  + ++   RLR  AAMF+S+RPHDH +
Sbjct  658   NIQFAWRRYRIRKRGLATPDMVNVSMEN---RLRLCAAMFMSLRPHDHFQ  704



>ref|XP_010936396.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Elaeis guineensis]
Length=730

 Score =   964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/704 (71%), Positives = 571/704 (81%), Gaps = 11/704 (2%)
 Frame = +2

Query  269   SRWFGTILRRKSVQPDNSDDTYDENPNFIS--TECYACTQVGVPVFHSTSCDNAHQPEWE  442
             +RW+  + RR    P+  DD  +E     S   ECYACTQ G P FHSTSCD AH PEWE
Sbjct  33    ARWWTRLPRRWRFHPEVGDDDDEEVAGTSSPAGECYACTQAGAPAFHSTSCDRAHAPEWE  92

Query  443   ASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWNRAFLLARGMAL  613
             ASAGSSLIPI+N  G    RS       GP   FG VLDPRS  VQRWNR  LLAR +AL
Sbjct  93    ASAGSSLIPIQNTAGGGERRSGW-----GPAWVFGAVLDPRSGGVQRWNRGLLLARAVAL  147

Query  614   AIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLV  793
             A+DP+FFYA+S+G  G   + MDG L      +RTC DAVH+ H+W+Q RLAYVSRESLV
Sbjct  148   AVDPVFFYAVSVGEGGGCVVGMDGRLGVAAAAVRTCADAVHVLHVWVQLRLAYVSRESLV  207

Query  794   VGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtill  973
             VGCGKLVWD RA+ASHY+RS KGFWFD F ILP+PQ VFWLV+PKL+REE++KLI T+LL
Sbjct  208   VGCGKLVWDPRAIASHYLRSPKGFWFDLFAILPLPQIVFWLVLPKLVREEELKLITTVLL  267

Query  974   liflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQ  1153
             LIFLFQFLP++YHSI +MR MQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQ
Sbjct  268   LIFLFQFLPKVYHSICMMRSMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQ  327

Query  1154  RVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDV  1333
             RVASCL+Q+C    +   + ++CS+  C   LLP G++  SC  N T         CLDV
Sbjct  328   RVASCLQQQCQKNNNCDLMSMACSKGACKLFLLPAGIDELSCINNLTFVGNQNLHACLDV  387

Query  1334  NGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVL  1513
             +GPF++GIY  ALPV+SS S+AVKILYP+FWGL+TLSTFGN+L PTS WLEVIFSI IVL
Sbjct  388   DGPFQYGIYDAALPVISSNSLAVKILYPMFWGLVTLSTFGNNLVPTSQWLEVIFSIAIVL  447

Query  1514  SGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWA  1693
             SGLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRDMEWWMKRRQLPS LRQRVR +E QRWA
Sbjct  448   SGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDMEWWMKRRQLPSRLRQRVRRYECQRWA  507

Query  1694  AMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKD  1873
              M GEDEME+IKDLP+GLRRDI+R+LCLDLIK+VPLFHSLDDLILDNICDR+K LVFSKD
Sbjct  508   TMRGEDEMEIIKDLPDGLRRDIRRYLCLDLIKQVPLFHSLDDLILDNICDRVKHLVFSKD  567

Query  1874  EKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRL  2053
             EKIIREGDPVQ++VFIV+G ++SSQ LSKG+VAT +L PG FLGDELLSWCLRRPFI+RL
Sbjct  568   EKIIREGDPVQQMVFIVQGHLQSSQKLSKGMVATCMLGPGNFLGDELLSWCLRRPFINRL  627

Query  2054  PASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQL  2233
             PASSATF C+  TEAFGLDA+HL +IT+HFRYKFAN+RLKRTARYYS+NWRTWAAVN+QL
Sbjct  628   PASSATFVCVQPTEAFGLDAHHLLYITEHFRYKFANDRLKRTARYYSSNWRTWAAVNIQL  687

Query  2234  AWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             AWR Y+ +TRG     P    D +RRLR YAAMF+SIRPHDHLE
Sbjct  688   AWRHYKAKTRGL-TIQPSELGDSERRLRLYAAMFMSIRPHDHLE  730



>ref|XP_004981703.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Setaria 
italica]
Length=728

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/679 (70%), Positives = 556/679 (82%), Gaps = 8/679 (1%)
 Frame = +2

Query  353   ISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP  532
             ++ ECYACTQ GVP FHST+CD  H P W+A AGSSL+P++ +    +  ++   H    
Sbjct  50    LAGECYACTQPGVPAFHSTTCDQVHSPGWDADAGSSLVPVRAQQAQASPSASAAQHAGAA  109

Query  533   ----FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
                 FG VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALS+GR G PCLYMD GLAA 
Sbjct  110   ARWLFGPVLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSVGRGGQPCLYMDAGLAAA  169

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VT LRTC D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RSLKG WFD F
Sbjct  170   VTALRTCADVAHLGHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSLKGLWFDLF  229

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP+PQ +FWLV+PKLIREEQVK IMTILLLIF+FQFLP++YHSI++MR+MQKVTGYIF
Sbjct  230   VILPLPQIIFWLVIPKLIREEQVKFIMTILLLIFIFQFLPKVYHSIHIMRKMQKVTGYIF  289

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY  1240
             GTIWWGF LNL AYFIASH+AGGCWYVLAIQR+ASCL++ C    S   + L+CS+E+C+
Sbjct  290   GTIWWGFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKKNNSCDLMSLACSKEICF  349

Query  1241  ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
                    V G +C  N T+ +      CL  NG F +GIY  ALPV+SS S+AVKILYPI
Sbjct  350   HPPWSSNVNGLACDANMTSFSQQNMSTCLSGNGSFAYGIYLGALPVISSNSLAVKILYPI  409

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGNDL PTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQL
Sbjct  410   FWGLMTLSTFGNDLAPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQL  469

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             R RDMEWWM+RRQLPS LRQRVR FER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+
Sbjct  470   RFRDMEWWMRRRQLPSRLRQRVRKFERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLE  529

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+K
Sbjct  530   LVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTK  589

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
             GVVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  L+FIT+H
Sbjct  590   GVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLQFITEH  649

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTV----PENADDGDR  2308
             FRYKFANE+LK TARYYS+NWRTWAAVN+QLAWRRYR R       V        DDGDR
Sbjct  650   FRYKFANEKLKHTARYYSSNWRTWAAVNIQLAWRRYRARKMDVTAMVAPPLAAGPDDGDR  709

Query  2309  RLRQYAAMFLSIRPHDHLE  2365
             RLR YAAMF+S+RPHDHLE
Sbjct  710   RLRHYAAMFMSLRPHDHLE  728



>ref|XP_010904936.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Elaeis 
guineensis]
Length=774

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/724 (69%), Positives = 568/724 (78%), Gaps = 27/724 (4%)
 Frame = +2

Query  272   RWFGTILRRKSVQPDNSDD---TYDENPNFIST---ECYACTQVGVPVFHSTSCDNAHQP  433
             RW+  +LRR   +    DD     D      S+   +CYACTQ G P FHSTSCD AH P
Sbjct  52    RWWTRLLRRWKFRLGGDDDEPAVGDGGTTAASSTAGDCYACTQAGAPAFHSTSCDRAHPP  111

Query  434   EWEASAGSSLIPIKN--RPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWNRAFLLA  598
             EWEASAGSSLIPI+N  R  S      +   R  P   FG VLDPRS  VQ+WNR  LLA
Sbjct  112   EWEASAGSSLIPIQNTARSSSAAGAGERRKARWRPAWVFGAVLDPRSGGVQQWNRGLLLA  171

Query  599   RGMALAIDPLFFYALSIG--------------RSGTPCLY-MDGGLAAIVTVLRTCLDAV  733
             R +ALA+DPLFFYA+S+G                G  C+  MDG L   V V+RTC DAV
Sbjct  172   RAVALAVDPLFFYAVSLGARPALAAAAAAAVEEEGGGCVVGMDGRLGVAVAVVRTCADAV  231

Query  734   HICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFW  913
             H+ H+W+Q RLAYVSRESLVVGCGKLVWD RA+ASHY+RS KGFWFD FVILP PQ + W
Sbjct  232   HVLHVWVQLRLAYVSRESLVVGCGKLVWDPRAIASHYLRSPKGFWFDLFVILPFPQIILW  291

Query  914   LVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNL  1093
             LV+PKLIREE++K+I T+LLLIFLFQFLP++YHSI +MR MQKVTGYIFGTIWWGF LNL
Sbjct  292   LVLPKLIREEELKVITTVLLLIFLFQFLPKVYHSICMMRSMQKVTGYIFGTIWWGFGLNL  351

Query  1094  IAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGN  1273
             I YFIASHVAGGCWYVLAIQRVASCL+Q+C    +   + ++CS E C  L LP G+   
Sbjct  352   ITYFIASHVAGGCWYVLAIQRVASCLQQQCQKNNNCDLMSIACSREACNRLSLPAGINEQ  411

Query  1274  SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             SC  N  +        CL+V+GPF++GIY  ALPV+SS S+ VKILYPIFWGLMTLSTFG
Sbjct  412   SCMNNLASVGNQNLLSCLNVDGPFQYGIYDAALPVISSNSLVVKILYPIFWGLMTLSTFG  471

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             N+LEPTS WLEVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRDMEWWMKR
Sbjct  472   NNLEPTSQWLEVIFSIAIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDMEWWMKR  531

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             RQLPS LRQRVR +ERQ+WA M GEDEME+IKDLPEGLRRDI+R+LCLDLIK+VPLF SL
Sbjct  532   RQLPSRLRQRVRQYERQKWATMRGEDEMEVIKDLPEGLRRDIRRYLCLDLIKQVPLFQSL  591

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDLILDNICDR+K LVFSKDE IIREGDPVQR+VFIVRG ++SSQ LSKG+VAT  L PG
Sbjct  592   DDLILDNICDRVKHLVFSKDENIIREGDPVQRMVFIVRGHLQSSQKLSKGMVATCKLGPG  651

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
              FLGDELLSWCLRRPFIDRLPASSATF C++  EAFGLDA HLR+IT+HFRYKFAN+RLK
Sbjct  652   NFLGDELLSWCLRRPFIDRLPASSATFVCVEPIEAFGLDAYHLRYITEHFRYKFANDRLK  711

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPH  2353
             RTARYYS+NWRTWAAVN+QLAWRRY+ +TR      P    D +RRLR YAAMF+S+RPH
Sbjct  712   RTARYYSSNWRTWAAVNIQLAWRRYKAKTRNVA-IQPSEFSDNERRLRLYAAMFMSMRPH  770

Query  2354  DHLE  2365
             DHLE
Sbjct  771   DHLE  774



>gb|EEC76211.1| hypothetical protein OsI_13606 [Oryza sativa Indica Group]
 gb|EEE59963.1| hypothetical protein OsJ_12656 [Oryza sativa Japonica Group]
Length=726

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/675 (72%), Positives = 565/675 (84%), Gaps = 14/675 (2%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  541
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +P +  H +         FG 
Sbjct  59    ECYACTQPGVPSFHSTTCDQVHSPDWDADAGSSLVPVQAQPSAAHHAAAAAARWV--FGP  116

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDPRSKRVQRWNR  LLAR  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRT 
Sbjct  117   VLDPRSKRVQRWNRWILLARAAALAVDPLFFYALSIGRAGQPCVYMDAGLAAAVTALRTA  176

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
              D  H+ H+ LQFR+AYVSRESLVVGCGKLVWD RA+A+HY RSLKG WFD FVILPIPQ
Sbjct  177   ADLAHLAHVLLQFRVAYVSRESLVVGCGKLVWDPRAIAAHYARSLKGLWFDLFVILPIPQ  236

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              +FWLV+PKLIREEQ+KLIMT+LLL+FL QFLP++YHSIY+MR+MQKVTGYIFGTIWWGF
Sbjct  237   VIFWLVIPKLIREEQIKLIMTMLLLLFLLQFLPKVYHSIYIMRKMQKVTGYIFGTIWWGF  296

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLLPG  1258
              LNL AYFIASH+AGGCWYVLAIQRVASCL++ C   K+TCNL  L+CS+E+C+ L    
Sbjct  297   GLNLFAYFIASHIAGGCWYVLAIQRVASCLQEECKI-KNTCNLTSLACSKEMCFHLPWS-  354

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
               + N  A N T+      P CL  NGPF +GIYK ALPV+SS S+AVKILYPIFWGLMT
Sbjct  355   --DKNGLACNLTSFGQQNIPDCLSGNGPFAYGIYKGALPVISSNSLAVKILYPIFWGLMT  412

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDME
Sbjct  413   LSTFGNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDME  472

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VP
Sbjct  473   WWMRRRQLPSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVP  532

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VF+++G+++S+Q L+KGVVAT 
Sbjct  533   LFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFVLQGKLRSTQPLAKGVVATC  592

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
             +L  G FLGDELLSWCLRRP +DRLPASSATF C+++ +AF LDA  LRFIT+ FRYKFA
Sbjct  593   MLGAGNFLGDELLSWCLRRPSLDRLPASSATFECVETAQAFCLDAPDLRFITEQFRYKFA  652

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR------GQPNTVPENADDGDRRLRQ  2320
             NE+LKRTARYYS+NWRTWAAVN+QLAWRRY+ RT        QP +     DDGDRRLR 
Sbjct  653   NEKLKRTARYYSSNWRTWAAVNIQLAWRRYKARTTTDLASAAQPPSA-GGPDDGDRRLRH  711

Query  2321  YAAMFLSIRPHDHLE  2365
             YAAMF+S+RPHDHLE
Sbjct  712   YAAMFMSLRPHDHLE  726



>dbj|BAJ99130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=721

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/673 (70%), Positives = 551/673 (82%), Gaps = 7/673 (1%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  541
             ECYACTQ GVP FHST+CD  H P W+A AGSSL+P++ +P  +   +         FG 
Sbjct  51    ECYACTQPGVPAFHSTTCDQVHSPGWDADAGSSLVPVRAQP--LPGAAAAVAAARWLFGP  108

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRT 
Sbjct  109   VLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGRPCMYMDAGLAAAVTALRTA  168

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
              D  H+ H+ +QFRLAYVSRESLVVGCGKLVWD RA+A+HY RSLKG  FD FVILPIPQ
Sbjct  169   ADVAHLAHVLVQFRLAYVSRESLVVGCGKLVWDPRAIAAHYARSLKGLCFDLFVILPIPQ  228

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              +FWLV+PKLIREEQVKLIMTILLLIF+ QFLP++YHSIY+MR+MQKVTGYIFGT+WWGF
Sbjct  229   IIFWLVIPKLIREEQVKLIMTILLLIFVLQFLPKVYHSIYIMRKMQKVTGYIFGTVWWGF  288

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGG  1261
              LNL AYFIASH+AGGCWYVLAIQRVASCL+  C    +   + L+CS+E+C+       
Sbjct  289   GLNLFAYFIASHIAGGCWYVLAIQRVASCLQSECEINNNCNLMSLACSKEMCFHFPWSSD  348

Query  1262  VEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTL  1441
             +   +C  N T+ +    P CL  NG F +GIYK ALPV+SS S+AVKILYPIFWGLMTL
Sbjct  349   MTALACDTNLTSFSQQNVPACLSGNGAFAYGIYKGALPVISSNSLAVKILYPIFWGLMTL  408

Query  1442  STFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEW  1621
             STFGNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDMEW
Sbjct  409   STFGNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEW  468

Query  1622  WMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPL  1801
             WM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VPL
Sbjct  469   WMRRRQLPSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPL  528

Query  1802  FHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSI  1981
             FH +D+LILDNICDR++PLVF   EK+IREGDPVQR+VF+++G+++S+Q L+KGVVA  +
Sbjct  529   FHGMDELILDNICDRLRPLVFCGGEKVIREGDPVQRMVFVLQGKLRSTQPLTKGVVAECV  588

Query  1982  LEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFAN  2161
             L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LR+IT+HFRYKFAN
Sbjct  589   LGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRYITEHFRYKFAN  648

Query  2162  ERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-----NTVPENADDGDRRLRQYA  2326
             ++LKRTARYYS+NWRTWAAVNVQLAWRRYR R                 +DGDRRLR YA
Sbjct  649   DKLKRTARYYSSNWRTWAAVNVQLAWRRYRARMMATAVLPPPPAGAAGPEDGDRRLRHYA  708

Query  2327  AMFLSIRPHDHLE  2365
             AMF+S+RPHDHLE
Sbjct  709   AMFMSLRPHDHLE  721



>ref|XP_002466423.1| hypothetical protein SORBIDRAFT_01g007550 [Sorghum bicolor]
 gb|EER93421.1| hypothetical protein SORBIDRAFT_01g007550 [Sorghum bicolor]
Length=729

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/679 (70%), Positives = 556/679 (82%), Gaps = 10/679 (1%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNR---PGSVTHRSTQDFHRS  526
             S ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +   P S   +      R 
Sbjct  52    SGECYACTQPGVPAFHSTTCDQVHLPDWDADAGSSLVPVQAQQVQPASSAAQHAGAAAR-  110

Query  527   GPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVT  706
               FG VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLAA VT
Sbjct  111   WLFGPVLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGQPCLYMDAGLAAAVT  170

Query  707   VLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVI  886
              LRTC D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG  FD FVI
Sbjct  171   ALRTCADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLSFDLFVI  230

Query  887   LPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGT  1066
             LPIPQ +FWLV+PKLIREEQVKLIMTILLL+F+FQFLP++YH I++MR+MQKVTGYIFG+
Sbjct  231   LPIPQVIFWLVIPKLIREEQVKLIMTILLLMFIFQFLPKVYHCIHIMRKMQKVTGYIFGS  290

Query  1067  IWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYEL  1246
             IWWGF LNL AYFIASH+AGGCWYVLAIQR+ASCL++ C    S   + L+CS+E+C+  
Sbjct  291   IWWGFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKRNNSCDLISLACSKEICFHP  350

Query  1247  LLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFW  1426
                  V G +C  N T+ +      CL   G F +GIY  ALPV+SS S+AVKILYPIFW
Sbjct  351   PWSSNVNGFACDTNMTSFSQRNVSTCLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFW  410

Query  1427  GLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRC  1606
             GLMTLSTFGNDL PTSN +EVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR 
Sbjct  411   GLMTLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRF  470

Query  1607  RDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLI  1786
             RDMEWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+
Sbjct  471   RDMEWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELV  530

Query  1787  KKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGV  1966
             K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+KGV
Sbjct  531   KQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGV  590

Query  1967  VATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFR  2146
             VAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT+HFR
Sbjct  591   VATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFITEHFR  650

Query  2147  YKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPE------NADDGDR  2308
             YKFANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT                 DDGDR
Sbjct  651   YKFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTSATDLAAMAAPPLAGGPDDGDR  710

Query  2309  RLRQYAAMFLSIRPHDHLE  2365
             RLR YAAMF+S+RPHDHLE
Sbjct  711   RLRHYAAMFMSLRPHDHLE  729



>ref|XP_007032655.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
 gb|EOY03581.1| Cyclic nucleotide-regulated ion channel family protein isoform 
1 [Theobroma cacao]
Length=704

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/711 (68%), Positives = 583/711 (82%), Gaps = 13/711 (2%)
 Frame = +2

Query  248   PGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAH  427
             P L F  +RWFG + R      D+   +  +     S ECYACTQVGVPVFHSTSCD+ H
Sbjct  2     PSLPFPRNRWFG-LARTWGFNNDSRSSSEQDGSVSNSIECYACTQVGVPVFHSTSCDSVH  60

Query  428   QPEWEASAGSSLIPIK--NRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLAR  601
             QP+WEA AGSSL P++  + P   + R+   F  SGPFG+ LDPRS  VQRWNR  L+AR
Sbjct  61    QPQWEAFAGSSLFPVQAASDPTKNSTRTRSRFS-SGPFGKALDPRSALVQRWNRVLLVAR  119

Query  602   GMALAIDPLFFYALSI--GRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYV  775
             G+ALA+DPLFFY L++     G PC+++D GLAAIVTV+RTC+DAVH+ H+WLQFRLAYV
Sbjct  120   GIALAVDPLFFYTLTLITREDGAPCVFLDSGLAAIVTVVRTCVDAVHLWHIWLQFRLAYV  179

Query  776   SRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKl  955
             S+ESLVVGCGKLVWDARA+ASHYVRSLKGFWFD FVILP+PQA FWL+VPKL+R E+ KL
Sbjct  180   SKESLVVGCGKLVWDARAIASHYVRSLKGFWFDVFVILPVPQAAFWLMVPKLLRAERYKL  239

Query  956   imtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCW  1135
             IMTILL IFLFQFLP++YHS+ LMRRM+KVTGYIFG++WWGF +NLIAY IASHVAGGCW
Sbjct  240   IMTILLSIFLFQFLPKVYHSLCLMRRMRKVTGYIFGSVWWGFGINLIAYLIASHVAGGCW  299

Query  1136  YVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRK  1315
             YVLA QRV +CL+Q+C  + ++CN   SCS+ VC + L P  V  + C G S     M K
Sbjct  300   YVLATQRVVTCLQQQCE-RSASCNPSSSCSKRVCSQYLSPANVLSSQCGGKSIT---MTK  355

Query  1316  PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIF  1495
               C D +GPFR+GIY+ A PV+SS S+AVKILYPIFWGL+ LS+FGN L PTSN +EV F
Sbjct  356   SFCFDPDGPFRYGIYEPAPPVISSNSLAVKILYPIFWGLLNLSSFGNQLSPTSNPMEVAF  415

Query  1496  SICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYF  1675
             SICIVL GL+LFTLL+GNIQVFLH VMA ++K+QLR RD+EWWM+RRQLPS LRQRVR+F
Sbjct  416   SICIVLGGLLLFTLLVGNIQVFLHVVMANRKKLQLRRRDVEWWMRRRQLPSGLRQRVRHF  475

Query  1676  ERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKP  1855
             E Q W +MGGE+EM+ I++LPEGLRRDIKR+LCLDLIKKVPLFHSLDDLIL+N+CDR+KP
Sbjct  476   ESQTWDSMGGEEEMKWIEELPEGLRRDIKRYLCLDLIKKVPLFHSLDDLILENVCDRVKP  535

Query  1856  LVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRR  2035
             L++SKDEKIIREGDPV R+VFIVRG  + SQ  SKG++ATS+LEPGGFLGDELLSWCLRR
Sbjct  536   LIYSKDEKIIREGDPVPRMVFIVRGHARRSQGFSKGIIATSVLEPGGFLGDELLSWCLRR  595

Query  2036  PFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWA  2215
             PF+DRLP SSATFTC + TEAFGLDA+ LR+IT+HFRY+FA+ +LKRTARYYS+NWRTWA
Sbjct  596   PFLDRLPTSSATFTCDEFTEAFGLDADDLRYITEHFRYRFAHNKLKRTARYYSSNWRTWA  655

Query  2216  AVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYAAMFLSIRPHDHLE  2365
             AVN+Q AWR Y++RTRG    +P  A+ G + RLR+YAAMF+S+RPHDHLE
Sbjct  656   AVNIQFAWRFYKMRTRGP--LIPVTANGGMEGRLRKYAAMFMSLRPHDHLE  704



>ref|XP_008666390.1| PREDICTED: uncharacterized protein LOC100272382 isoform X1 [Zea 
mays]
 tpg|DAA51485.1| TPA: hypothetical protein ZEAMMB73_065991 [Zea mays]
Length=730

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/672 (70%), Positives = 551/672 (82%), Gaps = 4/672 (1%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP--F  535
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +      +     
Sbjct  59    ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQGQAQAAAAAAAPRQRHAARWLL  118

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDPRS+RVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLA+ VT LR
Sbjct  119   GPVLDPRSRRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGQPCLYMDAGLASAVTALR  178

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             TC D  H+ H+ LQ RLAYVSRESLVVGCGKLVWDARAVA+HY RS+KG  FD FVILPI
Sbjct  179   TCADVAHLAHVLLQLRLAYVSRESLVVGCGKLVWDARAVAAHYARSVKGLCFDLFVILPI  238

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ +FWLV+PKLIREEQVKLIMTILLL+F+FQFLP++YHSI++MR+MQKVTGYIFG+IWW
Sbjct  239   PQVIFWLVIPKLIREEQVKLIMTILLLMFIFQFLPKVYHSIHIMRKMQKVTGYIFGSIWW  298

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             GF LNL AYFIASH+AGGCWYVLAIQR+ASCL++ C    S   + L+CS+E+C+     
Sbjct  299   GFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKRNNSCDLISLACSKEICFHPPWS  358

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
               V G +C  N T+ +      CL   G F +GIY  ALPV+SS S+AVKILYPIFWGLM
Sbjct  359   SNVNGFACDTNMTSFSQQNVSTCLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFWGLM  418

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGNDL PTSN +EVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDM
Sbjct  419   TLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDM  478

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+V
Sbjct  479   EWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELVKQV  538

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLFH +DDLILDNICDR++PLV S  EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT
Sbjct  539   PLFHGMDDLILDNICDRLRPLVLSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVAT  598

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF L A  LRFIT+HFRY F
Sbjct  599   CMLGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLGAPDLRFITEHFRYNF  658

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVP--ENADDGDRRLRQYAA  2329
             ANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT       P     DDGDRRLR YAA
Sbjct  659   ANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTSADLAAPPLVGGPDDGDRRLRHYAA  718

Query  2330  MFLSIRPHDHLE  2365
             MF+S+RPHDHLE
Sbjct  719   MFMSLRPHDHLE  730



>dbj|BAM44886.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=728

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/681 (70%), Positives = 551/681 (81%), Gaps = 13/681 (2%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP-  532
             + ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++         S          
Sbjct  50    AGECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASASALAAAHHHAG  109

Query  533   ------FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLA  694
                   FG VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLA
Sbjct  110   AAARWLFGPVLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGRPCLYMDAGLA  169

Query  695   AIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFD  874
             A VT LRT  D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG WFD
Sbjct  170   AAVTTLRTFADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLWFD  229

Query  875   AFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGY  1054
              FVILPIPQ +FWLV+PKLIREEQV++IMTILLLIFLFQFLP++YHSI++MR+MQKVTGY
Sbjct  230   LFVILPIPQVIFWLVIPKLIREEQVEVIMTILLLIFLFQFLPKVYHSIHIMRKMQKVTGY  289

Query  1055  IFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEV  1234
             IFGTIWWGF LNL AYFIASH+AGGCWYVL IQR+ASCL+  C   KS   + L+CS+E+
Sbjct  290   IFGTIWWGFGLNLFAYFIASHIAGGCWYVLTIQRIASCLQDECKKNKSCNLISLACSKEM  349

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
             C+ L  P     N  A N T+        CL  NG F +GIYK ALPV+SS S+AVKILY
Sbjct  350   CFHL--PWSSNNNGLACNMTSFGQQDVSTCLSGNGSFAYGIYKGALPVISSNSLAVKILY  407

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGNDLEPTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKM
Sbjct  408   PIFWGLMTLSTFGNDLEPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKM  467

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
             QLR RDMEWWM+RRQL   LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LC
Sbjct  468   QLRFRDMEWWMRRRQLSCRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLC  527

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             L+L+K+VPLFH +DDLILDNICDR++PLVF   EK+IREGDPVQR+VFI++G+++S+Q L
Sbjct  528   LELVKQVPLFHGMDDLILDNICDRLRPLVFCSGEKVIREGDPVQRMVFILQGKLRSTQPL  587

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
             +K VVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT
Sbjct  588   TKDVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFIT  647

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPN----TVPENADDG  2302
             +HFRY FANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT          V   +DDG
Sbjct  648   EHFRYNFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTADATTPAALLVGGPSDDG  707

Query  2303  DRRLRQYAAMFLSIRPHDHLE  2365
             DRRLR YAAMF+S+RPHDHLE
Sbjct  708   DRRLRHYAAMFMSLRPHDHLE  728



>dbj|BAM44885.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=728

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/681 (70%), Positives = 551/681 (81%), Gaps = 13/681 (2%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP-  532
             + ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++         S          
Sbjct  50    AGECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASASALAAAHHHAG  109

Query  533   ------FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLA  694
                   FG VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLA
Sbjct  110   AAARWLFGPVLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGRPCLYMDAGLA  169

Query  695   AIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFD  874
             A VT LRT  D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG WFD
Sbjct  170   AAVTTLRTFADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLWFD  229

Query  875   AFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGY  1054
              FVILPIPQ +FWLV+PKLIREEQV++IMTILLLIFLFQFLP++YHSI++MR+MQKVTGY
Sbjct  230   LFVILPIPQVIFWLVIPKLIREEQVEVIMTILLLIFLFQFLPKVYHSIHIMRKMQKVTGY  289

Query  1055  IFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEV  1234
             IFGTIWWGF LNL AYFIASH+AGGCWYVL IQR+ASCL+  C   KS   + L+CS+E+
Sbjct  290   IFGTIWWGFGLNLFAYFIASHIAGGCWYVLTIQRIASCLQDECKKNKSCNLISLACSKEM  349

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
             C+ L  P     N  A N T+        CL  NG F +GIYK ALPV+SS S+AVKILY
Sbjct  350   CFHL--PWSSNNNGLACNMTSFGQQDVSTCLSGNGSFAYGIYKGALPVISSNSLAVKILY  407

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGNDLEPTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKM
Sbjct  408   PIFWGLMTLSTFGNDLEPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKM  467

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
             QLR RDMEWWM+RRQL   LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LC
Sbjct  468   QLRFRDMEWWMRRRQLSCRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLC  527

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             L+L+K+VPLFH +DDLILDNICDR++PLVF   EK+IREG+PVQR+VFI++G+++S+Q L
Sbjct  528   LELVKQVPLFHGMDDLILDNICDRLRPLVFCSGEKVIREGNPVQRMVFILQGKLRSTQPL  587

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
             +K VVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C++S +AF LDA  LRFIT
Sbjct  588   TKDVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVESAQAFCLDAPDLRFIT  647

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPN----TVPENADDG  2302
             +HFRY FANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT          V   +DDG
Sbjct  648   EHFRYNFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTADATTPAALLVGGPSDDG  707

Query  2303  DRRLRQYAAMFLSIRPHDHLE  2365
             DRRLR YAAMF+S+RPHDHLE
Sbjct  708   DRRLRHYAAMFMSLRPHDHLE  728



>dbj|BAM44884.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=726

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/681 (70%), Positives = 553/681 (81%), Gaps = 13/681 (2%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP-  532
             + ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++         S          
Sbjct  48    AGECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASASALAAAHHHAG  107

Query  533   ------FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLA  694
                   FG VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLA
Sbjct  108   AAARWLFGPVLDPRSKRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGRPCLYMDAGLA  167

Query  695   AIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFD  874
             A VT LRT  D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG WFD
Sbjct  168   AAVTTLRTFADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLWFD  227

Query  875   AFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGY  1054
              FVILPIPQ +FWLV+PKLIREEQV++IMTILLLIFLFQFLP++YHSI++MR+MQKVTGY
Sbjct  228   LFVILPIPQVIFWLVIPKLIREEQVEVIMTILLLIFLFQFLPKVYHSIHIMRKMQKVTGY  287

Query  1055  IFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEV  1234
             IFGTIWWGF LNL AYFIASH+AGGCWYVL IQR+ SCL+  C   KS   + L+CS+E+
Sbjct  288   IFGTIWWGFGLNLFAYFIASHIAGGCWYVLTIQRIVSCLQDECKKNKSCNLISLACSKEM  347

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
             C+ L  P     N  A N T++       CL  NG F +GIYK ALPV+SS S+AVKILY
Sbjct  348   CFHL--PWSSNTNGLACNMTSSGQQDVSTCLSGNGSFAYGIYKGALPVISSNSLAVKILY  405

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGNDLEPTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKM
Sbjct  406   PIFWGLMTLSTFGNDLEPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKM  465

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
             QLR RDMEWWM+RRQL  +LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LC
Sbjct  466   QLRFRDMEWWMRRRQLSCSLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLC  525

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             L+L+K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L
Sbjct  526   LELVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPL  585

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
             +K VVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT
Sbjct  586   TKDVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFIT  645

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPEN----ADDG  2302
             +HFRYKFANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT     T         DDG
Sbjct  646   EHFRYKFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTADATTTAALLAGGPGDDG  705

Query  2303  DRRLRQYAAMFLSIRPHDHLE  2365
             DRRLR YAAMF+S+RPHDHLE
Sbjct  706   DRRLRHYAAMFMSLRPHDHLE  726



>dbj|BAM44881.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=726

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/679 (71%), Positives = 555/679 (82%), Gaps = 11/679 (2%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP-  532
             + ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++              H +G  
Sbjct  50    AGECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASALAAAHHHAGAA  109

Query  533   ----FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
                 FG VLDPRSKRVQRWN+  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLAA 
Sbjct  110   ARWLFGPVLDPRSKRVQRWNQWILLGRAAALAVDPLFFYALSIGRAGRPCLYMDAGLAAA  169

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VT LRT  D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG WFD F
Sbjct  170   VTTLRTFADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLWFDLF  229

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILPIPQ +FWLV+PKLIREEQV++IMTILLLIFLFQFLP++YHSI++MR+MQKVTGYIF
Sbjct  230   VILPIPQVIFWLVIPKLIREEQVEVIMTILLLIFLFQFLPKVYHSIHIMRKMQKVTGYIF  289

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY  1240
             GTIWWGF LNL AYFIASH+AGGCWYVL IQR+ SCL+  C   KS   + L+CS+E+C+
Sbjct  290   GTIWWGFGLNLFAYFIASHIAGGCWYVLTIQRIVSCLQDECKKNKSCNLISLACSKEMCF  349

Query  1241  ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
              L  P     N  A N T++       CL  NG F +GIYK ALPV+SS S+AVKILYPI
Sbjct  350   HL--PWSSNTNGLACNMTSSGQQDVSTCLSGNGSFAYGIYKGALPVISSNSLAVKILYPI  407

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGNDLEPTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQL
Sbjct  408   FWGLMTLSTFGNDLEPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQL  467

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             R RDMEWWM+RRQL   LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+
Sbjct  468   RFRDMEWWMRRRQLSCRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLE  527

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+K
Sbjct  528   LVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTK  587

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
              VVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT+H
Sbjct  588   DVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFITEH  647

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPEN----ADDGDR  2308
             FRYKFANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT G   T         DDGDR
Sbjct  648   FRYKFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTAGATTTAALLAGGPGDDGDR  707

Query  2309  RLRQYAAMFLSIRPHDHLE  2365
             RLR YAAMF+S+RPHDHLE
Sbjct  708   RLRHYAAMFMSLRPHDHLE  726



>dbj|BAM44883.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=726

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/679 (71%), Positives = 554/679 (82%), Gaps = 11/679 (2%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP-  532
             + ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++              H +G  
Sbjct  50    AGECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASALAAAHHHAGAA  109

Query  533   ----FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
                 FG VLDPRSKRVQRWN+  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLAA 
Sbjct  110   ARWLFGPVLDPRSKRVQRWNQWILLGRAAALAVDPLFFYALSIGRAGRPCLYMDAGLAAA  169

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VT LRT  D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG WFD F
Sbjct  170   VTTLRTFADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLWFDLF  229

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILPIPQ +FWLV+PKLIREEQV++IMTILLLIFLFQFLP++YHSI++MR+MQKVTGYIF
Sbjct  230   VILPIPQVIFWLVIPKLIREEQVEVIMTILLLIFLFQFLPKVYHSIHIMRKMQKVTGYIF  289

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY  1240
             GTIWWGF LNL AYFIASH+AGGCWYVL IQR+ SCL+  C   KS   + L+CS+E+C+
Sbjct  290   GTIWWGFGLNLFAYFIASHIAGGCWYVLTIQRIVSCLQDECKKNKSCNLISLACSKEMCF  349

Query  1241  ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
              L  P     N  A N T++       CL  NG F +GIYK ALPV+SS S+AVKILYPI
Sbjct  350   HL--PWSSNTNGLACNMTSSGQQDVSTCLSGNGSFAYGIYKGALPVISSNSLAVKILYPI  407

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGNDLEPTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQL
Sbjct  408   FWGLMTLSTFGNDLEPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQL  467

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             R RDMEWWM+RRQL   LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+
Sbjct  468   RFRDMEWWMRRRQLSCRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLE  527

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+K
Sbjct  528   LVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTK  587

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
              VVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT+H
Sbjct  588   DVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFITEH  647

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPEN----ADDGDR  2308
             FRYKFANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT     T         DDGDR
Sbjct  648   FRYKFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTADATTTAALLAGGPGDDGDR  707

Query  2309  RLRQYAAMFLSIRPHDHLE  2365
             RLR YAAMF+S+RPHDHLE
Sbjct  708   RLRHYAAMFMSLRPHDHLE  726



>ref|XP_008792776.1| PREDICTED: cyclic nucleotide-gated ion channel 2 [Phoenix dactylifera]
Length=757

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/726 (67%), Positives = 569/726 (78%), Gaps = 22/726 (3%)
 Frame = +2

Query  230   PKMPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHST  409
             P+   +P  H     W+  +LRR   +     D  DE     + +CYACTQ G P FHST
Sbjct  37    PRRRHHPSAHSGC--WWTRLLRRWKFRLGGDAD--DERA---AGDCYACTQAGAPAFHST  89

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWN  580
             SCD AH  EWEA AGSSL+PI+N   +    + +      P   FG VLDPRS  VQRWN
Sbjct  90    SCDGAHALEWEAGAGSSLMPIQNTARASASGAGERRTGRRPALVFGAVLDPRSGGVQRWN  149

Query  581   RAFLLARGMALAIDPLFFYALSIG----------RSGTPCLY-MDGGLAAIVTVLRTCLD  727
             R  LLAR +ALA+DPLFFY +S+G            G  C+  M G L      +RTC D
Sbjct  150   RGLLLARAVALAVDPLFFYTVSLGARPTAAAAAASEGGGCVVGMHGRLGVAAAAVRTCAD  209

Query  728   AVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAV  907
             AVH+ H+W+Q RLAYVSRESLVVGCGKLVWD RA+ASHY+RS KGFWFD FVILP+PQ +
Sbjct  210   AVHVLHVWVQLRLAYVSRESLVVGCGKLVWDPRAIASHYLRSSKGFWFDLFVILPLPQII  269

Query  908   FWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCL  1087
              WLV+PKLIREE++KLI T+LLLIFLFQF P++YHSI +MR MQKVTGYIFGTIWWGF L
Sbjct  270   LWLVLPKLIREEELKLITTVLLLIFLFQFFPKVYHSICMMRSMQKVTGYIFGTIWWGFGL  329

Query  1088  NLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVE  1267
             NLIAYFIASHVAGGCWYVLAIQRVASCL+Q+C    +   + ++CS+E C  L LP G++
Sbjct  330   NLIAYFIASHVAGGCWYVLAIQRVASCLQQQCQKNNNCDLMSMACSKEACKLLSLPAGID  389

Query  1268  GNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLST  1447
               SC  N T         CL+V+GPF++GIY  ALPV+SS S+AVKILYPIFWGLMTLST
Sbjct  390   ELSCINNLTFVGNQNLHACLNVDGPFQYGIYDAALPVISSNSLAVKILYPIFWGLMTLST  449

Query  1448  FGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM  1627
             FGN+L PTS WLEVIFSI IVLSGLMLFTLLIGNIQ+FLHAVMA++RKMQLR RDMEWWM
Sbjct  450   FGNNLVPTSQWLEVIFSIAIVLSGLMLFTLLIGNIQIFLHAVMARRRKMQLRFRDMEWWM  509

Query  1628  KRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFH  1807
             KRRQLPS LRQRVR +E QRWA M GEDEME+IKDLP+GLRRDI+R+LCLDLIK+VPLFH
Sbjct  510   KRRQLPSRLRQRVRQYECQRWATMRGEDEMEIIKDLPDGLRRDIRRYLCLDLIKQVPLFH  569

Query  1808  SLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILE  1987
             SLDDLILDNICDR+K LVFSKDEKIIREGDPVQR+VFIV+G ++SSQ LSKG+VA  +L 
Sbjct  570   SLDDLILDNICDRVKHLVFSKDEKIIREGDPVQRMVFIVQGHLQSSQKLSKGMVAKCMLG  629

Query  1988  PGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANER  2167
             PG FLGDELLSWCLRRPF++RLPASSATF C++ TEAFGLDA+HL +IT+HFRYKFAN+R
Sbjct  630   PGNFLGDELLSWCLRRPFMNRLPASSATFVCVEPTEAFGLDAHHLLYITEHFRYKFANDR  689

Query  2168  LKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIR  2347
             LKRTARYYS+NWRTWAAVN+QLAWRRY+ +TRG     P    D +RRLR +AAMF+SIR
Sbjct  690   LKRTARYYSSNWRTWAAVNIQLAWRRYKAKTRG-VTIQPSELGDSERRLRLFAAMFMSIR  748

Query  2348  PHDHLE  2365
             PHDHLE
Sbjct  749   PHDHLE  754



>ref|XP_008680983.1| PREDICTED: uncharacterized protein LOC100191751 isoform X1 [Zea 
mays]
Length=725

 Score =   938 bits (2424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/675 (70%), Positives = 555/675 (82%), Gaps = 5/675 (1%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  535
             S ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +         F
Sbjct  51    SGECYACTQPGVPAFHSTACDQVHSPDWDADAGSSLVPVQAQQQAQPAAAAAQHAARWLF  110

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLY+D GLAA VT LR
Sbjct  111   GPVLDPRSKRVQRWNRWILLGRAAALALDPLFFYALSIGRAGRPCLYLDAGLAAAVTALR  170

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             TC D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG  FD FVILPI
Sbjct  171   TCADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLCFDLFVILPI  230

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ +FWLV+PKLIREE+V+LIMTILLL+F+FQFLP++YHSI++MR+MQKVTGYIFG+IWW
Sbjct  231   PQVIFWLVIPKLIREERVRLIMTILLLMFIFQFLPKVYHSIHIMRKMQKVTGYIFGSIWW  290

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             GF LNL AYFIASH+AGGCWYVLAIQR+ASCL++ C    S   + L+CS+E+C+     
Sbjct  291   GFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKKNNSCDLISLACSKEICFHPPWS  350

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
               V G +C  N T+ +      CL   G F +GIY  ALPV+SS S+AVKILYPIFWGLM
Sbjct  351   SNVNGFACDTNMTSFSQRNVSTCLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFWGLM  410

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGNDL PTSN +EVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDM
Sbjct  411   TLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDM  470

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+V
Sbjct  471   EWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELVKQV  530

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT
Sbjct  531   PLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVAT  590

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT+HFRYKF
Sbjct  591   CMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFITEHFRYKF  650

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPE-----NADDGDRRLRQ  2320
             ANE+L+RTARYYS+NWRTWAAVN+QLAWRRYR R       +         DDGDRRLR 
Sbjct  651   ANEKLRRTARYYSSNWRTWAAVNIQLAWRRYRARASTDLAAMAAPPLAGGPDDGDRRLRH  710

Query  2321  YAAMFLSIRPHDHLE  2365
             YAAMF+S+RPHDHLE
Sbjct  711   YAAMFMSLRPHDHLE  725



>gb|AFW67569.1| hypothetical protein ZEAMMB73_354655 [Zea mays]
Length=745

 Score =   938 bits (2424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/675 (70%), Positives = 555/675 (82%), Gaps = 5/675 (1%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  535
             S ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +         F
Sbjct  71    SGECYACTQPGVPAFHSTACDQVHSPDWDADAGSSLVPVQAQQQAQPAAAAAQHAARWLF  130

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDPRSKRVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLY+D GLAA VT LR
Sbjct  131   GPVLDPRSKRVQRWNRWILLGRAAALALDPLFFYALSIGRAGRPCLYLDAGLAAAVTALR  190

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             TC D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG  FD FVILPI
Sbjct  191   TCADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLCFDLFVILPI  250

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ +FWLV+PKLIREE+V+LIMTILLL+F+FQFLP++YHSI++MR+MQKVTGYIFG+IWW
Sbjct  251   PQVIFWLVIPKLIREERVRLIMTILLLMFIFQFLPKVYHSIHIMRKMQKVTGYIFGSIWW  310

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             GF LNL AYFIASH+AGGCWYVLAIQR+ASCL++ C    S   + L+CS+E+C+     
Sbjct  311   GFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKKNNSCDLISLACSKEICFHPPWS  370

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
               V G +C  N T+ +      CL   G F +GIY  ALPV+SS S+AVKILYPIFWGLM
Sbjct  371   SNVNGFACDTNMTSFSQRNVSTCLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFWGLM  430

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGNDL PTSN +EVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDM
Sbjct  431   TLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDM  490

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+V
Sbjct  491   EWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELVKQV  550

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT
Sbjct  551   PLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVAT  610

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT+HFRYKF
Sbjct  611   CMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFITEHFRYKF  670

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPE-----NADDGDRRLRQ  2320
             ANE+L+RTARYYS+NWRTWAAVN+QLAWRRYR R       +         DDGDRRLR 
Sbjct  671   ANEKLRRTARYYSSNWRTWAAVNIQLAWRRYRARASTDLAAMAAPPLAGGPDDGDRRLRH  730

Query  2321  YAAMFLSIRPHDHLE  2365
             YAAMF+S+RPHDHLE
Sbjct  731   YAAMFMSLRPHDHLE  745



>ref|XP_010034400.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Eucalyptus 
grandis]
Length=696

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/712 (64%), Positives = 557/712 (78%), Gaps = 18/712 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYAC-TQVGVPVFHSTS  412
             MP +P   FSL RW     + +     +++          + EC+AC TQVGVP FHST+
Sbjct  1     MPYHPNSGFSLPRWISEFFKPRM----SAESATAMAGLAAAVECHACSTQVGVPAFHSTT  56

Query  413   CDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             CD AH QP W A AGSSL+ I+  PG     S +    +GPFG VLDPRS  V++WNRA 
Sbjct  57    CDGAHHQPRWVAFAGSSLVRIQAWPGPGDGASRR--RPAGPFGSVLDPRSPEVKKWNRAL  114

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             L+ARG+ALA+DPLFFY +S+G   +PCLYMDGGLAA + ++RTC+D VH+ H+WLQ RLA
Sbjct  115   LMARGVALAVDPLFFYTISVGTGASPCLYMDGGLAATLAIVRTCVDGVHVLHMWLQLRLA  174

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRES+V+GCGKLVWDARA+ASHY RSL+G  FD FV+LP+PQ + WL VPKLIREE+V
Sbjct  175   YVSRESMVIGCGKLVWDARAIASHYARSLEGLLFDVFVVLPVPQIILWLAVPKLIREERV  234

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             K+I  +LL+       P++YHSI LMRRM+KVTGY+FGTIWWGF +NLIAYFIASHVAGG
Sbjct  235   KMIPILLLIFLFQFL-PKVYHSICLMRRMRKVTGYVFGTIWWGFGINLIAYFIASHVAGG  293

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLA QRV  CL+++C    + CN  +SCS+ + Y+   P    GN   GN ++    
Sbjct  294   CWYVLATQRVVMCLQKQCDVS-AKCNFSISCSKVISYQFPSPAESLGNLLGGNWSSP---  349

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEV  1489
                 C D +GPF +GIY  AL V+SS S++V++LYPIFWGL+ LSTFGN+LEPTSNWLEV
Sbjct  350   ----CFDNDGPFNYGIYGDALSVISSESLSVRVLYPIFWGLLNLSTFGNELEPTSNWLEV  405

Query  1490  IFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVR  1669
             IFSICIVLSGL+LFTLL+GNIQ+FLHAVM KK+K+ LR RD+EWWM+RRQLPS+LRQRV 
Sbjct  406   IFSICIVLSGLLLFTLLVGNIQIFLHAVMVKKKKILLRFRDIEWWMRRRQLPSHLRQRVF  465

Query  1670  YFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRI  1849
             +FE QR    GGEDEM+LI+DLP+GLR DIKR LCLDLIKKVPLFH LDDL+LD+ICDR+
Sbjct  466   HFESQRLTITGGEDEMKLIEDLPDGLRHDIKRHLCLDLIKKVPLFHDLDDLVLDHICDRV  525

Query  1850  KPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCL  2029
             KPL+FSK EKIIREGDPV R++FIV G V   Q+LSKG VAT++LEPG FLGDELLSWCL
Sbjct  526   KPLIFSKGEKIIREGDPVHRIIFIVHGLVGRHQSLSKGRVATNVLEPGCFLGDELLSWCL  585

Query  2030  RRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRT  2209
             RRPF+DRLPASSATF+C++ TE FGLDA  L+++T+HFRYKF    LKR ARY+S+NWRT
Sbjct  586   RRPFMDRLPASSATFSCMEHTEGFGLDAKDLKYVTEHFRYKFMEGGLKRMARYFSSNWRT  645

Query  2210  WAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             WAAVN+QLAWRRY++RTRGQ   V EN  D + RL+QYAAMF+S++PHDHLE
Sbjct  646   WAAVNIQLAWRRYKMRTRGQVRVVIENG-DAEHRLKQYAAMFMSLKPHDHLE  696



>gb|AAK16188.1|AC079887_20 putative cyclic nucleotide and calmodulin-regulated ion channel 
protein [Oryza sativa Japonica Group]
 gb|ABF98977.1| Cyclic nucleotide-gated ion channel 2, putative, expressed [Oryza 
sativa Japonica Group]
Length=782

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/731 (65%), Positives = 561/731 (77%), Gaps = 70/731 (10%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  541
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +P +  H +         FG 
Sbjct  59    ECYACTQPGVPSFHSTTCDQVHSPDWDADAGSSLVPVQAQPSAAHHAAAAAARWV--FGP  116

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDPRSKRVQRWNR  LLAR  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRT 
Sbjct  117   VLDPRSKRVQRWNRWILLARAAALAVDPLFFYALSIGRAGQPCVYMDAGLAAAVTALRTA  176

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKG-------------  862
              D  H+ H+ LQFR+AYVSRESLVVGCGKLVWD RA+A+HY RSLKG             
Sbjct  177   ADLAHLAHVLLQFRVAYVSRESLVVGCGKLVWDPRAIAAHYARSLKGLWFDLFVILPIPQ  236

Query  863   ------------------FWFDAFVILP-------------------------IPQAVFW  913
                               F+   F +L                          + + +FW
Sbjct  237   HNRYSPFTSPLIPLCVAVFYLRPFTVLGRYDRYLPTFFTSTVYFLRGNLGKNNVNKVIFW  296

Query  914   LVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNL  1093
             LV+PKLIREEQ+KLIMT+LLL+FL QFLP++YHSIY+MR+MQKVTGYIFGTIWWGF LNL
Sbjct  297   LVIPKLIREEQIKLIMTMLLLLFLLQFLPKVYHSIYIMRKMQKVTGYIFGTIWWGFGLNL  356

Query  1094  IAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLLPGGVEG  1270
              AYFIASH+AGGCWYVLAIQRVASCL++ C   K+TCNL  L+CS+E+C+ L      + 
Sbjct  357   FAYFIASHIAGGCWYVLAIQRVASCLQEECKI-KNTCNLTSLACSKEMCFHLPWS---DK  412

Query  1271  NSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTF  1450
             N  A N T+      P CL  NGPF +GIYK ALPV+SS S+AVKILYPIFWGLMTLSTF
Sbjct  413   NGLACNLTSFGQQNIPDCLSGNGPFAYGIYKGALPVISSNSLAVKILYPIFWGLMTLSTF  472

Query  1451  GNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMK  1630
             GNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDMEWWM+
Sbjct  473   GNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEWWMR  532

Query  1631  RRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHS  1810
             RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VPLFH 
Sbjct  533   RRQLPSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPLFHG  592

Query  1811  LDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEP  1990
             +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VF+++G+++S+Q L+KGVVAT +L  
Sbjct  593   MDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFVLQGKLRSTQPLAKGVVATCMLGA  652

Query  1991  GGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERL  2170
             G FLGDELLSWCLRRP +DRLPASSATF C+++ +AF LDA  LRFIT+ FRYKFANE+L
Sbjct  653   GNFLGDELLSWCLRRPSLDRLPASSATFECVETAQAFCLDAPDLRFITEQFRYKFANEKL  712

Query  2171  KRTARYYSANWRTWAAVNVQLAWRRYRLRTR------GQPNTVPENADDGDRRLRQYAAM  2332
             KRTARYYS+NWRTWAAVN+QLAWRRY+ RT        QP +     DDGDRRLR YAAM
Sbjct  713   KRTARYYSSNWRTWAAVNIQLAWRRYKARTTTDLASAAQPPSA-GGPDDGDRRLRHYAAM  771

Query  2333  FLSIRPHDHLE  2365
             F+S+RPHDHLE
Sbjct  772   FMSLRPHDHLE  782



>gb|KCW51913.1| hypothetical protein EUGRSUZ_J01368 [Eucalyptus grandis]
Length=666

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/672 (67%), Positives = 543/672 (81%), Gaps = 14/672 (2%)
 Frame = +2

Query  356   STECYAC-TQVGVPVFHSTSCDNAH-QPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSG  529
             + EC+AC TQVGVP FHST+CD AH QP W A AGSSL+ I+  PG     S +    +G
Sbjct  7     AVECHACSTQVGVPAFHSTTCDGAHHQPRWVAFAGSSLVRIQAWPGPGDGASRR--RPAG  64

Query  530   PFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTV  709
             PFG VLDPRS  V++WNRA L+ARG+ALA+DPLFFY +S+G   +PCLYMDGGLAA + +
Sbjct  65    PFGSVLDPRSPEVKKWNRALLMARGVALAVDPLFFYTISVGTGASPCLYMDGGLAATLAI  124

Query  710   LRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVIL  889
             +RTC+D VH+ H+WLQ RLAYVSRES+V+GCGKLVWDARA+ASHY RSL+G  FD FV+L
Sbjct  125   VRTCVDGVHVLHMWLQLRLAYVSRESMVIGCGKLVWDARAIASHYARSLEGLLFDVFVVL  184

Query  890   PIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTI  1069
             P+PQ + WL VPKLIREE+VK+I  +LL+       P++YHSI LMRRM+KVTGY+FGTI
Sbjct  185   PVPQIILWLAVPKLIREERVKMIPILLLIFLFQFL-PKVYHSICLMRRMRKVTGYVFGTI  243

Query  1070  WWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELL  1249
             WWGF +NLIAYFIASHVAGGCWYVLA QRV  CL+++C    + CN  +SCS+ + Y+  
Sbjct  244   WWGFGINLIAYFIASHVAGGCWYVLATQRVVMCLQKQCDVS-AKCNFSISCSKVISYQFP  302

Query  1250  LPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWG  1429
              P    GN   GN ++        C D +GPF +GIY  AL V+SS S++V++LYPIFWG
Sbjct  303   SPAESLGNLLGGNWSSP-------CFDNDGPFNYGIYGDALSVISSESLSVRVLYPIFWG  355

Query  1430  LMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCR  1609
             L+ LSTFGN+LEPTSNWLEVIFSICIVLSGL+LFTLL+GNIQ+FLHAVM KK+K+ LR R
Sbjct  356   LLNLSTFGNELEPTSNWLEVIFSICIVLSGLLLFTLLVGNIQIFLHAVMVKKKKILLRFR  415

Query  1610  DMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIK  1789
             D+EWWM+RRQLPS+LRQRV +FE QR    GGEDEM+LI+DLP+GLR DIKR LCLDLIK
Sbjct  416   DIEWWMRRRQLPSHLRQRVFHFESQRLTITGGEDEMKLIEDLPDGLRHDIKRHLCLDLIK  475

Query  1790  KVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVV  1969
             KVPLFH LDDL+LD+ICDR+KPL+FSK EKIIREGDPV R++FIV G V   Q+LSKG V
Sbjct  476   KVPLFHDLDDLVLDHICDRVKPLIFSKGEKIIREGDPVHRIIFIVHGLVGRHQSLSKGRV  535

Query  1970  ATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRY  2149
             AT++LEPG FLGDELLSWCLRRPF+DRLPASSATF+C++ TE FGLDA  L+++T+HFRY
Sbjct  536   ATNVLEPGCFLGDELLSWCLRRPFMDRLPASSATFSCMEHTEGFGLDAKDLKYVTEHFRY  595

Query  2150  KFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAA  2329
             KF    LKR ARY+S+NWRTWAAVN+QLAWRRY++RTRGQ   V EN  D + RL+QYAA
Sbjct  596   KFMEGGLKRMARYFSSNWRTWAAVNIQLAWRRYKMRTRGQVRVVIENG-DAEHRLKQYAA  654

Query  2330  MFLSIRPHDHLE  2365
             MF+S++PHDHLE
Sbjct  655   MFMSLKPHDHLE  666



>ref|XP_009405110.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Musa acuminata 
subsp. malaccensis]
Length=728

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/705 (67%), Positives = 552/705 (78%), Gaps = 11/705 (2%)
 Frame = +2

Query  269   SRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEAS  448
             SRW   I+R      D++  +        + ECYACTQ GVP FHSTSCD AH  EWEA+
Sbjct  29    SRWVHKIVRCWRTDDDDASGSGGGGAGSAAVECYACTQAGVPAFHSTSCDRAHPLEWEAN  88

Query  449   AGSSLIPIKNRPGSVTHRSTQDFHRSGP------FGRVLDPRSKRVQRWNRAFLLARGMA  610
             AGSS+IPI++   +   R T+   R         FG VLDPRS  VQ+WNR  LLAR +A
Sbjct  89    AGSSMIPIQHHVAA--RRPTEGAGRRRRRRPAWVFGPVLDPRSGGVQQWNRGLLLARAVA  146

Query  611   LAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESL  790
             LA DPLF YA+ + R    C+ +DG  AA V  +RTC DA  + H W+Q RLAYVSRESL
Sbjct  147   LAADPLFLYAVGV-RGNRGCVEVDGRYAAAVAAVRTCADAAQVVHAWVQLRLAYVSRESL  205

Query  791   VVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtil  970
             VVGCGKLVWD +A+A+HY+RS   FWFD FVILPIPQ  FWLV+P+LIREE+++ I  IL
Sbjct  206   VVGCGKLVWDPKAIAAHYLRSATAFWFDLFVILPIPQVFFWLVLPRLIREEEMESIANIL  265

Query  971   lliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAI  1150
             LLI LFQF+P++ HSI +MR MQ+VTGYIFGTIWWGF LNLIAYFIASHV GGCWY+LAI
Sbjct  266   LLILLFQFIPKVCHSICMMRSMQQVTGYIFGTIWWGFALNLIAYFIASHVTGGCWYILAI  325

Query  1151  QRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLD  1330
             QRV+SCL+Q+C  + +     L+CS+E C  L LP GV+  SC  N T+    +  +C  
Sbjct  326   QRVSSCLQQQCQKKNNCGFASLACSKEACDRLPLPSGVDRASCYNNVTSIR-NQNGVCFS  384

Query  1331  VNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIV  1510
              +GPF +GIY  ALPV+SS S+ VK+LYPI WGLMTLSTFGN+LEPTS  LEV+F I  V
Sbjct  385   ADGPFAYGIYDAALPVISSNSLTVKVLYPICWGLMTLSTFGNNLEPTSQSLEVMFGIATV  444

Query  1511  LSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRW  1690
             L GLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRDMEWWMKRRQLPS LRQRVR +ERQRW
Sbjct  445   LGGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDMEWWMKRRQLPSRLRQRVRQYERQRW  504

Query  1691  AAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSK  1870
             AAM GEDE++L+KDLPEGLRRDI+R LCLDLIK+VPLF +LDDLILDNICDR+K +VFSK
Sbjct  505   AAMRGEDEVDLVKDLPEGLRRDIRRHLCLDLIKQVPLFQNLDDLILDNICDRVKHMVFSK  564

Query  1871  DEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDR  2050
             DEK+IREGDPVQ +VF+VRGR++SSQ LSKGVVAT +L PG FLGDELLSWCLRRPF DR
Sbjct  565   DEKVIREGDPVQCMVFVVRGRLQSSQRLSKGVVATCMLGPGNFLGDELLSWCLRRPFTDR  624

Query  2051  LPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQ  2230
             LPASSATF C+D TEAFGLDAN LR+IT+HFRYKFAN+RLKRTARYYS NWRTWAAVN+Q
Sbjct  625   LPASSATFACVDHTEAFGLDANDLRYITEHFRYKFANDRLKRTARYYSTNWRTWAAVNIQ  684

Query  2231  LAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             LAWRRY+ +TR   +  P    D ++RLR YAA+F+SIRPHDHLE
Sbjct  685   LAWRRYKTKTRATRDQ-PAELGDNEQRLRLYAAIFMSIRPHDHLE  728



>ref|NP_001051331.1| Os03g0758300 [Oryza sativa Japonica Group]
 dbj|BAF13245.1| Os03g0758300 [Oryza sativa Japonica Group]
Length=618

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/616 (74%), Positives = 526/616 (85%), Gaps = 12/616 (2%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
             R++ PRSKRVQRWNR  LLAR  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRT
Sbjct  8     RLVWPRSKRVQRWNRWILLARAAALAVDPLFFYALSIGRAGQPCVYMDAGLAAAVTALRT  67

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
               D  H+ H+ LQFR+AYVSRESLVVGCGKLVWD RA+A+HY RSLKG WFD FVILPIP
Sbjct  68    AADLAHLAHVLLQFRVAYVSRESLVVGCGKLVWDPRAIAAHYARSLKGLWFDLFVILPIP  127

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q +FWLV+PKLIREEQ+KLIMT+LLL+FL QFLP++YHSIY+MR+MQKVTGYIFGTIWWG
Sbjct  128   QVIFWLVIPKLIREEQIKLIMTMLLLLFLLQFLPKVYHSIYIMRKMQKVTGYIFGTIWWG  187

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSEEVCYELLLP  1255
             F LNL AYFIASH+AGGCWYVLAIQRVASCL++ C   K+TCNL  L+CS+E+C+ L   
Sbjct  188   FGLNLFAYFIASHIAGGCWYVLAIQRVASCLQEECKI-KNTCNLTSLACSKEMCFHLPWS  246

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
                + N  A N T+      P CL  NGPF +GIYK ALPV+SS S+AVKILYPIFWGLM
Sbjct  247   ---DKNGLACNLTSFGQQNIPDCLSGNGPFAYGIYKGALPVISSNSLAVKILYPIFWGLM  303

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDM
Sbjct  304   TLSTFGNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDM  363

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+V
Sbjct  364   EWWMRRRQLPSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQV  423

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VF+++G+++S+Q L+KGVVAT
Sbjct  424   PLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFVLQGKLRSTQPLAKGVVAT  483

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L  G FLGDELLSWCLRRP +DRLPASSATF C+++ +AF LDA  LRFIT+ FRYKF
Sbjct  484   CMLGAGNFLGDELLSWCLRRPSLDRLPASSATFECVETAQAFCLDAPDLRFITEQFRYKF  543

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR------GQPNTVPENADDGDRRLR  2317
             ANE+LKRTARYYS+NWRTWAAVN+QLAWRRY+ RT        QP +     DDGDRRLR
Sbjct  544   ANEKLKRTARYYSSNWRTWAAVNIQLAWRRYKARTTTDLASAAQPPSA-GGPDDGDRRLR  602

Query  2318  QYAAMFLSIRPHDHLE  2365
              YAAMF+S+RPHDHLE
Sbjct  603   HYAAMFMSLRPHDHLE  618



>ref|XP_008666400.1| PREDICTED: uncharacterized protein LOC100272382 isoform X2 [Zea 
mays]
 tpg|DAA51484.1| TPA: hypothetical protein ZEAMMB73_065991 [Zea mays]
Length=705

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/672 (67%), Positives = 528/672 (79%), Gaps = 29/672 (4%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP--F  535
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++ +  +    +      +     
Sbjct  59    ECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQGQAQAAAAAAAPRQRHAARWLL  118

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDPRS+RVQRWNR  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLA+ VT LR
Sbjct  119   GPVLDPRSRRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGQPCLYMDAGLASAVTALR  178

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             TC D  H+ H+ LQ RLAYVSRESLVVGCGKLVWDARAVA+HY RS+KG  FD FVILPI
Sbjct  179   TCADVAHLAHVLLQLRLAYVSRESLVVGCGKLVWDARAVAAHYARSVKGLCFDLFVILPI  238

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ +FWLV+PKLIREEQVKLIMTILLL+F+FQFLP++YHSI++MR+MQK+          
Sbjct  239   PQVIFWLVIPKLIREEQVKLIMTILLLMFIFQFLPKVYHSIHIMRKMQKI----------  288

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
                            AGGCWYVLAIQR+ASCL++ C    S   + L+CS+E+C+     
Sbjct  289   ---------------AGGCWYVLAIQRIASCLQEECKRNNSCDLISLACSKEICFHPPWS  333

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
               V G +C  N T+ +      CL   G F +GIY  ALPV+SS S+AVKILYPIFWGLM
Sbjct  334   SNVNGFACDTNMTSFSQQNVSTCLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFWGLM  393

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGNDL PTSN +EVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDM
Sbjct  394   TLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDM  453

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+V
Sbjct  454   EWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELVKQV  513

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLFH +DDLILDNICDR++PLV S  EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT
Sbjct  514   PLFHGMDDLILDNICDRLRPLVLSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVAT  573

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF L A  LRFIT+HFRY F
Sbjct  574   CMLGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLGAPDLRFITEHFRYNF  633

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVP--ENADDGDRRLRQYAA  2329
             ANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT       P     DDGDRRLR YAA
Sbjct  634   ANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTSADLAAPPLVGGPDDGDRRLRHYAA  693

Query  2330  MFLSIRPHDHLE  2365
             MF+S+RPHDHLE
Sbjct  694   MFMSLRPHDHLE  705



>dbj|BAM44882.1| cyclic nucleotide gated channel 2 [Phragmites australis]
Length=701

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/679 (67%), Positives = 531/679 (78%), Gaps = 36/679 (5%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP-  532
             + ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++              H +G  
Sbjct  50    AGECYACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQAHQAQSASALAAAHHHAGAA  109

Query  533   ----FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
                 FG VLDPRSKRVQRWN+  LL R  ALA+DPLFFYALSIGR+G PCLYMD GLAA 
Sbjct  110   ARWLFGPVLDPRSKRVQRWNQWILLGRAAALAVDPLFFYALSIGRAGRPCLYMDAGLAAA  169

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VT LRT  D  H+ H+ LQFRLAYVSRESLVVGCGKLVWDARA+A+HY RS+KG WFD F
Sbjct  170   VTTLRTFADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGLWFDLF  229

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILPIPQ +FWLV+PKLIREEQV++IMTILLLIFLFQFLP++YHSI++MR+MQK+     
Sbjct  230   VILPIPQVIFWLVIPKLIREEQVEVIMTILLLIFLFQFLPKVYHSIHIMRKMQKI-----  284

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY  1240
                                 AGGCWYVL IQR+ SCL+  C   KS   + L+CS+E+C+
Sbjct  285   --------------------AGGCWYVLTIQRIVSCLQDECKKNKSCNLISLACSKEMCF  324

Query  1241  ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
              L  P     N  A N T++       CL  NG F +GIYK ALPV+SS S+AVKILYPI
Sbjct  325   HL--PWSSNTNGLACNMTSSGQQDVSTCLSGNGSFAYGIYKGALPVISSNSLAVKILYPI  382

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGNDLEPTSN LEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQL
Sbjct  383   FWGLMTLSTFGNDLEPTSNGLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQL  442

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             R RDMEWWM+RRQL   LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+
Sbjct  443   RFRDMEWWMRRRQLSCRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLE  502

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI++G+++S+Q L+K
Sbjct  503   LVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRSTQPLTK  562

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
              VVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LRFIT+H
Sbjct  563   DVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRFITEH  622

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPEN----ADDGDR  2308
             FRYKFANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT     T         DDGDR
Sbjct  623   FRYKFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTADATTTAALLAGGPGDDGDR  682

Query  2309  RLRQYAAMFLSIRPHDHLE  2365
             RLR YAAMF+S+RPHDHLE
Sbjct  683   RLRHYAAMFMSLRPHDHLE  701



>gb|KHM98806.1| Cyclic nucleotide-gated ion channel 2 [Glycine soja]
Length=539

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/536 (82%), Positives = 495/536 (92%), Gaps = 4/536 (1%)
 Frame = +2

Query  758   FRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIR  937
              RLAYVSRESLVVGCGKLVWDAR +ASHY+RSLKGFWFDAFVILP+PQ VFWL+VPKL+R
Sbjct  8     LRLAYVSRESLVVGCGKLVWDARDIASHYLRSLKGFWFDAFVILPVPQVVFWLIVPKLLR  67

Query  938   EEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASH  1117
             EE++K+IMTI+LLIFLFQFLP++YHSI +MRRMQKVTGYIFGTIWWGF LNLIAYFIASH
Sbjct  68    EEKIKIIMTIMLLIFLFQFLPKVYHSICMMRRMQKVTGYIFGTIWWGFGLNLIAYFIASH  127

Query  1118  VAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTA  1297
             VAGGCWYVLAIQRVASCLRQ+C  + + CNL +SCSEE+CY+ LLP     +SC GNST 
Sbjct  128   VAGGCWYVLAIQRVASCLRQQCE-RTNGCNLSVSCSEEICYQSLLPASAIADSCGGNST-  185

Query  1298  AALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSN  1477
               ++RKPLCLDV GPF++GIY+WALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSN
Sbjct  186   --VVRKPLCLDVQGPFKYGIYQWALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSN  243

Query  1478  WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLR  1657
             WLEVIFSICIVLSGL+LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQLPS LR
Sbjct  244   WLEVIFSICIVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLR  303

Query  1658  QRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNI  1837
             QRVR+FERQRWAAMGGEDEME+IKDLPEGLRRDIKR LCLDLI+KVPLFH++DDLILDNI
Sbjct  304   QRVRHFERQRWAAMGGEDEMEMIKDLPEGLRRDIKRHLCLDLIRKVPLFHNMDDLILDNI  363

Query  1838  CDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELL  2017
             CDR+KPLVFSKDEKIIREGDPV R+VF+VRGR+K +Q+LSKG+VA+SIL+PGGFLGDELL
Sbjct  364   CDRVKPLVFSKDEKIIREGDPVPRMVFVVRGRIKRNQSLSKGMVASSILDPGGFLGDELL  423

Query  2018  SWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSA  2197
             SWCLRRPFIDRLPASSATF C++S EAFGLDAN+LR+ITDHFRYKFANERLKRTARYYS+
Sbjct  424   SWCLRRPFIDRLPASSATFVCLESAEAFGLDANNLRYITDHFRYKFANERLKRTARYYSS  483

Query  2198  NWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             NWRTWAAVN+Q AWRRYR RT+G    V +     +RRL QYAA+F+S+RPHDHLE
Sbjct  484   NWRTWAAVNIQFAWRRYRQRTKGPVIPVRDTNGGTERRLLQYAALFMSLRPHDHLE  539



>emb|CDP02280.1| unnamed protein product [Coffea canephora]
Length=717

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/720 (63%), Positives = 540/720 (75%), Gaps = 39/720 (5%)
 Frame = +2

Query  266   LSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEA  445
             L  W     +R  + P +SD   D++       CYACTQVGVPVFHST+CD  HQPEWEA
Sbjct  10    LCLWIAKQFQR--LNPCSSDLEADDS--IYPYACYACTQVGVPVFHSTTCDPDHQPEWEA  65

Query  446   SAGSSLIPIKNRPGSVTHRSTQDFHRSGPF-GRVLDPRSKRVQRWNRAFLLARGMALAID  622
             SAGSSL+PI  R      R+  +    G   GRVLDPRS RVQRWNR  LLAR +ALA+D
Sbjct  66    SAGSSLLPINCRKS----RTGDNPSPPGLLPGRVLDPRSARVQRWNRIILLARAVALAVD  121

Query  623   PLFFYALSIGRSG-------TPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSR  781
             PLFF+A+SI   G        PC+Y D G+A IV+ +RTC+D VH CH WLQFRLAYVS+
Sbjct  122   PLFFFAMSIRVRGGGGAADNQPCIYRDRGVATIVSAIRTCVDLVHTCHFWLQFRLAYVSK  181

Query  782   ESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlim  961
             ESLVVGCGKLVWD RA+AS Y+ S  GFW D FV+LPIPQAV+ LVVPKL+  ++++L +
Sbjct  182   ESLVVGCGKLVWDPRAIASRYLMSPAGFWLDVFVMLPIPQAVYLLVVPKLLEADRIRLTL  241

Query  962   tillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYV  1141
             +IL +IFL QFLP++YHS  LMRRM+KVTGYIFGTIWWGF LNLIAYF+ASHV+GG WY+
Sbjct  242   SILPIIFLMQFLPKVYHSFSLMRRMRKVTGYIFGTIWWGFGLNLIAYFLASHVSGGYWYI  301

Query  1142  LAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCA-GNSTAAALMRKP  1318
             LAIQR+ASCL Q+C   K++CN +LSC+ EVCY          ++CA GNST A    KP
Sbjct  302   LAIQRIASCLAQQCDRSKASCNKKLSCAMEVCY------WASRSTCAVGNSTTA---HKP  352

Query  1319  LCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTL-----------STFGNDLE  1465
             LCLD  GPF +G+YK+ALP+ S  S   KILY   WGLM L           ST GN+LE
Sbjct  353   LCLDDAGPFHYGLYKFALPLFSKNSAMTKILYSNLWGLMALRLKLIFGLLLYSTMGNNLE  412

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
             PT   LEVIF+I +VL GLMLFTLLI NIQVFLHA+M ++++MQLR R +EWWM+ RQLP
Sbjct  413   PTCRCLEVIFTIFMVLGGLMLFTLLIANIQVFLHAIMVRRKEMQLRYRGIEWWMRHRQLP  472

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
             SNL+ RVR +E QRW   GG+DEME I+DLPEGLRRDIK +LCL LIKKVPL  SLDDLI
Sbjct  473   SNLKCRVRRYENQRWKLAGGQDEMEFIRDLPEGLRRDIKHYLCLGLIKKVPLLCSLDDLI  532

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLG  2005
             LDNICDR+KPLV+SKDEKIIREGDPVQR++FI  GR++ SQ+L +G VA S+LE G FLG
Sbjct  533   LDNICDRVKPLVYSKDEKIIREGDPVQRMIFIADGRIRRSQSLGEGAVANSMLEAGSFLG  592

Query  2006  DELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTAR  2185
             DELLSWCLRRP  DRLPASSATFTCI+  EA+ LDA+  R+IT+HFR+ FAN+ LK+TAR
Sbjct  593   DELLSWCLRRPVADRLPASSATFTCIEPAEAYALDADDFRYITNHFRFHFANKNLKQTAR  652

Query  2186  YYSANWRTWAAVNVQLAWRRYRLRTRGQPN--TVPENADDGDRRLRQYAAMFLSIRPHDH  2359
             YYS+NWRTWAAVN+Q+AWR Y+ R RG  N   +    +D  RRLRQ AA F+S+RPHDH
Sbjct  653   YYSSNWRTWAAVNIQIAWRHYKTRARGSTNQLMLENGGNDSRRRLRQCAAFFMSLRPHDH  712



>ref|XP_011085714.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Sesamum indicum]
Length=688

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/707 (64%), Positives = 547/707 (77%), Gaps = 34/707 (5%)
 Frame = +2

Query  263   SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWE  442
             ++S+  G + R       +SDD + E P    T+CYACTQVGVPVFHST+CD  H+PEWE
Sbjct  10    AMSKLIGKLFR-------SSDDDFTEYP----TDCYACTQVGVPVFHSTTCDPVHKPEWE  58

Query  443   ASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAID  622
             ASAGSSL+PI       T RS+++   +     ++DPRS  VQRWNR  +LARG+ALA D
Sbjct  59    ASAGSSLVPI-------TSRSSRNSSAAKNRRLIVDPRSTNVQRWNRLIVLARGVALATD  111

Query  623   PLFFYALSIGRSGT----PCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESL  790
             PL+F+++S+   G     P +YMDGG+A + TV+RTC+D VH+CHL ++FRLAYVSRESL
Sbjct  112   PLYFFSISVSGGGGGGGRPFIYMDGGMATLATVVRTCVDLVHMCHLLVRFRLAYVSRESL  171

Query  791   VVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtil  970
             VVGCGKLV D RA+ASHY+ S  GFWFD FV+LPIPQA +WL+VP L+RE +++ +  IL
Sbjct  172   VVGCGKLVRDPRAIASHYLLSANGFWFDVFVVLPIPQATYWLLVPMLLRENRIEELTIIL  231

Query  971   lliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAI  1150
              L FL QFLP++YH   LMR M+KVTGYIFG+IWWGFCLNLIAYF+AS+ +GG WY+LA+
Sbjct  232   QLTFLVQFLPKVYHCYCLMRGMRKVTGYIFGSIWWGFCLNLIAYFLASNASGGYWYILAV  291

Query  1151  QRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLD  1330
             +R+ASCL Q C     +CNL LSCS E C           N    NS   A  +  +CLD
Sbjct  292   RRIASCLTQNC--DTRSCNLPLSCSMEACRP------TSTNPHGNNSLIVA--KTQMCLD  341

Query  1331  VNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIV  1510
               GPF +GIY++ALP++S+ S   KILY   WGLM LST GN+LEPTS  LEV+FSIC+V
Sbjct  342   SLGPFPYGIYQFALPLMSTDSFTAKILYSNLWGLMALSTMGNNLEPTSQCLEVLFSICMV  401

Query  1511  LSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRW  1690
             L+GL+LFTLLIGNIQVFLHAVM ++RKMQLR RDMEWWMK RQLPS LR+RVR +E Q W
Sbjct  402   LAGLLLFTLLIGNIQVFLHAVMMRRRKMQLRYRDMEWWMKHRQLPSQLRRRVRKYEHQIW  461

Query  1691  AAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSK  1870
               MGG+DEMELIKDLP GLRR+IKR++CLDLIKKVPLFH+LDDL+LDNICDR+KPL++SK
Sbjct  462   EMMGGQDEMELIKDLPSGLRREIKRYICLDLIKKVPLFHNLDDLVLDNICDRVKPLLYSK  521

Query  1871  DEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDR  2050
             DEKIIREGDPVQR+VFIV GRV  SQ L +G VATSILE G FLGDEL+SWCLRRPF+DR
Sbjct  522   DEKIIREGDPVQRMVFIVCGRVSRSQGLIRGKVATSILEAGSFLGDELISWCLRRPFLDR  581

Query  2051  LPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQ  2230
             LPASSATFTC    EAF L+A+ LR+ITD+FRY FANE LK TARYYS+NWRTWAAVN+Q
Sbjct  582   LPASSATFTCTQPAEAFALEADDLRYITDNFRYHFANEGLKWTARYYSSNWRTWAAVNIQ  641

Query  2231  LAWRRYRLRTR-GQPNTVPEN-ADDGDRRLRQYAAMFLSIRPHDHLE  2365
             LAWR Y  RTR G  + V EN   D DRRLR+YAAMFLS+RPHDHLE
Sbjct  642   LAWRHYARRTRSGVVDRVSENGGGDSDRRLRKYAAMFLSLRPHDHLE  688



>ref|XP_011085717.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Sesamum indicum]
Length=686

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/689 (66%), Positives = 540/689 (78%), Gaps = 27/689 (4%)
 Frame = +2

Query  317   NSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVT  496
             +SDD + E P    T+CYACTQVGVPVFHST+CD  H+PEWEASAGSSL+PI       T
Sbjct  19    SSDDDFTEYP----TDCYACTQVGVPVFHSTTCDPVHKPEWEASAGSSLVPI-------T  67

Query  497   HRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGT----  664
              RS+++   +     ++DPRS  VQRWNR  +LARG+ALA DPL+F+++S+   G     
Sbjct  68    SRSSRNSSAAKNRRLIVDPRSTNVQRWNRLIVLARGVALATDPLYFFSISVSGGGGGGGR  127

Query  665   PCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHY  844
             P +YMDGG+A + TV+RTC+D VH+CHL ++FRLAYVSRESLVVGCGKLV D RA+ASHY
Sbjct  128   PFIYMDGGMATLATVVRTCVDLVHMCHLLVRFRLAYVSRESLVVGCGKLVRDPRAIASHY  187

Query  845   VRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYL  1024
             + S  GFWFD FV+LPIPQA +WL+VP L+RE +++ +  IL L FL QFLP++YH   L
Sbjct  188   LLSANGFWFDVFVVLPIPQATYWLLVPMLLRENRIEELTIILQLTFLVQFLPKVYHCYCL  247

Query  1025  MRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC  1204
             MR M+KVTGYIFG+IWWGFCLNLIAYF+AS+ +GG WY+LA++R+ASCL Q C     +C
Sbjct  248   MRGMRKVTGYIFGSIWWGFCLNLIAYFLASNASGGYWYILAVRRIASCLTQNC--DTRSC  305

Query  1205  NLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVS  1384
             NL LSCS E C           N    NS   A  +  +CLD  GPF +GIY++ALP++S
Sbjct  306   NLPLSCSMEACRP------TSTNPHGNNSLIVA--KTQMCLDSLGPFPYGIYQFALPLMS  357

Query  1385  SRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFL  1564
             + S   KILY   WGLM LST GN+LEPTS  LEV+FSIC+VL+GL+LFTLLIGNIQVFL
Sbjct  358   TDSFTAKILYSNLWGLMALSTMGNNLEPTSQCLEVLFSICMVLAGLLLFTLLIGNIQVFL  417

Query  1565  HAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEG  1744
             HAVM ++RKMQLR RDMEWWMK RQLPS LR+RVR +E Q W  MGG+DEMELIKDLP G
Sbjct  418   HAVMMRRRKMQLRYRDMEWWMKHRQLPSQLRRRVRKYEHQIWEMMGGQDEMELIKDLPSG  477

Query  1745  LRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIV  1924
             LRR+IKR++CLDLIKKVPLFH+LDDL+LDNICDR+KPL++SKDEKIIREGDPVQR+VFIV
Sbjct  478   LRREIKRYICLDLIKKVPLFHNLDDLVLDNICDRVKPLLYSKDEKIIREGDPVQRMVFIV  537

Query  1925  RGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFG  2104
              GRV  SQ L +G VATSILE G FLGDEL+SWCLRRPF+DRLPASSATFTC    EAF 
Sbjct  538   CGRVSRSQGLIRGKVATSILEAGSFLGDELISWCLRRPFLDRLPASSATFTCTQPAEAFA  597

Query  2105  LDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR-GQPNTV  2281
             L+A+ LR+ITD+FRY FANE LK TARYYS+NWRTWAAVN+QLAWR Y  RTR G  + V
Sbjct  598   LEADDLRYITDNFRYHFANEGLKWTARYYSSNWRTWAAVNIQLAWRHYARRTRSGVVDRV  657

Query  2282  PEN-ADDGDRRLRQYAAMFLSIRPHDHLE  2365
              EN   D DRRLR+YAAMFLS+RPHDHLE
Sbjct  658   SENGGGDSDRRLRKYAAMFLSLRPHDHLE  686



>gb|AAY58313.1| cyclic nucleotide-gated ion channel 2 [Hordeum vulgare subsp. 
vulgare]
Length=605

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/604 (71%), Positives = 500/604 (83%), Gaps = 12/604 (2%)
 Frame = +2

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LL R  ALA+DPLFFYALSIGR+G PC+YMD GLAA VT LRT  D  H+ H+ +QFRLA
Sbjct  2     LLGRAAALAVDPLFFYALSIGRAGRPCMYMDAGLAAAVTALRTAADVAHLAHVLVQFRLA  61

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWD RA+A+HY RSLKG  FD FVILPIPQ +FWLV+PKLIREEQV
Sbjct  62    YVSRESLVVGCGKLVWDPRAIAAHYARSLKGLCFDLFVILPIPQIIFWLVIPKLIREEQV  121

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             KLIMTILLLIF+ QFLP++YHSIY+MR+MQKVTGYIFGT+WWGF LNL AYFIASH+AGG
Sbjct  122   KLIMTILLLIFVLQFLPKVYHSIYIMRKMQKVTGYIFGTVWWGFGLNLFAYFIASHIAGG  181

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             CWYVLAIQRVASCL+  C    +   + L+CS+E+C+       +   +C  N T+ +  
Sbjct  182   CWYVLAIQRVASCLQSECEINNNCNLMSLACSKEMCFHFPWSSDMTALACDTNLTSFSQQ  241

Query  1310  RKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLS-------TFGNDLEP  1468
               P CL  NG F +GIYK ALPV+SS S+AVKILYPIFWGLMTLS       TFGNDLEP
Sbjct  242   NVPACLSGNGAFAYGIYKGALPVISSNSLAVKILYPIFWGLMTLSLYESIGSTFGNDLEP  301

Query  1469  TSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPS  1648
             TSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDMEWWM+RRQLPS
Sbjct  302   TSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEWWMRRRQLPS  361

Query  1649  NLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLIL  1828
              LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VPLFH +D+LIL
Sbjct  362   RLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPLFHGMDELIL  421

Query  1829  DNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGD  2008
             DNICDR++PLVF   EK+IREGDPVQR+VF+++G+++S+Q L+KGVVA  +L  G FLGD
Sbjct  422   DNICDRLRPLVFCGGEKVIREGDPVQRMVFVLQGKLRSTQPLTKGVVAECVLGAGSFLGD  481

Query  2009  ELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARY  2188
             ELLSWCLRRPF+DRLPASSATF C+++ +AF LDA  LR+IT+HFRYKFAN++LKRTARY
Sbjct  482   ELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLRYITEHFRYKFANDKLKRTARY  541

Query  2189  YSANWRTWAAVNVQLAWRRYRLRTRGQP-----NTVPENADDGDRRLRQYAAMFLSIRPH  2353
             YS+NWRTWAAVNVQLAWRRYR R                 +DGDRRLR YAAMF+S+RPH
Sbjct  542   YSSNWRTWAAVNVQLAWRRYRARMMATAVLPPPPAGAAGPEDGDRRLRHYAAMFMSLRPH  601

Query  2354  DHLE  2365
             DHLE
Sbjct  602   DHLE  605



>ref|XP_006373346.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
 gb|ERP51143.1| hypothetical protein POPTR_0017s12550g [Populus trichocarpa]
Length=534

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/532 (79%), Positives = 461/532 (87%), Gaps = 15/532 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQP--DNSDDTY--------DENPNFISTECYACTQV  385
             MPS P  HFSL RW G +  + S     DNSD++         D NP   S ECYACTQV
Sbjct  1     MPSQPNSHFSLPRWIGLLCHKNSQSETGDNSDNSNLNSTNNIDDSNPISNSIECYACTQV  60

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHR--SGPFGRVLDPRS  559
             GVPVFHSTSCD AHQPEWEASAGSSL+PIKNR GS    + +   R  +GP G VLDPRS
Sbjct  61    GVPVFHSTSCDQAHQPEWEASAGSSLVPIKNRLGSRKSPANRAQSRRPAGPLGTVLDPRS  120

Query  560   KRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHI  739
             KRVQ+WNRAFLLARGMALA+DPLFFYALSIGR+G PCLYMDGGLAAIVTVLRT +DA+H+
Sbjct  121   KRVQKWNRAFLLARGMALAVDPLFFYALSIGRNGAPCLYMDGGLAAIVTVLRTSVDAIHL  180

Query  740   CHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLV  919
             CHLWLQFRLAYVSRESLVVGCG LVWDARA+ASHYVRSLKGFWFDAFVILP+PQAVFWL+
Sbjct  181   CHLWLQFRLAYVSRESLVVGCGNLVWDARAIASHYVRSLKGFWFDAFVILPVPQAVFWLL  240

Query  920   VPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIA  1099
             VPKLIREEQ+KLIMTILLLIFLFQFLP++YH I LM+RMQKVTGYIFGTIWWGF LNLIA
Sbjct  241   VPKLIREEQIKLIMTILLLIFLFQFLPKVYHCICLMKRMQKVTGYIFGTIWWGFGLNLIA  300

Query  1100  YFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSC  1279
             YFIASHVAGGCWYVLAIQRVASCL+Q C   +  C+L L+CSEEVCY+ LL  G  GN C
Sbjct  301   YFIASHVAGGCWYVLAIQRVASCLKQSCE-SRPNCDLSLACSEEVCYQFLLRAGTIGNPC  359

Query  1280  AGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGND  1459
              GN+T    +RKP+CLDVNG F +GIYKWALPV+SS S++VKILYPIFWGLMTLSTFGND
Sbjct  360   VGNTTHT--VRKPMCLDVNGAFNYGIYKWALPVISSNSLSVKILYPIFWGLMTLSTFGND  417

Query  1460  LEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQ  1639
             LEPTS+WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWM+RRQ
Sbjct  418   LEPTSHWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMRRRQ  477

Query  1640  LPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             LPS LRQRVR++ERQRWA MGGEDE+ELIKDLPEGLRRDIKR+LCLDLIKKV
Sbjct  478   LPSRLRQRVRHYERQRWATMGGEDEIELIKDLPEGLRRDIKRYLCLDLIKKV  529



>ref|XP_009370501.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Pyrus 
x bretschneideri]
Length=684

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/700 (61%), Positives = 534/700 (76%), Gaps = 31/700 (4%)
 Frame = +2

Query  296   RKSVQP-DNSD----DTYD-ENPNFISTECYACTQVGVPVFHSTSCDNAHQP--EWEASA  451
             R ++ P DNS+    + YD ++  F S ECYACTQVGVPVFHST CD  HQP  +WE SA
Sbjct  6     RWNINPNDNSNGGITEAYDNDDAIFNSKECYACTQVGVPVFHSTRCDPIHQPHLQWERSA  65

Query  452   GSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLF  631
             GSS+     R  + T  +      +G     +DPRS+ V+RWNRA L+ARGM++A+DPLF
Sbjct  66    GSSM----TRVHTPTTLNCGPHDLTGT--HAIDPRSQNVKRWNRAVLMARGMSVAVDPLF  119

Query  632   FYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKL  811
             FY +++ + G PC YMD  LA +VT++RTCLDA+H+ H+ LQF+LAYVS ES+V+GCGKL
Sbjct  120   FYVIALSQRGGPCFYMDVALALVVTLVRTCLDALHLAHILLQFKLAYVSSESMVIGCGKL  179

Query  812   VWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfq  991
             VWD+  +A HY+RSLKGFW DAFVILPIPQAV WL+VPKL  +EQ +LIMT LLL F FQ
Sbjct  180   VWDSGQIACHYMRSLKGFWLDAFVILPIPQAVIWLIVPKLFIQEQTRLIMTTLLLTFSFQ  239

Query  992   flPRIYHSIYLMRRMQKVTGYIF--GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVAS  1165
             F+ ++YHS+YL +R+++VTGYIF  G IWW F LN IAY  A+H+ GGCWYVLA QRV S
Sbjct  240   FIFKLYHSVYLAKRLKRVTGYIFAYGNIWWRFKLNFIAYLTAAHIVGGCWYVLATQRVMS  299

Query  1166  CLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPF  1345
             C +Q+C  +   CNL + CS+E+           G    GN+       K LCLD + PF
Sbjct  300   CFQQQCD-RSINCNLSIYCSKEIF--------SNGKFSGGNAFTKI---KTLCLDKDTPF  347

Query  1346  RFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLM  1525
             ++GIY+  L V +  ++AV+ILYPI+WGL+ L +F N+L PTS+W E+IFS  + L+GL 
Sbjct  348   KYGIYQPLLDVYAGNTLAVRILYPIYWGLINLGSFANNLTPTSDWRELIFSCLLTLTGLG  407

Query  1526  LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGG  1705
             LF  LIGNIQ+FLH VMA K+KMQL+ RDMEWWM+RRQLPS+LR+R RYF+R  WAAM G
Sbjct  408   LFITLIGNIQIFLHMVMANKKKMQLKYRDMEWWMQRRQLPSHLRKRARYFQRHSWAAMQG  467

Query  1706  EDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKII  1885
             +DE+ELI+  P+GLRRDIKR+LCLDL+KKVPLFH LDD+ILDNICD ++P V+SK EK+I
Sbjct  468   QDELELIQHFPDGLRRDIKRYLCLDLVKKVPLFHKLDDVILDNICDLVRPTVYSKGEKVI  527

Query  1886  REGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASS  2065
             REGDPVQR++FIV GR+K SQ LSKG +ATS+LEPG F GDELLSWCLRRPF+ RLP SS
Sbjct  528   REGDPVQRMMFIVHGRIKRSQGLSKGFLATSVLEPGSFFGDELLSWCLRRPFLGRLPPSS  587

Query  2066  ATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRR  2245
             ATFTC++  EAFGLDA+ LR+ITDHFRYKF NE L+ TAR+YS+NWRTWAAV +QLAWRR
Sbjct  588   ATFTCLEPMEAFGLDADCLRYITDHFRYKFLNEELRWTARFYSSNWRTWAAVIIQLAWRR  647

Query  2246  YRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             +R+RT+G    V +N D  + RLR YAA FLS++PHDHLE
Sbjct  648   HRMRTKGL--VVVQNGDI-ENRLRHYAAFFLSLKPHDHLE  684



>ref|XP_009372825.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Pyrus 
x bretschneideri]
Length=684

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/685 (61%), Positives = 524/685 (76%), Gaps = 26/685 (4%)
 Frame = +2

Query  326   DTYD-ENPNFISTECYACTQVGVPVFHSTSCDNAHQP--EWEASAGSSLIPIKNRPGSVT  496
             + YD ++  F S ECYACTQVGVPVFHST CD  HQP  +WE SAGSS+     R  + T
Sbjct  21    EAYDNDDAIFNSKECYACTQVGVPVFHSTRCDPIHQPHLQWERSAGSSM----TRVHTPT  76

Query  497   HRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLY  676
               +      +G     +DPRS+ V+RWNRA L+ARGM++A+DPLFFY +++ + G PC Y
Sbjct  77    TLNCGPHDLTGT--HAIDPRSQNVKRWNRAVLMARGMSVAVDPLFFYVIALSQRGGPCFY  134

Query  677   MDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSL  856
             MD  LA  VT++RTCLDA+H+ H+ LQF+LAYVS ES+V+GCGKLVWD+  +A HY+RSL
Sbjct  135   MDVALALFVTLVRTCLDALHLAHILLQFKLAYVSSESMVIGCGKLVWDSGEIACHYMRSL  194

Query  857   KGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRM  1036
             KGFW DAFVILPIPQAV WL+VPKL  +EQ +LIMT LLL F FQF+P++YH +YL +R+
Sbjct  195   KGFWLDAFVILPIPQAVIWLIVPKLFIQEQTRLIMTTLLLTFSFQFIPKLYHCVYLAKRL  254

Query  1037  QKVTGYIF--GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL  1210
             ++VTGYIF  G IWW F LN IAY  A+H+ GGCWYVLA QRV SC +Q+C  +   CNL
Sbjct  255   KRVTGYIFAYGNIWWRFKLNFIAYLTAAHIVGGCWYVLATQRVMSCFQQQCD-RSINCNL  313

Query  1211  RLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSR  1390
              + CS+E+           G    GN+       K LCLD + PF++GIY+  L V +  
Sbjct  314   SIYCSKEIF--------SNGKFSGGNAFTKI---KTLCLDKDTPFKYGIYQPLLDVYAGN  362

Query  1391  SIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHA  1570
             ++AV+ILYPI+WGL+ L +F N+L PTS+W E+IFS  + L+GL LF  LIGNIQ+FLH 
Sbjct  363   TLAVRILYPIYWGLINLGSFANNLTPTSDWRELIFSCLLTLTGLGLFITLIGNIQIFLHM  422

Query  1571  VMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLR  1750
             VMA K+KMQL+ RDMEWWM+RRQLPS+LR+R RYF+R  WAAM G+DE+ELI+  P+GLR
Sbjct  423   VMANKKKMQLKYRDMEWWMQRRQLPSHLRKRARYFQRHSWAAMQGQDELELIQHFPDGLR  482

Query  1751  RDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRG  1930
             RDIKR+LCLDL+KKVPLFH LDD+ILDNICD ++P V+SK EK+IREGDPVQR++FIV G
Sbjct  483   RDIKRYLCLDLVKKVPLFHKLDDVILDNICDLVRPTVYSKGEKVIREGDPVQRMMFIVHG  542

Query  1931  RVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLD  2110
             R+K SQ LSKG +ATS+LEPG F GDELLSWCLRRPF+ RLP SSATFTC++  EAFGLD
Sbjct  543   RIKRSQGLSKGFLATSVLEPGSFFGDELLSWCLRRPFLGRLPPSSATFTCLEPMEAFGLD  602

Query  2111  ANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPEN  2290
             A+ L +ITDHFRYKF NE L+ TAR+YS+NWRTWAAV +QLAWRR+R+RT+G    V +N
Sbjct  603   ADCLHYITDHFRYKFLNEELRWTARFYSSNWRTWAAVIIQLAWRRHRMRTKGL--VVVQN  660

Query  2291  ADDGDRRLRQYAAMFLSIRPHDHLE  2365
              D  + RLR YAA FLS++PHDHLE
Sbjct  661   GDI-ENRLRHYAAFFLSLKPHDHLE  684



>ref|XP_006482704.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006482705.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Citrus sinensis]
Length=670

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/676 (65%), Positives = 522/676 (77%), Gaps = 46/676 (7%)
 Frame = +2

Query  365   CYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRV  544
             C ACT    P F S+     HQP    SA  S +P ++RP   T              R+
Sbjct  32    CNACTTQ--PGFSSSHAH--HQP----SAAGSPLP-QSRPDYQTR------------TRI  70

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSI----GRSGTPCLYMDGGLAAIVTVL  712
             LDPR   VQ+ NR  LLARG+ALA+DPLFFY  S+    GR G PC+YMD  LA IVTV+
Sbjct  71    LDPRCDFVQKLNRVLLLARGIALAVDPLFFYVFSLYVAPGRGGAPCVYMDAELALIVTVI  130

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILP  892
             RTC+D VH+ HLWLQFRLAYVSRESLVVGCGKLVWDARA+A HYV S   FW D FVILP
Sbjct  131   RTCVDVVHLWHLWLQFRLAYVSRESLVVGCGKLVWDARAIARHYVISPTKFWLDVFVILP  190

Query  893   IPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIW  1072
             IPQAV WLVVPKLI+E+++KLIMTIL+L+ LFQFLP++YHS+ LMRRM+KVTGYIFGT+W
Sbjct  191   IPQAVLWLVVPKLIKEDRMKLIMTILILVILFQFLPKVYHSLCLMRRMRKVTGYIFGTVW  250

Query  1073  WGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLL  1252
             WGFC+NLIAY I SHVAGGCWY LA QR+ SCL+Q+C   KS C+  +SCS+ V ++   
Sbjct  251   WGFCINLIAYLIFSHVAGGCWYALATQRIVSCLQQQCENSKS-CDFPVSCSK-VYHKSEF  308

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
             P              A ++ K  CLD +GP+R+GIY  ALPV+SS S A  ILYPIFWGL
Sbjct  309   P-------------LALMVGKSSCLDDDGPYRYGIYAAALPVISSNSTADTILYPIFWGL  355

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             + LS+FGN+LEPTSN LEV+FSICIVL GL LFTLL+GNIQV L  VMA+++K+QLR RD
Sbjct  356   LNLSSFGNELEPTSNVLEVMFSICIVLCGLTLFTLLVGNIQVSLQVVMARRKKIQLRSRD  415

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWM+RRQL S L+ RVR+FERQRWA MG EDE++ I+DLP+GLRRDIKR+LCLDL+KK
Sbjct  416   MEWWMRRRQLTSGLKWRVRHFERQRWATMG-EDELDWIEDLPQGLRRDIKRYLCLDLVKK  474

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLFH LDDL+LDNICDR+K L++SKDEKIIREG+PV R+VF+VRGR+K SQ+LSKG +A
Sbjct  475   VPLFHCLDDLVLDNICDRVKALIYSKDEKIIREGNPVSRMVFLVRGRIKRSQSLSKGKLA  534

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
             TS+L PGGFLGDELLSWCLRRPF DRLPAS ATFTC++S EA+GL+A+ LR+I DHFRYK
Sbjct  535   TSVLGPGGFLGDELLSWCLRRPFKDRLPASPATFTCMESVEAYGLNASDLRYIADHFRYK  594

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAW----RRYRLRTRGQPNTVPENADDG-DRRLR  2317
              A+ERLKR  RYYS+NWRTWAAVN+Q AW     R R  T    + V  N  +G +RRLR
Sbjct  595   LADERLKRITRYYSSNWRTWAAVNIQFAWRRYRIRIRGGTAENVSHVMGNEIEGIERRLR  654

Query  2318  QYAAMFLSIRPHDHLE  2365
             +YAAMF+SIRPHDHLE
Sbjct  655   RYAAMFMSIRPHDHLE  670



>ref|XP_006482706.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006482707.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X4 [Citrus sinensis]
 gb|KDO72685.1| hypothetical protein CISIN_1g005964mg [Citrus sinensis]
Length=667

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/676 (65%), Positives = 522/676 (77%), Gaps = 46/676 (7%)
 Frame = +2

Query  365   CYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRV  544
             C ACT    P F S+     HQP    SA  S +P ++RP   T              R+
Sbjct  29    CNACTTQ--PGFSSSHAH--HQP----SAAGSPLP-QSRPDYQTR------------TRI  67

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSI----GRSGTPCLYMDGGLAAIVTVL  712
             LDPR   VQ+ NR  LLARG+ALA+DPLFFY  S+    GR G PC+YMD  LA IVTV+
Sbjct  68    LDPRCDFVQKLNRVLLLARGIALAVDPLFFYVFSLYVAPGRGGAPCVYMDAELALIVTVI  127

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILP  892
             RTC+D VH+ HLWLQFRLAYVSRESLVVGCGKLVWDARA+A HYV S   FW D FVILP
Sbjct  128   RTCVDVVHLWHLWLQFRLAYVSRESLVVGCGKLVWDARAIARHYVISPTKFWLDVFVILP  187

Query  893   IPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIW  1072
             IPQAV WLVVPKLI+E+++KLIMTIL+L+ LFQFLP++YHS+ LMRRM+KVTGYIFGT+W
Sbjct  188   IPQAVLWLVVPKLIKEDRMKLIMTILILVILFQFLPKVYHSLCLMRRMRKVTGYIFGTVW  247

Query  1073  WGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLL  1252
             WGFC+NLIAY I SHVAGGCWY LA QR+ SCL+Q+C   KS C+  +SCS+ V ++   
Sbjct  248   WGFCINLIAYLIFSHVAGGCWYALATQRIVSCLQQQCENSKS-CDFPVSCSK-VYHKSEF  305

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
             P              A ++ K  CLD +GP+R+GIY  ALPV+SS S A  ILYPIFWGL
Sbjct  306   P-------------LALMVGKSSCLDDDGPYRYGIYAAALPVISSNSTADTILYPIFWGL  352

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             + LS+FGN+LEPTSN LEV+FSICIVL GL LFTLL+GNIQV L  VMA+++K+QLR RD
Sbjct  353   LNLSSFGNELEPTSNVLEVMFSICIVLCGLTLFTLLVGNIQVSLQVVMARRKKIQLRSRD  412

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWM+RRQL S L+ RVR+FERQRWA MG EDE++ I+DLP+GLRRDIKR+LCLDL+KK
Sbjct  413   MEWWMRRRQLTSGLKWRVRHFERQRWATMG-EDELDWIEDLPQGLRRDIKRYLCLDLVKK  471

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLFH LDDL+LDNICDR+K L++SKDEKIIREG+PV R+VF+VRGR+K SQ+LSKG +A
Sbjct  472   VPLFHCLDDLVLDNICDRVKALIYSKDEKIIREGNPVSRMVFLVRGRIKRSQSLSKGKLA  531

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
             TS+L PGGFLGDELLSWCLRRPF DRLPAS ATFTC++S EA+GL+A+ LR+I DHFRYK
Sbjct  532   TSVLGPGGFLGDELLSWCLRRPFKDRLPASPATFTCMESVEAYGLNASDLRYIADHFRYK  591

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAW----RRYRLRTRGQPNTVPENADDG-DRRLR  2317
              A+ERLKR  RYYS+NWRTWAAVN+Q AW     R R  T    + V  N  +G +RRLR
Sbjct  592   LADERLKRITRYYSSNWRTWAAVNIQFAWRRYRIRIRGGTAENVSHVMGNEIEGIERRLR  651

Query  2318  QYAAMFLSIRPHDHLE  2365
             +YAAMF+SIRPHDHLE
Sbjct  652   RYAAMFMSIRPHDHLE  667



>ref|XP_006431245.1| hypothetical protein CICLE_v10011242mg [Citrus clementina]
 gb|ESR44485.1| hypothetical protein CICLE_v10011242mg [Citrus clementina]
Length=667

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/676 (65%), Positives = 522/676 (77%), Gaps = 46/676 (7%)
 Frame = +2

Query  365   CYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRV  544
             C ACT    P F S+     HQP    SA  S +P ++RP   T              R+
Sbjct  29    CNACT--SQPGFSSSHAH--HQP----SAAGSPLP-QSRPDYQTR------------TRI  67

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSI----GRSGTPCLYMDGGLAAIVTVL  712
             LDPR   VQ+ NR  LLARG+ALA+DPLFFY  S+    GR G PC+YMD  LA IVTV+
Sbjct  68    LDPRCVFVQKLNRVLLLARGIALAVDPLFFYVFSLYAAPGRGGAPCVYMDTELALIVTVI  127

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILP  892
             RTC+D VH+ HLWLQFRLAYVSRESLVVGCGKLVWDARA+A HYV S   FW D FVILP
Sbjct  128   RTCVDVVHLWHLWLQFRLAYVSRESLVVGCGKLVWDARAIARHYVMSPTKFWLDVFVILP  187

Query  893   IPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIW  1072
             IPQAV WLVVPKLI+E+++KLIMTIL+L+ LFQFLP++YHS+ LMRRM+KVTGYIFGT+W
Sbjct  188   IPQAVLWLVVPKLIKEDRIKLIMTILILVILFQFLPKVYHSLCLMRRMRKVTGYIFGTVW  247

Query  1073  WGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLL  1252
             WGFC+NLIAY I SHVAGGCWY LA QR+ +CL+Q+C   KS C+  +SCS+ V ++   
Sbjct  248   WGFCINLIAYLIFSHVAGGCWYALATQRIVTCLQQQCENSKS-CDFPVSCSK-VYHKSQF  305

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
             P              A ++ K  CLD +GP+R+GIY  ALPV+SS S A  ILYPIFWGL
Sbjct  306   P-------------LALMVGKSSCLDDDGPYRYGIYAAALPVISSNSTADTILYPIFWGL  352

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             + LS+FGN+LEPTSN LEV+FSICIVL GL LFTLL+GNIQV L  VMA+++K+QLR RD
Sbjct  353   LNLSSFGNELEPTSNVLEVMFSICIVLCGLTLFTLLVGNIQVSLQVVMARRKKIQLRSRD  412

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWM+RRQL S L+ RVR+FERQRWA MG EDE++ I+DLP+GLRRDIKR+LCLDL+KK
Sbjct  413   MEWWMRRRQLTSGLKWRVRHFERQRWATMG-EDELDWIEDLPQGLRRDIKRYLCLDLVKK  471

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLFH LDDL+LDNICDR+K L++SKDEKIIREG+PV R+VF+VRGR+K SQ+LSKG +A
Sbjct  472   VPLFHCLDDLVLDNICDRVKALIYSKDEKIIREGNPVSRMVFLVRGRIKRSQSLSKGKLA  531

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
             TS+L PGGFLGDELLSWCLRRPF DRLPAS ATFTC++S EA+GL+A+ LR+I DHFRYK
Sbjct  532   TSVLGPGGFLGDELLSWCLRRPFKDRLPASPATFTCMESVEAYGLNASDLRYIADHFRYK  591

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAW----RRYRLRTRGQPNTVPENADDG-DRRLR  2317
              A+ERLKR  RYYS+NWRTWAAVN+Q AW     R R  T    + V  N  +G +RRLR
Sbjct  592   LADERLKRITRYYSSNWRTWAAVNIQFAWRRYRIRIRGGTAENVSHVMGNEIEGIERRLR  651

Query  2318  QYAAMFLSIRPHDHLE  2365
             +YAAMF+SIRPHDHLE
Sbjct  652   RYAAMFMSIRPHDHLE  667



>ref|XP_010551825.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X1 [Tarenaya hassleriana]
Length=677

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/716 (61%), Positives = 534/716 (75%), Gaps = 45/716 (6%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  415
             M S P + F   R F    R ++  P  S +T    P   S ECYACT+ GVP FHSTSC
Sbjct  1     MTSQPSVFFRWFRVFARKFRWETTAPVKSPET----PVLSSVECYACTRPGVPAFHSTSC  56

Query  416   DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLL  595
             D+    EW ASAGSSL+PI++ P     R+ Q     GPFG VLDPR+KRV++WNR  LL
Sbjct  57    DHPQALEWRASAGSSLVPIQHGPDPKPVRA-QKKRPLGPFGVVLDPRTKRVRKWNRTLLL  115

Query  596   ARGMALAIDPLFFYALSIGRS-GTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAY  772
             ARG+ALA+DP FFY+L + R+ G P LYMD  L  +VTVLR C+DA H+ H+WLQFR AY
Sbjct  116   ARGIALAVDPFFFYSLCVDRTAGPPNLYMDRALLEVVTVLRFCVDAFHLWHVWLQFRSAY  175

Query  773   VSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVK  952
             +SRESLVVG G LVWD RA+A HY RSL GFWFD  VILP PQA+FWL++PKLIREE++K
Sbjct  176   ISRESLVVGNGMLVWDPRAIACHYARSLSGFWFDLLVILPAPQAMFWLIIPKLIREEKIK  235

Query  953   limtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGC  1132
              +M ILLLIFLFQ++P+IYH ++++RR+QK  GYIFGTIW+G  LN I Y+IASHV G C
Sbjct  236   WMMEILLLIFLFQYVPKIYHFMHMIRRIQKAPGYIFGTIWFGLALNFIVYYIASHVIGAC  295

Query  1133  WYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR  1312
             WY LA+QRV SC+RQ+C                        GGV  +SC  +        
Sbjct  296   WYALAVQRVDSCIRQQCI-----------------------GGV-NSSCIED--------  323

Query  1313  KPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI  1492
               +CL+ +GPF +GIY+ ALPV+++ S+A ++L P+ WG + LST GN L P+SN  EVI
Sbjct  324   --VCLNPDGPFLYGIYREALPVITTDSLAFRLLCPMSWGFLILSTVGNVLTPSSNLPEVI  381

Query  1493  FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRY  1672
             F I +++ GL+LFTL++ NIQVFLHAVM KK+K+QLR +D+EWWM RRQLPS LR+RVR 
Sbjct  382   FCILLMVCGLLLFTLMVANIQVFLHAVMVKKKKVQLRSQDLEWWMSRRQLPSRLRRRVRR  441

Query  1673  FERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIK  1852
             FERQR  A+ GE+EM LI+DLP+GLRRDIKR+LC+DLI KVPLF  +++LILDNI DR++
Sbjct  442   FERQRCTALAGEEEMNLIQDLPQGLRRDIKRYLCIDLINKVPLFSGMNELILDNIVDRVR  501

Query  1853  PLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLR  2032
             PL+FSKDEKIIREGDPVQR++FIVRGR K SQN+SKGVVATS LE GG+LGDELLSWCLR
Sbjct  502   PLIFSKDEKIIREGDPVQRMMFIVRGRAKRSQNVSKGVVATSTLESGGYLGDELLSWCLR  561

Query  2033  RPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTW  2212
             +PF+DRLP SSATF C DS EAFGL++N LR+IT HFRY F+NERLKRTARYYS+NWRTW
Sbjct  562   KPFLDRLPPSSATFECTDSVEAFGLESNDLRYITRHFRYDFSNERLKRTARYYSSNWRTW  621

Query  2213  AAVNVQLAWRRYRLRT---RGQPNTV--PENADDGDRRLRQYAAMFLSIRPHDHLE  2365
              A+ +QLAWRRY  RT    G    V  PEN  D DR+L QYAAMF+SIRPHDHL+
Sbjct  622   GAMIIQLAWRRYLKRTGRDSGDRTMVSWPENCGDSDRKLLQYAAMFISIRPHDHLQ  677



>ref|XP_007220842.1| hypothetical protein PRUPE_ppa024719mg [Prunus persica]
 gb|EMJ22041.1| hypothetical protein PRUPE_ppa024719mg [Prunus persica]
Length=728

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/688 (60%), Positives = 530/688 (77%), Gaps = 35/688 (5%)
 Frame = +2

Query  320   SDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPE--WEASAGSSLI--PIKNRPG  487
             SDD   E+P F S ECYACTQVGVPVFHST CD  HQP+  WE +AGSS+    +K RP 
Sbjct  70    SDDL--EDPIFNSKECYACTQVGVPVFHSTRCDPTHQPQLRWERTAGSSMTRTDLKCRP-  126

Query  488   SVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTP  667
                    QD  R     R +DPRS  V+ WNR  L+ARG+++A+DPLFFY +++ + G P
Sbjct  127   -------QDLTRP----RAIDPRSSSVKSWNRIVLMARGLSIAVDPLFFYVMALSQIGAP  175

Query  668   CLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYV  847
             C YMD  LA +VTV+RTCLDA+H+ H+ LQF+LAYVSRES+V+GCGKLVW +R ++ HY+
Sbjct  176   CFYMDVALALVVTVVRTCLDALHVAHILLQFKLAYVSRESMVIGCGKLVWGSRDISLHYM  235

Query  848   RSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLM  1027
             RSL+GFW DAFVILPIPQ + WL+VP+L+REE+ +LIMT LL+ FLFQF+P++YHS+YL 
Sbjct  236   RSLRGFWLDAFVILPIPQTIIWLIVPRLLREEKTRLIMTTLLITFLFQFIPKLYHSVYLA  295

Query  1028  RRMQKVTGYIF--GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
             +R++KVTGYIF  G IWW F LN+IAY  ASH+AGGCW+VLA QRV SCL+Q+C   ++ 
Sbjct  296   KRLKKVTGYIFAYGNIWWRFKLNVIAYLTASHIAGGCWHVLATQRVMSCLQQQCEASRN-  354

Query  1202  CNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVV  1381
             CNL + CS++V     L GG   N+    +T        +CLD +  F +GIYK  L V 
Sbjct  355   CNLSIYCSKQVFSSGKLSGG---NAFTKITT--------MCLDEDTTFGYGIYKPLLVVY  403

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             +  ++AV+ILYPI+WGL+ L +F N+L PTS+WLE+IFS C+ L+GL LF  L+GNIQ+F
Sbjct  404   AGNTLAVRILYPIYWGLINLGSFANNLIPTSDWLELIFSCCVTLAGLGLFITLLGNIQIF  463

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             LH+VM  K+KMQL+ +DME WMKRRQLPS+LR+RVR+F+R  WAAM G +E+ELI+  P+
Sbjct  464   LHSVMENKKKMQLKYQDMECWMKRRQLPSHLRKRVRHFQRCSWAAMQGLEELELIQHFPD  523

Query  1742  GLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFI  1921
             GLRRDIK +LCLDL+K+VPLFH L+D+ILDNICD ++P+++SK EK+IREGDPVQR++FI
Sbjct  524   GLRRDIKGYLCLDLVKQVPLFHKLEDVILDNICDLVRPIIYSKGEKLIREGDPVQRMMFI  583

Query  1922  VRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAF  2101
             VRG +  SQ LSKG  ATS+LEPG F GDELLSWCLRRPF  RLP SSATFTC++S EAF
Sbjct  584   VRGHIIRSQGLSKGFQATSVLEPGSFFGDELLSWCLRRPFSGRLPPSSATFTCMESIEAF  643

Query  2102  GLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTV  2281
             GLDAN L +I DHFRYKF+NERL+RTARYYS+NWRTW AV +QLAW R+R+RT+G    +
Sbjct  644   GLDANCLHYIIDHFRYKFSNERLRRTARYYSSNWRTWGAVIIQLAWHRHRMRTKG---VI  700

Query  2282  PENADDGDRRLRQYAAMFLSIRPHDHLE  2365
                + D   RLR YAA FLS++PHDHL+
Sbjct  701   MVQSGDIANRLRLYAAFFLSLKPHDHLD  728



>ref|XP_008234503.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Prunus 
mume]
Length=684

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/705 (60%), Positives = 539/705 (76%), Gaps = 27/705 (4%)
 Frame = +2

Query  263   SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPE--  436
             SL RW    ++      ++SDD   ++P F S ECYAC QVGVPVFHST CD  HQP+  
Sbjct  3     SLPRWKLNQVKHCCNNINDSDD--QDDPIFNSKECYACNQVGVPVFHSTRCDPTHQPQLR  60

Query  437   WEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALA  616
             WE +AGSS+  ++  P  +  R  QD  R     R +DPRS  V+RWNR  L+ARG+++A
Sbjct  61    WERTAGSSMTLLRI-PTDLKCRP-QDLTRP----RAIDPRSSNVKRWNRIVLMARGLSIA  114

Query  617   IDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVV  796
             +DPLFFY +++ + G PC YMD  LA +VTV+RTCLDA+H+ H+ LQF+LAYVSRES+V+
Sbjct  115   VDPLFFYVMALSQIGAPCFYMDVALALVVTVVRTCLDALHVAHILLQFKLAYVSRESMVI  174

Query  797   GCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtilll  976
             GCGKLVWD+R ++ HY+RSL+GFW DAFVILPIPQ V WL+VP+L+REE+ +LIMT LL+
Sbjct  175   GCGKLVWDSRDISLHYMRSLRGFWLDAFVILPIPQTVIWLIVPRLLREEKTRLIMTTLLV  234

Query  977   iflfqflPRIYHSIYLMRRMQKVTGYIF--GTIWWGFCLNLIAYFIASHVAGGCWYVLAI  1150
              FLFQF+P++YHS+YL +R++KVTGYIF  G IWW F LN+IAY  ASH+AGGCW+VLA 
Sbjct  235   TFLFQFIPKLYHSVYLAKRLKKVTGYIFAYGNIWWRFKLNVIAYLTASHIAGGCWHVLAT  294

Query  1151  QRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLD  1330
             QRV SCL+Q+C   ++  NL + CS++V     L GG   N+    +T        +CLD
Sbjct  295   QRVMSCLQQQCEASRNY-NLSIYCSKQVFSTGKLSGG---NAFTKITT--------MCLD  342

Query  1331  VNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIV  1510
              +  F +GIYK  L V +  ++AV+ILYPI+WGL+ L +F N+L PTS+WLE+IFS C+ 
Sbjct  343   EDTTFGYGIYKPLLVVYAGNTLAVRILYPIYWGLINLGSFANNLIPTSDWLELIFSCCVT  402

Query  1511  LSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRW  1690
             L+GL L   L+GNIQ+FLH+VM  K+KMQL+ RDME WMKRRQLPS+LR+RVR+F+R  W
Sbjct  403   LAGLGLLITLLGNIQIFLHSVMENKKKMQLKYRDMECWMKRRQLPSHLRKRVRHFQRCSW  462

Query  1691  AAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSK  1870
             AAM G DE+ELI+  P+GLRRDIKR+LCLDL+K+VPLFH L+D+ILDNICD ++P+++SK
Sbjct  463   AAMQGLDELELIQHFPDGLRRDIKRYLCLDLVKQVPLFHKLEDVILDNICDLVRPIIYSK  522

Query  1871  DEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDR  2050
              EK+IREGDPVQR++FIVRGR+K SQ LSKG  ATS+LEPG F GDELLSWCLRRPF  R
Sbjct  523   GEKLIREGDPVQRMMFIVRGRIKRSQCLSKGFQATSVLEPGSFFGDELLSWCLRRPFSGR  582

Query  2051  LPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQ  2230
             LP SSATFTC++S EAFGLDAN L +I DHFRYKF+NE L+RTARYYS+NWR W AV +Q
Sbjct  583   LPPSSATFTCMESIEAFGLDANCLHYIIDHFRYKFSNEGLRRTARYYSSNWRAWGAVIIQ  642

Query  2231  LAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             LAW R+R+RT G    +   + D + RLR YAA FLS++PHDHL+
Sbjct  643   LAWHRHRMRTEG---VIMVQSGDIENRLRLYAAFFLSLKPHDHLD  684



>ref|XP_006651833.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Oryza 
brachyantha]
Length=676

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/614 (67%), Positives = 480/614 (78%), Gaps = 45/614 (7%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGR  541
             ECYACTQ GVP FHST+CD  H P+W+A AGSSL+P++    +    S+         GR
Sbjct  61    ECYACTQPGVPAFHSTTCDQVHLPDWDADAGSSLVPVQ----AQAQSSSSAAAHHAAIGR  116

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
                P                                      C+YMD GLAA VT LRTC
Sbjct  117   AGQP--------------------------------------CMYMDAGLAAAVTALRTC  138

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
              D  H+ H+ LQFRLAYVSRESLVVGCGKLVWD RA+A+HY  SLKG WFD FVILP+PQ
Sbjct  139   ADLAHLAHVLLQFRLAYVSRESLVVGCGKLVWDPRAIAAHYALSLKGLWFDLFVILPLPQ  198

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              +FW+++PKLIREEQ+KLIMTILLL+FL QFLP++YHSIY+MR+MQKVTGYIFGTIWWGF
Sbjct  199   VIFWVIIPKLIREEQIKLIMTILLLLFLLQFLPKVYHSIYIMRKMQKVTGYIFGTIWWGF  258

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN-LRLSCSEEVCYELLLPG  1258
              LNL AYFIASH+AGGCWYVLAIQRVASCL++ C   K+TCN + L+CS+E+C+ L    
Sbjct  259   GLNLFAYFIASHIAGGCWYVLAIQRVASCLQEDCKI-KNTCNQISLACSKEMCFHLPWSD  317

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
                G +C  N T+      P CL  NGPF +GIYK ALPV+SS S+AVKILYPIFWGLMT
Sbjct  318   K-NGLACNMNLTSFGQQNIPDCLSGNGPFAYGIYKGALPVISSNSLAVKILYPIFWGLMT  376

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDLEPTSNWLEVIFSI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDME
Sbjct  377   LSTFGNDLEPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDME  436

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS LRQRVR +ER+RWAA+ GE+EME+IKD PEGLRRDIKR+LCL+L+K+VP
Sbjct  437   WWMRRRQLPSRLRQRVRQYERERWAAITGEEEMEMIKDFPEGLRRDIKRYLCLELVKQVP  496

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VF+++G+++S+Q L+KGVVAT 
Sbjct  497   LFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFVLQGKLRSTQPLAKGVVATC  556

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
             +L  G FLGDELLSWCLRRPF+ RLPASSATF CI++ +AF LDA  LRFIT+ FRYKFA
Sbjct  557   VLGAGNFLGDELLSWCLRRPFVARLPASSATFECIETAQAFCLDAPDLRFITEQFRYKFA  616

Query  2159  NERLKRTARYYSAN  2200
             NE+LKRTARYYS+ 
Sbjct  617   NEKLKRTARYYSSK  630



>ref|XP_004309022.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Fragaria 
vesca subsp. vesca]
Length=663

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/690 (58%), Positives = 498/690 (72%), Gaps = 48/690 (7%)
 Frame = +2

Query  317   NSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVT  496
             N DD ++    F S ECYACTQ G+P FHS  C          SAGSSL P         
Sbjct  15    NGDDPFE----FSSPECYACTQAGLPAFHSNRC----------SAGSSLTP---------  51

Query  497   HRSTQDFHRSGPFG-----RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSG  661
                T D   + P G     RV+DPRS  V+RWNR  L+ARG+ALA+DPLF Y +++ RSG
Sbjct  52    ---TTDLKCNPPPGHLSRTRVIDPRSNYVKRWNRLVLMARGVALAVDPLFLYVIALSRSG  108

Query  662   TPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASH  841
              PC YMD  LA  VTV+RTCLDA+H+ H+ LQF+LAYVS ES+ +GCGKLVWD RA+  H
Sbjct  109   -PCFYMDVALATYVTVVRTCLDALHLAHIVLQFKLAYVSSESMGIGCGKLVWDPRAIVWH  167

Query  842   YVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIY  1021
             Y+ S KGFW DAFVILPIPQ V WL+ PKL+R E+   IM  +LL FLFQF P++YH I+
Sbjct  168   YIESFKGFWLDAFVILPIPQIVIWLIEPKLLRGERPTHIMATVLLTFLFQFTPKVYHIIH  227

Query  1022  LMRRMQKVTGYIF--GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK  1195
             L +R++KVTGYIF  G IWW F LN+IAY  A H+ GG WYVLA QRV SC++Q+C   K
Sbjct  228   LAKRLKKVTGYIFSYGNIWWRFKLNVIAYLTACHIVGGIWYVLATQRVMSCIQQQCESNK  287

Query  1196  STCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALP  1375
               CN  L CS E+ + L       GN   GN        K  C D +  F +GIY+  LP
Sbjct  288   K-CNFSLYCSREI-FSL-------GNFPEGNRFPKI---KAWCFDEDTEFGYGIYQPILP  335

Query  1376  VVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQ  1555
             V    + AV+ILYPI+WGL  L +FGN+L P+++ LE+IFS C+ L+G+ LF  L+GNIQ
Sbjct  336   VYIGNTRAVRILYPIYWGLNNLGSFGNNLTPSTDLLELIFSCCLCLTGMGLFVTLLGNIQ  395

Query  1556  VFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDL  1735
             +FLH++MA K+KMQL+ RDMEWWM RRQLP +LR+RVR+F+R  WAAM G DE++LI++ 
Sbjct  396   IFLHSIMANKKKMQLKYRDMEWWMHRRQLPHHLRKRVRHFQRCSWAAMQGLDEIDLIQNF  455

Query  1736  PEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVV  1915
             P+GLRRDIKR LCLDL+ KVPLFH LDD+IL+NICD ++PL++SK EKIIREGDPVQR+V
Sbjct  456   PDGLRRDIKRHLCLDLVMKVPLFHKLDDVILENICDLVRPLIYSKGEKIIREGDPVQRMV  515

Query  1916  FIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTE  2095
             F+VRGRV+  Q L+KG +ATS+LEPG F GDELLSWCLRRPF+ RLP+SSATFT +   E
Sbjct  516   FLVRGRVQRCQGLTKGFLATSVLEPGAFFGDELLSWCLRRPFLGRLPSSSATFTTMGPVE  575

Query  2096  AFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPN  2275
             AFGLDA  LR+I++HFRYK ++E +KRTARYYS+NWR+W AV +QLAWRR+R RT+G  +
Sbjct  576   AFGLDAEFLRYISEHFRYKLSSENIKRTARYYSSNWRSWGAVIIQLAWRRHRERTKG--S  633

Query  2276  TVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             + P    D + RL+ YAAMFLS +P DH +
Sbjct  634   STPMQNWDIESRLKMYAAMFLSFKPQDHTD  663



>ref|XP_006482708.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X5 [Citrus sinensis]
Length=552

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/568 (69%), Positives = 465/568 (82%), Gaps = 21/568 (4%)
 Frame = +2

Query  677   MDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSL  856
             MD  LA IVTV+RTC+D VH+ HLWLQFRLAYVSRESLVVGCGKLVWDARA+A HYV S 
Sbjct  1     MDAELALIVTVIRTCVDVVHLWHLWLQFRLAYVSRESLVVGCGKLVWDARAIARHYVISP  60

Query  857   KGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRM  1036
               FW D FVILPIPQAV WLVVPKLI+E+++KLIMTIL+L+ LFQFLP++YHS+ LMRRM
Sbjct  61    TKFWLDVFVILPIPQAVLWLVVPKLIKEDRMKLIMTILILVILFQFLPKVYHSLCLMRRM  120

Query  1037  QKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL  1216
             +KVTGYIFGT+WWGFC+NLIAY I SHVAGGCWY LA QR+ SCL+Q+C   KS C+  +
Sbjct  121   RKVTGYIFGTVWWGFCINLIAYLIFSHVAGGCWYALATQRIVSCLQQQCENSKS-CDFPV  179

Query  1217  SCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSI  1396
             SCS+ V ++   P              A ++ K  CLD +GP+R+GIY  ALPV+SS S 
Sbjct  180   SCSK-VYHKSEFP-------------LALMVGKSSCLDDDGPYRYGIYAAALPVISSNST  225

Query  1397  AVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVM  1576
             A  ILYPIFWGL+ LS+FGN+LEPTSN LEV+FSICIVL GL LFTLL+GNIQV L  VM
Sbjct  226   ADTILYPIFWGLLNLSSFGNELEPTSNVLEVMFSICIVLCGLTLFTLLVGNIQVSLQVVM  285

Query  1577  AKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRD  1756
             A+++K+QLR RDMEWWM+RRQL S L+ RVR+FERQRWA MG EDE++ I+DLP+GLRRD
Sbjct  286   ARRKKIQLRSRDMEWWMRRRQLTSGLKWRVRHFERQRWATMG-EDELDWIEDLPQGLRRD  344

Query  1757  IKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRV  1936
             IKR+LCLDL+KKVPLFH LDDL+LDNICDR+K L++SKDEKIIREG+PV R+VF+VRGR+
Sbjct  345   IKRYLCLDLVKKVPLFHCLDDLVLDNICDRVKALIYSKDEKIIREGNPVSRMVFLVRGRI  404

Query  1937  KSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDAN  2116
             K SQ+LSKG +ATS+L PGGFLGDELLSWCLRRPF DRLPAS ATFTC++S EA+GL+A+
Sbjct  405   KRSQSLSKGKLATSVLGPGGFLGDELLSWCLRRPFKDRLPASPATFTCMESVEAYGLNAS  464

Query  2117  HLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAW----RRYRLRTRGQPNTVP  2284
              LR+I DHFRYK A+ERLKR  RYYS+NWRTWAAVN+Q AW     R R  T    + V 
Sbjct  465   DLRYIADHFRYKLADERLKRITRYYSSNWRTWAAVNIQFAWRRYRIRIRGGTAENVSHVM  524

Query  2285  ENADDG-DRRLRQYAAMFLSIRPHDHLE  2365
              N  +G +RRLR+YAAMF+SIRPHDHLE
Sbjct  525   GNEIEGIERRLRRYAAMFMSIRPHDHLE  552



>gb|KHN13581.1| Cyclic nucleotide-gated ion channel 2 [Glycine soja]
Length=452

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/456 (82%), Positives = 413/456 (91%), Gaps = 12/456 (3%)
 Frame = +2

Query  1022  LMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
             +MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASCLRQ+C  + + 
Sbjct  1     MMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQRVASCLRQQCE-RTNG  59

Query  1202  CNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVV  1381
             CNL +SCSEE+CY+ LLP    G+SC GNST   ++RKPLCLDV GPF++GIY+WALPV+
Sbjct  60    CNLSVSCSEEICYQSLLPASAIGDSCGGNST---VVRKPLCLDVEGPFKYGIYQWALPVI  116

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             SS S+AVKILYPIFWGLMTLSTFGNDLEPTS+WLEVIFSICIVLSGL+LFTLLIGNIQVF
Sbjct  117   SSNSLAVKILYPIFWGLMTLSTFGNDLEPTSHWLEVIFSICIVLSGLLLFTLLIGNIQVF  176

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             LHAVMAKKRKMQLRCRDMEWWM+RRQLPS LRQRVR+FERQRWAAMGGEDEME+IKDLPE
Sbjct  177   LHAVMAKKRKMQLRCRDMEWWMRRRQLPSRLRQRVRHFERQRWAAMGGEDEMEMIKDLPE  236

Query  1742  GLRRDIKRFLCLDLIKK--------VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGD  1897
             GLRRDIKR LCLDLI+K        VPLFH+LDDLILDNICDR+KPLVFSKDEKIIREGD
Sbjct  237   GLRRDIKRHLCLDLIRKASNVHMKEVPLFHNLDDLILDNICDRVKPLVFSKDEKIIREGD  296

Query  1898  PVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFT  2077
             PV R+VFIVRGR+K +Q+LSKG+VA+SILEPGGFLGDELLSWCLRRPFIDRLPASSATF 
Sbjct  297   PVPRMVFIVRGRIKRNQSLSKGMVASSILEPGGFLGDELLSWCLRRPFIDRLPASSATFV  356

Query  2078  CIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR  2257
             C++S+EAFGLDANHLR+ITDHFRYKFANERLKRTARYYS+NWRTWAAVN+Q AWRRYR R
Sbjct  357   CLESSEAFGLDANHLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYRQR  416

Query  2258  TRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             T+G    V +     +RRL QYAAMF+SIRPHDHLE
Sbjct  417   TKGPVTPVRDTNGGTERRLLQYAAMFMSIRPHDHLE  452



>gb|KHG13041.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
Length=484

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/487 (75%), Positives = 405/487 (83%), Gaps = 43/487 (9%)
 Frame = +2

Query  1025  MRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC  1204
             MRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASCLRQ+C  +   C
Sbjct  1     MRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQRVASCLRQQCA-RNEQC  59

Query  1205  NLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVS  1384
              L LSCSEEVCY+   P    G +C GNST   +M KPLCL+V+GPF +GIY+WALPVVS
Sbjct  60    KLSLSCSEEVCYQFSFPAQAVGKTCGGNSTN--VMGKPLCLEVHGPFNYGIYQWALPVVS  117

Query  1385  SRSIAVKILYPIFWGLMTL----------------------------------------S  1444
             S S+AVKILYPIFWGLM+L                                        +
Sbjct  118   SNSVAVKILYPIFWGLMSLRHLSNSDVVGFMKELNHFLELELGLNLAIVLTLGLELFLSN  177

Query  1445  TFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWW  1624
             TFGNDLEPTS+WLEV+FSICIVL+GLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWW
Sbjct  178   TFGNDLEPTSHWLEVMFSICIVLAGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWW  237

Query  1625  MKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLF  1804
             MKRRQLPS LRQRVR++ERQ+WA +GGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLF
Sbjct  238   MKRRQLPSRLRQRVRHYERQKWATLGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLF  297

Query  1805  HSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSIL  1984
             H+L+DLILDNICDR+KPLVFSKDEKIIREGDPVQR+VF+VRGR+K  Q+LSKGVVATS++
Sbjct  298   HNLNDLILDNICDRVKPLVFSKDEKIIREGDPVQRMVFVVRGRIKRIQSLSKGVVATSLI  357

Query  1985  EPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANE  2164
             EPGGFLGDELLSWCLRRPFIDRLPASSATF C++  EAF LD+NHL++ITDHFRYKFANE
Sbjct  358   EPGGFLGDELLSWCLRRPFIDRLPASSATFVCVEPIEAFSLDSNHLKYITDHFRYKFANE  417

Query  2165  RLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSI  2344
             RLKRTARYYS+NWRTWAAVN+QL WRRYR RTRG   +  EN +  DRRL QYAAMF+SI
Sbjct  418   RLKRTARYYSSNWRTWAAVNIQLGWRRYRTRTRGPMISAAENGNSSDRRLLQYAAMFMSI  477

Query  2345  RPHDHLE  2365
             RPHDHLE
Sbjct  478   RPHDHLE  484



>ref|XP_010551827.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Tarenaya hassleriana]
Length=650

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/716 (58%), Positives = 507/716 (71%), Gaps = 72/716 (10%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  415
             M S P + F   R F    R ++  P  S +T    P   S ECYACT+ GVP FHSTSC
Sbjct  1     MTSQPSVFFRWFRVFARKFRWETTAPVKSPET----PVLSSVECYACTRPGVPAFHSTSC  56

Query  416   DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLL  595
             D+    EW ASAGSSL+PI++ P     R+ Q     GPFG VLDPR+KRV++WNR  LL
Sbjct  57    DHPQALEWRASAGSSLVPIQHGPDPKPVRA-QKKRPLGPFGVVLDPRTKRVRKWNRTLLL  115

Query  596   ARGMALAIDPLFFYALSIGRS-GTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAY  772
             ARG+ALA+DP FFY+L + R+ G P LYMD  L  +VTVLR C+DA H+ H+WLQFR AY
Sbjct  116   ARGIALAVDPFFFYSLCVDRTAGPPNLYMDRALLEVVTVLRFCVDAFHLWHVWLQFRSAY  175

Query  773   VSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVK  952
             +SRESLVVG G LVWD RA+A HY RSL GFWFD  VILP PQA+FWL++PKLIREE++K
Sbjct  176   ISRESLVVGNGMLVWDPRAIACHYARSLSGFWFDLLVILPAPQAMFWLIIPKLIREEKIK  235

Query  953   limtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGC  1132
              +M ILLLIFLFQ++P+IYH ++++RR+QK  GYIFGTIW+G  LN I Y+IASHV G C
Sbjct  236   WMMEILLLIFLFQYVPKIYHFMHMIRRIQKAPGYIFGTIWFGLALNFIVYYIASHVIGAC  295

Query  1133  WYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR  1312
             WY LA+QRV SC+RQ+C        +  SC E+VC                         
Sbjct  296   WYALAVQRVDSCIRQQC-----IGGVNSSCIEDVC-------------------------  325

Query  1313  KPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVI  1492
                 L+ +GPF +GIY+ ALPV+++ S+A ++L P+ WG + LST GN L P+SN  EVI
Sbjct  326   ----LNPDGPFLYGIYREALPVITTDSLAFRLLCPMSWGFLILSTVGNVLTPSSNLPEVI  381

Query  1493  FSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRY  1672
             F I +++ GL+LFTL++ NIQVFLHAVM KK+K+QLR +D+EWWM RRQLPS LR+RVR 
Sbjct  382   FCILLMVCGLLLFTLMVANIQVFLHAVMVKKKKVQLRSQDLEWWMSRRQLPSRLRRRVRR  441

Query  1673  FERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIK  1852
             FERQR  A+ GE+EM LI+DLP+GLRRDIKR+LC+DLI KVPLF  +++LILDNI DR++
Sbjct  442   FERQRCTALAGEEEMNLIQDLPQGLRRDIKRYLCIDLINKVPLFSGMNELILDNIVDRVR  501

Query  1853  PLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLR  2032
             PL+FSKDEKIIREGDPVQR++FIVRGR K SQN+SKGVVATS LE GG+LGDELLSWCLR
Sbjct  502   PLIFSKDEKIIREGDPVQRMMFIVRGRAKRSQNVSKGVVATSTLESGGYLGDELLSWCLR  561

Query  2033  RPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTW  2212
             +PF+DRLP SSATF C DS EAFGL++N L                           RTW
Sbjct  562   KPFLDRLPPSSATFECTDSVEAFGLESNDL---------------------------RTW  594

Query  2213  AAVNVQLAWRRYRLRT---RGQPNTV--PENADDGDRRLRQYAAMFLSIRPHDHLE  2365
              A+ +QLAWRRY  RT    G    V  PEN  D DR+L QYAAMF+SIRPHDHL+
Sbjct  595   GAMIIQLAWRRYLKRTGRDSGDRTMVSWPENCGDSDRKLLQYAAMFISIRPHDHLQ  650



>ref|XP_004156212.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Cucumis 
sativus]
Length=625

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/512 (76%), Positives = 441/512 (86%), Gaps = 7/512 (1%)
 Frame = +2

Query  836   SHYVRSLKGFWFDA--FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIY  1009
             S  V  +K    DA  F  +     V+WLV+PKLIREE++KLIMT++LL+FLFQFLP++Y
Sbjct  119   SQLVSEMKDNRHDAKTFAFILKAMIVYWLVLPKLIREERIKLIMTVILLMFLFQFLPKVY  178

Query  1010  HSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHY  1189
             HSI LMRRMQKVTGYIFGTIWWGF LNLIAYFIASHVAGGCWYVLAIQRVASC++Q C  
Sbjct  179   HSIILMRRMQKVTGYIFGTIWWGFGLNLIAYFIASHVAGGCWYVLAIQRVASCIQQHC--  236

Query  1190  QKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWA  1369
             +++ CNL LSCSEEVCY+ L      G+SC  NSTA    RKPLCLDVNGPF +GIYKWA
Sbjct  237   ERNKCNLSLSCSEEVCYQFLSSDTTIGSSCGRNSTAT--FRKPLCLDVNGPFAYGIYKWA  294

Query  1370  LPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGN  1549
             LPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSNWLEV FSIC VLSGL+LFTLLIGN
Sbjct  295   LPVISSNSVAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVCFSICTVLSGLLLFTLLIGN  354

Query  1550  IQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIK  1729
             IQV LHAVMA++RKMQLRCRD+EWWM+RRQLPS L+ RVR++E QRWAAMGGEDEMELI 
Sbjct  355   IQVLLHAVMARRRKMQLRCRDLEWWMRRRQLPSRLKHRVRHYEHQRWAAMGGEDEMELIN  414

Query  1730  DLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQR  1909
             DLPEGLRRDIKR LC+DLI+KVPLF +L++LILDNICD++KPLVFSKDEKIIREGDPV R
Sbjct  415   DLPEGLRRDIKRHLCVDLIRKVPLFQNLEELILDNICDKVKPLVFSKDEKIIREGDPVPR  474

Query  1910  VVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDS  2089
             ++FIV GRVK SQ+LSKG+ ATS +EPGGFLGDELLSWCLRRPF++RLPASSATF CI+ 
Sbjct  475   MLFIVCGRVKRSQSLSKGMTATSFIEPGGFLGDELLSWCLRRPFLERLPASSATFVCIEP  534

Query  2090  TEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQ  2269
             TEAF L A+HL++ITDHFRYKFANERLKRTAR+YS+NWRTWAAVN+QLAWRRYR R R  
Sbjct  535   TEAFALKADHLKYITDHFRYKFANERLKRTARFYSSNWRTWAAVNIQLAWRRYRKRMRRP  594

Query  2270  PNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
                V EN    +RRL QYAAMF+S RPHDHLE
Sbjct  595   VIAVVENGST-ERRLLQYAAMFMSFRPHDHLE  625



>gb|EPS58125.1| hypothetical protein M569_16691, partial [Genlisea aurea]
Length=482

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/489 (74%), Positives = 414/489 (85%), Gaps = 7/489 (1%)
 Frame = +2

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             QA FWL +P+LI EE++KL +T+LLL+F+FQF+P++YH I LMR MQKVTGY+FGTIWWG
Sbjct  1     QAAFWLAMPRLIGEEEIKLTVTVLLLVFVFQFVPKVYHCICLMRSMQKVTGYLFGTIWWG  60

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
             F LNLIAYFIASHVAGGCWY LAIQRVASCL+Q+C    + CNL LSCS+EV +      
Sbjct  61    FALNLIAYFIASHVAGGCWYGLAIQRVASCLQQQCR-GIAACNLSLSCSDEVRFGFSPQA  119

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
                G+    NST   + R   C DVNGPFR+GIY+ ALP+VS  SIAVKILYPIFWGLMT
Sbjct  120   NSSGDF---NSTVVGIYRSS-CFDVNGPFRYGIYQSALPIVSGDSIAVKILYPIFWGLMT  175

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGNDL PTS WLEV+FSIC VLSG+MLFTLLIGNIQVFLHAV+AK+RKMQ+R RD+E
Sbjct  176   LSTFGNDLAPTSEWLEVMFSICGVLSGMMLFTLLIGNIQVFLHAVLAKRRKMQIRRRDVE  235

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS LR+RVR +ERQRWAA+GG+DEMELIKD P+GLRRDIKRFLCLDLIK+VP
Sbjct  236   WWMRRRQLPSELRRRVRLYERQRWAAIGGDDEMELIKDFPDGLRRDIKRFLCLDLIKQVP  295

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LFHSLDDLILDNICDR+KPL+FSK EKIIREGDPVQR+VFIVRGRVKS + LS+G+V+TS
Sbjct  296   LFHSLDDLILDNICDRVKPLIFSKGEKIIREGDPVQRMVFIVRGRVKSDRTLSRGMVSTS  355

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
              LEPGGF GDELLSWCLRRPF+DRLPASS+TFTC  STEAFGL+A  LR+ITDHFRYKFA
Sbjct  356   QLEPGGFFGDELLSWCLRRPFVDRLPASSSTFTCAKSTEAFGLEAEDLRYITDHFRYKFA  415

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFL  2338
             NERL R ARYYS+NWRTWAAV +Q+AWRR R     +  T     D  +RRLR+YAA F+
Sbjct  416   NERLLRMARYYSSNWRTWAAVKIQMAWRRSREMASYETTTTTMRND--ERRLRKYAAFFM  473

Query  2339  SIRPHDHLE  2365
             SIRPHDHLE
Sbjct  474   SIRPHDHLE  482



>ref|XP_007032657.1| Cyclic nucleotide-regulated ion channel family protein isoform 
3 [Theobroma cacao]
 gb|EOY03583.1| Cyclic nucleotide-regulated ion channel family protein isoform 
3 [Theobroma cacao]
Length=495

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/493 (70%), Positives = 415/493 (84%), Gaps = 10/493 (2%)
 Frame = +2

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             QA FWL+VPKL+R E+ KLIMTILL IFLFQFLP++YHS+ LMRRM+KVTGYIFG++WWG
Sbjct  9     QAAFWLMVPKLLRAERYKLIMTILLSIFLFQFLPKVYHSLCLMRRMRKVTGYIFGSVWWG  68

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
             F +NLIAY IASHVAGGCWYVLA QRV +CL+Q+C  + ++CN   SCS+ VC + L P 
Sbjct  69    FGINLIAYLIASHVAGGCWYVLATQRVVTCLQQQCE-RSASCNPSSSCSKRVCSQYLSPA  127

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
              V  + C G S     M K  C D +GPFR+GIY+ A PV+SS S+AVKILYPIFWGL+ 
Sbjct  128   NVLSSQCGGKSIT---MTKSFCFDPDGPFRYGIYEPAPPVISSNSLAVKILYPIFWGLLN  184

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LS+FGN L PTSN +EV FSICIVL GL+LFTLL+GNIQVFLH VMA ++K+QLR RD+E
Sbjct  185   LSSFGNQLSPTSNPMEVAFSICIVLGGLLLFTLLVGNIQVFLHVVMANRKKLQLRRRDVE  244

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWM+RRQLPS LRQRVR+FE Q W +MGGE+EM+ I++LPEGLRRDIKR+LCLDLIKKVP
Sbjct  245   WWMRRRQLPSGLRQRVRHFESQTWDSMGGEEEMKWIEELPEGLRRDIKRYLCLDLIKKVP  304

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEK---IIREGDPVQRVVFIVRGRVKSSQNLSKGVV  1969
             LFHSLDDLIL+N+CDR+KPL++SKDEK   IIREGDPV R+VFIVRG  + SQ  SKG++
Sbjct  305   LFHSLDDLILENVCDRVKPLIYSKDEKVQQIIREGDPVPRMVFIVRGHARRSQGFSKGII  364

Query  1970  ATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRY  2149
             ATS+LEPGGFLGDELLSWCLRRPF+DRLP SSATFTC + TEAFGLDA+ LR+IT+HFRY
Sbjct  365   ATSVLEPGGFLGDELLSWCLRRPFLDRLPTSSATFTCDEFTEAFGLDADDLRYITEHFRY  424

Query  2150  KFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYA  2326
             +FA+ +LKRTARYYS+NWRTWAAVN+Q AWR Y++RTRG    +P  A+ G + RLR+YA
Sbjct  425   RFAHNKLKRTARYYSSNWRTWAAVNIQFAWRFYKMRTRGP--LIPVTANGGMEGRLRKYA  482

Query  2327  AMFLSIRPHDHLE  2365
             AMF+S+RPHDHLE
Sbjct  483   AMFMSLRPHDHLE  495



>ref|NP_001130650.1| uncharacterized protein LOC100191751 [Zea mays]
 gb|ACF78956.1| unknown [Zea mays]
Length=452

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/452 (70%), Positives = 375/452 (83%), Gaps = 5/452 (1%)
 Frame = +2

Query  1025  MRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC  1204
             MR+MQKVTGYIFG+IWWGF LNL AYFIASH+AGGCWYVLAIQR+ASCL++ C    S  
Sbjct  1     MRKMQKVTGYIFGSIWWGFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKKNNSCD  60

Query  1205  NLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVS  1384
              + L+CS+E+C+       V G +C  N T+ +      CL   G F +GIY  ALPV+S
Sbjct  61    LISLACSKEICFHPPWSSNVNGFACDTNMTSFSQRNVSTCLSGKGSFAYGIYLGALPVIS  120

Query  1385  SRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFL  1564
             S S+AVKILYPIFWGLMTLSTFGNDL PTSN +EVIFSI  VLSGLMLFTLLIGNIQVFL
Sbjct  121   SNSLAVKILYPIFWGLMTLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFL  180

Query  1565  HAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEG  1744
             HAV+A+KRKMQLR RDMEWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEG
Sbjct  181   HAVLARKRKMQLRFRDMEWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEG  240

Query  1745  LRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIV  1924
             LRRDIKR+LCL+L+K+VPLFH +DDLILDNICDR++PLVFS  EK+IREGDPVQR+VFI+
Sbjct  241   LRRDIKRYLCLELVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFIL  300

Query  1925  RGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFG  2104
             +G+++S+Q L+KGVVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF 
Sbjct  301   QGKLRSTQPLTKGVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFC  360

Query  2105  LDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVP  2284
             LDA  LRFIT+HFRYKFANE+L+RTARYYS+NWRTWAAVN+QLAWRRYR R       + 
Sbjct  361   LDAPDLRFITEHFRYKFANEKLRRTARYYSSNWRTWAAVNIQLAWRRYRARASTDLAAMA  420

Query  2285  E-----NADDGDRRLRQYAAMFLSIRPHDHLE  2365
                     DDGDRRLR YAAMF+S+RPHDHLE
Sbjct  421   APPLAGGPDDGDRRLRHYAAMFMSLRPHDHLE  452



>ref|XP_002980676.1| hypothetical protein SELMODRAFT_112824 [Selaginella moellendorffii]
 gb|EFJ18327.1| hypothetical protein SELMODRAFT_112824 [Selaginella moellendorffii]
Length=641

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/638 (54%), Positives = 452/638 (71%), Gaps = 30/638 (5%)
 Frame = +2

Query  515   FHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLA  694
             F+++  FG+VLDPRSK +  WNR FLL+R  ALAI+PLF Y ++I      C Y+DG   
Sbjct  12    FYKTWIFGKVLDPRSKTIIAWNRVFLLSRFWALAIEPLFLYTVAIS-PHRYCFYIDGWFG  70

Query  695   AIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFD  874
               VT+ R   D +H+ H+WLQ +LAYV+R+SLV+G GKLVWDAR VA HY+R   GF FD
Sbjct  71    IFVTLFRCVSDLMHLWHIWLQLKLAYVARKSLVLGSGKLVWDARMVALHYLRPSGGFVFD  130

Query  875   AFVILPIPQAVF----WLVVPKLIREE-QVKlimtillliflfqflPRIYHSIYLMRRMQ  1039
              FV+ PI QA F    W VVP++IR   ++  +MT +L+ F  QF+ +++H I L+ RMQ
Sbjct  131   LFVVFPILQASFSIVIWGVVPEMIRSGGKMSGMMTSILVAFAIQFVYKVFHLITLVPRMQ  190

Query  1040  KVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-L  1216
             +VTGY+FGT WWGF LNL AYF+A+H AG CWY+LA+QR++SCL  +C   K+ CN+R L
Sbjct  191   RVTGYVFGTAWWGFALNLTAYFVAAHAAGACWYLLALQRISSCLYDQCK-MKAGCNVRDL  249

Query  1217  SCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGP-FRFGIYKWALPVVSSRS  1393
               S  + Y     G    +     S        P CL+  G  F++GI+  ALP+ +SR+
Sbjct  250   GSSHAILY-----GPRFSDPSPLTSAKLYADVAPTCLENKGDVFKYGIFITALPLTTSRN  304

Query  1394  IAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAV  1573
                +ILYPIFWGLMTLS+FGN + P++  LEVIFSI ++  GLMLFTLLIGNIQVFLH++
Sbjct  305   FLNRILYPIFWGLMTLSSFGNAMVPSNQMLEVIFSILVITCGLMLFTLLIGNIQVFLHSM  364

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
              AKK +M+L+ RD+E WMKRRQLPS LR RVR +ERQ+WAA+ G DE  ++++LPEG+RR
Sbjct  365   TAKKEEMRLKIRDLEVWMKRRQLPSRLRHRVRQYERQKWAALRGVDEHAMVRELPEGVRR  424

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGR  1933
             D+KR LCLDL+++VPLF+ +D+++LD ICDR+KPL+F K E I R GDPVQR++FIVRGR
Sbjct  425   DVKRHLCLDLVRQVPLFYQMDEIVLDTICDRVKPLMFIKGETISRTGDPVQRMLFIVRGR  484

Query  1934  VKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDA  2113
             ++S  NLS+   +   +EPG F GDELLSWCLRRPF+DRLP S AT  C+DS EAFG +A
Sbjct  485   LQSIHNLSENKTSIFTMEPGSFCGDELLSWCLRRPFVDRLPPSIATLRCLDSVEAFGFEA  544

Query  2114  NHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR--TRGQPNTVPE  2287
               L+++TDHFR +FANE+LKRTARYYS+ WRTWAAV +QLAWRR++    +  +P     
Sbjct  545   RDLKYVTDHFRTEFANEKLKRTARYYSSGWRTWAAVTIQLAWRRFKAARVSVAEPARTSR  604

Query  2288  N-------------ADDGDRRLRQYAAMFLSIRPHDHL  2362
             N             A D D +LR Y AMFLS +P DHL
Sbjct  605   NRGGAGLERRLSIAASDSD-KLRMYTAMFLSPKPQDHL  641



>ref|XP_002976933.1| hypothetical protein SELMODRAFT_416791 [Selaginella moellendorffii]
 gb|EFJ22043.1| hypothetical protein SELMODRAFT_416791 [Selaginella moellendorffii]
Length=758

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/677 (52%), Positives = 460/677 (68%), Gaps = 38/677 (6%)
 Frame = +2

Query  386   GVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKR  565
             G P  H T  D       E + G SL+  +  P          F+++  FG+VLDPRSK 
Sbjct  102   GPPPHHVTDHDRGSSYMLEGAVGVSLMHHEPPP------KPDGFYKTWIFGKVLDPRSKT  155

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICH  745
             +  WNR FLL+R  ALAI+PLF Y ++I      C Y+DG     VT+ R   D +H+ H
Sbjct  156   IIAWNRVFLLSRFWALAIEPLFLYTVAISPHRY-CFYIDGWFGIFVTLFRCVSDLMHLWH  214

Query  746   LWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVP  925
             +WLQ +LAYV+R+SLV+G GKLVWDAR VA HY+R   GF FD FVI      V W VVP
Sbjct  215   IWLQLKLAYVARKSLVLGSGKLVWDARMVALHYLRPSGGFVFDLFVI------VIWGVVP  268

Query  926   KLIREE-QVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAY  1102
             ++IR   ++  +MT +L+ F  QF+ +++H I L+ RMQ+VTGY+FGT WWGF LNL AY
Sbjct  269   EMIRRGGKMSGMMTSILVAFAIQFVYKVFHLITLVPRMQRVTGYVFGTAWWGFALNLTAY  328

Query  1103  FIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLLPGGVEGNSC  1279
             F+A+H AG CWY+LA+QR++SCL  +C   K+ CN R L  S  + Y     G    +  
Sbjct  329   FVAAHAAGACWYLLALQRISSCLYDQCK-MKAGCNARDLGSSHAILY-----GPRFSDPS  382

Query  1280  AGNSTAAALMRKPLCLDVNGP-FRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGN  1456
                S        P CL+  G  F++GI+  ALP+ +SR+   +ILYPIFWGLMTLS+FGN
Sbjct  383   PLTSAKLYADVAPTCLENKGDVFKYGIFITALPLTTSRNFLNRILYPIFWGLMTLSSFGN  442

Query  1457  DLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRR  1636
              + P++  LEVIFSI ++  GLMLFTLLIGNIQVFLH++ AKK +M+L+ RD+E WMKRR
Sbjct  443   AMVPSNQMLEVIFSILVITCGLMLFTLLIGNIQVFLHSMTAKKEEMRLKIRDLEVWMKRR  502

Query  1637  QLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLD  1816
             QLPS LR RVR +ERQ+WAA+ G DE  ++++LPEG+RRD+KR LCLDL+++VPLF+ +D
Sbjct  503   QLPSRLRHRVRQYERQKWAALRGVDEHAMVRELPEGVRRDVKRHLCLDLVRQVPLFYQMD  562

Query  1817  DLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGG  1996
             +++LD ICDR+KPL+F K E I R GDPVQR++FIVRGR++S  NLS+   +   +EPG 
Sbjct  563   EIVLDTICDRVKPLMFIKGETISRTGDPVQRMLFIVRGRLQSIHNLSENKTSIFTMEPGS  622

Query  1997  FLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKR  2176
             F GDELLSWCLRRPF+DRLP S AT  C+DS EAFG +A  L+++TDHFR +FANE+LKR
Sbjct  623   FCGDELLSWCLRRPFVDRLPPSIATLRCLDSVEAFGFEARDLKYVTDHFRTEFANEKLKR  682

Query  2177  TARYYSANWRTWAAVNVQLAWRRYRL------------RTRGQPNT---VPENADDGDRR  2311
             TARYYS+ WRTWAAV +QLAWRR++             R RG       +   A D D +
Sbjct  683   TARYYSSGWRTWAAVTIQLAWRRFKAARVSVAEPARTSRDRGGAGLERRLSIAASDSD-K  741

Query  2312  LRQYAAMFLSIRPHDHL  2362
             LR Y AMFLS +P DHL
Sbjct  742   LRMYTAMFLSPKPQDHL  758



>gb|KDP27205.1| hypothetical protein JCGZ_19904 [Jatropha curcas]
Length=441

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/445 (71%), Positives = 372/445 (84%), Gaps = 5/445 (1%)
 Frame = +2

Query  1034  MQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR  1213
             M+KVTGYI+GTIWWGF LNLIAY IASHV GGCWYVLA QRV SCL+++C  + S C L 
Sbjct  1     MRKVTGYIYGTIWWGFGLNLIAYLIASHVIGGCWYVLATQRVVSCLKEQCE-RNSNCTLS  59

Query  1214  LSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRS  1393
             LSCS++VCY+ + P    GN C  NS   A   KPLCL+  GPF  GIY   L VV+S S
Sbjct  60    LSCSKDVCYQFMYPEDKFGNPCGNNSKMIA---KPLCLNDEGPFNHGIYTEGLLVVTSNS  116

Query  1394  IAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAV  1573
             +A++ILYPIFWGL+ LS+FGN+L+PTSN +EV+FSI IVL GL LFTL++GNIQVFL  +
Sbjct  117   LALRILYPIFWGLLNLSSFGNELDPTSNLVEVMFSIFIVLCGLTLFTLMVGNIQVFLSVI  176

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
             +AK + MQL+ RD+EWWM RRQLPSNLR+R+R+F+ QRWA MGGEDE++ I++LPEGLRR
Sbjct  177   LAKNKNMQLKRRDIEWWMSRRQLPSNLRRRIRHFDNQRWAVMGGEDEIKWIEELPEGLRR  236

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGR  1933
             DIKR+LCLDLIKK PLFH+LDDLILDNICDR+KPLV+ K EKIIREGDPV R+ FIVRGR
Sbjct  237   DIKRYLCLDLIKKAPLFHNLDDLILDNICDRVKPLVYCKGEKIIREGDPVPRMYFIVRGR  296

Query  1934  VKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDA  2113
             VK SQ+LSKG+VATS+LEPGGFLGDELLSWCLRRPFIDRLPASSATF C++ TEAFGLDA
Sbjct  297   VKRSQSLSKGMVATSVLEPGGFLGDELLSWCLRRPFIDRLPASSATFFCMEPTEAFGLDA  356

Query  2114  NHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENA  2293
             N LR+ITDHFRY FA+ RLKRT RYYS+NWRTWAAVNVQLAWRRYR+RT G    V  N 
Sbjct  357   NSLRYITDHFRYTFASVRLKRTLRYYSSNWRTWAAVNVQLAWRRYRMRTTGLVIPVAING  416

Query  2294  DDGDR-RLRQYAAMFLSIRPHDHLE  2365
             ++ +   LR+YAAMFLS+RPHDHLE
Sbjct  417   NNIENLLLRRYAAMFLSLRPHDHLE  441



>ref|XP_008785948.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X2 [Phoenix dactylifera]
Length=644

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 362/431 (84%), Gaps = 2/431 (0%)
 Frame = +2

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             GF  ++        VAGGCWYVLAIQRVASCLRQ+C    +   + L+CS+EVCY L LP
Sbjct  215   GFWFDIFVILPVPQVAGGCWYVLAIQRVASCLRQQCEKNNNCDLVSLACSKEVCYRLPLP  274

Query  1256  GGVEGNSCAGN-STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
              G++  +C  N +TA  +   P+CL+ NGPFRFGIY  ALPVVSS S+AVKILYPIFWGL
Sbjct  275   LGMDELACKSNLTTAIGIQNIPVCLNGNGPFRFGIYNGALPVVSSNSLAVKILYPIFWGL  334

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGNDLEPTS+WLEVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLR RD
Sbjct  335   MTLSTFGNDLEPTSHWLEVIFSIIIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRFRD  394

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWMKRRQLPS LRQRVR +ERQRW AM GEDEM++I++ PEGLRRDIKR LCLDLIKK
Sbjct  395   MEWWMKRRQLPSRLRQRVRQYERQRWLAMRGEDEMDIIEEFPEGLRRDIKRHLCLDLIKK  454

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VP FH+LDDLILD ICDR+KPLVFSK EK+IREGDPV  +VFIVRG++KSSQ+LS+G VA
Sbjct  455   VPFFHNLDDLILDTICDRVKPLVFSKGEKVIREGDPVHCMVFIVRGQLKSSQHLSQGTVA  514

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
             T +L PG FLGDELLSWCLRRPF+DRLP SSATF C+D TEAFGLDA HLR+IT+HFRY 
Sbjct  515   TCMLGPGNFLGDELLSWCLRRPFVDRLPPSSATFECVDPTEAFGLDAPHLRYITEHFRYN  574

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAM  2332
             FANERLKRTARYYS+NWRTWAAVN+QLAWRR + RT G  N  PE   D +RRLR YAAM
Sbjct  575   FANERLKRTARYYSSNWRTWAAVNIQLAWRRCKARTGGMVNPPPE-LGDSERRLRLYAAM  633

Query  2333  FLSIRPHDHLE  2365
             F+S+RPHDHLE
Sbjct  634   FMSLRPHDHLE  644


 Score =   268 bits (684),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 165/229 (72%), Gaps = 8/229 (3%)
 Frame = +2

Query  236  MPSYPGLHFSLSRWFGTILRRK------SVQPDNSDDTYDENP-NFISTECYACTQVGVP  394
            M  +   H  LSRW G    RK           + +     NP    + ECYACTQ GVP
Sbjct  1    MSLFSEFHSFLSRWVGAFRHRKIRSDDDDDTDSSKESGGGSNPIPPAAVECYACTQPGVP  60

Query  395  VFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQR  574
             FHSTSCD AH PEWEASAGSSLIPI+++P        Q    S  FG VLDPRSK+V+R
Sbjct  61   AFHSTSCDRAHTPEWEASAGSSLIPIRSQPAP-RPAGLQRRPNSWIFGSVLDPRSKQVRR  119

Query  575  WNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
            WNRA LLAR  ALA+DPLFFYALSIGR G PCLYMDGGLAA+VTVLRTC DAVH+ H+WL
Sbjct  120  WNRAILLARAAALAVDPLFFYALSIGRGGAPCLYMDGGLAAVVTVLRTCADAVHVMHVWL  179

Query  755  QFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
            Q R+AYVSRESLVVGCGKLVWDAR +A+ Y+RSLKGFWFD FVILP+PQ
Sbjct  180  QLRVAYVSRESLVVGCGKLVWDARTIAARYLRSLKGFWFDIFVILPVPQ  228



>gb|EPS68288.1| cyclic nucleotide-gated ion channel 2, partial [Genlisea aurea]
Length=614

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/670 (52%), Positives = 459/670 (69%), Gaps = 59/670 (9%)
 Frame = +2

Query  362   ECYACTQVGVPVFHSTSCDNAHQPE-WEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFG  538
             EC AC  +GVP+FHS + +   +P  WEA+AG              HR+           
Sbjct  1     ECEACMTMGVPIFHSATRNTIRKPPLWEAAAG--------------HRNL----------  36

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
              +LDPRS  V+ WNR  LLAR +ALA+DP+FF+++SIG    PC++M+   A + + LRT
Sbjct  37    -ILDPRSHNVRIWNRLILLARALALAVDPVFFFSISIG--PRPCIHMNRSAAEVASALRT  93

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
             CLD  H CHL +QFRLAYVSRESLVVGCGKL W+ARA+ASHY+    GFWFD FV+LPIP
Sbjct  94    CLDLAHACHLLIQFRLAYVSRESLVVGCGKLEWNARAIASHYLLCSHGFWFDLFVLLPIP  153

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V+  +VP L+R+ ++  +M +  + F  QF+P++YH   LMRRM++  GY+FGT+WWG
Sbjct  154   QIVYLWLVPWLLRQNKIWEMMKLAQITFFLQFIPKVYHLFSLMRRMREAAGYVFGTVWWG  213

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
             F LNLIAY +ASH +GGCWY+L+I+R A CL Q            +SC+ E   +     
Sbjct  214   FTLNLIAYSLASHASGGCWYILSIERAAMCLSQ--------TRALMSCNRETWIQYF---  262

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVN-GPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
                      NS+     +K +C + N   F +GIY++ALP+++S +  +K+LY   WGLM
Sbjct  263   -------HTNSST----KKSVCFEENQTSFPYGIYQFALPLMTSNAFTIKLLYANLWGLM  311

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
              LST GN+LEPTS  LEV+FSI +VL GL+LFT LIGNIQVFLHA+M ++RKMQL  R+M
Sbjct  312   ALSTMGNNLEPTSQSLEVVFSISMVLGGLLLFTTLIGNIQVFLHAIMMQRRKMQLHYREM  371

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+ R+LP  LR+RVR +E   W    G+DEM LI+  PEGLRRD+KR + L  I+K+
Sbjct  372   EWWMRHRRLPEKLRRRVRRYEHWMWETRRGQDEMALIQGFPEGLRRDVKRCIWLHDIRKI  431

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLF +L DL+LD+ICDR+KPL +SK EKIIREGDPVQR+VFI++GRV+      K    T
Sbjct  432   PLFFNLGDLVLDSICDRVKPLAYSKHEKIIREGDPVQRIVFIMKGRVRRMTKAEK--TTT  489

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
             S+LE G FLGDEL+ WCLRRPF DRLPAS ATFTC    EAF ++++ L++ITD FR++F
Sbjct  490   SLLETGAFLGDELIPWCLRRPFFDRLPASGATFTCTRPVEAFAVESSDLKYITDQFRFQF  549

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-NTVPENADDGDRRLRQYAAM  2332
             ANE LKRT RYYS+NWRTWAAVN+QLAWR+Y  R +  P + +P N    +RR       
Sbjct  550   ANEGLKRTMRYYSSNWRTWAAVNIQLAWRQYLKRVQRLPEDQLPANVAGDNRR-----PA  604

Query  2333  FLSIRPHDHL  2362
               S+RP+DHL
Sbjct  605   LSSLRPYDHL  614



>ref|XP_006841828.1| hypothetical protein AMTR_s00003p00270020 [Amborella trichopoda]
 gb|ERN03503.1| hypothetical protein AMTR_s00003p00270020 [Amborella trichopoda]
Length=748

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/613 (53%), Positives = 427/613 (70%), Gaps = 14/613 (2%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GRV DPRSK +Q WNR FLL     LA+DPLF YALSI  +   CL++DG  A  VT L
Sbjct  137   LGRVFDPRSKIIQEWNRVFLLVCAAGLAVDPLFLYALSISDTCL-CLFIDGWFALTVTAL  195

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILP  892
             R   D +H+C++W+Q +  YV++ S+ VG G L    RAVA HY+ S KGF FD FVILP
Sbjct  196   RCMTDLMHLCNMWVQLKTCYVTKHSVGVGGGTLQTHPRAVALHYLTSKKGFLFDLFVILP  255

Query  893   IPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIW  1072
             I Q V W+V P LIR      +MT+ L++FLFQ+LP++YH+I L+RRMQ ++GYIFGTIW
Sbjct  256   IQQMVLWVVAPNLIRLGSTTTVMTVFLIMFLFQYLPKLYHAISLLRRMQNLSGYIFGTIW  315

Query  1073  WGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLL  1252
             WGF LN+IAYF+A+H AG CWY+L IQR A CLR +C    S     L C + + Y   +
Sbjct  316   WGFALNMIAYFVAAHAAGACWYLLGIQRAAKCLRVQCRGMASCSLTTLGCKDTIYYGTAI  375

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                    +   N        + +C+D    F +G YKW +P+V++ S   KIL+PIFWGL
Sbjct  376   VRDSMRMAWGANKQV-----RHMCIDTADNFNYGAYKWVVPLVTNSSRLEKILFPIFWGL  430

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T+ W+EV+F+I I+ SGL+L T+LIGNI+VFL A  +KK+ MQL+ R+
Sbjct  431   MTLSTFGN-LESTTEWVEVVFNIIILTSGLLLVTMLIGNIKVFLQATTSKKQAMQLKMRN  489

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWM RRQLP   RQR+R +ERQRWAAM G DE+ +IK+LPEGLRRDIK  LCLDL+++
Sbjct  490   MEWWMNRRQLPQAYRQRLRQYERQRWAAMRGVDEVAMIKNLPEGLRRDIKYHLCLDLVRQ  549

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +DDL+L+NICDR+K ++F K E I REGDPV+R++F+VRG ++SSQ L  G+ +
Sbjct  550   VPLFQHMDDLVLENICDRVKSVIFPKGETITREGDPVERMLFVVRGHLQSSQVLHNGLQS  609

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
             + +L PG F GDELLSWCLRRPF++RLP SSAT   +++ E F L+A  ++++T HFRY 
Sbjct  610   SCMLGPGNFSGDELLSWCLRRPFVERLPPSSATLKSLETAETFVLEAADVKYVTQHFRYT  669

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             F NER+KR+ARYYS  WRTWAAV +QLAWRR+R R      +       +  +    + R
Sbjct  670   FMNERVKRSARYYSPGWRTWAAVAIQLAWRRHRHRLALTSLSFIRPRRPLSRSTSLSEDR  729

Query  2312  LRQYAAMFLSIRP  2350
             LR Y A+  S +P
Sbjct  730   LRLYTALLTSPKP  742



>ref|XP_008805117.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Phoenix 
dactylifera]
Length=441

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/417 (74%), Positives = 352/417 (84%), Gaps = 1/417 (0%)
 Frame = +2

Query  1115  HVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNST  1294
              VAGGCWYVLAI+RVASCL+Q+C    +   + ++CS E C    LP G++  SC  N T
Sbjct  26    QVAGGCWYVLAIRRVASCLQQQCQKNNNCDLMSIACSREACNRPSLPAGIDELSCISNLT  85

Query  1295  AAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTS  1474
             +        CL+V+GPF++GIY  ALPV+SS S+AVKILYPIFWGLMTLSTFGN+L PTS
Sbjct  86    SVGNQNLHSCLNVDGPFQYGIYDAALPVMSSNSLAVKILYPIFWGLMTLSTFGNNLAPTS  145

Query  1475  NWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNL  1654
              WLEVIFSI IVLSGLMLFTLLIGNIQVFLHAVMA+KRKMQLRCRDMEWWMKRRQLPS L
Sbjct  146   QWLEVIFSIAIVLSGLMLFTLLIGNIQVFLHAVMARKRKMQLRCRDMEWWMKRRQLPSRL  205

Query  1655  RQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDN  1834
             RQRVR +ER+RWA M GEDEME IKDLPEGLRRDI+R+LCLDLIK+VPLF SLDDLILDN
Sbjct  206   RQRVRQYERRRWATMRGEDEMETIKDLPEGLRRDIRRYLCLDLIKQVPLFQSLDDLILDN  265

Query  1835  ICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDEL  2014
             ICDR+K LVFSKDEKIIREGDPVQ++VFIVRG ++SSQ LSKG VAT  L PG FLGDEL
Sbjct  266   ICDRVKHLVFSKDEKIIREGDPVQQMVFIVRGHLQSSQKLSKGKVATCKLGPGNFLGDEL  325

Query  2015  LSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYS  2194
             LSWCLRRPF+DRLPASSATF C++ TEAFGLDA HLR+IT+HFRY+FAN+RLKR ARYYS
Sbjct  326   LSWCLRRPFMDRLPASSATFVCVEPTEAFGLDACHLRYITEHFRYRFANDRLKRIARYYS  385

Query  2195  ANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             +NWRTWAAVN+QLAWRRY+ +TRG     P    D +RRLR YAAMF+S+RPHDHLE
Sbjct  386   SNWRTWAAVNIQLAWRRYKAKTRGVV-IQPSEFSDSERRLRLYAAMFMSMRPHDHLE  441



>ref|XP_010268849.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Nelumbo 
nucifera]
Length=667

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/620 (53%), Positives = 437/620 (70%), Gaps = 18/620 (3%)
 Frame = +2

Query  521   RSGPF-GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAA  697
             R G F GRVLDPR++ +Q WNR FLL     L +DPLFFYALSI  +   CL++DG  A 
Sbjct  49    RGGWFLGRVLDPRARWIQEWNRVFLLVSATGLFVDPLFFYALSISNTCM-CLFIDGWFAI  107

Query  698   IVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDA--RAVASHYVRSLKGFWF  871
              VT LR   DA+H+ ++WLQ ++   S  ++VV  G  + +A  R+VA  Y+++ KGF+F
Sbjct  108   TVTALRCMTDALHVWNMWLQLKMVKRS-HAMVVEDGDSLRNATARSVALRYLKAKKGFFF  166

Query  872   DAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTG  1051
             D F+ILP+PQ V W+ +P L+      ++MT+ L+IFLFQ+LP+IYHS+ L+RRMQ ++G
Sbjct  167   DLFIILPLPQLVLWVAIPSLLERGSTTIVMTVFLIIFLFQYLPKIYHSVCLLRRMQNLSG  226

Query  1052  YIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEE  1231
             YIFGT+WWG  LNLIAYF+ASH AG CWY+L IQR A CL+ +C   +      L+C + 
Sbjct  227   YIFGTVWWGIALNLIAYFVASHAAGACWYLLGIQRAAKCLKLQCGITEGCGPRTLACQDP  286

Query  1232  VCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKIL  1411
             + Y   +    E  +   N        +  C+D    F +G YKW +P+V++ S   KIL
Sbjct  287   IYYGTRMVRDRERLAWGENVHV-----RSTCIDSADNFDYGAYKWTVPLVTNESRLEKIL  341

Query  1412  YPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRK  1591
             +PIFWGLMTLSTFGN LE T+ W+E++F+I I+ SGL+L T+LIGNI+VFLHA  +KK+ 
Sbjct  342   FPIFWGLMTLSTFGN-LESTTEWMEIVFNIIIITSGLLLVTMLIGNIKVFLHATTSKKQA  400

Query  1592  MQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFL  1771
             MQL+ R++EWWM+RR LP   RQRVR +ERQRWAAM G DE ++I++LPEGLRRDIK  L
Sbjct  401   MQLKMRNVEWWMRRRHLPQAFRQRVRQYERQRWAAMRGVDECQMIRNLPEGLRRDIKYHL  460

Query  1772  CLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQN  1951
             CLDL+++VPLF  +DDL+L+NICDR+K L+F K E I REGDPVQR++F+VRG ++SSQ 
Sbjct  461   CLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGETITREGDPVQRMLFVVRGHLQSSQV  520

Query  1952  LSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFI  2131
             L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++
Sbjct  521   LRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYV  580

Query  2132  TDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPEN  2290
             T HFRY F NER+KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +   
Sbjct  581   TQHFRYTFVNERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRC  640

Query  2291  ADDGDRRLRQYAAMFLSIRP  2350
             +  G+ RLR Y AM  S +P
Sbjct  641   SSLGEDRLRLYTAMLTSPKP  660



>ref|XP_011085718.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like isoform 
X3 [Sesamum indicum]
Length=584

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/546 (61%), Positives = 415/546 (76%), Gaps = 32/546 (6%)
 Frame = +2

Query  263   SLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSCDNAHQPEWE  442
             ++S+  G + R       +SDD + E P    T+CYACTQVGVPVFHST+CD  H+PEWE
Sbjct  10    AMSKLIGKLFR-------SSDDDFTEYP----TDCYACTQVGVPVFHSTTCDPVHKPEWE  58

Query  443   ASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAID  622
             ASAGSSL+PI       T RS+++   +     ++DPRS  VQRWNR  +LARG+ALA D
Sbjct  59    ASAGSSLVPI-------TSRSSRNSSAAKNRRLIVDPRSTNVQRWNRLIVLARGVALATD  111

Query  623   PLFFYALSIGRSGT----PCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESL  790
             PL+F+++S+   G     P +YMDGG+A + TV+RTC+D VH+CHL ++FRLAYVSRESL
Sbjct  112   PLYFFSISVSGGGGGGGRPFIYMDGGMATLATVVRTCVDLVHMCHLLVRFRLAYVSRESL  171

Query  791   VVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtil  970
             VVGCGKLV D RA+ASHY+ S  GFWFD FV+LPIPQA +WL+VP L+RE +++ +  IL
Sbjct  172   VVGCGKLVRDPRAIASHYLLSANGFWFDVFVVLPIPQATYWLLVPMLLRENRIEELTIIL  231

Query  971   lliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAI  1150
              L FL QFLP++YH   LMR M+KVTGYIFG+IWWGFCLNLIAYF+AS+ +GG WY+LA+
Sbjct  232   QLTFLVQFLPKVYHCYCLMRGMRKVTGYIFGSIWWGFCLNLIAYFLASNASGGYWYILAV  291

Query  1151  QRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLD  1330
             +R+ASCL Q C  +  +CNL LSCS E C           N    NS   A  +  +CLD
Sbjct  292   RRIASCLTQNCDTR--SCNLPLSCSMEACRP------TSTNPHGNNSLIVA--KTQMCLD  341

Query  1331  VNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIV  1510
               GPF +GIY++ALP++S+ S   KILY   WGLM LST GN+LEPTS  LEV+FSIC+V
Sbjct  342   SLGPFPYGIYQFALPLMSTDSFTAKILYSNLWGLMALSTMGNNLEPTSQCLEVLFSICMV  401

Query  1511  LSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRW  1690
             L+GL+LFTLLIGNIQVFLHAVM ++RKMQLR RDMEWWMK RQLPS LR+RVR +E Q W
Sbjct  402   LAGLLLFTLLIGNIQVFLHAVMMRRRKMQLRYRDMEWWMKHRQLPSQLRRRVRKYEHQIW  461

Query  1691  AAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSK  1870
               MGG+DEMELIKDLP GLRR+IKR++CLDLIKKVPLFH+LDDL+LDNICDR+KPL++SK
Sbjct  462   EMMGGQDEMELIKDLPSGLRREIKRYICLDLIKKVPLFHNLDDLVLDNICDRVKPLLYSK  521

Query  1871  DEKIIR  1888
             DEK+ R
Sbjct  522   DEKVQR  527



>emb|CDP05851.1| unnamed protein product [Coffea canephora]
Length=684

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/624 (52%), Positives = 436/624 (70%), Gaps = 24/624 (4%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G++LDPR+  +Q WNR FLL     L +DPLFFY LSI  +   CL++DG  A  VTVLR
Sbjct  63    GKILDPRASWIQEWNRIFLLVCATGLFVDPLFFYTLSISENCM-CLFVDGWFAVTVTVLR  121

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR---------AVASHYVRSLKGFW  868
                DA+H+ ++WLQF++      +L V     V  +R          +A  Y++S KGF+
Sbjct  122   CMTDALHVWNMWLQFKMNRRPHAALAVTGDDTVGSSRIRLHDTSPRTIALKYLKSKKGFF  181

Query  869   FDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVT  1048
             FD FVILP+PQ V W+ +P L+ +     +MT+LL +FLFQ+LP+IYHS+ L+RRMQ ++
Sbjct  182   FDLFVILPLPQIVLWVAIPLLLEKGSTTAVMTVLLTMFLFQYLPKIYHSVCLLRRMQNLS  241

Query  1049  GYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCS  1225
             GYIFGT+WWG  LNLIAYF+ASH  G CWY+L IQR A CL+++C + K  C L+ L+C 
Sbjct  242   GYIFGTVWWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKEQCRFTKG-CGLKMLACE  300

Query  1226  EEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVK  1405
             + V Y    P         G S AA    +  CL     F +G YKWA+ +V++ +   K
Sbjct  301   QPVYYGTRSPVKDSFRLIWGESNAA----RTTCLQNYDSFDYGAYKWAVQLVTNDNRLEK  356

Query  1406  ILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKK  1585
             IL+PIFWGLMTLSTFGN LE T++WLEVIF I ++ +GL+L T+LIGNI+VFLHA  +KK
Sbjct  357   ILFPIFWGLMTLSTFGN-LEATTDWLEVIFIIIVLTTGLLLVTMLIGNIKVFLHATTSKK  415

Query  1586  RKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKR  1765
             + M LR R +EWWM+RR+LP N +QRVR +ERQRWAAM G DE E++++LPEGLRRDIK 
Sbjct  416   QAMHLRMRSIEWWMRRRRLPPNFKQRVRNYERQRWAAMRGVDEYEMVRNLPEGLRRDIKY  475

Query  1766  FLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSS  1945
              LCLDL+++VPLF  +D+L+L+NICDR+K L+F+K E I +EGDPVQR++FIVRG ++SS
Sbjct  476   HLCLDLVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITKEGDPVQRMLFIVRGHLQSS  535

Query  1946  QNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLR  2125
             Q L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  ++
Sbjct  536   QVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAEDVK  595

Query  2126  FITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VP  2284
             ++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       + 
Sbjct  596   YVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSLIRPRRPLS  655

Query  2285  ENADDGDRRLRQYAAMFLSIRPHD  2356
              ++  G+ RLR Y A+  S +P+ 
Sbjct  656   RSSSLGEDRLRLYTALLTSPKPNQ  679



>ref|XP_009334580.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Pyrus x bretschneideri]
Length=691

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/667 (50%), Positives = 446/667 (67%), Gaps = 29/667 (4%)
 Frame = +2

Query  416   DNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGP---FGRVLDPRSKRVQRWNRA  586
             D+  Q + E S GSS     N    + +       R  P    G+VLDPR+K VQ WNR 
Sbjct  30    DHEVQEDDEESDGSSTSHGGNFENCLYNNMCSSRQRRRPGWSLGQVLDPRAKWVQEWNRV  89

Query  587   FLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL  766
             FLL     L IDPLFFYALSI +S   CL++DG  A  VTVLR   D +H+ ++WLQ ++
Sbjct  90    FLLVCATGLIIDPLFFYALSISQSCM-CLFVDGWFAITVTVLRCMTDVLHLWNMWLQLKM  148

Query  767   A----YVSRESLVVGCGKLVWDA--RAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPK  928
             A    + +      G    + D   R+VA  Y++S KGF FD FVI+PIPQ + W+V+P 
Sbjct  149   AKRYSFTAMVGGDGGGANGLRDTSPRSVALKYLKSKKGFLFDLFVIIPIPQIILWVVIPS  208

Query  929   LIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFI  1108
             L+    V ++MT+ L+ F     P+IYHS+ L+RRMQ ++GYIFGT+WWG  LNLIAYF+
Sbjct  209   LLERGSVTVVMTVFLMFFFQYL-PKIYHSVCLLRRMQNLSGYIFGTVWWGIALNLIAYFV  267

Query  1109  ASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLLPGGVEGNSCAG  1285
             A+H AG CWY+L IQR   CL+++C  + S C LR L+C + + Y      G +      
Sbjct  268   AAHAAGACWYLLGIQRAEKCLKEQCR-ETSGCGLRILACEDSIYY------GAKNTLREA  320

Query  1286  NSTAAALMRKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGND  1459
                A A  RK    CLD    + +G Y W + +V++ S   KIL+PIFWGLMTLSTFGN 
Sbjct  321   ARLAWAENRKARSTCLDSADHYDYGAYSWTVQLVTNDSRLEKILFPIFWGLMTLSTFGN-  379

Query  1460  LEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQ  1639
             LE ++ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM++RQ
Sbjct  380   LESSTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAMQLKMRNIEWWMRKRQ  439

Query  1640  LPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDD  1819
             LP   RQRVR +ERQRWAAM G DE E+I++LPEGLRRDIK  LCLDL+++VPLF  +DD
Sbjct  440   LPQGFRQRVRNYERQRWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDD  499

Query  1820  LILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGF  1999
             L+L+NICDR+K L+F K E I REGDPVQR++F+VRG ++SSQ L  GV +  +L PG F
Sbjct  500   LVLENICDRVKSLIFPKGETITREGDPVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNF  559

Query  2000  LGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRT  2179
              GDELLSWCLRRPFI+RLP SS+T   +++TEAF L+A  ++++T HFRY F NE++KR+
Sbjct  560   SGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFSLEAEDVKYVTQHFRYTFVNEKVKRS  619

Query  2180  ARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFL  2338
             ARYYS  WRTWAAV +QLAWRRY+ R      +       V   +  G+ RLR Y A+  
Sbjct  620   ARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPVSRCSSLGEDRLRLYTALLT  679

Query  2339  SIRPHDH  2359
             S +P+D 
Sbjct  680   SPKPNDQ  686



>ref|XP_004149297.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Cucumis 
sativus]
 gb|KGN56205.1| hypothetical protein Csa_3G099660 [Cucumis sativus]
Length=659

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/626 (53%), Positives = 442/626 (71%), Gaps = 23/626 (4%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDP SK V+ WN  FLL     L +DPLF Y LSI  S   C+++DG LA  VTVLR  
Sbjct  38    VLDPTSKWVREWNWVFLLVCAAGLFVDPLFLYTLSISESWM-CVFIDGWLAITVTVLRCM  96

Query  722   LDAVHICHLWLQFRLAYVSR-----ESLVVGCGKLVWDA--RAVASHYVRSLKGFWFDAF  880
              DA+H+ ++WLQ + A  S      E    G  + + D+  RAVA  Y++S KGF+FD F
Sbjct  97    GDALHLWNMWLQLKTATKSSFAGSGEGDGRGENRRLCDSSPRAVALRYLKSKKGFFFDLF  156

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP PQ V W+V+P++++E  V  +MT+LL++FLFQ+LP++YHS+ L+RR+Q ++GYIF
Sbjct  157   VILPFPQVVLWIVIPRIMKEGLVTSVMTVLLIVFLFQYLPKLYHSVCLLRRLQNLSGYIF  216

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKS-TCNLRL-SCSEEV  1234
             GT+WWG  LNLIAYF+A+H AG CWY+L +QR A CL+++C    + +C LRL SC + +
Sbjct  217   GTVWWGIALNLIAYFVAAHAAGACWYLLGVQRAAKCLKEQCRSATTNSCGLRLLSCKDPI  276

Query  1235  CYELLLPGGVEGNSCAGN-STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKIL  1411
              Y    P  +      G    A   + K +CLD    F +G YKW + +V ++S   KIL
Sbjct  277   FYG---PNNMRMGRDGGRFDWANNRLSKFMCLDTADNFDYGAYKWTVQLVVNQSRLEKIL  333

Query  1412  YPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRK  1591
             +PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ 
Sbjct  334   FPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQG  392

Query  1592  MQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFL  1771
             MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G DE E+IK+LPEGLRRDIK  L
Sbjct  393   MQLKMRNLEWWMRKRRLPQGFRQRVRNYERQRWAAMRGVDECEMIKNLPEGLRRDIKYHL  452

Query  1772  CLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQN  1951
             CLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++SSQ 
Sbjct  453   CLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQRMLFVVRGHLQSSQV  512

Query  1952  LSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFI  2131
             L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS T   +++TEAF L+A  ++++
Sbjct  513   LRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSFTLVTLETTEAFSLEAEDVKYV  572

Query  2132  TDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPEN  2290
             T HFRY F N+++KR+ARYYS  WRTWAAV +QLAWRRYR R      +       +   
Sbjct  573   TQHFRYTFVNDKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRPRRPLSRC  632

Query  2291  ADDGDRRLRQYAAMFLSIRP-HDHLE  2365
             +  G+ RLR Y A+  S +P HDH +
Sbjct  633   SSLGEDRLRLYTALLTSPKPNHDHFD  658



>ref|XP_004167598.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Cucumis 
sativus]
Length=663

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/626 (53%), Positives = 442/626 (71%), Gaps = 23/626 (4%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDP SK V+ WN  FLL     L +DPLF Y LSI  S   C+++DG LA  VTVLR  
Sbjct  42    VLDPTSKWVREWNWVFLLVCAAGLFVDPLFLYTLSISESWM-CVFIDGWLAITVTVLRCM  100

Query  722   LDAVHICHLWLQFRLAYVSR-----ESLVVGCGKLVWDA--RAVASHYVRSLKGFWFDAF  880
              DA+H+ ++WLQ + A  S      E    G  + + D+  RAVA  Y++S KGF+FD F
Sbjct  101   GDALHLWNMWLQLKTATKSSFAGSGEGDGRGENRRLRDSSPRAVALRYLKSKKGFFFDLF  160

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP PQ V W+V+P++++E  V  +MT+LL++FLFQ+LP++YHS+ L+RR+Q ++GYIF
Sbjct  161   VILPFPQVVLWIVIPRIMKEGLVTSVMTVLLIVFLFQYLPKLYHSVCLLRRLQNLSGYIF  220

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKS-TCNLRL-SCSEEV  1234
             GT+WWG  LNLIAYF+A+H AG CWY+L +QR A CL+++C    + +C LRL SC + +
Sbjct  221   GTVWWGIALNLIAYFVAAHAAGACWYLLGVQRAAKCLKEQCRSATTNSCGLRLLSCKDPI  280

Query  1235  CYELLLPGGVEGNSCAGN-STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKIL  1411
              Y    P  +      G    A   + K +CLD    F +G YKW + +V ++S   KIL
Sbjct  281   FYG---PNNMRMGRDGGRFDWANNRLSKFMCLDTADNFDYGAYKWTVQLVVNQSRLEKIL  337

Query  1412  YPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRK  1591
             +PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ 
Sbjct  338   FPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQG  396

Query  1592  MQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFL  1771
             MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G DE E+IK+LPEGLRRDIK  L
Sbjct  397   MQLKMRNLEWWMRKRRLPQGFRQRVRNYERQRWAAMRGVDECEMIKNLPEGLRRDIKYHL  456

Query  1772  CLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQN  1951
             CLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++SSQ 
Sbjct  457   CLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQRMLFVVRGHLQSSQV  516

Query  1952  LSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFI  2131
             L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS T   +++TEAF L+A  ++++
Sbjct  517   LRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSFTLVTLETTEAFSLEAEDVKYV  576

Query  2132  TDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPEN  2290
             T HFRY F N+++KR+ARYYS  WRTWAAV +QLAWRRYR R      +       +   
Sbjct  577   TQHFRYTFVNDKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRPRRPLSRC  636

Query  2291  ADDGDRRLRQYAAMFLSIRP-HDHLE  2365
             +  G+ RLR Y A+  S +P HDH +
Sbjct  637   SSLGEDRLRLYTALLTSPKPNHDHFD  662



>ref|XP_008366405.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Malus domestica]
Length=690

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/625 (52%), Positives = 431/625 (69%), Gaps = 26/625 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              G+VLDPR+K VQ WNR FLL     L IDPLFFYALSI +S   CL++DG  A  VTVL
Sbjct  71    LGQVLDPRAKWVQEWNRVFLLVCATGLIIDPLFFYALSISQSCM-CLFVDGWFAITVTVL  129

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLVVGCGKLVWDA--RAVASHYVRSLKGFWFD  874
             R   D +H+ ++WLQ ++A    + +      G    + D   R+VA  Y++S KGF FD
Sbjct  130   RCMTDVLHLWNMWLQLKMAKRYSFTAMVGGDGGGANGLRDTSPRSVALKYLKSKKGFLFD  189

Query  875   AFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGY  1054
              FVI+PIPQ + W+V+P L+    V ++MT+ L+ F     P+IYHS+ L+RRMQ ++GY
Sbjct  190   LFVIIPIPQIILWVVIPSLLERGSVTVVMTVFLMFFFQYL-PKIYHSVCLLRRMQNLSGY  248

Query  1055  IFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEE  1231
             IFGT+WWG  LNLIAYF+A+H AG CWY+L IQR   CL+++C  + S C LR L+C + 
Sbjct  249   IFGTVWWGIALNLIAYFVAAHAAGACWYLLGIQRAEKCLKEQCR-ETSGCGLRILACEDT  307

Query  1232  VCYELLLPGGVEGNSCAGNSTAAALMRKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVK  1405
             + Y      G           A A  RK    CLD    + +G Y W + +V++ S   K
Sbjct  308   IYY------GATNTLREAARLAWAENRKARSTCLDNADHYDYGAYSWTVQLVTNDSRLEK  361

Query  1406  ILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKK  1585
             IL+PIFWGLMTLSTFGN LE ++ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK
Sbjct  362   ILFPIFWGLMTLSTFGN-LESSTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKK  420

Query  1586  RKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKR  1765
             + MQL+ R++EWWM++RQLP   RQRVR +ERQRWAAM G DE E+I++LPEGLRRDIK 
Sbjct  421   QAMQLKMRNIEWWMRKRQLPQGFRQRVRNYERQRWAAMRGVDECEMIRNLPEGLRRDIKY  480

Query  1766  FLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSS  1945
              LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I REGDPVQR++F+VRG ++SS
Sbjct  481   HLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGETITREGDPVQRMLFVVRGHLQSS  540

Query  1946  QNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLR  2125
             Q L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAF L+A  ++
Sbjct  541   QVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFSLEAEDVK  600

Query  2126  FITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VP  2284
             ++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       V 
Sbjct  601   YVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPVS  660

Query  2285  ENADDGDRRLRQYAAMFLSIRPHDH  2359
               +  G+ RLR Y A+  S +P+D 
Sbjct  661   RCSSMGEDRLRLYTALLTSPKPNDQ  685



>ref|XP_008452299.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Cucumis melo]
Length=661

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/633 (52%), Positives = 444/633 (70%), Gaps = 32/633 (5%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G VLDP +K V+ WN  FLL     L +DPLF Y LSI  S   C+++DG LA  VTVLR
Sbjct  37    GSVLDPTTKWVREWNWVFLLVCAAGLFVDPLFLYTLSISESWM-CVFIDGWLAITVTVLR  95

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR------------AVASHYVRSLK  859
                DA+H+ ++W+Q + A  ++ S   G G+   DAR            AVA  Y++S K
Sbjct  96    CMGDALHLWNIWVQLKTA--TKSSFAAGRGE--GDARDENRGLRDSSPRAVALRYLKSKK  151

Query  860   GFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQ  1039
             GF+FD FVILP PQ V W+V+P++++E  V ++MT+LL++FLFQ+LP++YHS+ L+RR+Q
Sbjct  152   GFFFDLFVILPFPQVVLWVVIPRIMKEGLVTMVMTVLLIVFLFQYLPKLYHSVCLLRRLQ  211

Query  1040  KVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKS-TCNLRL  1216
              ++GYIFGT+WWG  LNLIAYF+A+H AG CWY+L +QR A CL+++C    S +C LRL
Sbjct  212   NLSGYIFGTVWWGIALNLIAYFVAAHAAGACWYLLGVQRAAKCLKEQCRSATSNSCGLRL  271

Query  1217  -SCSEEVCYELLLPGGVEGNSCAGN-STAAALMRKPLCLDVNGPFRFGIYKWALPVVSSR  1390
              SC + + Y    P  +      G    A     K +CLD    F +G YKW + +V ++
Sbjct  272   LSCKDPIFYG---PNNMRMGRDRGRFDWANNRQSKFMCLDTADNFDYGAYKWTVQLVVNQ  328

Query  1391  SIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHA  1570
             S   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA
Sbjct  329   SRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHA  387

Query  1571  VMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLR  1750
               +KK+ MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G DE E+IK+LPEGLR
Sbjct  388   TTSKKQGMQLKMRNLEWWMRKRRLPQGFRQRVRNYERQRWAAMRGVDECEMIKNLPEGLR  447

Query  1751  RDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRG  1930
             RDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG
Sbjct  448   RDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQRMLFVVRG  507

Query  1931  RVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLD  2110
              ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS T   +++TEAF L+
Sbjct  508   HLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSFTLVTLETTEAFSLE  567

Query  2111  ANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT----  2278
             A  ++++T HFRY F N+++KR+ARYYS  WRTWAAV +QLAWRRYR R      +    
Sbjct  568   AEDVKYVTQHFRYTFVNDKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRP  627

Query  2279  ---VPENADDGDRRLRQYAAMFLSIRP-HDHLE  2365
                +   +  G+ RLR Y A+  S +P HDH +
Sbjct  628   RRPLSRCSSLGEDRLRLYTALLTSPKPNHDHFD  660



>ref|XP_002525760.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF36596.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=687

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/631 (52%), Positives = 436/631 (69%), Gaps = 27/631 (4%)
 Frame = +2

Query  521   RSG--PFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLA  694
             RSG    G+VLDPR+K VQ WNR FLL     L +DPLFFYALS+  +   CL++DG  A
Sbjct  62    RSGGWSLGQVLDPRAKWVQEWNRGFLLVCATGLFVDPLFFYALSVSDTCM-CLFIDGWFA  120

Query  695   AIVTVLRTCLDAVHICHLWLQFRLA------YVSRESLVVGCGKLVWDARAVASHYVRSL  856
               VT LR   DA+H+ ++WLQ ++A                 G       +VA  Y+++ 
Sbjct  121   LTVTALRCMTDALHVWNMWLQLKMAKKPSIGGGIGGDYGDRSGPRFSSPSSVALRYLKAK  180

Query  857   KGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRM  1036
             KGF+FD FVILP+PQ + W+ +P L+    V ++MTI L+IFLFQ+LP+IYHS+ L+RRM
Sbjct  181   KGFFFDLFVILPLPQIILWVAIPSLLEGGSVTVVMTIFLIIFLFQYLPKIYHSVCLLRRM  240

Query  1037  QKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL  1216
             Q ++GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+++C  +   C LRL
Sbjct  241   QNLSGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRTAKCLKEKCR-ETQGCGLRL  299

Query  1217  -SCSEEVCYELLLPGGVEGNSCAGNSTAAA--LMRKPLCLDVNGPFRFGIYKWALPVVSS  1387
              SC E + Y      G       G   A A   + +  CLD +  + +G YKW + +V++
Sbjct  300   LSCKEPIYY------GTASKVRDGARLAWADNKVARATCLDSSDNYDYGAYKWTVQLVTN  353

Query  1388  RSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLH  1567
              S   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLH
Sbjct  354   GSRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLH  412

Query  1568  AVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGL  1747
             A  +KK+ MQL+ R++EWWM++R+LP   R RVR +ERQRWAAM G DE E+I++LPEGL
Sbjct  413   ATTSKKQAMQLKMRNIEWWMRKRRLPPEFRHRVRNYERQRWAAMRGVDECEMIRNLPEGL  472

Query  1748  RRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVR  1927
             RRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VR
Sbjct  473   RRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQRMLFVVR  532

Query  1928  GRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGL  2107
             G ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS T   +++TEAFGL
Sbjct  533   GHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSCTLVTLETTEAFGL  592

Query  2108  DANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT---  2278
             +A  ++++T HFRY F NER+KR+ARYYS  WRTWAAV +QLAWRRY+ R      +   
Sbjct  593   EAEDVKYVTQHFRYTFVNERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIR  652

Query  2279  ----VPENADDGDRRLRQYAAMFLSIRPHDH  2359
                 +   +  G+ RLR Y A+  S +P+  
Sbjct  653   PRRPLSRCSSLGEDRLRLYTALLTSPKPNQE  683



>ref|XP_007213607.1| hypothetical protein PRUPE_ppa002333mg [Prunus persica]
 gb|EMJ14806.1| hypothetical protein PRUPE_ppa002333mg [Prunus persica]
Length=686

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/639 (51%), Positives = 436/639 (68%), Gaps = 28/639 (4%)
 Frame = +2

Query  503   STQDFHRSGP---FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCL  673
             ST    R  P    G+VLDPR+K VQ WNR FLL     L IDPLFFYALSI  S   CL
Sbjct  51    STCSTRRRSPGWSLGQVLDPRAKWVQEWNRVFLLVCATGLIIDPLFFYALSIS-SNCMCL  109

Query  674   YMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVW---------DAR  826
             ++DG LA  VTVLR   D +H+ ++WLQ ++A     + +VG                AR
Sbjct  110   FVDGWLAITVTVLRCMTDVLHVWNMWLQLKMAKRYSFTAMVGGAGREGGGANGLRDTSAR  169

Query  827   AVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRI  1006
             +VA  Y+RS KGF+FD FVILPIPQ + W+V+P L+ +  V ++MT+ L+ F     P+I
Sbjct  170   SVALKYLRSKKGFFFDLFVILPIPQIILWVVIPTLLEKGSVTVVMTVFLMFFFQYL-PKI  228

Query  1007  YHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCH  1186
             YHS+ L+RRMQ ++GYIFGT+WWG  LNLIAYF+A+H AG CWY+L IQR   CL+++C 
Sbjct  229   YHSVCLLRRMQNLSGYIFGTVWWGIALNLIAYFVAAHAAGACWYLLGIQRAEKCLKEQCR  288

Query  1187  YQKSTCNLR-LSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYK  1363
              + S C+LR LSC   + Y    P          ++  A    K  CL+    + +G Y 
Sbjct  289   -EISGCSLRILSCKNPIYYGATNPLRDRARLAWADNKRA----KSTCLENADHYDYGAYS  343

Query  1364  WALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLI  1543
             W + +V++ S   KIL+PIFWGLMTLSTFGN LE ++ WLEV+F+I ++ SGL+L T+LI
Sbjct  344   WTVQLVTNDSRLEKILFPIFWGLMTLSTFGN-LESSTEWLEVVFNIIVLTSGLLLVTMLI  402

Query  1544  GNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMEL  1723
             GNI+VFLHA  +KK+ MQL+ R++EWWM++R LP   R RVR +ERQRWAAM G DE E+
Sbjct  403   GNIKVFLHATTSKKQAMQLKMRNIEWWMRKRHLPQGFRHRVRNYERQRWAAMRGVDECEM  462

Query  1724  IKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPV  1903
             I++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I REGDPV
Sbjct  463   IRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGETITREGDPV  522

Query  1904  QRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCI  2083
             QR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +
Sbjct  523   QRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTL  582

Query  2084  DSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR  2263
             ++TEAF L+A+ ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R  
Sbjct  583   ETTEAFSLEADDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLT  642

Query  2264  GQPNT-------VPENADDGDRRLRQYAAMFLSIRPHDH  2359
                 +       +   +  G+ RLR Y A+  S +P+D 
Sbjct  643   LTSLSFIRPRRPLSRCSSLGEDRLRLYTALLTSPKPNDQ  681



>ref|XP_011095264.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Sesamum indicum]
Length=669

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/625 (53%), Positives = 445/625 (71%), Gaps = 32/625 (5%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
             +G+VLDPR+  VQ WNR FLL     L +DPLFFYALS+      C+++DG  A  VTVL
Sbjct  55    WGKVLDPRASWVQEWNRIFLLGCAAGLFVDPLFFYALSVS-DNFMCVFVDGWFAVTVTVL  113

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             R   DA+H+ ++WLQ ++     Y + E +  G       ARAVA  Y++S KGF+FD F
Sbjct  114   RCMTDALHLWNMWLQLKMNRRPHYPNGERVHDGSSA---TARAVALKYLKSKKGFFFDLF  170

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP+PQ V W+V+P+L+ +    ++MT+LL++FLFQ+LP+IYHS+ L+RRMQ ++GYIF
Sbjct  171   VILPLPQIVMWVVIPRLLEKGSTTVVMTVLLIMFLFQYLPKIYHSVCLLRRMQNLSGYIF  230

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL-SCSEEVC  1237
             GT+WWG  LN+IAYF+ASH  G CWY+L IQR A CL+Q+C    + CN+R+ +C E + 
Sbjct  231   GTVWWGIALNMIAYFVASHAVGACWYLLGIQRAAKCLKQQC-IMSTGCNMRMMACQESIY  289

Query  1238  Y---ELLL--PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAV  1402
             Y   +L+   P  V G     N TA A      CL+    F +G YKW + +V++ +   
Sbjct  290   YGTKDLIRDRPRFVWGE----NKTARAT-----CLENYDNFDYGAYKWTVQLVTNDNRLE  340

Query  1403  KILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAK  1582
             KIL+PIFWGLMTLSTFGN LE T++WLEV+F I ++ +GL+L T+LIGNI+VFLHA  +K
Sbjct  341   KILFPIFWGLMTLSTFGN-LESTTDWLEVVFIIIVLTTGLLLVTMLIGNIKVFLHATTSK  399

Query  1583  KRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIK  1762
             K+ MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G DE E+ ++LPEGLRRDIK
Sbjct  400   KQAMQLKMRNIEWWMRKRRLPQAFRQRVRNYERQRWAAMRGVDECEMTRNLPEGLRRDIK  459

Query  1763  RFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKS  1942
               LCLDL+++VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++FIVRG ++S
Sbjct  460   YHLCLDLVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITREGDPVQRMLFIVRGHLQS  519

Query  1943  SQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHL  2122
             SQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  +
Sbjct  520   SQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDV  579

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------V  2281
             +++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRYR R      +       +
Sbjct  580   KYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRPRRPL  639

Query  2282  PENADDGDRRLRQYAAMFLSIRPHD  2356
                +  G+ RLR Y A+  S +P+ 
Sbjct  640   SRCSSLGEDRLRLYTALLTSPKPNQ  664



>ref|XP_008386094.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Malus 
domestica]
Length=691

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/659 (51%), Positives = 443/659 (67%), Gaps = 29/659 (4%)
 Frame = +2

Query  440   EASAGSSLIPIKNRPGSVTHR--STQDFHRSG-PFGRVLDPRSKRVQRWNRAFLLARGMA  610
             E S GSS     N   +  +   S Q   R G   G+VLDPR+K +Q WNR FLL     
Sbjct  38    EESDGSSTSHGGNFENNCLYNMCSLQRRRRPGWSLGQVLDPRAKWIQEWNRIFLLVCASG  97

Query  611   LAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA----YVS  778
             L IDPLFFYALSI +S   CL++DG LA  VTVLR   D +H+ ++WLQ ++A    + +
Sbjct  98    LIIDPLFFYALSISQSCM-CLFVDGWLAITVTVLRCMTDVLHVWNMWLQLKMAKRYSFTA  156

Query  779   RESLVVGCGKLVWDA--RAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVK  952
                   G    + D   R+VA  Y++S KGF FD FVILPIPQ + W+V+P L+    V 
Sbjct  157   MVGGDGGGATGLRDTSPRSVALKYLKSKKGFLFDLFVILPIPQIILWVVIPSLLERGSVT  216

Query  953   limtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGC  1132
             ++MT+ L+ F     P+IYHS+ L+RRMQ ++GYIFGT+WWG  LNLIAYF+A+H AG C
Sbjct  217   VVMTVFLMFFFQYL-PKIYHSVCLLRRMQNLSGYIFGTVWWGIALNLIAYFVAAHAAGAC  275

Query  1133  WYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLLPGGVEGNSCAGNSTAAALM  1309
             WY+L IQR   CL+++C  + S C LR L+C + + Y      G           A A  
Sbjct  276   WYLLGIQRAEKCLKEQCR-ESSGCGLRILACKDPIYY------GATNTLRDTARLAWAEN  328

Query  1310  RKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWL  1483
             RK    CLD    + +G Y W + +V++ S   KIL+PIFWGLMTLSTFGN LE ++ WL
Sbjct  329   RKARSTCLDNADHYDYGAYSWTVQLVTNDSRLEKILFPIFWGLMTLSTFGN-LESSTEWL  387

Query  1484  EVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQR  1663
             EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM++R LP   RQR
Sbjct  388   EVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAMQLKMRNIEWWMRKRHLPQGFRQR  447

Query  1664  VRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  1843
             VR +ERQRWAAM G DE E+I++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICD
Sbjct  448   VRNYERQRWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICD  507

Query  1844  RIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSW  2023
             R+K L+F K E I REGDPVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSW
Sbjct  508   RVKSLIFPKGETITREGDPVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSW  567

Query  2024  CLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANW  2203
             CLRRPFI+RLP SS+T   +++TEAF L+A  ++++T HFRY F NE++KR+ARYYS  W
Sbjct  568   CLRRPFIERLPPSSSTLVTLETTEAFSLEAEDVKYVTQHFRYTFVNEKVKRSARYYSPGW  627

Query  2204  RTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHDH  2359
             RTWAAV +QLAWRRY+ R      +       +   +  G+ RLR Y A+  S +P+D 
Sbjct  628   RTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDRLRLYTALLTSPKPNDQ  686



>ref|XP_008226715.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Prunus mume]
Length=685

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/626 (52%), Positives = 432/626 (69%), Gaps = 25/626 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              G+VLDPR+K VQ WNR FLL     L IDPLFFYALSI  S   CL++DG LA  VTVL
Sbjct  63    LGQVLDPRAKWVQEWNRVFLLVCATGLIIDPLFFYALSIS-SNCMCLFVDGWLAITVTVL  121

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVW---------DARAVASHYVRSLKGF  865
             R   D +H+ ++WLQ ++A     + +VG   +            AR+VA  Y+RS KGF
Sbjct  122   RCMTDVLHVWNMWLQLKMAKRYSFTAMVGGAGMEGGGANGLRDTSARSVALKYLRSKKGF  181

Query  866   WFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKV  1045
             +FD FVILPIPQ + W+V+P L+ +  V ++MT+ L+ F     P+IYHS+ L+RRMQ +
Sbjct  182   FFDLFVILPIPQIILWVVIPTLLEKGSVTVVMTVFLMFFFQYL-PKIYHSVCLLRRMQNL  240

Query  1046  TGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSC  1222
             +GYIFGT+WWG  LNLIAYF+A+H AG CWY+L IQR   CL+++C  + S C+LR LSC
Sbjct  241   SGYIFGTVWWGIALNLIAYFVAAHAAGACWYLLGIQRAEKCLKEQCR-EISGCSLRILSC  299

Query  1223  SEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAV  1402
                + Y               ++  A    +  CLD    + +G Y W + +V++ S   
Sbjct  300   KHPIYYGATNRLRDRARLAWADNKRA----RSTCLDNADHYDYGAYSWTVQLVTNDSRLE  355

Query  1403  KILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAK  1582
             KIL+PIFWGLMTLSTFGN LE ++ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +K
Sbjct  356   KILFPIFWGLMTLSTFGN-LESSTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSK  414

Query  1583  KRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIK  1762
             K+ MQL+ R++EWWM++R LP   R RVR +ERQRWAAM G DE E+I++LPEGLRRDIK
Sbjct  415   KQAMQLKMRNIEWWMRKRHLPQGFRHRVRNYERQRWAAMRGVDECEMIRNLPEGLRRDIK  474

Query  1763  RFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKS  1942
               LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I REGDPVQR++F+VRG ++S
Sbjct  475   YHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGETITREGDPVQRMLFVVRGHLQS  534

Query  1943  SQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHL  2122
             SQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAF L+A+ +
Sbjct  535   SQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFSLEADDV  594

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------V  2281
             +++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +
Sbjct  595   KYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPL  654

Query  2282  PENADDGDRRLRQYAAMFLSIRPHDH  2359
                +  G+ RLR Y A+  S +P+D 
Sbjct  655   SRCSSLGEDRLRLYTALLTSPKPNDQ  680



>ref|XP_003634689.2| PREDICTED: cyclic nucleotide-gated ion channel 4 [Vitis vinifera]
Length=706

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/618 (53%), Positives = 428/618 (69%), Gaps = 18/618 (3%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
               RVLDPR+K VQ WNR FLL     L +DPLFFY LSI  S   CL++DG  A  VT L
Sbjct  92    LSRVLDPRAKWVQEWNRVFLLVCATGLFVDPLFFYVLSIN-STCMCLFVDGWFAITVTAL  150

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGC-GKLVWDARA--VASHYVRSLKGFWFDAFV  883
             R   DA+H+ ++WLQ ++A   R   VVG  G  + DA A  VA  Y+++ KGF+FD FV
Sbjct  151   RCMTDALHLWNMWLQLKMA--KRTFHVVGEEGSRLHDASASTVALRYLKAKKGFFFDLFV  208

Query  884   ILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFG  1063
             ILP+PQ V W+ +P L+       +MT+LL+IFLFQ+LP+IYHS+ L+ RMQ V+GYIFG
Sbjct  209   ILPLPQIVLWVAIPSLLERGLTTTVMTVLLIIFLFQYLPKIYHSVCLLLRMQNVSGYIFG  268

Query  1064  TIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYE  1243
             TIWWG  LN+IAYF+ASH AG CWY+L +QR A CL++ C          L+C   + Y 
Sbjct  269   TIWWGIVLNMIAYFVASHAAGACWYLLGLQRAAKCLKEECAVANYCSTKTLACKNPIYYG  328

Query  1244  LLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIF  1423
                           N+  A    +  CLD    F +G Y+W + +V++ +   KIL+P+F
Sbjct  329   TTSLLKDRARLAWANNKHA----RSTCLDSADNFEYGGYRWTIQLVTNDNRLEKILFPLF  384

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGLMTLSTFGN LE T+ WLEVIF+I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL+
Sbjct  385   WGLMTLSTFGN-LESTTEWLEVIFNIIVLTSGLILVTMLIGNIKVFLHATTSKKQTMQLK  443

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
              R++EWWM+RR+LP   RQRVR +ERQ+WAAM G DE ++ K+LPEGLRRDIK  LCLDL
Sbjct  444   MRNIEWWMRRRKLPLGFRQRVRNYERQKWAAMRGVDECQMTKNLPEGLRRDIKYHLCLDL  503

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKG  1963
             +++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++SSQ L  G
Sbjct  504   VRQVPLFQHMDDLVLENICDRVKSLIFTKGEVITREGDPVQRMLFVVRGHLQSSQVLRDG  563

Query  1964  VVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHF  2143
             V +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A+ ++++T HF
Sbjct  564   VKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLITLETTEAFGLEADDVKYVTQHF  623

Query  2144  RYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDG  2302
             RY F  ER+KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       V   +  G
Sbjct  624   RYTFVKERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPVSRCSSLG  683

Query  2303  DRRLRQYAAMFLSIRPHD  2356
             + RLR Y AM  S +P+ 
Sbjct  684   EDRLRLYTAMLTSPKPNQ  701



>gb|KDP38949.1| hypothetical protein JCGZ_00706 [Jatropha curcas]
Length=698

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/643 (51%), Positives = 432/643 (67%), Gaps = 33/643 (5%)
 Frame = +2

Query  518   HRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAA  697
              R    G+VLDPR++ VQ WNR FLL     L +DPLFFYALS+  +   CL++DG  A 
Sbjct  61    QRGWSLGQVLDPRARWVQEWNRIFLLVCATGLFVDPLFFYALSVSDTCM-CLFIDGWFAI  119

Query  698   IVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVAS-------------  838
              VT LR   DA+H+ ++WLQFR+A         G G                        
Sbjct  120   TVTALRCMTDALHVWNMWLQFRMARKPSNIGSGGEGGGGGGVGQGGQGRGGSGGGGGPCF  179

Query  839   ------HYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflP  1000
                    Y+++ KGF+FD FV+LP+PQ V W+ +P L+    V ++MT+LL+IFLFQ+LP
Sbjct  180   TIPSSLRYIKAKKGFFFDLFVVLPLPQIVLWVAIPSLLERGSVTVVMTVLLIIFLFQYLP  239

Query  1001  RIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQR  1180
             +IYHS+ L+RRMQ ++GYIFGT+WWG  LNLIAYF+ASH AG CWY+L IQR A CL ++
Sbjct  240   KIYHSVCLLRRMQNISGYIFGTVWWGIALNLIAYFVASHAAGACWYLLGIQRAAKCLEEQ  299

Query  1181  CHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIY  1360
             C  +   C +RL   +E  Y        +G   A      A   +  CLD +  + +G Y
Sbjct  300   CR-ETHGCRMRLLSCKETIYYGTTSKVRDGARLAWADNKVA---RATCLDSSDNYDYGAY  355

Query  1361  KWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLL  1540
             KW + +VS+ S   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+L
Sbjct  356   KWTVQLVSNDSRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTML  414

Query  1541  IGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEME  1720
             IGNI+VFLHA  +KK+ MQL+ R+MEWWM++R LP   R RVR +ERQRWAAM G DE E
Sbjct  415   IGNIKVFLHATTSKKQAMQLKMRNMEWWMRKRHLPHEFRHRVRNYERQRWAAMRGVDECE  474

Query  1721  LIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDP  1900
             +I++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDP
Sbjct  475   MIRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDP  534

Query  1901  VQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTC  2080
             VQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   
Sbjct  535   VQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVT  594

Query  2081  IDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRT  2260
             +++TEAFGL+A  ++++T HFRY F NER+KR+ARYYS  WRTWAAV +QLAWRRY+ R 
Sbjct  595   LETTEAFGLEAEDVKYVTQHFRYTFVNERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRL  654

Query  2261  RGQPNT-------VPENADDGDRRLRQYAAMFLSIRP-HDHLE  2365
                  +       +   +  G+ RLR Y A+  S +P HD  +
Sbjct  655   TLTSLSFIRPRRPLSRCSSLGEDRLRLYTALLTSPKPNHDDFD  697



>ref|XP_007021254.1| Cyclic nucleotide-gated ion channel 4 isoform 1 [Theobroma cacao]
 gb|EOY12779.1| Cyclic nucleotide-gated ion channel 4 isoform 1 [Theobroma cacao]
Length=823

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/636 (52%), Positives = 440/636 (69%), Gaps = 33/636 (5%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             R    G+VLDPR+K VQ WNR FLL     L +DPLFFY LSI  +   CL++DG  A  
Sbjct  192   RGWSLGQVLDPRAKWVQEWNRVFLLVCATGLFVDPLFFYVLSISDTCM-CLFIDGWFAIT  250

Query  701   VTVLRTCLDAVHICHLWLQFRLA----YVSRESLVVG----------CGKLVWDARAVAS  838
             VT LR   DA+H+ ++WLQ ++A    Y S  +               G L  +AR VA 
Sbjct  251   VTALRCMTDALHVWNMWLQLKMAKRSSYGSNATHGGSDVGGGGGRERSGPLGANARRVAI  310

Query  839   HYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSI  1018
              Y+++ KGF+FD FVILP+PQAV W+ +P L+ +  V L+MT+ L+IFLFQ+LP+IYHS+
Sbjct  311   KYLKARKGFFFDLFVILPLPQAVLWVAIPSLLEKGSVTLVMTVFLIIFLFQYLPKIYHSV  370

Query  1019  YLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKS  1198
              L+RRMQ ++GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A C++++C   + 
Sbjct  371   CLLRRMQNLSGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRSAKCMKEQCRVVE-  429

Query  1199  TCNLRL-SCSEEVCYELLLPGGVEG--NSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWA  1369
              C+ RL +C E + Y      G        A  + A     +  C+D    + +G YKW 
Sbjct  430   VCDPRLLACKEPIYY------GTSNMVRDRARLAWAENKQARRTCIDSPENYDYGAYKWT  483

Query  1370  LPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGN  1549
             + +V++ S   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGN
Sbjct  484   VQLVTNDSRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGN  542

Query  1550  IQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIK  1729
             I+VFLHA  +KK+ MQL+ R++EWWM++R LPS  RQRVR +ERQRWAAM G DE E+I+
Sbjct  543   IKVFLHATTSKKQAMQLKMRNIEWWMRKRHLPSGFRQRVRNYERQRWAAMRGVDECEMIR  602

Query  1730  DLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQR  1909
             +LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR
Sbjct  603   NLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQR  662

Query  1910  VVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDS  2089
             ++F+VRG ++SSQ L   V +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++
Sbjct  663   MLFVVRGHLQSSQVLRDSVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLET  722

Query  2090  TEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQ  2269
             TEAFGL+A  ++++T HFRY F NER+KR+ARYYS  WRTWAAV +QLAWRRYR R    
Sbjct  723   TEAFGLEAEDVKYVTQHFRYTFVNERVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLT  782

Query  2270  PNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
               +       +  +   G+ RLR Y AM  S +P+ 
Sbjct  783   SLSFIRPRRPLSRSNSLGEDRLRLYTAMLTSPKPNQ  818



>ref|XP_004294484.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Fragaria 
vesca subsp. vesca]
Length=692

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/634 (52%), Positives = 434/634 (68%), Gaps = 38/634 (6%)
 Frame = +2

Query  524   SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSI-GRSGTPCLYMDGGLAAI  700
             S   G+VLDPR+K VQ WNR FLL     L IDPLFFYALSI GR    CL++DG  A  
Sbjct  70    SWSLGQVLDPRAKWVQEWNRVFLLVCATGLVIDPLFFYALSISGRC--MCLFVDGWFAIT  127

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDA------RAVASHYVRSLKG  862
             VTVLR   D +H+ ++WLQ ++A     + +VG G+   +       R+VA  Y++  KG
Sbjct  128   VTVLRCMTDVLHVWNMWLQLKMAKRYSFTAMVGGGEGTNNGLRDTSPRSVAMRYLKGKKG  187

Query  863   FWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQK  1042
             F FD FVILPIPQ V W+V+P L+    V ++MT+ L+ F+    P+IYHS+ L+RRMQ 
Sbjct  188   FLFDLFVILPIPQIVLWVVIPALLERGSVTVVMTVFLMFFIQYL-PKIYHSVCLLRRMQN  246

Query  1043  VTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LS  1219
             ++GYIFGT+WWG  LNLIAYF+A+H AG CWY+L IQR   CL+++C  + + C LR LS
Sbjct  247   LSGYIFGTVWWGIALNLIAYFVAAHAAGACWYLLGIQRAEKCLKEQCR-ETAGCGLRILS  305

Query  1220  CSEEVCYELLLPGGVEGN-------SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPV  1378
             C +   Y      G E N       + A N  A     +  CLD    + +G + W + +
Sbjct  306   CKDPFYY------GKETNLRDRARIAWANNKQA-----RSTCLDSPDHYDYGAFAWTVQL  354

Query  1379  VSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQV  1558
              ++ S   KIL+PIFWGLMTLSTFGN LE ++ WLEV+F+I ++ SGL+L T+LIGNI+V
Sbjct  355   FTNTSRLEKILFPIFWGLMTLSTFGN-LESSTEWLEVVFNIIVLTSGLLLVTMLIGNIKV  413

Query  1559  FLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLP  1738
             FLHA  +KK+ MQL+ R++EWWM++R LP   RQRVR +ERQRWAAM G DE E+I++LP
Sbjct  414   FLHATTSKKQAMQLKMRNIEWWMRKRHLPMGFRQRVRNYERQRWAAMRGVDECEMIRNLP  473

Query  1739  EGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVF  1918
             EGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I REGDPVQR++F
Sbjct  474   EGLRRDIKYHLCLDLVRQVPLFQYMDDLVLENICDRVKSLIFPKGETITREGDPVQRMLF  533

Query  1919  IVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEA  2098
             +VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEA
Sbjct  534   VVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLITLETTEA  593

Query  2099  FGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT  2278
             F L+A  ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +
Sbjct  594   FSLEAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLS  653

Query  2279  -------VPENADDGDRRLRQYAAMFLSIRPHDH  2359
                    +   +  G+ RLR Y A+  S +P+D 
Sbjct  654   FIRPRRPLSRCSSLGEDRLRLYTALLTSPKPNDQ  687



>ref|XP_006452002.1| hypothetical protein CICLE_v10010507mg [Citrus clementina]
 ref|XP_006464668.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Citrus 
sinensis]
 gb|ESR65242.1| hypothetical protein CICLE_v10010507mg [Citrus clementina]
Length=695

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/625 (52%), Positives = 437/625 (70%), Gaps = 25/625 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
             FG+VLDPR+K VQ WNR FLL     L +DPLFFYALSI  +   CL++DG  A  VT L
Sbjct  74    FGQVLDPRAKWVQEWNRVFLLVCATGLFVDPLFFYALSISETCM-CLFVDGWFAITVTAL  132

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWD--------ARAVASHYVRSLKGFW  868
             R   D +H+ ++WLQ ++   +             D        +R+VA  Y+++ KGF+
Sbjct  133   RCMTDLLHVWNMWLQLKMTKAAYGVGGAAAAADDEDKRPRSGPHSRSVALRYMKAKKGFF  192

Query  869   FDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVT  1048
             FD FVILP+PQ V W+V+P L+    + L+MT+ L++FLFQ+LP+IYHS+ L+RRMQ ++
Sbjct  193   FDLFVILPLPQIVLWVVIPALLERGSITLVMTVFLIMFLFQYLPKIYHSVCLLRRMQNLS  252

Query  1049  GYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL-SCS  1225
             GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CLR++C  + + C+LRL SC 
Sbjct  253   GYIFGTVWWGIVLNMIAYFVASHAAGACWYLLGIQRSAKCLREQCR-EMNGCDLRLLSCK  311

Query  1226  EEVCYELLLPGGVEG-NSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAV  1402
             E + Y     G  +     A  + A     +  C++ +  + +G YKW + +V++ S   
Sbjct  312   EPIYY-----GTTDMVRDRARLAWAENKQARSTCIESSNNYDYGAYKWTVQLVTNVSRLE  366

Query  1403  KILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAK  1582
             KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +K
Sbjct  367   KILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSK  425

Query  1583  KRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIK  1762
             K+ MQL+ R++EWWM++RQLP   RQRVR +ERQRWAAM G DE E+I +LPEGLRRDIK
Sbjct  426   KQAMQLKMRNIEWWMRKRQLPQGFRQRVRNYERQRWAAMRGVDECEMISNLPEGLRRDIK  485

Query  1763  RFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKS  1942
               LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGDPVQR++F+VRG ++S
Sbjct  486   YHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGEVITKEGDPVQRMLFVVRGHLQS  545

Query  1943  SQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHL  2122
             SQ L   + +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  +
Sbjct  546   SQILHNNIKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLITLETTEAFGLEAEDV  605

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------V  2281
             +++T HFRY F  E++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +
Sbjct  606   KYVTQHFRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPL  665

Query  2282  PENADDGDRRLRQYAAMFLSIRPHD  2356
                +  G+ RLR Y A+  S +P+ 
Sbjct  666   SRCSSLGEDRLRLYTALLTSPKPNQ  690



>gb|KEH19596.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=672

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/615 (52%), Positives = 433/615 (70%), Gaps = 21/615 (3%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             +DPR+K VQ WNR FLL     L +DPLFFYALSI  S   CL++DG  A  VTVLR   
Sbjct  63    VDPRAKWVQEWNRVFLLVCAAGLFVDPLFFYALSISDSCM-CLFIDGWFAVTVTVLRCMT  121

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR-AVASHYVRSLKGFWFDAFVILPIPQ  901
             DA+H  +++L+F+ A   R SL         D R  VA  Y++S +GF+FD FVILPIPQ
Sbjct  122   DALHFWNIFLRFKTA--KRSSLTFASHSATADGRRLVALAYLKSRRGFFFDLFVILPIPQ  179

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              V W+ +P L+ +  V L+MTI L++FLFQ+LP+IYHS+  +RR Q ++GYIFGT+WWG 
Sbjct  180   IVLWVAIPSLLEQGSVTLVMTIFLIVFLFQYLPKIYHSVCHLRRTQNLSGYIFGTVWWGI  239

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL-SCSEEVCY--ELLL  1252
              LN+IAYF+ASH AG CWY+L IQR + CL+++C Y+ + C + L SC + + Y    LL
Sbjct  240   ALNMIAYFVASHAAGACWYLLGIQRASKCLKEQC-YKTNGCGMNLLSCHKPMYYGSTSLL  298

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                +   + AGN  A     +  CL+    F +G YKW + + ++ +   K+L+PIFWGL
Sbjct  299   NKDMARMAWAGNREA-----RSTCLNSPDSFNYGAYKWTVQLFTNENRLEKVLFPIFWGL  353

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T++WLEV+F+I I+ SGL+L T+LIGNI+VFLHA  +KK+ MQLR R+
Sbjct  354   MTLSTFGN-LESTTDWLEVVFNIIILTSGLLLVTMLIGNIKVFLHATTSKKQVMQLRIRN  412

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +EWWM+++ LP   RQRVR +ERQRWAAM G DE E+ K+LPEGLRRDIK  LCLDL+++
Sbjct  413   VEWWMRKKHLPQGFRQRVRNYERQRWAAMRGVDECEMTKNLPEGLRRDIKYHLCLDLVRQ  472

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++SSQ L  G+ +
Sbjct  473   VPLFQHMDELVLENICDRVKSLIFTKGETIAREGDPVQRMLFVVRGHLQSSQVLRDGLKS  532

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPFI+RLP S++T   +++TEAFGL+A  ++++T HFRY 
Sbjct  533   CCMLGPGNFSGDELLSWCLRRPFIERLPLSTSTLVTLETTEAFGLEAEDVKYVTQHFRYT  592

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             F  E++KR+ARYYS  WRTW AV +QLAWRRYR R      +       +   +  G+ R
Sbjct  593   FVKEKVKRSARYYSPGWRTWGAVAIQLAWRRYRHRLTLNSLSFIRPRRPLSRCSSLGEDR  652

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  653   LRLYTALLTSPKPNQ  667



>ref|XP_010101777.1| hypothetical protein L484_018733 [Morus notabilis]
 gb|EXB89632.1| hypothetical protein L484_018733 [Morus notabilis]
Length=711

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/651 (50%), Positives = 438/651 (67%), Gaps = 43/651 (7%)
 Frame = +2

Query  512   DFHRSG-PFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGG  688
             D  R G   G VLDPR+K VQ WNR FLL     L +DPLFFYALSI  +   CL++DG 
Sbjct  64    DRRRKGWSLGHVLDPRAKWVQEWNRVFLLVCATGLFVDPLFFYALSISDT-CMCLFVDGW  122

Query  689   LAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESL-----VVGCGKLVWDARAVASHYVRS  853
              A  VTVLR   DA+H+ ++WLQ ++A  S  ++         G     AR+VA  Y+++
Sbjct  123   FAVTVTVLRCMTDALHVWNMWLQLKMAKRSFAAVGAVDGSAAAGLRDATARSVALRYLKA  182

Query  854   LKGFWFDAFVILPIPQ--------------------AVFWLVVPKLIREEQVKlimtill  973
              +GF FD FVILP+PQ                     V W+ +P L+    V ++MT+ L
Sbjct  183   KRGFLFDLFVILPLPQLWTTMPSWLLTSEEVQSGNTIVLWVAIPSLLERGAVTIVMTVFL  242

Query  974   liflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQ  1153
             +IFLFQ+LP+IYHS+ L+RRMQ ++GYIFGT+WWG  LNLIAYF+ASH AG CWY+L IQ
Sbjct  243   IIFLFQYLPKIYHSVCLLRRMQNLSGYIFGTVWWGIALNLIAYFVASHAAGACWYLLGIQ  302

Query  1154  RVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR--KPLCL  1327
             R A CL+++C          LSC E + Y      G       G   + AL +  +  CL
Sbjct  303   RAAKCLKEQCGATSGCGPTILSCKEPIYY------GGSSMVRDGPRLSWALNKQARSACL  356

Query  1328  DVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICI  1507
             D    + +G Y+W + +V++ S   K+L+PIFWGLMTLSTFGN LE T+ WLEV+F+I +
Sbjct  357   DSADNYDYGAYRWTVQLVTNNSRLEKMLFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIV  415

Query  1508  VLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQR  1687
             + SGL+L T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM++R LP   RQRVR +ERQR
Sbjct  416   LTSGLLLVTMLIGNIKVFLHATTSKKQAMQLKMRNIEWWMRKRHLPQGFRQRVRNYERQR  475

Query  1688  WAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFS  1867
             WAAM G DE E+I++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+
Sbjct  476   WAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFT  535

Query  1868  KDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFID  2047
             K E I REGDPVQR++F+VRG ++SSQ L  G+ +  +L PG F GDELLSWCLRRPFI+
Sbjct  536   KGETITREGDPVQRMLFVVRGHLQSSQVLRDGLKSCCMLGPGNFSGDELLSWCLRRPFIE  595

Query  2048  RLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNV  2227
             RLP SS+T   +++TEAFGL+A  ++++T HFRY F NE++KR+ARYYS  WRTWAAV +
Sbjct  596   RLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAI  655

Query  2228  QLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHDH  2359
             QLAWRRY+ R      +       +   +  G+ RL+ Y A+  S +P+D 
Sbjct  656   QLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDRLKLYTALLTSPKPNDQ  706



>ref|XP_010062911.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Eucalyptus 
grandis]
 gb|KCW70056.1| hypothetical protein EUGRSUZ_F03358 [Eucalyptus grandis]
Length=698

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/626 (51%), Positives = 429/626 (69%), Gaps = 26/626 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              G+VLDPRSK VQ W+R FLL     L +DPLFFYALS+  +   CL++DG  A  VTVL
Sbjct  76    LGQVLDPRSKWVQEWSRVFLLVCATGLFVDPLFFYALSVSDTCM-CLFIDGWFAITVTVL  134

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVW---------DARAVASHYVRSLKGF  865
             R   DA+H+ ++WLQ ++A     S     G              + AVA  Y+++ KG 
Sbjct  135   RCMTDALHVWNMWLQLKMANRRFSSHAAAFGSGRGGGRGKLHDTGSGAVALRYLKARKGL  194

Query  866   WFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKV  1045
              FD FVILP+PQ V W+ +P  +   +   +MT+LL++FLFQ+LP+IYH + L+RRMQ +
Sbjct  195   LFDLFVILPLPQVVLWVAIPSQLERGETTRVMTVLLIMFLFQYLPKIYHFVCLLRRMQNL  254

Query  1046  TGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCS  1225
             +GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CLR+ C          L+C 
Sbjct  255   SGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLREHCRSTNGCFPRVLACK  314

Query  1226  EEVCYELLLPGGVEGNSCAGNSTAAALMR--KPLCLDVNGPFRFGIYKWALPVVSSRSIA  1399
             E + Y      G  G    G   A    R  + +CLD +  + +G YKW + +V++ S  
Sbjct  315   EPIYY------GTTGMVRDGARLAWGENRQARSMCLDSSENYDYGAYKWTVQLVTNDSRL  368

Query  1400  VKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMA  1579
              KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +
Sbjct  369   EKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTS  427

Query  1580  KKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDI  1759
             KK+ MQL+ R++EWWM++R+LP   RQRVR +ERQ WAAM G +E E+I++LPEGLRRDI
Sbjct  428   KKQAMQLKMRNIEWWMRKRRLPQGFRQRVRNYERQHWAAMRGVNECEMIRNLPEGLRRDI  487

Query  1760  KRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVK  1939
             K  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++
Sbjct  488   KYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIAREGDPVQRMLFVVRGHLQ  547

Query  1940  SSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANH  2119
             SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  
Sbjct  548   SSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFGLEAED  607

Query  2120  LRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------  2278
             ++++T HFRY F NER+KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       
Sbjct  608   VKYVTQHFRYTFVNERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRP  667

Query  2279  VPENADDGDRRLRQYAAMFLSIRPHD  2356
             +   +  G+ RLR Y A+  S +P+ 
Sbjct  668   LSRCSSLGEDRLRLYTALLTSPKPNQ  693



>gb|EYU19163.1| hypothetical protein MIMGU_mgv1a002305mg [Erythranthe guttata]
Length=689

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/631 (51%), Positives = 437/631 (69%), Gaps = 33/631 (5%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
             +G+VLDPRS  V+ WNR FLL     L +DPLFFYALSI  +   CL++DG  +  VTVL
Sbjct  64    WGKVLDPRSTWVREWNRIFLLVCATGLFVDPLFFYALSISENCM-CLFVDGWFSVTVTVL  122

Query  713   RTCLDAVHICHLWLQFRL-----------AYVSR----ESLVVGCGKLVWDARAVASHYV  847
             R   DA+H+ ++WLQF++           A V R    + L++  G     A  VA  Y 
Sbjct  123   RCMTDALHLWNMWLQFKMNRRPHHPHHGGAAVERHGGADGLMMHDGA---TAGEVAWKYF  179

Query  848   RSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLM  1027
             +S KGF+ D FVILP+PQ V W+ +PKL+ +     +MT+LL+ FLFQ+LP+IYHS+ L+
Sbjct  180   KSKKGFFLDLFVILPLPQIVMWVAIPKLLEKGSTTAVMTVLLVTFLFQYLPKIYHSVGLL  239

Query  1028  RRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN  1207
             RRMQ ++GYIFGT+WWG  LNLIAYF+ASH  G CWY+L IQR A CL+++C   K  CN
Sbjct  240   RRMQNLSGYIFGTVWWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKKQCMSTKD-CN  298

Query  1208  LRL-SCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVS  1384
              R+ +C E + Y              G++  A    +  CL+    F +G YKW + +V+
Sbjct  299   ERMMACQESIYYGTKDIISDRTRFMWGDNKFA----RTTCLENYDNFDYGAYKWTVQLVT  354

Query  1385  SRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFL  1564
             + +   KIL+PIFWGLMTLSTFGN LE T++WLEV+F I ++ +GL+L T+LIGNI+VFL
Sbjct  355   NNNRLEKILFPIFWGLMTLSTFGN-LESTTDWLEVVFIIIVLTTGLLLVTMLIGNIKVFL  413

Query  1565  HAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEG  1744
             HA  +KK+ MQL+ R++EWWM++R+LP   +QRVR +ERQRWAAM G DE ++ ++LPEG
Sbjct  414   HATTSKKQAMQLKMRNIEWWMRKRRLPQTFKQRVRNYERQRWAAMRGVDECDMTRNLPEG  473

Query  1745  LRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIV  1924
             LRRDIK  LCLDL+++VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++FIV
Sbjct  474   LRRDIKYHLCLDLVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITREGDPVQRMLFIV  533

Query  1925  RGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFG  2104
             RG ++SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFG
Sbjct  534   RGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFG  593

Query  2105  LDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT--  2278
             L+A  ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRYR R      +  
Sbjct  594   LEAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFI  653

Query  2279  -----VPENADDGDRRLRQYAAMFLSIRPHD  2356
                  +   +  G+ RLR Y A+  S +P+ 
Sbjct  654   RPRRPLSRCSSLGEDRLRLYTALLTSPKPNQ  684



>ref|XP_009613618.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Nicotiana 
tomentosiformis]
Length=672

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/618 (51%), Positives = 432/618 (70%), Gaps = 29/618 (5%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G+V+DPR+  VQ WNR FLL     L +DPLFFYALSI  +   CL++DG  A  VT LR
Sbjct  68    GKVIDPRAPWVQEWNRIFLLVCATGLFVDPLFFYALSISENCI-CLFIDGWFAVTVTALR  126

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
                DA+H+ ++WLQFR+  +                R+VA  Y+++ KGF+FD FVILP+
Sbjct  127   CMTDALHLWNMWLQFRMNKLRPHDKN--------PPRSVALRYLKAKKGFFFDLFVILPL  178

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W+ +P L+ +  +  +MT+LL++FLFQ+LP+IYHS+ L+RRMQ ++GYIFGT+WW
Sbjct  179   PQIVMWVAIPDLLEKGSITTVMTVLLIMFLFQYLPKIYHSVCLLRRMQGLSGYIFGTVWW  238

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLL  1252
             G  LNLIAYF+ASH  G CWY+L IQR A CL+Q+C   K  C LR L+C E + Y    
Sbjct  239   GIALNLIAYFVASHAVGACWYLLGIQRAAKCLKQQCEITKG-CGLRMLACEESIYYGTTS  297

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                 +     G +  A    +  CL     F +G YKW + +V++ +   KIL+PIFWGL
Sbjct  298   LVKHKSRLIWGETKLA----RSTCLSSEESFDYGAYKWTVQLVTNENRLEKILFPIFWGL  353

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T++WLE++F I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL+ R+
Sbjct  354   MTLSTFGN-LESTTDWLELVFIIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAMQLKMRN  412

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +EWWM+RR+LP + +QRVR +ERQR+AA  G DE E+I +LPEGLRRDIK  LCLDL+++
Sbjct  413   VEWWMRRRRLPQDYKQRVRNYERQRYAATRGVDECEMIHNLPEGLRRDIKYHLCLDLVRQ  472

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++FIVRG ++SSQ L  GV +
Sbjct  473   VPLFQHMDNLVLENICDRVKSLIFTKGETITREGDPVQRMLFIVRGHLQSSQVLRDGVKS  532

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPF++RLP SS++   +++TEAFGL+A+ ++++T HFRY 
Sbjct  533   CCMLGPGNFSGDELLSWCLRRPFVERLPPSSSSLVTLETTEAFGLEADDVKYVTQHFRYT  592

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYR----------LRTRGQPNTVPENADDG  2302
             F +E++KR+ARYYS  WRTWAAV +QLAWRRY+          +R R   +      +D 
Sbjct  593   FVDEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLTED-  651

Query  2303  DRRLRQYAAMFLSIRPHD  2356
               RL+ Y A+  S +P+ 
Sbjct  652   --RLKLYTALLTSPKPNQ  667



>ref|XP_009765747.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X1 [Nicotiana sylvestris]
Length=669

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/622 (51%), Positives = 433/622 (70%), Gaps = 37/622 (6%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G+++DPR+  VQ WNR FLL     L +DPLFFYALSI  +   CL++DG  A  VT LR
Sbjct  65    GKIIDPRAAWVQEWNRIFLLVCATGLFVDPLFFYALSISENCI-CLFIDGWFAVSVTALR  123

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
                DA H+C++WLQFR+  +                R+VA  Y+++ KGF+FD FVILP+
Sbjct  124   CMTDAFHLCNMWLQFRMNKLRPNDKS--------PRRSVALRYLKAKKGFFFDLFVILPL  175

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W+ +P L+ +  +  +MT+LL++FLFQ+LP+IYHS+ L+RRMQ  +GYIFGT+WW
Sbjct  176   PQIVMWVAIPDLLEKGSITTVMTVLLIMFLFQYLPKIYHSVCLLRRMQGFSGYIFGTVWW  235

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLL  1252
             G  LNLIAYF+ASH  G CWY+L IQR A CL+++C   K  C +R L+C E + Y    
Sbjct  236   GIALNLIAYFVASHAVGACWYLLGIQRAAKCLKEQCGVTKG-CGVRMLACEESIYYG---  291

Query  1253  PGGVEGNSCAGNST----AAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
                   NS   + +        + +  CL     F +G YKW + +V++ +   KIL+PI
Sbjct  292   -----TNSLVKHKSRIIWGETKLARTTCLSSEESFDYGAYKWTVQLVTNENRLEKILFPI  346

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGN LE T++WLE++F I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL
Sbjct  347   FWGLMTLSTFGN-LESTTDWLELVFIIIVLTSGLILVTMLIGNIKVFLHATTSKKQAMQL  405

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             + R++EWWM+RR+LP N +QR+R +ERQ++AA  G DE E+I++LPEGLRRDIK  LCLD
Sbjct  406   KMRNVEWWMRRRRLPQNYKQRMRNYERQKYAATRGVDECEMIQNLPEGLRRDIKYHLCLD  465

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+++VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++FIVRG ++SSQ L  
Sbjct  466   LVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITREGDPVQRMLFIVRGHLQSSQVLRD  525

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
             GV +  +L PG F GDELLSWCLRRPF++RLP SS++   +++TEAFGL+A+ ++++T H
Sbjct  526   GVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSSLVTLETTEAFGLEADDVKYVTQH  585

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR----------LRTRGQPNTVPEN  2290
             FRY F +E++KR+ARYYS  WRTWAAV +QLAWRRY+          +R R   +     
Sbjct  586   FRYTFVDEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSL  645

Query  2291  ADDGDRRLRQYAAMFLSIRPHD  2356
              +D   RLR Y A+  S +P+ 
Sbjct  646   TED---RLRLYTALLTSPKPNQ  664



>ref|XP_007149641.1| hypothetical protein PHAVU_005G086600g [Phaseolus vulgaris]
 gb|ESW21635.1| hypothetical protein PHAVU_005G086600g [Phaseolus vulgaris]
Length=671

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/625 (51%), Positives = 433/625 (69%), Gaps = 39/625 (6%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
             F  +LDPR+K VQ WNR FLL     L +DPLFFYALSI  +   CL++DG L   VTV+
Sbjct  62    FWVLLDPRAKWVQEWNRVFLLVSATGLFVDPLFFYALSISDTCM-CLFVDGWLVVTVTVI  120

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             R   D +H+ ++WLQF++A    +++R++  +  G         A  Y++  +GF FD F
Sbjct  121   RCMTDTLHVWNMWLQFKMAKRSSFLARDAYSLRGG--------YALRYLKDKRGFLFDLF  172

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILPIPQ V W+ +P L+ +  + L+MT+ L++FLFQ+LP+IYHS+ L+RRMQ ++GYIF
Sbjct  173   VILPIPQIVLWVAIPSLLEKGSITLVMTVFLIMFLFQYLPKIYHSVCLLRRMQNLSGYIF  232

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY  1240
             GT+WWG  LN+IAYF+ASH AG CWY+L +QR A CL ++C  + + C LR  C +E  Y
Sbjct  233   GTVWWGIALNMIAYFVASHAAGACWYLLGLQRAAKCLEEQCA-KTAGCGLRTLCCKEPIY  291

Query  1241  ELLLPGGVEGNSCAGNST----AAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
                      G S   + T    A     +  CLD    + +G Y W++ +V++ +   KI
Sbjct  292   -------YGGTSIVRDKTRLSWAENREARSTCLDSADNYDYGAYAWSVQLVTNDNRLEKI  344

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L+PIFWGLMTLSTFGN LE T   LEVIF+I ++ SGL+L T+LIGNI+VFLHA  +KK+
Sbjct  345   LFPIFWGLMTLSTFGN-LESTPERLEVIFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQ  403

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              MQL+ R++EWWM +R+LP + RQRVR +ERQRWAAM G DE ++IK+LPEGLRRDIK  
Sbjct  404   AMQLKMRNIEWWMSKRRLPQSFRQRVRNYERQRWAAMRGVDECQMIKNLPEGLRRDIKYH  463

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+++VPLF  +DDL+L+NICDR+K LVF+K E I REGDPVQR++F+VRG ++SSQ
Sbjct  464   LCLDLVRQVPLFQHMDDLVLENICDRVKSLVFTKGETITREGDPVQRMLFVVRGHLQSSQ  523

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  +++
Sbjct  524   VLRDGVKSYCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLEATEAFGLEAKDVKY  583

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR----------LRTRGQPNT  2278
             +T HFRY F  E++KR+ARYYS  WRTWAAV +QLAWRRY+          +R R   + 
Sbjct  584   VTQHFRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTCLSFIRPRRPASR  643

Query  2279  VPENADDGDRRLRQYAAMFLSIRPH  2353
                  +D   RLR Y A+  S +P+
Sbjct  644   CTSMEED---RLRLYTALLTSPKPN  665



>ref|XP_010904922.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Elaeis guineensis]
Length=654

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/633 (51%), Positives = 432/633 (68%), Gaps = 22/633 (3%)
 Frame = +2

Query  500   RSTQDFH-RSGPF--GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPC  670
             ++ Q++  RSG +  G  LDPR+K V+ WNRA+LLA    L IDPLFFYALS+      C
Sbjct  25    QANQNYDPRSGRWLPGLALDPRAKWVREWNRAYLLACAAGLIIDPLFFYALSVS-GPLMC  83

Query  671   LYMDGGLAAIVTVLRTCLDAVHICHLWLQFRL--AYVSRESLVVGCGKLVWDARAVASHY  844
             +++DG  A  VTVLR  +DA+H+ ++WLQ ++  A V R       G       A    Y
Sbjct  84    VFIDGWFAITVTVLRCMVDAMHVWNIWLQLKMTSAAVRRSDGEEDGGARKGQQGAAVLAY  143

Query  845   VRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYL  1024
              +  KGF+ D FVILP+ Q V W+  P LI +  +  +MT+LL+ FLF++LP+IYHS+  
Sbjct  144   FKPKKGFFLDLFVILPVMQVVMWVAAPALIAKGSITTVMTVLLVTFLFEYLPKIYHSVCS  203

Query  1025  MRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC  1204
             +RRMQ  +GYIFGTIWWG  LNL+AYF+ASH  G CWY+L IQR A CL ++C       
Sbjct  204   LRRMQNFSGYIFGTIWWGIALNLMAYFVASHAVGACWYLLGIQRAAKCLNRQCKLTTECG  263

Query  1205  NLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAA--LMRKPLCLDVNGPFRFGIYKWALPV  1378
                ++C   + Y      G   +   G+  A A  L  + +CLD +  F +G YKW +P+
Sbjct  264   PKTVACVNPIYY------GTTTSIRDGDRLAWAKNLHARQMCLDSSDNFEYGAYKWTVPL  317

Query  1379  VSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQV  1558
             V++ S   KIL PIFWGLMTLSTFGN LE T+ WLE++F+I I+ SGL+L T+LIGNI+V
Sbjct  318   VTNTSRLEKILLPIFWGLMTLSTFGN-LESTTEWLEIVFNIIIITSGLILVTMLIGNIKV  376

Query  1559  FLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLP  1738
             FLHA  +KK+ M LR R +EWWMKR++LP   RQRVR +ERQRWAAM G DE E+I++LP
Sbjct  377   FLHATTSKKQAMHLRMRSVEWWMKRKRLPQGFRQRVRQYERQRWAAMRGVDECEMIRNLP  436

Query  1739  EGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVF  1918
             EGLRRDIK  LCLDL+++VPLF  +D+L L+NICDR+K L+F K E I REGDPVQR++F
Sbjct  437   EGLRRDIKYHLCLDLVRQVPLFQHMDELALENICDRVKSLIFPKGETITREGDPVQRMLF  496

Query  1919  IVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEA  2098
             IVRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEA
Sbjct  497   IVRGHLQSSQVLRNGVQSCCMLGPGNFTGDELLSWCLRRPFIERLPLSSSTLVTVETTEA  556

Query  2099  FGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR------T  2260
             FGL+A+ ++++T HFRY F +E+L+R+ARYYS  WRTWAAV +QLAWRRY+ R      +
Sbjct  557   FGLEASDVKYVTQHFRYTFVSEKLRRSARYYSPGWRTWAAVAIQLAWRRYKHRKTLTSLS  616

Query  2261  RGQPNTVPENADD-GDRRLRQYAAMFLSIRPHD  2356
               +P       +  G+ +LR Y A+  S +P+ 
Sbjct  617   FIRPRRPLSRCNSLGEEKLRLYTALLTSPKPNQ  649



>gb|KFK27042.1| hypothetical protein AALP_AA8G326400 [Arabis alpina]
Length=693

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/627 (51%), Positives = 436/627 (70%), Gaps = 30/627 (5%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y LS+  +   CL +DG L+  VTVL
Sbjct  70    LGRILDPRSKWVQEWNRVFLLVCATGLFVDPLFLYTLSVNDTCM-CLLVDGWLSLTVTVL  128

Query  713   RTCLDAVHICHLWLQFRLA--------YVSRESLVVGCGKLVWDARAVAS-HYVRSLKGF  865
             R+  D +H+ ++WLQF++A                +  G      R VA+  YV+  KGF
Sbjct  129   RSMTDILHLWNMWLQFKIARRWPYPAGDGGDSDGDINKGGGGARLRRVATPSYVKIKKGF  188

Query  866   WFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKV  1045
             +FD FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ++P+IYHS+  +R    +
Sbjct  189   FFDLFVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLIAFLFQYIPKIYHSVRHLRENATL  248

Query  1046  TGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSC  1222
             +GYIFGT+WWG  LN++AYF+A+H AG CWY+L +QR A CL+++C      C+LR LSC
Sbjct  249   SGYIFGTVWWGIALNMVAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTMGCDLRMLSC  307

Query  1223  SEEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRS  1393
              E V Y   E++L       + AGN  A     + +CLD+N  + +G Y+W + +VS+ S
Sbjct  308   KEPVYYGTTEMVLDRA--RLAWAGNHQA-----RSVCLDINTNYTYGAYQWTIQLVSNES  360

Query  1394  IAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAV  1573
                KIL+PIFWGLMTLSTFGN LE T+ W EVIF+I ++ SGL+L T+LIGNI+VFLHA 
Sbjct  361   RLEKILFPIFWGLMTLSTFGN-LESTTEWSEVIFNIIVLTSGLLLVTMLIGNIKVFLHAT  419

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
              +KK+ M L+ R++EWWMK+R LP   +QRVR +ERQRWAAM G DE E++++LPEGLRR
Sbjct  420   TSKKQAMHLKMRNIEWWMKKRHLPLGFKQRVRNYERQRWAAMRGVDECEMVQNLPEGLRR  479

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGR  1933
             DIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+++K E I +EGD VQR++F+VRG 
Sbjct  480   DIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIYTKGETIQKEGDAVQRMLFVVRGH  539

Query  1934  VKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDA  2113
             ++SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA
Sbjct  540   LQSSQLLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDA  599

Query  2114  NHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-----  2278
               ++++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +     
Sbjct  600   EDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPR  659

Query  2279  --VPENADDGDRRLRQYAAMFLSIRPH  2353
               +   A  G+ +LR Y A+  S +P+
Sbjct  660   RPLSRCASLGEDKLRLYTAILTSPKPN  686



>ref|XP_006401592.1| hypothetical protein EUTSA_v10012835mg [Eutrema salsugineum]
 gb|ESQ43045.1| hypothetical protein EUTSA_v10012835mg [Eutrema salsugineum]
Length=698

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/625 (52%), Positives = 437/625 (70%), Gaps = 31/625 (5%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y LS+  +   CL +DG LA  VT L
Sbjct  81    LGRILDPRSKLVQEWNRVFLLVCATGLFVDPLFLYVLSVN-AACMCLLVDGWLALTVTAL  139

Query  713   RTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASHYVRSLKGFWF  871
             R+  D +H+ ++WLQF++A    Y  R+S   +  G G  V     VA  YV+  KGF+F
Sbjct  140   RSMTDLLHLWNIWLQFKIARRWPYPGRDSDGDINEGDGTRV--RTRVAPPYVKK-KGFFF  196

Query  872   DAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTG  1051
             D FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHSI  +R    ++G
Sbjct  197   DLFVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLISFLFQYLPKIYHSIRHLRENATLSG  256

Query  1052  YIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSE  1228
             YIFGT WWG  LN++AYF+A+H AG CWY+L +QR A CL+++C      C+LR LSC E
Sbjct  257   YIFGTAWWGIALNMMAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTMGCDLRMLSCKE  315

Query  1229  EVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIA  1399
              V Y   E++L       + A N  A     + +CLD+N  + +G Y+W + +VS+ S  
Sbjct  316   PVYYGTTEMVLDRA--RLAWAQNHQA-----RSICLDINTNYTYGAYQWTIQLVSNESRL  368

Query  1400  VKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMA  1579
              KIL+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +
Sbjct  369   EKILFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTS  427

Query  1580  KKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDI  1759
             KK+ M L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDI
Sbjct  428   KKQGMHLKMRNIEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDI  487

Query  1760  KRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVK  1939
             K  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++
Sbjct  488   KYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQ  547

Query  1940  SSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANH  2119
             SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  
Sbjct  548   SSQLLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAED  607

Query  2120  LRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------  2278
             ++++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       
Sbjct  608   VKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRP  667

Query  2279  VPENADDGDRRLRQYAAMFLSIRPH  2353
             +   A  G+ +LR Y A+  S +P+
Sbjct  668   LSRCASLGEDKLRLYTAILTSPKPN  692



>ref|XP_011044529.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Populus euphratica]
Length=687

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/625 (51%), Positives = 431/625 (69%), Gaps = 20/625 (3%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             R    G+VLDPR K VQ WNR FLL     L +DPLFFY LSI  +   CL++DG  A  
Sbjct  65    RGWSLGQVLDPRGKWVQEWNRVFLLVCATGLFVDPLFFYVLSISDTCM-CLFVDGWFAIT  123

Query  701   VTVLRTCLDAVHICHLWLQFRLA-----YVSRESLVVGCGKLVWDARAVASHYVRSLKGF  865
             VT LR   D +++ ++WLQ ++A                G  V    + A  Y+++ KGF
Sbjct  124   VTALRCMTDVLYLWNMWLQLKIAKRPHGGGESGGDGERGGSRVAGPCSSALRYLKAKKGF  183

Query  866   WFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKV  1045
             +FD FVILP+PQ V W+ +P L+++  V L+M + L+IFLFQ+LP+I++S+ L+RRMQ +
Sbjct  184   FFDLFVILPLPQIVLWVAIPSLLQKGSVTLMMNVFLIIFLFQYLPKIHYSVCLLRRMQSL  243

Query  1046  TGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL-SC  1222
             +GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+++C  +   C L L SC
Sbjct  244   SGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLKEQC-IETPGCGLGLLSC  302

Query  1223  SEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAV  1402
              E + Y        +      ++  A    + +CLD    + +G YKW + +V++ S   
Sbjct  303   KEPIYYGTTRKVMEKARWAWADNKQA----RSMCLDSPDKYDYGAYKWTVQLVTNDSRLE  358

Query  1403  KILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAK  1582
             KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +K
Sbjct  359   KILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSK  417

Query  1583  KRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIK  1762
             K+ MQL+ R++EWWM++R LP+  RQRVR +ERQRWAAM G DE E+I++LPEGLRRDIK
Sbjct  418   KQAMQLKMRNIEWWMRKRHLPTGFRQRVRNYERQRWAAMRGVDECEMIRNLPEGLRRDIK  477

Query  1763  RFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKS  1942
               LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++S
Sbjct  478   YHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQRMLFVVRGHLQS  537

Query  1943  SQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHL  2122
             SQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  +
Sbjct  538   SQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFGLEAEDV  597

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------V  2281
             +++T HFRY F  ER+KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +
Sbjct  598   KYVTQHFRYTFVKERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPL  657

Query  2282  PENADDGDRRLRQYAAMFLSIRPHD  2356
                +  G+ RLR Y A+  S +P+ 
Sbjct  658   SRCSSLGEDRLRLYTALLTSPKPNQ  682



>ref|XP_009792554.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X1 [Nicotiana sylvestris]
Length=657

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/615 (51%), Positives = 424/615 (69%), Gaps = 27/615 (4%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
              +++DPR++ VQ WNR FLLA  + L +DPLFFYALSI  S   CL++DG  A  VT LR
Sbjct  57    NKIIDPRAQWVQEWNRVFLLACAIGLFLDPLFFYALSISESCM-CLFVDGWFAVTVTALR  115

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
                DA+H+ ++WLQF++   SR +              VA  Y ++ KGF FD FVILP+
Sbjct  116   CMTDALHVWNMWLQFKMINRSRRN------------HMVAQPYFKAKKGFLFDLFVILPL  163

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W+ +P L+ +     +MT+LL++FLFQ+LP+IYHS+ L+RRMQ ++GYIFGT+WW
Sbjct  164   PQLVMWVGIPALLEKGSTTTVMTVLLIMFLFQYLPKIYHSVCLLRRMQNLSGYIFGTVWW  223

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLL  1252
             G  LN IAYF+ASH  G CWY+L IQR A CL+++C      C L+ L+C E + Y    
Sbjct  224   GIALNTIAYFVASHAVGACWYLLGIQRAAKCLKEQCRVTNG-CGLKMLACQEPIYYGTSN  282

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                 +     G ++ A       CL+    F +G YKW + + ++ +   KIL PIFWGL
Sbjct  283   LVKEKSRLIWGETSNARFT----CLNNGENFDYGAYKWTVQLFANENRFEKILLPIFWGL  338

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T++WLEVIF I ++ SGL+L T+ IGNI+VFLHA  +KK+ MQL+ R+
Sbjct  339   MTLSTFGN-LESTTDWLEVIFIIIVLTSGLILVTMFIGNIKVFLHATTSKKQAMQLKMRN  397

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +EWWM+RR LP  L+QR R FERQ+WAAM G DE E+I++LPEGLRRDIK  LCLDL+++
Sbjct  398   IEWWMRRRHLPRELKQRTRNFERQKWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQ  457

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+NICDR+K L+F+K E I +EGDPVQR++FIVRG ++SSQ L  GV +
Sbjct  458   VPLFQHMDNLVLENICDRVKSLIFTKGETITKEGDPVQRMLFIVRGHLQSSQLLRDGVKS  517

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++T HFRY 
Sbjct  518   CCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYT  577

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             F  E++KR+ARYYS  WRTW AV +QLAWRRY+ R      +       +   +  G+ R
Sbjct  578   FVKEKVKRSARYYSPGWRTWGAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDR  637

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  638   LRIYTALLTSPKPNQ  652



>ref|XP_008812641.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Phoenix dactylifera]
Length=654

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/617 (52%), Positives = 422/617 (68%), Gaps = 17/617 (3%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             G  LDPR+K V+ WNRA+L A    L +DPLF YALS+      C+++DG  A  VTVLR
Sbjct  40    GWALDPRAKWVREWNRAYLFACAAGLIVDPLFLYALSVS-GPLMCVFIDGWFAITVTVLR  98

Query  716   TCLDAVHICHLWLQFRLA--YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVIL  889
               +D +H+ ++WLQ ++A   V R       G       A    Y +S KGF+ D FVIL
Sbjct  99    CMVDTMHVWNIWLQLKMACGAVRRSDGEEDGGARKGQHGAALLPYFKSKKGFFLDLFVIL  158

Query  890   PIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTI  1069
             P+ Q V W+  P LIR+  +  +MT+LL++FLF++LP+IYHS+  +RRMQ  +GYIFGTI
Sbjct  159   PVMQVVMWVAAPALIRKGSITSVMTVLLIMFLFEYLPKIYHSVCFLRRMQNFSGYIFGTI  218

Query  1070  WWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELL  1249
             WWG  LNLIAYF+ASH  G CWY+L IQR A CL+++C          ++C   V Y   
Sbjct  219   WWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKEQCILTTGCGPKTVACVNPVYYGTT  278

Query  1250  LPGGVEGN-SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFW  1426
                   G  + A NS A     + +CLD +  F++G YKW +P+V++ S   KIL PIFW
Sbjct  279   TSIREGGRMAWAKNSRA-----RTMCLDSSDNFQYGAYKWTVPLVTNTSRLEKILLPIFW  333

Query  1427  GLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRC  1606
             GLMTLSTFGN LE T+ WLE++F+I I+ SGL+L T+LIGNI+VFLHA  +KK+ M LR 
Sbjct  334   GLMTLSTFGN-LESTTEWLEIVFNIIIITSGLILVTMLIGNIKVFLHATTSKKQAMHLRM  392

Query  1607  RDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLI  1786
             R +EWWMKR++LP   RQRVR +ERQRWAAM G DE E+I++LPEGLRRDIK  LCLDL+
Sbjct  393   RSVEWWMKRKRLPQGFRQRVRQYERQRWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLV  452

Query  1787  KKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGV  1966
             ++VPLF  +D+L L+NICDR+K L+F K E I REGDPVQR++FIVRG ++SSQ L   V
Sbjct  453   RQVPLFQHMDELALENICDRVKSLIFPKGETITREGDPVQRMLFIVRGHLQSSQVLRNSV  512

Query  1967  VATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFR  2146
              +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  ++++T HFR
Sbjct  513   QSCCMLGPGNFTGDELLSWCLRRPFIERLPLSSSTLVTVETTEAFGLEAGDVKYVTQHFR  572

Query  2147  YKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR------TRGQPNTVPENADD-GD  2305
             Y F +E+L+R+ARYYS  WRTWAAV +QLAWRRY+ R      +  +P       +  G+
Sbjct  573   YTFVSEKLRRSARYYSPGWRTWAAVAIQLAWRRYKHRKTLTSLSFIRPRRPLSRCNSLGE  632

Query  2306  RRLRQYAAMFLSIRPHD  2356
              +LR Y A+  S +P+ 
Sbjct  633   EKLRLYTALLTSPKPNQ  649



>ref|XP_004510076.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X1 [Cicer arietinum]
 ref|XP_004510077.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X2 [Cicer arietinum]
Length=675

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/619 (51%), Positives = 433/619 (70%), Gaps = 29/619 (5%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             +DPR K VQ WNR FL      L +DPLFFYALSI  S   C+++DG  A  VT LR   
Sbjct  66    VDPREKWVQEWNRVFLFVCAAGLFVDPLFFYALSISDSFI-CIFVDGWFAVTVTALRCMT  124

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR-AVASHYVRSLKGFWFDAFVILPIPQ  901
             DA+H+ +++L+F++A   R          V+D+R +VA+ Y++S  GF+FD FVILPIPQ
Sbjct  125   DALHLWNIFLRFKMA--KRSFGFAANSTAVFDSRRSVATAYLKSRFGFFFDVFVILPIPQ  182

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              V W+ +P L+ +  V  +MTILL++FLFQ+LP+IYHS+  +RR Q ++GYIFGT+WWG 
Sbjct  183   IVLWVAIPSLLEQGSVTFVMTILLIVFLFQYLPKIYHSVCHLRRTQNLSGYIFGTVWWGI  242

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLLPG  1258
              LN+IAYF+ASH AG CWY+L IQR A CLR++CH + + C ++ +SC + + Y      
Sbjct  243   ALNMIAYFVASHAAGACWYLLGIQRAAKCLREQCH-KTNGCGIQIMSCHKPIYY------  295

Query  1259  GVEGNSCAGNSTAAAL------MRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
                G++   N   A L        +  CL     + +G Y W + +V++ +   KIL+PI
Sbjct  296   ---GSTSLWNRDRARLDWAENREARSTCLSGPDNYNYGAYSWTVQLVTNENRLEKILFPI  352

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGN LE T++WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL
Sbjct  353   FWGLMTLSTFGN-LESTTDWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQVMQL  411

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             + R++EWWM+++ LP   RQRVR +ERQRWAAM G DE E+ ++LPEGLRRDIK  LCLD
Sbjct  412   KMRNVEWWMRKKNLPQGFRQRVRNYERQRWAAMRGVDECEMTRNLPEGLRRDIKYHLCLD  471

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+++VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++SSQ L  
Sbjct  472   LVRQVPLFQHMDELVLENICDRVKSLIFTKGETIAREGDPVQRMLFVVRGHLQSSQVLRD  531

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
             GV +  +L PG F GDELLSWCLRRPFI+RLP S++T   +++TEAFGL+A  ++++T H
Sbjct  532   GVKSCCMLGPGNFSGDELLSWCLRRPFIERLPLSTSTLVTLETTEAFGLEAEDVKYVTQH  591

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADD  2299
             FRY F  E++KR+ARYYS  WRTWAAV +QLAWRRYR R      +       +   +  
Sbjct  592   FRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLATLSFIRPRRPLSRCSSL  651

Query  2300  GDRRLRQYAAMFLSIRPHD  2356
             G+ RLR Y A+  S +P+ 
Sbjct  652   GEDRLRLYTALLTSPKPNQ  670



>ref|XP_006370343.1| hypothetical protein POPTR_0001s41830g [Populus trichocarpa]
 gb|ERP66912.1| hypothetical protein POPTR_0001s41830g [Populus trichocarpa]
Length=716

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/626 (51%), Positives = 431/626 (69%), Gaps = 20/626 (3%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             R    G+VLDPR K VQ WNR FLL     L +DPLFFY LSI  +   CL++DG  A  
Sbjct  94    RGWSLGQVLDPRGKWVQEWNRVFLLVCATGLFVDPLFFYVLSISDTCM-CLFVDGWFAIT  152

Query  701   VTVLRTCLDAVHICHLWLQFRLA-----YVSRESLVVGCGKLVWDARAVASHYVRSLKGF  865
             VT LR   D +++ ++WLQ ++A                G  V    + A  Y+++ KGF
Sbjct  153   VTALRCMTDVLYLWNMWLQLKIAKRPHGGGESGGDGERGGSRVAGPCSSALRYLKAKKGF  212

Query  866   WFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKV  1045
             +FD FVILP+PQ V W+ +P L+++  V L+M + L+IFLFQ+LP+I++S+ L+RRMQ +
Sbjct  213   FFDLFVILPLPQIVLWVGIPSLLQKGSVTLLMNVFLIIFLFQYLPKIHYSVCLLRRMQSL  272

Query  1046  TGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL-SC  1222
             +GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+++C  +   C L L SC
Sbjct  273   SGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLKEQC-IETPGCGLGLLSC  331

Query  1223  SEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAV  1402
              E + Y        +      ++  A    + +CLD    + +G YKW + +V++ S   
Sbjct  332   KEPIYYGTTRKVMEKARWAWADNKLA----RSMCLDSPDKYDYGAYKWTVQLVTNDSRLE  387

Query  1403  KILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAK  1582
             KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +K
Sbjct  388   KILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSK  446

Query  1583  KRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIK  1762
             K+ MQL+ R++EWWM++R LP+  RQRVR +ERQRWAAM G DE E+I++LPEGLRRDIK
Sbjct  447   KQAMQLKMRNIEWWMRKRHLPTGFRQRVRNYERQRWAAMRGVDECEMIRNLPEGLRRDIK  506

Query  1763  RFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKS  1942
               LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++S
Sbjct  507   YHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITREGDPVQRMLFVVRGHLQS  566

Query  1943  SQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHL  2122
             SQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  +
Sbjct  567   SQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFGLEAEDV  626

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------V  2281
             +++T HFRY F  ER+KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +
Sbjct  627   KYVTQHFRYTFVKERVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPL  686

Query  2282  PENADDGDRRLRQYAAMFLSIRPHDH  2359
                +  G+ RLR Y A+  S +P+  
Sbjct  687   SRCSSLGEDRLRLYTALLTSPKPNQE  712



>ref|XP_003539580.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Glycine 
max]
Length=683

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/632 (51%), Positives = 435/632 (69%), Gaps = 28/632 (4%)
 Frame = +2

Query  509   QDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGG  688
             ++F+R   F  VLDPR K VQ WNR FLL     L +DPLFFYALSI  +   CL++DG 
Sbjct  59    ENFNRRREFRVVLDPRGKWVQEWNRVFLLVCATGLFVDPLFFYALSISDTCM-CLFVDGW  117

Query  689   LAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVG-----CGKLVWDARAVASHYVRS  853
             L   VT LR   DA+H+ ++WL+F++A   R S  +G      G         A  Y+++
Sbjct  118   LVITVTALRCMTDALHVWNMWLEFKMA--KRSSSFIGRDTNASGGGGGGGGGYALRYLKA  175

Query  854   LKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRR  1033
              +GF+FD FVILPIPQ V W+ +P L+++  + L++T+ L++FLFQ+LP+IYHS+ L+RR
Sbjct  176   KRGFFFDLFVILPIPQIVLWVTIPFLLKKGSITLVVTVFLIMFLFQYLPKIYHSVCLLRR  235

Query  1034  MQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR  1213
             MQ ++GYI GT+WWG  LNLIAYF+ASH AG CWY+L +QR A CL ++C  + + C LR
Sbjct  236   MQDLSGYISGTVWWGIALNLIAYFVASHAAGACWYLLGLQRAAKCLEEQCA-KTTGCGLR  294

Query  1214  LSCSEEVCYELLLPGGVEGNSCAGNST----AAALMRKPLCLDVNGPFRFGIYKWALPVV  1381
               C    C E +  GG+   +   + T    A     +  CLD    + +G+Y+W++ +V
Sbjct  295   TLC----CKEPIYYGGI---NIVRDKTRLLWAQNREARSTCLDSADNYDYGVYEWSVQLV  347

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             ++ S   KIL+PIFWGLMTLSTFGN LE T   LEVIF+I ++ SGL+L T+LIGNI+VF
Sbjct  348   TNDSRLEKILFPIFWGLMTLSTFGN-LESTPERLEVIFNIIVLTSGLLLVTMLIGNIKVF  406

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             LH+  +KK+ M LR R++EWWM +R+LP   RQRVR +ER RWAA  G DE ++IK+LPE
Sbjct  407   LHSTTSKKQAMLLRMRNIEWWMSKRRLPQGFRQRVRNYERMRWAATRGVDECQMIKNLPE  466

Query  1742  GLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFI  1921
             GLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K LVF+K E I +EGDPVQR++F+
Sbjct  467   GLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLVFTKGETITKEGDPVQRMLFV  526

Query  1922  VRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAF  2101
             VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS T   +++TEAF
Sbjct  527   VRGHLQSSQVLRDGVKSFCMLGPGNFSGDELLSWCLRRPFIERLPPSSCTLVTLETTEAF  586

Query  2102  GLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-  2278
             GL+A  ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R      + 
Sbjct  587   GLEAQDVKYVTQHFRYTFVNEKVKRSARYYSPAWRTWAAVAIQLAWRRYQHRLTLTSLSF  646

Query  2279  ------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                   +  +    + RLR Y AM  S +P+ 
Sbjct  647   IRPRRPLSRSTSMEEDRLRLYTAMLTSPKPNQ  678



>ref|XP_006367652.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Solanum 
tuberosum]
Length=688

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/626 (50%), Positives = 437/626 (70%), Gaps = 27/626 (4%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
             +V+DPR+  VQ WNR FLL     L +DPLFFYALSI  +   CL++DG  A  VTVLR 
Sbjct  65    KVIDPRAPWVQEWNRVFLLVCATGLFVDPLFFYALSISETCM-CLFIDGWFAVTVTVLRC  123

Query  719   CLDAVHICHLWLQFRLAYVS------RESLVVGCGK---LVWDARA---VASHYVRSLKG  862
               DA+H+ ++W+QF++  +        E+L+    +   L  D      VA  Y++S KG
Sbjct  124   MTDAMHLWNMWIQFKMHKLRPYDGKMDENLISSSSRGSRLHQDQSFRCFVALRYLKSKKG  183

Query  863   FWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQK  1042
             F+FD FVILP+PQ V W+ +P L+ +  +  +MT+LL++FLFQ+LP+IYHS+ L+RRMQ 
Sbjct  184   FFFDLFVILPLPQIVMWVGIPGLLEKGYITTVMTVLLIMFLFQYLPKIYHSVCLLRRMQN  243

Query  1043  VTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LS  1219
             ++GYIFGT+WWG  LNLIAYF+ASH  G CWY+L IQR A CL+Q+C    + C+LR L+
Sbjct  244   LSGYIFGTVWWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKQQCRV-TNVCSLRMLA  302

Query  1220  CSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIA  1399
             C E++ Y        +     G +  A    +  CL     F +G+YKW + +V++ +  
Sbjct  303   CEEQIFYGTSSLVKHKSRVIWGETKIA----RSTCLASEHNFGYGVYKWTVQLVTNENRF  358

Query  1400  VKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMA  1579
              KIL+PIFWGLMTLSTFGN LE T++WLE +F I ++ +GL+L T+LIGNI+VFLHA  +
Sbjct  359   EKILFPIFWGLMTLSTFGN-LESTTDWLEDVFIIIVLTTGLLLVTMLIGNIKVFLHATTS  417

Query  1580  KKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDI  1759
             KK+ MQL+ R++EWWM+RR+LP   +QRVR +ER R+AA  G DE E+I +LPEGLRRDI
Sbjct  418   KKQAMQLKMRNVEWWMRRRRLPQGFKQRVRNYERHRFAATRGVDEYEMISNLPEGLRRDI  477

Query  1760  KRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVK  1939
             K  LCLDL+++VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++FIVRG ++
Sbjct  478   KYHLCLDLVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITREGDPVQRMLFIVRGHLQ  537

Query  1940  SSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANH  2119
             SSQ L  GV +  +L PG F GDELLSWCLR+PF++RLP SS++   +++TEAFGL+A+ 
Sbjct  538   SSQELRDGVESCCMLGPGNFSGDELLSWCLRKPFVERLPPSSSSLVTLETTEAFGLEADD  597

Query  2120  LRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------  2278
             ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRYR R      +       
Sbjct  598   VKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRPRRP  657

Query  2279  VPENADDGDRRLRQYAAMFLSIRPHD  2356
             +  ++   + RLR Y A+  S +P+ 
Sbjct  658   LSRSSSLTEDRLRLYTALLTSPKPNQ  683



>ref|XP_007132934.1| hypothetical protein PHAVU_011G137200g [Phaseolus vulgaris]
 gb|ESW04928.1| hypothetical protein PHAVU_011G137200g [Phaseolus vulgaris]
Length=773

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/640 (51%), Positives = 439/640 (69%), Gaps = 26/640 (4%)
 Frame = +2

Query  482   PGSVTHRSTQDFHRSG--PFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGR  655
             P     RST +    G    G+VLDPR+K VQ WNR FLL     L +DPLFFYALS+  
Sbjct  140   PTGAGWRSTAECGGDGRRTLGKVLDPRAKWVQEWNRVFLLVCAAGLFVDPLFFYALSVSD  199

Query  656   SGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR--A  829
             S   C+++DG LA  VTVLR   DA+H+ ++ L+ ++A   + +  +G    + D R   
Sbjct  200   SCM-CVFVDGWLAVTVTVLRCMTDALHLWNMVLRMKMA---KRTFGLGAAAGLRDTRPRT  255

Query  830   VASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIY  1009
             VA  Y++S  GF FD FVILP+PQ V W+ +P L+ +  V L+MT+ L+IFLFQ+LP+IY
Sbjct  256   VALGYLKSRTGFIFDLFVILPLPQIVLWVAIPSLLEKGSVTLVMTVFLIIFLFQYLPKIY  315

Query  1010  HSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHY  1189
             HS+  +RR Q ++GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+ +C  
Sbjct  316   HSVCHLRRTQNLSGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLKVQCG-  374

Query  1190  QKSTCNLR-LSCSEEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGI  1357
             + S C +  LSC   + Y   + LL       + A N        +  CL+    + +G 
Sbjct  375   KTSGCGMNILSCQSPIYYGSNKSLLVRDRARLAWAENREV-----RQTCLNGPDNYNYGA  429

Query  1358  YKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTL  1537
             Y+W + +V + +   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+
Sbjct  430   YRWTVQLVKNNNRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTM  488

Query  1538  LIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEM  1717
             LIGNI+VFLHA  +KK+ MQL+ R++EWWM++R+LP   RQRVR +ER RWAAM G DE 
Sbjct  489   LIGNIKVFLHATTSKKQAMQLKMRNIEWWMRKRRLPQGFRQRVRNYERHRWAAMRGVDEY  548

Query  1718  ELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGD  1897
             E+ ++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGD
Sbjct  549   EMTRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIAREGD  608

Query  1898  PVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFT  2077
             PVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T  
Sbjct  609   PVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLI  668

Query  2078  CIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR  2257
              +++TEAFGL+A  ++++T HFRY F  E++KR+ARYYS  WRTWAAV +QLAWRRY+ R
Sbjct  669   TLETTEAFGLEAEDVKYVTQHFRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHR  728

Query  2258  TRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                   +       +  ++  G+ RLR Y A+  S +P+ 
Sbjct  729   LTLTSLSFIRPRRPLSRSSSMGEDRLRLYTALLTSPKPNQ  768



>emb|CDY18313.1| BnaC09g30630D [Brassica napus]
Length=698

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/635 (50%), Positives = 442/635 (70%), Gaps = 28/635 (4%)
 Frame = +2

Query  503   STQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMD  682
             S+  +++    GR+LDPRSK VQ WN+ FLL     L +DPLF Y +S+      CL +D
Sbjct  67    SSSSYNKWMMLGRILDPRSKLVQEWNKVFLLVCATGLFVDPLFLYTISVN-DACMCLLVD  125

Query  683   GGLAAIVTVLRTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASH  841
             G LA  +T +R+  D +H+ ++W+QF++A    Y   +S      G    +  +R VA  
Sbjct  126   GWLALTITAVRSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGDETRLRTSRRVAPP  185

Query  842   YVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIY  1021
             YV+    F+FD FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHS+ 
Sbjct  186   YVKKKGTFFFDLFVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSVR  245

Query  1022  LMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
              +R+   ++GYIFGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      
Sbjct  246   HLRQNATLSGYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-STMG  304

Query  1202  CNLR-LSCSEEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWA  1369
             C+LR LSC E V Y   E++L       + A N+ A     + +CLD+N  + +G YKW 
Sbjct  305   CDLRMLSCKEPVYYGTTEMVLDRA--RLAWAQNNQA-----RSICLDINTNYTYGAYKWT  357

Query  1370  LPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGN  1549
             + +VS+ S   KIL+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGN
Sbjct  358   IQLVSNESRLEKILFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGN  416

Query  1550  IQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIK  1729
             I+VFLHA  +KK+ M L+ R++EWWMK+RQLP   +QRVR +ERQRWAAM G DE E+++
Sbjct  417   IKVFLHATTSKKQAMHLKMRNIEWWMKKRQLPLGYKQRVRNYERQRWAAMRGVDECEMVQ  476

Query  1730  DLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQR  1909
             +LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR
Sbjct  477   NLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQR  536

Query  1910  VVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDS  2089
             ++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP S++T   +++
Sbjct  537   MLFVVRGHLQSSQLLRDGVRSCCMLGPGNFSGDELLSWCLRRPFVERLPPSTSTLVTLET  596

Query  2090  TEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQ  2269
             TEAFGLDA  ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R    
Sbjct  597   TEAFGLDAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLT  656

Query  2270  PNT-------VPENADDGDRRLRQYAAMFLSIRPH  2353
               +       +   A  G+ +LR Y A+  S +P+
Sbjct  657   SLSFIRPRRPLSRCASLGEDKLRLYTAILTSPKPN  691



>ref|XP_006362932.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Solanum 
tuberosum]
Length=661

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/613 (51%), Positives = 422/613 (69%), Gaps = 28/613 (5%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
              +++DP+++ V+ WNR FLL   + L +DPLFFY +SI  +   CL++DG  +  VTVLR
Sbjct  64    SKLIDPKAQWVKEWNRVFLLVCAIGLFVDPLFFYTISISENCM-CLFVDGWFSVTVTVLR  122

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
                D +H+C++WLQF               K+V + R     Y+++ KGF FD FVILP+
Sbjct  123   CINDGLHVCNMWLQF---------------KMVINRRTNNIPYLKANKGFLFDLFVILPL  167

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W+ +P L+ +     +MT+LL+IFLFQ+LP+IYHSI L+RRMQ ++GYIFGT+WW
Sbjct  168   PQLVMWVGIPILLEKGLTTTVMTVLLIIFLFQYLPKIYHSICLLRRMQNLSGYIFGTVWW  227

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             G  LN+IAYF+ASH  G CWY+L IQR A CL+++C   K  C L++   EE  Y     
Sbjct  228   GIALNIIAYFVASHAVGACWYLLGIQRAAKCLKEQCIVTKG-CTLKMLACEESIYYGTSN  286

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
                E N      T  A   +  CL     F +G YKW + +VS+ +   KIL PIFWGLM
Sbjct  287   LVKEKNRLMWGETINA---RLTCLKNGQNFDYGAYKWTVQLVSNENRIEKILLPIFWGLM  343

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGN LE T++WLEVIF I ++ SGL+L T+ IGNI+VFLHA  +KK+ MQL+ R +
Sbjct  344   TLSTFGN-LESTTDWLEVIFIIIVLTSGLILVTMFIGNIKVFLHATTSKKQAMQLKMRSI  402

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RR+LP  L+QR R F+RQ+WAAM G DE ++I++LPEGLRRDIK  LCLDL+++V
Sbjct  403   EWWMRRRRLPRELKQRTRNFQRQKWAAMRGVDECDMIRNLPEGLRRDIKYHLCLDLVRQV  462

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLF  +D L+L+NICDR+K L+F+K E + REGDPVQR++FIVRG ++SSQ L  GV + 
Sbjct  463   PLFQHMDSLVLENICDRVKSLIFTKGETVSREGDPVQRMLFIVRGHLQSSQYLRDGVKSY  522

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++T HFRY F
Sbjct  523   CMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYTF  582

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRL  2314
              NE++KR+ARYYS  WRTW AV +QLAWRRY+ R      +       +   +  G+ RL
Sbjct  583   VNEKVKRSARYYSPGWRTWGAVAIQLAWRRYKHRLTLSSLSFIRPRRPLSRCSSLGEDRL  642

Query  2315  RQYAAMFLSIRPH  2353
             R Y A+  S +P+
Sbjct  643   RLYTALLTSPKPN  655



>ref|XP_009119956.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Brassica 
rapa]
Length=698

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/635 (50%), Positives = 441/635 (69%), Gaps = 28/635 (4%)
 Frame = +2

Query  503   STQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMD  682
             S+  +++    GR+LDPRSK VQ WN+ FLL     L +DPLF Y +S+      CL +D
Sbjct  67    SSSSYNKWMVLGRILDPRSKLVQEWNKVFLLVCATGLFVDPLFLYTISVN-DACMCLLVD  125

Query  683   GGLAAIVTVLRTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASH  841
             G LA  +T +R+  D +H+ ++W+QF++A    Y   +S      G    +  +R VA  
Sbjct  126   GWLALSITAVRSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGDETRLRTSRRVAPP  185

Query  842   YVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIY  1021
             YV+    F+FD FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHS+ 
Sbjct  186   YVKKKGTFFFDLFVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSVR  245

Query  1022  LMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
              +R+   ++GYIFGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL ++C      
Sbjct  246   HLRQNATLSGYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLTEQCE-STMG  304

Query  1202  CNLR-LSCSEEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWA  1369
             C+LR LSC E V Y   E++L       + A N+ A     + +CLD+N  + +G YKW 
Sbjct  305   CDLRMLSCKEPVYYGTTEMVLDRARL--AWAQNNQA-----RSICLDINTNYTYGAYKWT  357

Query  1370  LPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGN  1549
             + +VS+ S   KIL+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGN
Sbjct  358   IQLVSNESRLEKILFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGN  416

Query  1550  IQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIK  1729
             I+VFLHA  +KK+ M L+ R++EWWMK+RQLP   RQRVR +ERQRWAAM G DE E+++
Sbjct  417   IKVFLHATTSKKQAMHLKMRNIEWWMKKRQLPLGYRQRVRNYERQRWAAMRGVDECEMVQ  476

Query  1730  DLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQR  1909
             +LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR
Sbjct  477   NLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQR  536

Query  1910  VVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDS  2089
             ++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP S++T   +++
Sbjct  537   MLFVVRGHLQSSQLLRDGVRSCCMLGPGNFSGDELLSWCLRRPFVERLPPSTSTLVTLET  596

Query  2090  TEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQ  2269
             TEAFGLDA  ++++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R    
Sbjct  597   TEAFGLDAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLT  656

Query  2270  PNT-------VPENADDGDRRLRQYAAMFLSIRPH  2353
               +       +   A  G+ +LR Y A+  S +P+
Sbjct  657   SLSFIRPRRPLSRCASLGEDKLRLYTAILTSPKPN  691



>ref|XP_010443001.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Camelina 
sativa]
Length=698

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/623 (51%), Positives = 432/623 (69%), Gaps = 27/623 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y +S+      CL +DG LA  VT L
Sbjct  80    LGRILDPRSKWVQEWNRVFLLVCATGLFVDPLFLYTISVN-DACMCLLVDGWLALTVTAL  138

Query  713   RTCLDAVHICHLWLQFRLA--------YVSRESLVVGCGKLVWDARAVASHYVRSLKGFW  868
             R+  D +H+ ++W+QF++A        Y   ++     G ++  +  V   YV+  +GF+
Sbjct  139   RSMTDLLHLWNIWIQFKIARRWPYPGGYSDDDN---NKGGVIRGSTRVVPPYVKK-RGFF  194

Query  869   FDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVT  1048
             FD FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHSI  +RR   ++
Sbjct  195   FDLFVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSIRHLRRNATLS  254

Query  1049  GYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCS  1225
             GYIFGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      C++R LSC 
Sbjct  255   GYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-DTIGCDIRMLSCK  313

Query  1226  EEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVK  1405
             E V Y   +            +  A    + +CLD+N  + +G Y+W + +VS+ S   K
Sbjct  314   EPVYYGTTVMVLDRARLAWAQNHQA----RSVCLDINTNYTYGAYQWTIQLVSNESRLEK  369

Query  1406  ILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKK  1585
             IL+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK
Sbjct  370   ILFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKK  428

Query  1586  RKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKR  1765
             + M L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK 
Sbjct  429   QAMHLKMRNVEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKY  488

Query  1766  FLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSS  1945
              LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SS
Sbjct  489   HLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSS  548

Query  1946  QNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLR  2125
             Q L  GV +  +L PG F GDELLSWCLRRPF++RLP+SS+T   +++TEAFGLDA  ++
Sbjct  549   QLLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPSSSSTLVTLETTEAFGLDAEDVK  608

Query  2126  FITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VP  2284
             ++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       + 
Sbjct  609   YVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLS  668

Query  2285  ENADDGDRRLRQYAAMFLSIRPH  2353
               A  G+ +LR Y A+  S +P+
Sbjct  669   RCASLGEDKLRLYTAILTSPKPN  691



>ref|NP_200236.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana]
 ref|NP_851188.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana]
 sp|Q94AS9.2|CNGC4_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 4; Short=AtCNGC4; 
AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 4; Short=AtHLM1 [Arabidopsis thaliana]
 emb|CAB40129.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis 
thaliana]
 dbj|BAB10748.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis 
thaliana]
 gb|AAL15321.1| AT5g54250/MDK4_7 [Arabidopsis thaliana]
 dbj|BAH19524.1| AT5G54250 [Arabidopsis thaliana]
 gb|AED96473.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana]
 gb|AED96474.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana]
Length=694

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/620 (51%), Positives = 431/620 (70%), Gaps = 21/620 (3%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK V+ WN+ FLL     L +DPLF Y LS+  +   CL +DG LA  VT L
Sbjct  76    LGRILDPRSKWVREWNKVFLLVCATGLFVDPLFLYTLSVSDTCM-CLLVDGWLALTVTAL  134

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLV-VGCGKLVWDARAVASHYVRSLKGFWFDA  877
             R+  D +H+ ++W+QF++A    Y   +S      G     +  VA  YV+   GF+FD 
Sbjct  135   RSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGGGTRGSTRVAPPYVKK-NGFFFDL  193

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHSI  +RR   ++GYI
Sbjct  194   FVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSIRHLRRNATLSGYI  253

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEV  1234
             FGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      C+LR LSC E V
Sbjct  254   FGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTIGCDLRMLSCKEPV  312

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
              Y   +            +  A    + +CLD+N  + +G Y+W + +VSS S   KIL+
Sbjct  313   YYGTTVMVLDRARLAWAQNHQA----RSVCLDINTNYTYGAYQWTIQLVSSESRLEKILF  368

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M
Sbjct  369   PIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAM  427

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
              L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LC
Sbjct  428   HLKMRNIEWWMKKRHLPIGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLC  487

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             LDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L
Sbjct  488   LDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLL  547

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
               GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  ++++T
Sbjct  548   RDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAEDVKYVT  607

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENA  2293
              HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   A
Sbjct  608   QHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCA  667

Query  2294  DDGDRRLRQYAAMFLSIRPH  2353
               G+ +LR YAA+  S +P+
Sbjct  668   SLGEDKLRLYAAILTSPKPN  687



>ref|XP_004248279.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Solanum 
lycopersicum]
Length=662

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/659 (48%), Positives = 436/659 (66%), Gaps = 37/659 (6%)
 Frame = +2

Query  398   FHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRW  577
             +  + C+     E     G S     NR G         F RS    +++DP+++ V+ W
Sbjct  28    YSHSECNKTIDHEPCNDGGDSRDDRNNRVGL-----NMIFSRS----KLIDPKAQWVKEW  78

Query  578   NRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQ  757
             NR FLL   + L +DPLFFY +SI  S   CL++DG  A  VTVLR   D +H+C++WLQ
Sbjct  79    NRVFLLVCAIGLFVDPLFFYTISISESCM-CLFVDGWFAVAVTVLRCINDGLHVCNMWLQ  137

Query  758   FRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIR  937
             +++    R + +                Y+++ KGF+FD FVILP+PQ V W+ +P L+ 
Sbjct  138   YKMMIHRRTNNI---------------PYLKANKGFFFDLFVILPLPQLVMWVGIPILLE  182

Query  938   EEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASH  1117
             +     +MT+LL+IFLFQ+LP+IYHSI L+RRMQ ++GYIFGT+WWG  LN+IAYF+ASH
Sbjct  183   KGLTTTVMTVLLIIFLFQYLPKIYHSICLLRRMQNLSGYIFGTVWWGIALNIIAYFVASH  242

Query  1118  VAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTA  1297
               G CWY+L IQR A CL+++C   K  CNL+L   EE  Y        + N      T 
Sbjct  243   AVGACWYLLGIQRAAKCLKEQCIVTKG-CNLKLLACEESIYYGTSDLVKQKNRLMWGETI  301

Query  1298  AALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSN  1477
              A   +  CL     F +G YKW + +V++ +   KIL PIFWGLMTLSTFGN LE T++
Sbjct  302   NA---RLTCLKNEQNFDYGAYKWTVQLVTNENHIEKILLPIFWGLMTLSTFGN-LESTTD  357

Query  1478  WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLR  1657
             WLEVIF I ++ SGL+L T+ IGNI+VFLHA  +KK+ MQL  R++EWWM+RR+ P  L+
Sbjct  358   WLEVIFIIIVLTSGLILVTMFIGNIKVFLHATTSKKQSMQLNMRNIEWWMRRRRFPRELK  417

Query  1658  QRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNI  1837
             QR R F+RQ+WAAM G DE ++I+++PEGLRRDIK  LCLDL+K+VPLF  +D L+L+NI
Sbjct  418   QRTRNFQRQKWAAMRGVDECDMIRNIPEGLRRDIKYHLCLDLVKQVPLFQHMDSLVLENI  477

Query  1838  CDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELL  2017
             CDR+K L+F+K E + REGDPVQR++FIVRG ++SSQ L  GV +  +L PG F GDELL
Sbjct  478   CDRVKSLIFTKGETVSREGDPVQRMLFIVRGHLQSSQYLRDGVKSYCMLGPGNFSGDELL  537

Query  2018  SWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSA  2197
             SWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++T HFRY F +E++KR+ARYYS 
Sbjct  538   SWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYTFVDEKVKRSARYYSP  597

Query  2198  NWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPH  2353
              WRTW AV +QLAWRRY+ R      +       +   +  G+ RLR Y A+  S +P+
Sbjct  598   GWRTWGAVAIQLAWRRYKHRLTLSSLSFIRPRRPLSRCSSLGENRLRLYTALLTSPKPN  656



>gb|KHG27716.1| Cyclic nucleotide-gated ion channel 4 -like protein [Gossypium 
arboreum]
Length=709

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/641 (50%), Positives = 435/641 (68%), Gaps = 37/641 (6%)
 Frame = +2

Query  521   RSGPFGRVL-DPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAA  697
             +S   G+V  DPR+K VQ WNR FLL     L +DPLFFYALSI  +   CL++DG  A 
Sbjct  70    KSWSLGQVFFDPRAKWVQEWNRVFLLVCATGLFVDPLFFYALSISDTCM-CLFVDGWFAI  128

Query  698   IVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKL---------------------V  814
              VT LR   DA+H+ ++ LQ ++   S  S   G  K                       
Sbjct  129   TVTALRCMTDALHVWNMCLQLKMIKRSSSSYGRGNDKRSGSESEGEGGDGGEGSSNRPRA  188

Query  815   WDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqf  994
              + R +A   +++ KG +FD  VILP+PQ V W+ +P L+ +  V L+MT+ L+IFLFQ+
Sbjct  189   ANGRHLAFQCLKAKKGLFFDLLVILPLPQIVLWVAIPSLLEKGSVTLVMTVFLIIFLFQY  248

Query  995   lPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLR  1174
             LP+IYHS+ L+RRMQ ++GYIFGT+WWG  LNLIAYF+ASH AG CWY+L IQR A CL+
Sbjct  249   LPKIYHSVCLLRRMQNLSGYIFGTVWWGIALNLIAYFVASHAAGACWYLLGIQRSAKCLK  308

Query  1175  QRCHYQKSTCNLRL-SCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRF  1351
             ++C   ++ C+LRL +C + + Y                +  A    +  C+D    + +
Sbjct  309   EQCRGIEN-CDLRLLACKDPIYYGTRSMVRDRARLVWAETNRA----RSTCIDNPDNYDY  363

Query  1352  GIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLF  1531
             G YKW + +V++ S   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L 
Sbjct  364   GAYKWTVQLVTNDSRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLV  422

Query  1532  TLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGED  1711
             T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM++R+LPS  +QRVR +ERQRWAAM G D
Sbjct  423   TMLIGNIKVFLHATTSKKQAMQLKMRNIEWWMRKRRLPSGFKQRVRNYERQRWAAMRGVD  482

Query  1712  EMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIRE  1891
             E ++I++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I RE
Sbjct  483   ECQMIRNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETITRE  542

Query  1892  GDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSAT  2071
             GDPVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP S++T
Sbjct  543   GDPVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSTST  602

Query  2072  FTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR  2251
                +++TEAFGLDA  ++++T HFRY F NER+KR+ARYYS  WRTWAAV +QLAWRRY+
Sbjct  603   LVTLETTEAFGLDAEDVKYVTQHFRYTFVNERVKRSARYYSPGWRTWAAVAIQLAWRRYK  662

Query  2252  LRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPH  2353
              R      +       +  +   G+ RLR Y AM  S +P+
Sbjct  663   HRLTLTSLSFIRPRRPLSRSNSLGEDRLRLYTAMLTSPKPN  703



>ref|XP_004251491.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Solanum lycopersicum]
Length=686

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/626 (50%), Positives = 432/626 (69%), Gaps = 27/626 (4%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
             +V+DPR+  VQ WNR FLL     L +DPLFFY+LSI  +   CL++DG  A  VTVLR 
Sbjct  63    KVIDPRAPWVQEWNRVFLLVCATGLFVDPLFFYSLSISETCM-CLFIDGWFAVTVTVLRC  121

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARA------------VASHYVRSLKG  862
               DA+H+ ++W++F++  +   +  +   ++   +R             VA  Y++S KG
Sbjct  122   MTDAMHLWNMWIRFKMHKLRPYNEKMDENQITSSSRGPRLHQDQSFRCFVALRYLKSKKG  181

Query  863   FWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQK  1042
             F+ D FVILP+PQ V W+ +P L+ +     +MT+LL++FLFQ+LP+IYHS+ L+RRMQ 
Sbjct  182   FFLDLFVILPLPQIVMWVGIPGLLEKGYTTTVMTVLLIMFLFQYLPKIYHSVCLLRRMQN  241

Query  1043  VTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LS  1219
             ++GYIFGT+WWG  LNLIAYF+ASH  G CWY+L IQR A CL+Q+C      C+LR L+
Sbjct  242   LSGYIFGTVWWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKQQCRVTNG-CSLRMLA  300

Query  1220  CSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIA  1399
             C E++ Y              G S  A    +  CL     F +G+YKW + +V++ +  
Sbjct  301   CEEKIFYGTSSLVKHRSRVIWGESKIA----RSTCLASEHNFDYGVYKWTVQLVTNENRF  356

Query  1400  VKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMA  1579
              KIL+PIFWGLMTLSTFGN LE T++WLE +F I ++ +GL+L T+LIGNI+VFLHA  +
Sbjct  357   EKILFPIFWGLMTLSTFGN-LESTTDWLEDVFIIIVLTTGLLLVTMLIGNIKVFLHATTS  415

Query  1580  KKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDI  1759
             KK+ MQL+ R++EWWM+RR+LP   +QRVR +ER R+AA  G DE E+I +LPEGLRRDI
Sbjct  416   KKQAMQLKMRNVEWWMRRRRLPQGYKQRVRNYERHRFAATRGVDEYEMISNLPEGLRRDI  475

Query  1760  KRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVK  1939
             K  LCLDL+++VPLF  +D+L+L+NICDR+K L+F+K E I REGDPVQR++FIVRG ++
Sbjct  476   KYHLCLDLVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITREGDPVQRMLFIVRGHLQ  535

Query  1940  SSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANH  2119
             SSQ L  GV +  +L PG F GDELLSWCLR+PF++RLP SS++   +++TEAFGL+A+ 
Sbjct  536   SSQELRDGVKSCCMLGPGNFSGDELLSWCLRKPFVERLPPSSSSLVTLETTEAFGLEADD  595

Query  2120  LRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------  2278
             ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRRYR R      +       
Sbjct  596   VKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRPRRP  655

Query  2279  VPENADDGDRRLRQYAAMFLSIRPHD  2356
             +  ++   + RLR Y A+  S +P+ 
Sbjct  656   LSRSSSLTEDRLRLYTALLTSPKPNQ  681



>emb|CDY14322.1| BnaA10g07330D [Brassica napus]
Length=699

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/636 (50%), Positives = 442/636 (69%), Gaps = 29/636 (5%)
 Frame = +2

Query  503   STQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMD  682
             S+  +++    GR+LDPRSK VQ WN+ FLL     L +DPLF Y +S+      CL +D
Sbjct  67    SSSSYNKWMVLGRILDPRSKLVQEWNKVFLLVCATGLFVDPLFLYTISVN-DACMCLLVD  125

Query  683   GGLAAIVTVLRTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASH  841
             G LA  +T +R+  D +H+ ++W+QF++A    Y   +S      G    +  +R VA  
Sbjct  126   GWLALSITAVRSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGDETRLRASRRVAPP  185

Query  842   YVRSLKGFWFDAFVILPIPQ-AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSI  1018
             YV+    F+FD FVILP+PQ  V W+V+P L++   V L++++LL+ FLFQ+LP+IYHS+
Sbjct  186   YVKKKGTFFFDLFVILPLPQQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSV  245

Query  1019  YLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKS  1198
               +R+   ++GYIFGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C     
Sbjct  246   RHLRQNATLSGYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-STM  304

Query  1199  TCNLR-LSCSEEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKW  1366
              C+LR LSC E V Y   E++L       + A N+ A     + +CLD+N  + +G YKW
Sbjct  305   GCDLRMLSCKEPVYYGTTEMVLDRARL--AWAQNNQA-----RSICLDINTNYTYGAYKW  357

Query  1367  ALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIG  1546
              + +VS+ S   KIL+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIG
Sbjct  358   TIQLVSNESRLEKILFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIG  416

Query  1547  NIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELI  1726
             NI+VFLHA  +KK+ M L+ R++EWWMK+RQLP   RQRVR +ERQRWAAM G DE E++
Sbjct  417   NIKVFLHATTSKKQAMHLKMRNIEWWMKKRQLPLGYRQRVRNYERQRWAAMRGVDECEMV  476

Query  1727  KDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQ  1906
             ++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQ
Sbjct  477   QNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQ  536

Query  1907  RVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCID  2086
             R++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP S++T   ++
Sbjct  537   RMLFVVRGHLQSSQLLRDGVRSCCMLGPGNFSGDELLSWCLRRPFVERLPPSTSTLVTLE  596

Query  2087  STEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRG  2266
             +TEAFGLDA  ++++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R   
Sbjct  597   TTEAFGLDAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTL  656

Query  2267  QPNT-------VPENADDGDRRLRQYAAMFLSIRPH  2353
                +       +   A  G+ +LR Y A+  S +P+
Sbjct  657   TSLSFIRPRRPLSRCASLGEDKLRLYTAILTSPKPN  692



>ref|XP_009792556.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X2 [Nicotiana sylvestris]
Length=654

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/615 (51%), Positives = 422/615 (69%), Gaps = 30/615 (5%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
              +++DPR++ VQ WNR FLLA  + L +DPLFFYALSI  S   CL++DG  A  VT LR
Sbjct  57    NKIIDPRAQWVQEWNRVFLLACAIGLFLDPLFFYALSISESCM-CLFVDGWFAVTVTALR  115

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
                DA+H+ ++WLQF++   SR +              VA  Y ++ KGF FD FVILP+
Sbjct  116   CMTDALHVWNMWLQFKMINRSRRN------------HMVAQPYFKAKKGFLFDLFVILPL  163

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W+ +P L+ +     +MT+LL++FLFQ+LP+IYHS+ L+RRMQ ++GYIFGT+WW
Sbjct  164   PQLVMWVGIPALLEKGSTTTVMTVLLIMFLFQYLPKIYHSVCLLRRMQNLSGYIFGTVWW  223

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLL  1252
             G  LN IAYF+ASH  G CWY+L IQR A CL+++C      C L+ L+C E + Y    
Sbjct  224   GIALNTIAYFVASHAVGACWYLLGIQRAAKCLKEQCRVTNG-CGLKMLACQEPIYYGTSN  282

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                 +     G ++ A       CL+    F +G YKW + + ++ +   KIL PIFWGL
Sbjct  283   LVKEKSRLIWGETSNARFT----CLNNGENFDYGAYKWTVQLFANENRFEKILLPIFWGL  338

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T++WLEVIF I ++ SGL+L T+ IGNI+VFLHA  +KK+ MQL+ R+
Sbjct  339   MTLSTFGN-LESTTDWLEVIFIIIVLTSGLILVTMFIGNIKVFLHATTSKKQAMQLKMRN  397

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +EWWM+RR LP  L+QR R FERQ+WAAM G DE E+I++LPEGLRRDIK  LCLDL+++
Sbjct  398   IEWWMRRRHLPRELKQRTRNFERQKWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQ  457

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+NICDR+K L+F+K E    EGDPVQR++FIVRG ++SSQ L  GV +
Sbjct  458   VPLFQHMDNLVLENICDRVKSLIFTKGET---EGDPVQRMLFIVRGHLQSSQLLRDGVKS  514

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++T HFRY 
Sbjct  515   CCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYT  574

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             F  E++KR+ARYYS  WRTW AV +QLAWRRY+ R      +       +   +  G+ R
Sbjct  575   FVKEKVKRSARYYSPGWRTWGAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDR  634

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  635   LRIYTALLTSPKPNQ  649



>ref|XP_010538051.1| PREDICTED: LOW QUALITY PROTEIN: cyclic nucleotide-gated ion channel 
4 [Tarenaya hassleriana]
Length=709

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/658 (49%), Positives = 430/658 (65%), Gaps = 39/658 (6%)
 Frame = +2

Query  470   IKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSI  649
             +  R   +TH+  +    +   GRVLDPRSK VQ WN+ FLL     L +DPLFFY LS+
Sbjct  64    VGRRSVKLTHQKRRFRSDNWNLGRVLDPRSKWVQEWNKIFLLVCATGLFVDPLFFYTLSV  123

Query  650   GRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA--------YVSRESLVVGCG  805
               +   CL +DG LA  VT +R+  D +H+ ++WL  ++A        + +    V   G
Sbjct  124   SDTCM-CLLIDGWLAITVTAIRSMTDLLHLWNMWLLLKMAKRRWPHGGFSTAGDDVGTRG  182

Query  806   KLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtilllifl  985
             ++   +R VA  YV+S KG +FD FVILP+PQ V W+VVP L+ E         +LLI  
Sbjct  183   EM---SRRVALGYVKSKKGLFFDLFVILPLPQVVLWVVVPSLL-ERGSATTAMTVLLITF  238

Query  986   fqflPRIYH------SIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLA  1147
                   I H      SI     M   +GYIFGTIWWG  LN++AYF+ASH AG CWY+L 
Sbjct  239   LGIYKLIXHPQSDLKSIQNETHMTLTSGYIFGTIWWGIALNMLAYFVASHAAGACWYLLG  298

Query  1148  IQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLLPGGVEGNSCAGNST---AAALMRK  1315
             +QR+  CL+++C      C++R LSC E V Y      G   +          A     +
Sbjct  299   LQRIEKCLKEQCRGTMG-CDIRMLSCKEAVYY------GTSSSMVRDRMRLEWAENKQAR  351

Query  1316  PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIF  1495
               CLDVN  + FG+++W L +V++ S   KIL+PIFWGLMTLSTFGN L  T+ W EV+F
Sbjct  352   STCLDVNTSYTFGVFQWTLQLVANESRLEKILFPIFWGLMTLSTFGN-LNSTTEWTEVVF  410

Query  1496  SICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYF  1675
             +I I+ SGL+L T+LIGNI+VFLHA  +KK+ MQL+ R++EWWMK+RQLP   RQRVR +
Sbjct  411   NIIILTSGLLLVTMLIGNIKVFLHATTSKKQAMQLKMRNIEWWMKKRQLPQGFRQRVRNY  470

Query  1676  ERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKP  1855
             ERQRWAAM G DE E+++DLPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K 
Sbjct  471   ERQRWAAMRGVDEYEMVRDLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKS  530

Query  1856  LVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRR  2035
             L+F+K E I +EGDPVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRR
Sbjct  531   LIFTKGEIIQKEGDPVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRR  590

Query  2036  PFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWA  2215
             PF++RLP SS+T   +++TEAFGL+A+ ++++T HFRY F NE++KR+ARYYS  WRTWA
Sbjct  591   PFVERLPPSSSTLVTLETTEAFGLEASDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWA  650

Query  2216  AVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPH-DHLE  2365
             AV +QLAWRRY+ R      +       +   +  G+ RLR Y AM  S +P+ DH +
Sbjct  651   AVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDRLRLYTAMLTSPKPNPDHFD  708



>ref|XP_002866035.1| ATCNGC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42294.1| ATCNGC4 [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/620 (51%), Positives = 430/620 (69%), Gaps = 21/620 (3%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK V+ WN+ FLL     L +DPLF Y LS+  +   CL +DG LA  VT L
Sbjct  76    LGRILDPRSKWVREWNKVFLLVCATGLFVDPLFLYTLSVSDTCM-CLLVDGWLALTVTAL  134

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLV-VGCGKLVWDARAVASHYVRSLKGFWFDA  877
             R+  D +H+ ++W+QF++A    Y   +S      G     +  VA  YV+   GF+FD 
Sbjct  135   RSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGGGTRGSTRVAPPYVKK-NGFFFDF  193

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQ V W+V+P L+R   V L++++LL+ FLFQ+LP+IYHSI  +RR   ++GYI
Sbjct  194   FVILPLPQVVLWVVIPSLLRRGSVTLVVSVLLVTFLFQYLPKIYHSIRHLRRNATLSGYI  253

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEV  1234
             FGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      C++R LSC E V
Sbjct  254   FGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTMGCDIRMLSCKEPV  312

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
              Y   +            +  A    + +CLD+N  + +G Y+W + +VS+ S   KIL+
Sbjct  313   YYGTTVMVLDRARLAWAQNHQA----RSVCLDINTNYTYGAYQWTIQLVSNESRLEKILF  368

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M
Sbjct  369   PIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAM  427

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
              L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LC
Sbjct  428   HLKMRNIEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLC  487

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             LDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L
Sbjct  488   LDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLL  547

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
               GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  ++++T
Sbjct  548   RDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAEDVKYVT  607

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENA  2293
              HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   A
Sbjct  608   QHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCA  667

Query  2294  DDGDRRLRQYAAMFLSIRPH  2353
               G+ +LR Y A+  S +P+
Sbjct  668   SLGEDKLRLYTAILTSPKPN  687



>ref|XP_010482832.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Camelina 
sativa]
Length=697

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/620 (50%), Positives = 431/620 (70%), Gaps = 21/620 (3%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y +S+      CL +DG LA  VT L
Sbjct  79    LGRILDPRSKWVQEWNRVFLLVCATGLFVDPLFLYTISVN-DACMCLLVDGWLALTVTAL  137

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLVVGC-GKLVWDARAVASHYVRSLKGFWFDA  877
             R+  D +H+ ++W+QF++A    Y   +S      G++   +  +   YV+  +GF+FD 
Sbjct  138   RSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDNNKGRVTRGSTRIVPPYVKK-RGFFFDL  196

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHS+  +RR   ++GYI
Sbjct  197   FVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSVRHLRRNATLSGYI  256

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEV  1234
             FGT+WWG  LN+ AYF+A+H AG CWY+L +QR A CL+++C      C++R LSC E V
Sbjct  257   FGTVWWGIALNMFAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-DTIGCDIRMLSCKEPV  315

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
              Y   +            +  A    + +CLD+N  + +G Y+W + +VS+ S   KIL+
Sbjct  316   YYGTTVMVLDRARLAWAQNHQA----RSVCLDINTNYTYGAYQWTIQLVSNESRLEKILF  371

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M
Sbjct  372   PIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAM  430

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
              L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LC
Sbjct  431   HLKMRNVEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLC  490

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             LDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L
Sbjct  491   LDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLL  550

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
               GV +  +L PG F GDELLSWCLRRPF++RLP+SS+T   +++TEAFGLDA  ++++T
Sbjct  551   RDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPSSSSTLVTLETTEAFGLDAEDVKYVT  610

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENA  2293
              HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   A
Sbjct  611   QHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCA  670

Query  2294  DDGDRRLRQYAAMFLSIRPH  2353
               G+ +LR Y A+  S +P+
Sbjct  671   SLGEDKLRLYTAILTSPKPN  690



>ref|XP_008777136.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Phoenix 
dactylifera]
Length=662

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/653 (48%), Positives = 432/653 (66%), Gaps = 16/653 (2%)
 Frame = +2

Query  425   HQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARG  604
             H  + E+   SS    +N          +    S   G V+DP+S+ VQ WNRAFLL   
Sbjct  13    HMEDGESDEESSSHAPRNGDNHSHGGRRRRRKGSWSLGGVVDPQSRWVQEWNRAFLLVCT  72

Query  605   MALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRE  784
               L +DPLFFY LSI      CL++DG  A  VT LR   DAV + ++W++ + +Y    
Sbjct  73    AGLVVDPLFFYPLSIS-GARVCLFVDGWFAITVTALRCMTDAVLVWNMWMRLKTSYRMGR  131

Query  785   SLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimt  964
                   G+     RAVA  Y++S KGF+FD F+I P+PQ V W+  P LI      ++MT
Sbjct  132   LRGAEEGRAPMSPRAVALDYLKSKKGFFFDLFIIFPVPQVVLWVAAPVLICRGLTTMVMT  191

Query  965   illliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVL  1144
             + L++FLFQ+LP+IYH I  +RR+Q  +GYIFGTIWWG  +NLIAYF+A+H  G CWY+L
Sbjct  192   VFLVMFLFQYLPKIYHCISFLRRLQNSSGYIFGTIWWGIAINLIAYFVAAHAIGACWYLL  251

Query  1145  AIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLLPG-GVEGNSCAGNSTAAALMRKP  1318
              IQR  +CL ++C   K  C L+ + C+  + Y +       E  S A N+ A     + 
Sbjct  252   GIQRATNCLNEQCIATKG-CGLKAVGCANPIYYGITTASRDGEILSWANNANA-----RE  305

Query  1319  LCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFS  1498
             +CLD    F +G YKW + ++++ S   KIL PIFWGLM L+TFG  LE T+ W E++F+
Sbjct  306   VCLDSQDKFDYGTYKWTVLLITNSSRLEKILLPIFWGLMNLTTFGGGLESTTEWHEILFN  365

Query  1499  ICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFE  1678
             I ++ +GL+L T+LIGNI+VFLH+  +KK+ + L+ R ++WWM++RQLP  +R RVR +E
Sbjct  366   IIVITAGLLLVTMLIGNIKVFLHSATSKKQALHLKMRSLDWWMRKRQLPKGIRHRVRQYE  425

Query  1679  RQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPL  1858
             RQRWAAM G DE ++I+DLPEGLR++IK  LCLDL+++VPLF  +D+L+L+NICDR+K L
Sbjct  426   RQRWAAMRGVDECKMIQDLPEGLRKEIKYHLCLDLVRQVPLFQHMDELVLENICDRVKSL  485

Query  1859  VFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRP  2038
             +F K E I REGDPVQR++FIVRG ++SSQ L  G+++  +L PG F GDELLSWCLRRP
Sbjct  486   IFPKGETITREGDPVQRMLFIVRGHLQSSQALRNGIMSCCMLGPGNFSGDELLSWCLRRP  545

Query  2039  FIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAA  2218
             FI+RLP SS+T   +++TEAF L+A  ++++T +FRY FANE++KR+ARYYS  WRTWAA
Sbjct  546   FIERLPPSSSTLVTLETTEAFSLEAGDVKYVTQNFRYTFANEKVKRSARYYSPGWRTWAA  605

Query  2219  VNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
             V +QLAWRRY+LR      +           +  G+ RLR YAA+  S +P+ 
Sbjct  606   VAIQLAWRRYKLRLTLASLSFIRPRRPASRCSSPGEERLRHYAALLTSPKPNQ  658



>gb|AAP38213.1| putative cyclic nucleotide and calmodulin-regulated ion channel 
protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/415 (69%), Positives = 340/415 (82%), Gaps = 5/415 (1%)
 Frame = +2

Query  1136  YVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRK  1315
             YVLAIQRVASCL+  C    +   + L+CS+E+C+       +   +C  N T+ +    
Sbjct  1     YVLAIQRVASCLQSECEINNNCNLMSLACSKEMCFHFPWSSDMTALACDTNLTSFSQQNV  60

Query  1316  PLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIF  1495
             P CL  NG F +GIYK ALPV+SS S+AVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIF
Sbjct  61    PACLSGNGAFAYGIYKGALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIF  120

Query  1496  SICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYF  1675
             SI  VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDMEWWM+RRQLPS LRQRVR +
Sbjct  121   SIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEWWMRRRQLPSRLRQRVRKY  180

Query  1676  ERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKP  1855
             ER+RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VPLFH +D+LILDNICDR++P
Sbjct  181   ERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPLFHGMDELILDNICDRLRP  240

Query  1856  LVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRR  2035
             LVF   EK+IREGDPVQR+VF+++G+++S+Q L+KGVVA  +L  G FLGDELLSWCLRR
Sbjct  241   LVFCGGEKVIREGDPVQRMVFVLQGKLRSTQPLTKGVVAECVLGAGSFLGDELLSWCLRR  300

Query  2036  PFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWA  2215
             PF+DRLPASSATF C+++ +AF LDA  LR+IT+HFRYKFAN++LKRTARYYS+NWRTWA
Sbjct  301   PFVDRLPASSATFECVEAAQAFCLDAPDLRYITEHFRYKFANDKLKRTARYYSSNWRTWA  360

Query  2216  AVNVQLAWRRYRLRTRGQP-----NTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             AVNVQLAWRRYR R                 +DGDRRLR YAAMF+S+RPHDHLE
Sbjct  361   AVNVQLAWRRYRARMMATAVLPPPPAGAAGPEDGDRRLRHYAAMFMSLRPHDHLE  415



>ref|XP_010446700.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Camelina sativa]
Length=699

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/620 (51%), Positives = 431/620 (70%), Gaps = 21/620 (3%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y +S+      CL +DG LA  VT L
Sbjct  81    LGRILDPRSKWVQEWNRVFLLVCATGLFVDPLFLYTISVN-DPCMCLLVDGWLALTVTAL  139

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLVVGC-GKLVWDARAVASHYVRSLKGFWFDA  877
             R+  D +H+ ++W+QF++A    Y   +S      G +   +  V   YV+  +GF+FD 
Sbjct  140   RSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDNNKGGVTRGSTRVVPPYVKK-RGFFFDL  198

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQ V W+V+P L++   V L++++LL+ F+FQ+LP+IYHSI  +RR   ++GYI
Sbjct  199   FVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFIFQYLPKIYHSIRHLRRNATLSGYI  258

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEV  1234
             FGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      C++R LSC E V
Sbjct  259   FGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-DTIRCDIRMLSCKEPV  317

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
              Y   +            +  A    + +CLD+N  + +G Y+W + +VS+ S   KIL+
Sbjct  318   YYGTTVMVLDRARLAWAQNHQA----RSVCLDINTNYTYGAYQWTIQLVSNESRLEKILF  373

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M
Sbjct  374   PIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAM  432

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
              L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LC
Sbjct  433   HLKMRNVEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLC  492

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             LDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L
Sbjct  493   LDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLL  552

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
               GV +  +L PG F GDELLSWCLRRPF++RLP+SS+T   +++TEAFGLDA  ++++T
Sbjct  553   RDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPSSSSTLVTLETTEAFGLDAEDVKYVT  612

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENA  2293
              HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   A
Sbjct  613   QHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCA  672

Query  2294  DDGDRRLRQYAAMFLSIRPH  2353
               G+ +LR Y A+  S +P+
Sbjct  673   SLGEDKLRLYTAILTSPKPN  692



>ref|XP_009589775.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/614 (50%), Positives = 419/614 (68%), Gaps = 31/614 (5%)
 Frame = +2

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
              +++DPR++ VQ WNR FLL   + L +DPLFFYALSI  +   CL++DG  A  VTVLR
Sbjct  55    NKIIDPRAQWVQEWNRVFLLVCAIGLFLDPLFFYALSISENCM-CLFVDGWFAVTVTVLR  113

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
                DA+H+ ++WLQF++   SR + +V                  + KGF+FD FVILP+
Sbjct  114   CMTDALHVWNMWLQFKMINRSRRTHMV------------------AKKGFFFDLFVILPL  155

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W+ +P L+ +     +MT+LL++FLFQ+LP+IYHSI L+RRMQ ++GYIFGT+WW
Sbjct  156   PQLVMWVGIPALLEKGSTTTVMTVLLIMFLFQYLPKIYHSICLLRRMQNLSGYIFGTVWW  215

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             G  LN IAYF+ASH  G CWY+L IQR A CL+++C   K      L+C E + Y     
Sbjct  216   GIALNTIAYFVASHAVGACWYLLGIQRAAKCLKEQCRVTKGCGLNMLACQEPIYYGTSSL  275

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
                +     G ++ A       CL+    F +G YKW + + ++ +   KIL PIFWGLM
Sbjct  276   VKEKSRLIWGETSNARFT----CLNNGENFDYGAYKWTVQLFANENRFEKILLPIFWGLM  331

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGN LE T++WLEVIF I ++ SGL+L T+ IGNI+VFLHA  +KK+ MQL+ R +
Sbjct  332   TLSTFGN-LESTTDWLEVIFIIIVLTSGLILVTMFIGNIKVFLHATTSKKQAMQLKMRKI  390

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+ R+LP  L+QR R FERQ+WAAM G DE E+I++LPEGLRRDIK  LCLDL+++V
Sbjct  391   EWWMRSRRLPRELKQRTRNFERQKWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQV  450

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLF  +D+L+L+NICDR+K L+F+K E I +EGDPVQR++FIVRG ++S Q L  GV + 
Sbjct  451   PLFQHMDNLVLENICDRVKSLIFTKGETITKEGDPVQRMLFIVRGHLQSCQFLRDGVKSC  510

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++T HFRY F
Sbjct  511   CMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYTF  570

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRL  2314
               E++KR+ARYYS  WRTW AV +QLAWRRY+ R      +       +   +  G+ RL
Sbjct  571   VKEKVKRSARYYSPGWRTWGAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDRL  630

Query  2315  RQYAAMFLSIRPHD  2356
             R Y A+  S +P+ 
Sbjct  631   RIYTALLTSPKPNQ  644



>ref|XP_009127107.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Brassica rapa]
Length=695

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/625 (52%), Positives = 435/625 (70%), Gaps = 31/625 (5%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y LS+      CL +DG LA  VT L
Sbjct  77    LGRILDPRSKLVQEWNRVFLLVCATGLFVDPLFLYTLSVN-DACMCLLVDGWLALTVTAL  135

Query  713   RTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASHYVRSLKGFWF  871
             R+  D +H+ ++ +QF++A    Y   +S   +  G G  V      A  YV+   GF+F
Sbjct  136   RSMTDLLHLWNILIQFKIARWWPYRGGDSDGDINKGDGTRV--RMRGAPPYVKK-NGFFF  192

Query  872   DAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTG  1051
             D FVILP+PQ V W+V+P L++   V L+++ILLL FLFQ+LP+IYHSI  +R+   ++G
Sbjct  193   DLFVILPLPQVVLWVVIPSLLKRGSVTLVVSILLLTFLFQYLPKIYHSIRHLRQNATLSG  252

Query  1052  YIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSE  1228
             YIFGT+WWGF LN++AYF+A+H AG CWY+L +QR A CL+++C      C+LR LSC E
Sbjct  253   YIFGTVWWGFALNMVAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTMGCDLRMLSCKE  311

Query  1229  EVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIA  1399
              V Y   E++L       + A N  A     + +CLD++  + +G Y+W + +VS+ S  
Sbjct  312   PVYYGTTEMVLDRARL--AWARNHQA-----RSVCLDIDTDYTYGAYQWTIQLVSNESRL  364

Query  1400  VKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMA  1579
              K+L+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +
Sbjct  365   EKVLFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTS  423

Query  1580  KKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDI  1759
             KK+ M L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDI
Sbjct  424   KKQAMHLKMRNIEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDI  483

Query  1760  KRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVK  1939
             K  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++
Sbjct  484   KYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQ  543

Query  1940  SSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANH  2119
             SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  
Sbjct  544   SSQLLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAQD  603

Query  2120  LRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------  2278
             ++++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       
Sbjct  604   VKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRP  663

Query  2279  VPENADDGDRRLRQYAAMFLSIRPH  2353
             +   A  G+ +LR Y A+  S +P+
Sbjct  664   LSRCASLGEDKLRLYTAILTSPKPN  688



>ref|XP_008376367.1| PREDICTED: cyclic nucleotide-gated ion channel 2-like [Malus 
domestica]
Length=456

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/458 (62%), Positives = 358/458 (78%), Gaps = 17/458 (4%)
 Frame = +2

Query  998   PRIYHSIYLMRRMQKVTGYIF--GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCL  1171
             P++YHS+YL +R+++VTGYIF  G IWW F LN+IAY  A+H+ GGCWYVLA QRV SC 
Sbjct  14    PKLYHSVYLAKRLKRVTGYIFAYGNIWWRFKLNIIAYLTAAHIVGGCWYVLATQRVMSCF  73

Query  1172  RQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRF  1351
             +Q+C  +   CNL + CS+E+           G    GN+       K LCLD + PF++
Sbjct  74    QQQCD-RSLNCNLSIYCSKEIF--------SNGKFSGGNAFTKI---KTLCLDKDTPFKY  121

Query  1352  GIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLF  1531
             GIY+  L V +  ++AV+ILYPI+WGL+ + +F N+L PTS+W E+IFS  + L+GL LF
Sbjct  122   GIYQPLLDVYAGNTLAVRILYPIYWGLINIGSFANNLTPTSDWRELIFSCLLTLAGLGLF  181

Query  1532  TLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGED  1711
               LIGNIQ+FLH +MA K+KMQL+ RDMEWWM+RRQLPS+LR+R RYF+R  WAAM G+D
Sbjct  182   ITLIGNIQIFLHMMMANKKKMQLKYRDMEWWMQRRQLPSHLRKRARYFQRHSWAAMQGQD  241

Query  1712  EMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIRE  1891
             E+ELI+  P+GLRRDIKR+LCLDL+KKVPLFH LDD+ILDNICD ++P V+SK EK+IRE
Sbjct  242   ELELIQHFPDGLRRDIKRYLCLDLLKKVPLFHKLDDVILDNICDLVRPTVYSKGEKVIRE  301

Query  1892  GDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSAT  2071
             GDPVQR++F+V GR+K SQ LSKG +ATS+LEPG F GDELLSWCLRRPF+ RLP SSAT
Sbjct  302   GDPVQRMMFVVHGRIKRSQGLSKGFLATSVLEPGSFFGDELLSWCLRRPFLGRLPPSSAT  361

Query  2072  FTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR  2251
             FTC++  EAFGLDA+ LR+ITDHFRYKF NE L+ TAR+YS+NWRTWAAV +QLAWRR+R
Sbjct  362   FTCLEPMEAFGLDADCLRYITDHFRYKFLNEELRWTARFYSSNWRTWAAVIIQLAWRRHR  421

Query  2252  LRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHDHLE  2365
             +RT+G    V +N D  + RLR YAA FLS++PHDHLE
Sbjct  422   MRTKGL--VVLQNGDI-ENRLRHYAAFFLSLKPHDHLE  456



>ref|XP_003526201.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Glycine 
max]
Length=691

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/632 (51%), Positives = 435/632 (69%), Gaps = 35/632 (6%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GRVLDPR+K VQ WNR FLL     L +DPLFFYALS+  S   C+++DG LA  VTVL
Sbjct  66    LGRVLDPRAKWVQEWNRVFLLVCAAGLFVDPLFFYALSVSDSCM-CVFVDGWLAVTVTVL  124

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDA--------------RAVASHYVR  850
             R   DA+H+ ++ ++ ++A   + +  +G                      R+VA  Y+ 
Sbjct  125   RCMTDALHVWNMVIRCKMA---KRTFGLGASTTSSGRGTSSSSVGLRDTRPRSVAMGYLM  181

Query  851   SLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMR  1030
             S  GF+FD FVILP+PQ V W+ +P L+ +  V L+MT+ L+IFLFQ+LP+I+HS+  +R
Sbjct  182   SRTGFFFDLFVILPLPQIVLWVAIPSLLEKGSVTLVMTVFLIIFLFQYLPKIFHSVCHLR  241

Query  1031  RMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL  1210
             R Q ++GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+ +C  + S C +
Sbjct  242   RTQNLSGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLKVQCE-KTSGCGM  300

Query  1211  R-LSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGP--FRFGIYKWALPVV  1381
             + LSC   + Y     G            A A  R+     +NGP  + +G Y+W++ +V
Sbjct  301   KILSCQTPIYY-----GSNSFLVRDRARLAWAENREVRHTCLNGPDNYNYGAYRWSVQLV  355

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             ++ +   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VF
Sbjct  356   TNDNRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVF  414

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             LHA  +KK+ MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G DE E+ K+LPE
Sbjct  415   LHATTSKKQAMQLKMRNIEWWMRKRRLPLGFRQRVRNYERQRWAAMRGVDEFEMTKNLPE  474

Query  1742  GLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFI  1921
             GLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+
Sbjct  475   GLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIAREGDPVQRMLFV  534

Query  1922  VRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAF  2101
             VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAF
Sbjct  535   VRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLITLETTEAF  594

Query  2102  GLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-  2278
             GL+A  ++++T HFRY F  E++KR+ARYYS  WRTWAAV +QLAWRRY+ R      + 
Sbjct  595   GLEAEDVKYVTQHFRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSF  654

Query  2279  ------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                   +  ++  G+ RLR Y A+  S +P+ 
Sbjct  655   IRPRRPLSRSSSMGEDRLRLYTALLTSPKPNQ  686



>ref|XP_010904933.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Elaeis 
guineensis]
Length=648

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/620 (49%), Positives = 422/620 (68%), Gaps = 16/620 (3%)
 Frame = +2

Query  524   SGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIV  703
             S   G V+DP+S+ VQ WNRAFLL     L +DPLFFYALSI      CL++DG  A  V
Sbjct  32    SWSLGGVVDPQSRWVQEWNRAFLLVCTAGLVVDPLFFYALSIS-GARMCLFVDGWFAITV  90

Query  704   TVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFV  883
             T LR   DAVH+ ++W++ + +Y +R       G+     RA A  Y++S KGF+FD F+
Sbjct  91    TALRCMTDAVHVWNMWMRLKTSYSTRRLRGAEEGQAPMSPRASAFGYLKSKKGFFFDLFI  150

Query  884   ILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFG  1063
             I P+PQ V W+  P LIR     ++MT+ L++FLFQ+LP+IYH I  +RR+Q   G IFG
Sbjct  151   IFPVPQVVLWVAAPVLIRRGLTTMVMTVFLIMFLFQYLPKIYHCICFLRRLQNSLGCIFG  210

Query  1064  TIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCY  1240
             TIWWG  LNLIAYF A+H  G CWY+L IQR  +CL ++C   K  C L+ + C+  + Y
Sbjct  211   TIWWGIALNLIAYFAAAHAIGACWYLLGIQRATNCLNEQCIATKG-CGLKTVGCANPIYY  269

Query  1241  ELLLPGG-VEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYP  1417
              +    G  E  S A N  A     + +CL+    F +G Y W + ++++ +   KIL P
Sbjct  270   GITTASGDGEILSWANNVNA-----REVCLNSQDKFDYGTYTWTVLLIANSNRLEKILLP  324

Query  1418  IFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ  1597
             IFWGLM L+TFG  LE T+ W E++F+I ++ +GL+L T+LIGNI+VFLH+  +KK+ + 
Sbjct  325   IFWGLMNLTTFGGGLESTTEWHEILFNIIVITAGLLLVTMLIGNIKVFLHSATSKKQALH  384

Query  1598  LRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCL  1777
             L+ R ++WWM++RQLP  +RQRVR +ERQRWAAM G DE ++I+DLPEGLR++IK  LCL
Sbjct  385   LKMRSLDWWMRKRQLPKGIRQRVRQYERQRWAAMRGVDECKMIQDLPEGLRKEIKYHLCL  444

Query  1778  DLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS  1957
             DL+++VPLF  +D+L+L+NICDR+K L+F K E I REGDPVQR++FIVRG ++SSQ L 
Sbjct  445   DLVRQVPLFQHMDELVLENICDRVKSLIFPKGETITREGDPVQRMLFIVRGHLQSSQVLR  504

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G+++  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAF L+A+ ++++T 
Sbjct  505   DGIMSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLVTLETTEAFSLEASDVKYVTQ  564

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENAD  2296
             +FRY F NE++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +           + 
Sbjct  565   NFRYTFVNEQVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLASLSFIRPRRPASRCSS  624

Query  2297  DGDRRLRQYAAMFLSIRPHD  2356
              G+ RLR Y A+  S +P+ 
Sbjct  625   PGEERLRHYTALLTSPKPNQ  644



>emb|CDY28787.1| BnaA02g09790D [Brassica napus]
Length=621

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/626 (51%), Positives = 435/626 (69%), Gaps = 32/626 (5%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y LS+      CL +DG LA  VT L
Sbjct  2     LGRILDPRSKLVQEWNRVFLLVCATGLFVDPLFLYTLSVN-DACMCLLVDGWLALTVTAL  60

Query  713   RTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASHYVRSLKGFWF  871
             R+  D +H+ ++ +QF++A    Y   +S   +  G G  V      A  YV+   GF+F
Sbjct  61    RSMTDLLHLWNILIQFKIARWWPYRGGDSDGDINKGDGTRV--RMRGAPPYVKK-NGFFF  117

Query  872   DAFVILPIPQ-AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVT  1048
             D FVILP+PQ  V W+V+P L++   V L+++ILLL FLFQ+LP+IYHSI  +R+   ++
Sbjct  118   DLFVILPLPQQVVLWVVIPSLLKRGSVTLVVSILLLTFLFQYLPKIYHSIRHLRQNATLS  177

Query  1049  GYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCS  1225
             GYIFGT+WWGF LN++AYF+A+H AG CWY+L +QR A CL+++C      C+LR LSC 
Sbjct  178   GYIFGTVWWGFALNMVAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTMGCDLRMLSCK  236

Query  1226  EEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSI  1396
             E V Y   E++L       + A N  A     + +CLD++  + +G Y+W + +VS+ S 
Sbjct  237   EPVYYGTTEMVLDRA--RLAWARNHQA-----RSVCLDIDTDYTYGAYQWTIQLVSNESR  289

Query  1397  AVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVM  1576
               K+L+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  
Sbjct  290   LEKVLFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATT  348

Query  1577  AKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRD  1756
             +KK+ M L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRD
Sbjct  349   SKKQAMHLKMRNIEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRD  408

Query  1757  IKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRV  1936
             IK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG +
Sbjct  409   IKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHL  468

Query  1937  KSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDAN  2116
             +SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA 
Sbjct  469   QSSQLLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAQ  528

Query  2117  HLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT------  2278
              ++++T HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +      
Sbjct  529   DVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRR  588

Query  2279  -VPENADDGDRRLRQYAAMFLSIRPH  2353
              +   A  G+ +LR Y A+  S +P+
Sbjct  589   PLSRCASLGEDKLRLYTAILTSPKPN  614



>ref|XP_003541002.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Glycine 
max]
Length=690

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/624 (51%), Positives = 430/624 (69%), Gaps = 27/624 (4%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             VLDPR+K VQ WNR FLL     L +DPLFFY LS+  S   C+++DG LA  VTVLR  
Sbjct  70    VLDPRAKWVQEWNRVFLLVCAAGLFVDPLFFYVLSVSDSCM-CVFVDGWLAVTVTVLRCM  128

Query  722   LDAVHICHLWLQ-------FRLAYVSRESLVVGCGKLVWDAR--AVASHYVRSLKGFWFD  874
              DA+H+ ++ ++       F L   +           + D R  +VA  Y++S  GF+FD
Sbjct  129   TDALHVWNMVIRSKMAKRTFGLGAATASGRGSSSSIGLRDTRPCSVAIGYLKSRTGFFFD  188

Query  875   AFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGY  1054
              FVILP+PQ V W+ +P L+ +  V L+MT+ L+IFLFQ+LP+IYHS+  +RR Q ++GY
Sbjct  189   LFVILPLPQIVLWVAIPSLLEKGSVTLVMTVFLIIFLFQYLPKIYHSVCHLRRTQNLSGY  248

Query  1055  IFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEE  1231
             IFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+ +C  + S C ++ LSC   
Sbjct  249   IFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLKVQCA-KTSGCGMKILSCQTP  307

Query  1232  VCY--ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVK  1405
             + Y    LL       + A N        +  CL+    + +G Y+W + +V++ +   K
Sbjct  308   IYYGSNSLLVRDKARLAWAENREV-----RHTCLNGPDSYNYGAYRWTVQLVTNDNRLEK  362

Query  1406  ILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKK  1585
             IL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK
Sbjct  363   ILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKK  421

Query  1586  RKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKR  1765
             + MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G DE E+ K+LPEGLRRDIK 
Sbjct  422   QAMQLKMRNIEWWMRKRRLPLGFRQRVRNYERQRWAAMRGVDEFEMTKNLPEGLRRDIKY  481

Query  1766  FLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSS  1945
              LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGDPVQR++F+VRG ++SS
Sbjct  482   HLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIAREGDPVQRMLFVVRGHLQSS  541

Query  1946  QNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLR  2125
             Q L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  ++
Sbjct  542   QVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLITLETTEAFGLEAQDVK  601

Query  2126  FITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VP  2284
             ++T HFRY F  E++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       + 
Sbjct  602   YVTQHFRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLS  661

Query  2285  ENADDGDRRLRQYAAMFLSIRPHD  2356
              ++  G+ +LR Y A+  S +P+ 
Sbjct  662   RSSSIGEDKLRLYTALLTSPKPNQ  685



>gb|EPS70503.1| hypothetical protein M569_04242, partial [Genlisea aurea]
Length=585

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/614 (50%), Positives = 422/614 (69%), Gaps = 49/614 (8%)
 Frame = +2

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICH  745
             VQ WNR FLL   ++L +DPLFFYALSI  S   C+++DG  A  VTVLR   DA+HI +
Sbjct  2     VQEWNRIFLLVCSVSLFVDPLFFYALSISES-FACIFIDGWFAVAVTVLRCVSDALHIWN  60

Query  746   LWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVP  925
             +WLQFR+             KL W+             GF+F+ F++ P+PQ V W+V+P
Sbjct  61    MWLQFRMN-----------RKLKWNG------------GFFFELFIVFPLPQIVMWVVIP  97

Query  926   KLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYF  1105
             KL+R+      +T+LL++F+FQ+LP+IY+S+ L+RRMQ ++GYIFGT+WWG  LN+IAYF
Sbjct  98    KLLRKGSTTEAITVLLIMFIFQYLPKIYYSVDLLRRMQNLSGYIFGTVWWGIALNIIAYF  157

Query  1106  IASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRL-SCSEEVCYELLLPGGVEG--NS  1276
             +ASH  GGCWY+L IQR A CL   C  + + CN R+ +C E V Y      G +   N+
Sbjct  158   VASHAVGGCWYLLGIQRAARCLNDECG-KSNGCNYRMVTCQERVYY------GTKQLVNT  210

Query  1277  CAGNSTAAALMR-------KPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
                N+  A L+        +  CL     + +G YKW + +V++ +   KIL+PIFWGLM
Sbjct  211   MEPNNYGARLINWEYIQNARSTCLLNYDNYGYGAYKWTVQLVTNSNRVEKILFPIFWGLM  270

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGN LE T++WLEV+F I ++ +GL+L T+LIGNI+VFLHA  +KK+ MQL+ R++
Sbjct  271   TLSTFGN-LESTTDWLEVVFIIIVLTAGLLLVTMLIGNIKVFLHATTSKKQAMQLKMRNI  329

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM +R LP + RQRVR +ERQRWAAM G DE E+ ++LPEGLRRDIK  LCLDL+++V
Sbjct  330   EWWMSKRGLPQSFRQRVRNYERQRWAAMRGVDECEMTRNLPEGLRRDIKYHLCLDLVRQV  389

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLF  +D L+L+NICDR+K L+F+K E I REGDPV R++FIVRG ++SSQ L  GV + 
Sbjct  390   PLFQHMDSLVLENICDRVKSLIFTKGETITREGDPVGRMLFIVRGHLQSSQILRDGVKSC  449

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L PG F GDELLSWCLR+PFI+RLP SS+T   +++TEAFGL+A+ ++++T HFRY F
Sbjct  450   CMLGPGNFSGDELLSWCLRKPFIERLPPSSSTLVTLETTEAFGLEADDVKYVTQHFRYTF  509

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRL  2314
               E++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +  +A  G+ RL
Sbjct  510   VKEKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRSASLGEDRL  569

Query  2315  RQYAAMFLSIRPHD  2356
             R Y A+  S +P+ 
Sbjct  570   RLYTALLTSPKPNQ  583



>ref|XP_006280133.1| hypothetical protein CARUB_v10026031mg [Capsella rubella]
 gb|EOA13031.1| hypothetical protein CARUB_v10026031mg [Capsella rubella]
Length=669

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/578 (53%), Positives = 413/578 (71%), Gaps = 14/578 (2%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK VQ WNR FLL     L +DPLF Y +S+  +   CL +DG LA  VT L
Sbjct  87    LGRILDPRSKWVQEWNRVFLLVCATGLFVDPLFLYTISVNDT-CMCLLVDGWLALTVTAL  145

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLVVGC-GKLVWDARAVASHYVRSLKGFWFDA  877
             R+  D +H+ ++W+QF++A    Y   +S      G     +  V   YV+  +GF+FD 
Sbjct  146   RSMTDLLHLWNIWVQFKIARRWPYPGGDSDGDNNKGGGTRGSMRVVPQYVKK-RGFFFDL  204

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQ V W+V+P L++   V L++++LL+ F+FQ+LP+IYHSI  +RR    +GYI
Sbjct  205   FVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFIFQYLPKIYHSIRHLRRNANFSGYI  264

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEV  1234
             FGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      C++R LSC E V
Sbjct  265   FGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTIGCDIRMLSCKEPV  323

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
              Y   +    +       +  A    + +CLD+N  + +G Y+W + +VS+ S   KIL+
Sbjct  324   YYGTTVMVLDKARLAWAKNHQA----RSVCLDINTNYTYGAYQWTIQLVSNESRLEKILF  379

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M
Sbjct  380   PIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAM  438

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
              L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LC
Sbjct  439   HLKMRNVEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLC  498

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             LDL+++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L
Sbjct  499   LDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQFL  558

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
               GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  ++++T
Sbjct  559   RDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAEDVKYVT  618

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRY  2248
              HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY
Sbjct  619   QHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRY  656



>ref|XP_010694435.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Beta vulgaris 
subsp. vulgaris]
Length=701

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/623 (52%), Positives = 429/623 (69%), Gaps = 25/623 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              G VLDPR+  VQ WN+ FLL     L +DPLFFYALSI  +   CL++DG  A +VTV+
Sbjct  84    LGGVLDPRATWVQEWNKIFLLVCVTGLFVDPLFFYALSISEA-YLCLFVDGWFAIMVTVI  142

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVW---DARAVASHYVRSLKGFWFDAFV  883
             R   D +H+ ++WLQ ++A   +     G G+       A  VA  Y ++  GF+FD FV
Sbjct  143   RCMTDVLHVWNMWLQLKMAKHHQPFSRDGNGESRLGDKSAHKVALGYFKARNGFFFDLFV  202

Query  884   ILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFG  1063
             ILP+PQ V W+V+P L+R      +M +LL+IFLFQ+LP+IYHS+ L+RRMQK +GY+FG
Sbjct  203   ILPLPQIVLWVVIPYLLRRGSTNAVMIVLLIIFLFQYLPKIYHSVCLLRRMQKFSGYVFG  262

Query  1064  TIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYE  1243
             TIWWGF LN+I YF+ASH AG CWY+L IQRV  CL ++C  +   CN RL  S++    
Sbjct  263   TIWWGFALNMIVYFVASHAAGACWYLLGIQRVIKCLSEQCS-KMHGCNTRLLASQQ----  317

Query  1244  LLLPGGVEGNSCAGNST-----AAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
                P    GN            A+  + +  CL+    + +G YKW + +VS+ +   KI
Sbjct  318   ---PIFYGGNKALIKDHGRLFWASNRVARHNCLESYNNYEYGAYKWVIYLVSNNNRFEKI  374

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L PIFWGLMT+STFGN LE T+ W+E +F I ++ SGL+L T+LIGNI+VFLHA  +KK+
Sbjct  375   LMPIFWGLMTMSTFGN-LESTAEWMESLFVIIVLTSGLLLVTMLIGNIKVFLHATTSKKQ  433

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              MQLR R++EWWMK+R+LP  L+QRVR +E QRWAAM G DE E+I++LPEGLRRDIK  
Sbjct  434   AMQLRMRNIEWWMKKRKLPLKLKQRVRNYEWQRWAAMRGVDECEMIRNLPEGLRRDIKYH  493

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+K+VPLF  +DDL+L+NICDR+K LVF+K E I +EGDPVQR++FIVRG ++SSQ
Sbjct  494   LCLDLVKQVPLFQHMDDLVLENICDRVKSLVFTKGETITKEGDPVQRMLFIVRGHLQSSQ  553

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T   +++TEAFGL+A  +++
Sbjct  554   FLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLITLETTEAFGLEAEDVKY  613

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPE  2287
             +T HFRY F N ++KR+ARYYS  WRTWAAV +QLAWRRY+ R      +       +  
Sbjct  614   VTQHFRYTFVNNKVKRSARYYSPGWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSR  673

Query  2288  NADDGDRRLRQYAAMFLSIRPHD  2356
             ++  G+ RLR Y A+  S +P+ 
Sbjct  674   SSSLGEDRLRLYTALLTSPKPNQ  696



>ref|XP_009392575.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/634 (49%), Positives = 420/634 (66%), Gaps = 17/634 (3%)
 Frame = +2

Query  473   KNRPGSVTHRSTQDFHRSGPF-GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSI  649
             +N+P   T     D HR     G  LDP +K V+ WNR +LLA  + L +DPLFFY LS+
Sbjct  20    QNKPSEST--GACDSHRGRWLHGWALDPCTKWVREWNRIYLLACALGLIVDPLFFYTLSV  77

Query  650   GRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARA  829
                   C+++DG  A  VT LR  +DA+H+ ++WLQ ++AY ++ S     G+       
Sbjct  78    S-GALKCIFVDGWFAVTVTALRCMIDAMHVWNIWLQLKMAYGAKRSEGEEKGEKG-GGGN  135

Query  830   VASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIY  1009
                 YV+S +GF+ D FV+LP+ Q V W+  P L+R      +MT+ L+ FLF++LP+IY
Sbjct  136   FMPIYVKSKRGFFLDIFVVLPVMQIVTWVGAPALLRRGATTTVMTVFLITFLFEYLPKIY  195

Query  1010  HSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHY  1189
             HS+ ++RRMQ  +GY+FGTIWWG  LNL+ YF+ASH  G CWY+L IQR   CLR +C  
Sbjct  196   HSVCILRRMQNFSGYVFGTIWWGIALNLMVYFVASHAVGACWYLLGIQRAEKCLRVQCSR  255

Query  1190  QKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWA  1369
              K      ++C + + Y             A    A  L  K  CLD +  F++G YKW 
Sbjct  256   VKGCGPKTMACMDPIYY----GAATRTRDEARLDWAKNLEAKTRCLDSSDYFQYGAYKWT  311

Query  1370  LPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGN  1549
             + +V++ +   KIL PIFWGLMTLSTFGN LE T+ WLE++F+I I+ SGL+L T+LIGN
Sbjct  312   VSLVTNTNRLEKILLPIFWGLMTLSTFGN-LESTTEWLEIVFNIIIITSGLILVTMLIGN  370

Query  1550  IQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIK  1729
             I+VFLHA  +KK+ M LR R +EWWMKRR L   +RQRVR +ERQRWAA  G DE E+I+
Sbjct  371   IKVFLHATTSKKQAMHLRIRSVEWWMKRRNLTQGIRQRVRQYERQRWAATRGVDECEMIR  430

Query  1730  DLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQR  1909
             + P+GLRRDIK  LCLDL+++VPLF  +D+L+L+NICDR+K L+F K E I REGDPV+R
Sbjct  431   NFPDGLRRDIKYHLCLDLVRQVPLFQHMDELVLENICDRLKSLIFPKGEVIAREGDPVRR  490

Query  1910  VVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDS  2089
             ++F+VRG ++SSQ L  G+ +  +L PG F GDELLSWCLRRPF++RLP SS+T   ++ 
Sbjct  491   MLFVVRGHLQSSQALRDGIRSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLEP  550

Query  2090  TEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQ  2269
             TEAFGL+A  ++++T HFRY F NER+KR+ARYYS  WRTWAAV VQLAWRRY+ R    
Sbjct  551   TEAFGLEAGDVKYVTQHFRYTFTNERVKRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLT  610

Query  2270  PNT-------VPENADDGDRRLRQYAAMFLSIRP  2350
               +       +   +  G+ +LR Y A+  S +P
Sbjct  611   SLSFIRPRRPLSRCSSLGEEKLRLYTALLTSPKP  644



>ref|NP_001190536.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana]
 gb|AED96475.1| cyclic nucleotide-gated ion channel 4 [Arabidopsis thaliana]
Length=689

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/620 (51%), Positives = 427/620 (69%), Gaps = 26/620 (4%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GR+LDPRSK V+ WN+ FLL     L +DPLF Y LS+  +   CL +DG LA  VT L
Sbjct  76    LGRILDPRSKWVREWNKVFLLVCATGLFVDPLFLYTLSVSDTCM-CLLVDGWLALTVTAL  134

Query  713   RTCLDAVHICHLWLQFRLA----YVSRESLV-VGCGKLVWDARAVASHYVRSLKGFWFDA  877
             R+  D +H+ ++W+QF++A    Y   +S      G     +  VA  YV+   GF+FD 
Sbjct  135   RSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGGGTRGSTRVAPPYVKK-NGFFFDL  193

Query  878   FVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             FVILP+PQ V W+V+P L++   V L++++LL+ FLFQ+LP+IYHSI  +RR   ++GYI
Sbjct  194   FVILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIYHSIRHLRRNATLSGYI  253

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEV  1234
             FGT+WWG  LN+IAYF+A+H AG CWY+L +QR A CL+++C      C+LR LSC E V
Sbjct  254   FGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCE-NTIGCDLRMLSCKEPV  312

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILY  1414
              Y   +            +  A    + +CLD+N  + +G Y+W + +VSS S   KIL+
Sbjct  313   YYGTTVMVLDRARLAWAQNHQA----RSVCLDINTNYTYGAYQWTIQLVSSESRLEKILF  368

Query  1415  PIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKM  1594
             PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M
Sbjct  369   PIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAM  427

Query  1595  QLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLC  1774
              L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LC
Sbjct  428   HLKMRNIEWWMKKRHLPIGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLC  487

Query  1775  LDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNL  1954
             LDL+++      +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L
Sbjct  488   LDLVRQ-----HMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLL  542

Query  1955  SKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFIT  2134
               GV +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  ++++T
Sbjct  543   RDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAEDVKYVT  602

Query  2135  DHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENA  2293
              HFRY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   A
Sbjct  603   QHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCA  662

Query  2294  DDGDRRLRQYAAMFLSIRPH  2353
               G+ +LR YAA+  S +P+
Sbjct  663   SLGEDKLRLYAAILTSPKPN  682



>ref|XP_002989263.1| hypothetical protein SELMODRAFT_129465 [Selaginella moellendorffii]
 gb|EFJ09701.1| hypothetical protein SELMODRAFT_129465 [Selaginella moellendorffii]
Length=685

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/626 (50%), Positives = 438/626 (70%), Gaps = 27/626 (4%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             RS  FG+VLDPRS+ ++ WNR FL++RG++LAIDPLF Y +SI    T CL++DG  AA+
Sbjct  66    RSWIFGQVLDPRSRYIRAWNRLFLVSRGLSLAIDPLFLYVVSIDEDST-CLHVDGWFAAL  124

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VT+LR  +D + + H+ LQ +LA+VS++SLVVG GKLVWD + VA HY++  +GF  D  
Sbjct  125   VTILRAAIDVMLLWHVRLQLKLAFVSKKSLVVGRGKLVWDGKKVALHYIQQREGFLCDVL  184

Query  881   VILPIPQAVFWLVVPKLI-REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             V+LPI + + WL+VP +I +  Q   +M+++L +F+ Q+LP++ H + LMRRMQ VTGYI
Sbjct  185   VMLPIMEVLIWLIVPGMITKRNQGIHMMSLVLFVFILQYLPKVSHLVLLMRRMQHVTGYI  244

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR---LSCSE  1228
             F + WWGF LNL AYFIASHVAG CWY+L +QR+ +C+    H Q      R   L C +
Sbjct  245   FSSAWWGFVLNLTAYFIASHVAGACWYLLGLQRIETCM----HVQLEKKGFRSSWLGCHK  300

Query  1229  EVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              + +       V+G++ +  S  +A     +  +    F +GIY+  +P+  +R+   +I
Sbjct  301   PISFG---HAPVKGSTTSPLSINSAAFISCIS-NYTNTFSYGIYQPTIPLALTRNWLERI  356

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
              YPIFWGLMTLS+FGN LEPT++  EV FSI ++  GL+LFTLLIGNIQ+FL+++ +KK 
Sbjct  357   SYPIFWGLMTLSSFGN-LEPTNHVPEVAFSIIVITCGLLLFTLLIGNIQMFLYSMTSKKE  415

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
             +MQL+ RD+E WMKRRQLP+ LR RVR++ERQ+WA+  G DE  ++ DLP+G++RDIKR 
Sbjct  416   EMQLKMRDLEHWMKRRQLPTRLRHRVRHYERQKWASTRGVDEHAMVCDLPDGIKRDIKRH  475

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL   VPLF  +D+++LDNICDR+KP+++ KDE I+REGDPV R++F+VRG+++S  
Sbjct  476   LCLDL---VPLFGQMDEVVLDNICDRVKPILYIKDEIIMREGDPVLRMLFMVRGQLESVY  532

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRP--FIDRLPASSATFTCIDSTEAFGLDANHL  2122
              + K  ++T  L PG F G+ELL WCL R    I  LP S AT +C++S EAFGL+A  L
Sbjct  533   RVGKSKMSTVTLGPGNFCGEELLPWCLYRSSDTIASLPPSIATISCLESVEAFGLEAEDL  592

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR------LRTRGQPNTVP  2284
             +++T +F++ F NE+L+ T RYYS  WRTWAAVN+QLAWRRY+      L    Q   V 
Sbjct  593   KYVTQNFQHTFINEKLRHTTRYYSPGWRTWAAVNIQLAWRRYKYHKALALDMPRQGGFVR  652

Query  2285  ENADDGDRR--LRQYAAMFLSIRPHD  2356
             + ++   R+  LR YAAM +S +P D
Sbjct  653   KASEASLRKDLLRMYAAMMVSPKPRD  678



>ref|XP_010277927.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Nelumbo nucifera]
Length=686

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 423/615 (69%), Gaps = 16/615 (3%)
 Frame = +2

Query  533   FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
              GRVLDPRS  +Q WNR FLL    +L +DPLFFYAL I  +   CL++DG  A  VT L
Sbjct  63    LGRVLDPRSMWIQEWNRVFLLVSTTSLFVDPLFFYALLISETCM-CLFIDGWFAITVTAL  121

Query  713   RTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWD--ARAVASHYVRSLKGFWFDAFVI  886
             R   DA+H+ ++WLQF++A  S+  ++V     + +  AR+ A  Y+++ KGF+ D F++
Sbjct  122   RCMTDALHVWNMWLQFKMAQRSQAVVMVEDSAKLQNTSARSTALRYLKAKKGFFLDLFIL  181

Query  887   LPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGT  1066
             LP+PQ + W+ +P L+      ++MT+ L+ FLFQ+ P+I +S+ L+RRMQ  +GYIFGT
Sbjct  182   LPVPQIMLWVAIPSLLERGSSAVVMTVFLITFLFQYFPKICYSVCLLRRMQNQSGYIFGT  241

Query  1067  IWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYEL  1246
             +WWG  LNLI++F+ASH AG CWY+L +QR   CL ++C   K      L+C + + Y  
Sbjct  242   VWWGIALNLISFFVASHAAGACWYLLGLQRATKCLGEQCRATKGCRLSTLACEDPIYYGT  301

Query  1247  LLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFW  1426
              +    E  + A N  A     + +C++    + +G+Y+W + +V++ S   KIL PIFW
Sbjct  302   RMVIDRERLAWAENKHA-----RSMCIESADNYEYGLYEWTIYLVANASRVEKILLPIFW  356

Query  1427  GLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRC  1606
             GLM L TFGN L+ ++ WLE +F+I ++  GL+L T+LIGNI+VFLH++ +KK+ MQL+ 
Sbjct  357   GLMNLCTFGN-LQCSTEWLETVFNIIVIACGLLLVTMLIGNIKVFLHSITSKKQAMQLKM  415

Query  1607  RDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLI  1786
             R++EWWM+RR LP   RQRVR +ERQRWAAM G DE ++I+ LPEGLRRDIK  LCLDL+
Sbjct  416   RNVEWWMRRRNLPQGFRQRVRKYERQRWAAMRGVDECQIIRYLPEGLRRDIKYHLCLDLV  475

Query  1787  KKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGV  1966
             ++VPLF  +DDL+L+NICDR+K L+F K E I +EGDPV+R++FIVRG ++S Q L  GV
Sbjct  476   RQVPLFQHMDDLVLENICDRVKSLIFPKGETITKEGDPVRRMLFIVRGHLQSCQVLRDGV  535

Query  1967  VATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFR  2146
              +  +L PG F GDELLSWCL+RPF++RLP SS+T   +++TEAF L+A  +R++T HFR
Sbjct  536   QSCCMLGPGNFSGDELLSWCLKRPFVERLPPSSSTLITLETTEAFALEAEDVRYVTQHFR  595

Query  2147  YKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGD  2305
             Y F NE++KR+ARYYS  WRT AAV +QLAWRRY+ R      +       +  ++  G+
Sbjct  596   YTFINEKVKRSARYYSPGWRTGAAVAIQLAWRRYKHRLTLASLSFLRPRRPLSRSSSLGE  655

Query  2306  RRLRQYAAMFLSIRP  2350
              RLR Y A+  + +P
Sbjct  656   DRLRLYTAILTAPKP  670



>ref|XP_009402606.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/689 (47%), Positives = 425/689 (62%), Gaps = 74/689 (11%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAH--------QPEWEASAGSSLIPIKNRPGSVTHRSTQ  511
             +  C  C+  G    H+    +AH        +P W +S                     
Sbjct  4     TAHCSGCSSAGEEALHAEEASSAHVASNSGCGKPPWSSS---------------------  42

Query  512   DFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGL  691
                         + ++K  Q WNRAFLL     L +DPLFFYALSI R+   C+++DG  
Sbjct  43    ------------ESKAKLFQEWNRAFLLVCAGGLFVDPLFFYALSISRTCM-CVFIDGWF  89

Query  692   AAIVTVLRTCLDAVHICHLWLQFRLAYVS---RESLVVGCGKLVWDARAVASHYVRSLKG  862
             A  VTVLR   DAVH+ +LWLQ R A      R S      K +   R ++      LK 
Sbjct  90    AVTVTVLRCTNDAVHLLNLWLQVRTAAYDAGRRASADEEGCKAIAKVRRLSF-----LKS  144

Query  863   FWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQK  1042
               FD FVILP+PQ V W+V P LIR      +MT+ L++FL Q+LP+IYH+   +RR+Q 
Sbjct  145   VLFDLFVILPVPQVVMWIVAPALIRRGMTTTVMTVFLIMFLLQYLPKIYHAFCFLRRLQN  204

Query  1043  VTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LS  1219
             + GYIFG IW G  LNLIAYF+ASH AG CWY+L IQR   CL Q+C   +  C LR ++
Sbjct  205   LLGYIFGNIWGGIVLNLIAYFVASHAAGACWYLLGIQRATKCLNQQCMATEG-CALRTVA  263

Query  1220  CSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIA  1399
             C++ + Y     G  E    A          + +CLD +  F +G YKW + +V++ S  
Sbjct  264   CTDPMYY-----GVTERQRLAWAENKKV---RSMCLDSSDNFEYGAYKWTVALVTNPSRV  315

Query  1400  VKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMA  1579
              KIL PIFWGLMTLSTFG  +E T+ WLE++F+I IV SGL+L T LIGNI+VFLHA  +
Sbjct  316   EKILLPIFWGLMTLSTFGT-IESTTEWLEIVFNIIIVTSGLLLVTALIGNIKVFLHATTS  374

Query  1580  KKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDI  1759
             KK+ + LR R +EWWM+RR LP   RQRVR +ERQRWAAM G DE E+ ++LPEGLRRDI
Sbjct  375   KKQALHLRMRSLEWWMRRRHLPRGFRQRVRQYERQRWAAMRGVDECEVTRNLPEGLRRDI  434

Query  1760  KRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVK  1939
             K  LCLDL+++VPLF  +D+L+L+NICDR+K L+F K E I REGDPVQR++F+VRG ++
Sbjct  435   KYHLCLDLVRQVPLFQHMDELVLENICDRVKSLIFPKGETITREGDPVQRMLFVVRGHLR  494

Query  1940  SSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANH  2119
             SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+T    ++TEAFGL A+ 
Sbjct  495   SSQALRNGVKSHCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTAETTEAFGLGASD  554

Query  2120  LRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR----------LRTRGQ  2269
             LR++T HFRY F +E+++R+ARYYS  WRTWAAV +QLAWRRYR          +R R  
Sbjct  555   LRYVTQHFRYTFVSEKVRRSARYYSPGWRTWAAVAIQLAWRRYRHRLTLTSLSFIRPRRP  614

Query  2270  PNTVPENADDGDRRLRQYAAMFLSIRPHD  2356
              +      +D   +LR Y A+  S +P+ 
Sbjct  615   LSRCSSLEED---KLRIYTALLTSPKPNQ  640



>ref|XP_002965652.1| hypothetical protein SELMODRAFT_84488 [Selaginella moellendorffii]
 gb|EFJ33072.1| hypothetical protein SELMODRAFT_84488 [Selaginella moellendorffii]
Length=685

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/626 (50%), Positives = 437/626 (70%), Gaps = 27/626 (4%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             RS  FG+VLDPRS+ ++ WNR FL++RG++LAIDPLF Y +SI    T CL++DG  AA+
Sbjct  66    RSWIFGQVLDPRSRYIRAWNRLFLVSRGLSLAIDPLFLYVVSIDEDST-CLHVDGWFAAL  124

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VT+LR  +D + + H+ LQ +LA+VS++SLVVG GKLVWD + VA HY++  +GF  D  
Sbjct  125   VTILRAAIDVMLLWHVRLQLKLAFVSKKSLVVGRGKLVWDGKKVALHYIQQREGFLCDVL  184

Query  881   VILPIPQAVFWLVVPKLI-REEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYI  1057
             V+LPI + + WL+VP +I +  Q   +M+++L +F+ Q+LP++ H + LMRRMQ VTGYI
Sbjct  185   VMLPIMEVLIWLIVPGMITKRNQGIHMMSLVLFVFILQYLPKVSHLVLLMRRMQHVTGYI  244

Query  1058  FGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR---LSCSE  1228
             F + WWGF LNL AYFIASHVAG CWY+L +QR+ +C+    H Q      R   L C +
Sbjct  245   FSSAWWGFVLNLTAYFIASHVAGACWYLLGLQRIETCM----HVQLEKKGFRSSWLGCHK  300

Query  1229  EVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              + +       V+G++ +  S  +A     +  +    F +GIY+  +P+  +R+   +I
Sbjct  301   PISFG---HAPVKGSTTSPLSINSAAFISCIS-NYTNTFSYGIYQPTIPLALTRNWLERI  356

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
              YPIFWGLMTLS+FGN LEPT++  EV FSI ++  GL+LFTLLIGNIQ+FL+++ +KK 
Sbjct  357   SYPIFWGLMTLSSFGN-LEPTNHVPEVAFSIIVITCGLLLFTLLIGNIQMFLYSMTSKKE  415

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
             +MQL+ RD+E WMKRRQLP+ LR RVR++ERQ+WA+  G DE  ++ DLP+G++RDIKR 
Sbjct  416   EMQLKMRDLEHWMKRRQLPTRLRHRVRHYERQKWASTRGVDEHAMVCDLPDGIKRDIKRH  475

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL   VPLF  +D+++LDNICDR+KP+++ KDE I+REGDPV R++F+VRG+++S  
Sbjct  476   LCLDL---VPLFGQMDEVVLDNICDRVKPILYIKDEIIMREGDPVLRMLFMVRGQLESVY  532

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRP--FIDRLPASSATFTCIDSTEAFGLDANHL  2122
              + K  ++   L PG F G+ELL WCL R    I  LP S AT +C++S EAFGL+A  L
Sbjct  533   RVGKSKMSIVTLGPGNFCGEELLPWCLYRSSDTIASLPPSIATISCLESVEAFGLEAEDL  592

Query  2123  RFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR------LRTRGQPNTVP  2284
             +++T +F++ F NE+L+ T RYYS  WRTWAAVN+QLAWRRY+      L    Q   V 
Sbjct  593   KYVTQNFQHTFINEKLRHTTRYYSPGWRTWAAVNIQLAWRRYKYHKALALDMPRQGGFVR  652

Query  2285  ENADDGDRR--LRQYAAMFLSIRPHD  2356
             + ++   R+  LR YAAM +S +P D
Sbjct  653   KASEASLRKDLLRMYAAMMVSPKPRD  678



>ref|XP_007032656.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2 [Theobroma cacao]
 gb|EOY03582.1| Cyclic nucleotide-regulated ion channel family protein isoform 
2 [Theobroma cacao]
Length=630

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/431 (68%), Positives = 353/431 (82%), Gaps = 7/431 (2%)
 Frame = +2

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLP  1255
             GF  ++        VAGGCWYVLA QRV +CL+Q+C  + ++CN   SCS+ VC + L P
Sbjct  206   GFWFDVFVILPVPQVAGGCWYVLATQRVVTCLQQQCE-RSASCNPSSSCSKRVCSQYLSP  264

Query  1256  GGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
               V  + C G S     M K  C D +GPFR+GIY+ A PV+SS S+AVKILYPIFWGL+
Sbjct  265   ANVLSSQCGGKSIT---MTKSFCFDPDGPFRYGIYEPAPPVISSNSLAVKILYPIFWGLL  321

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
              LS+FGN L PTSN +EV FSICIVL GL+LFTLL+GNIQVFLH VMA ++K+QLR RD+
Sbjct  322   NLSSFGNQLSPTSNPMEVAFSICIVLGGLLLFTLLVGNIQVFLHVVMANRKKLQLRRRDV  381

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             EWWM+RRQLPS LRQRVR+FE Q W +MGGE+EM+ I++LPEGLRRDIKR+LCLDLIKKV
Sbjct  382   EWWMRRRQLPSGLRQRVRHFESQTWDSMGGEEEMKWIEELPEGLRRDIKRYLCLDLIKKV  441

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLFHSLDDLIL+N+CDR+KPL++SKDEKIIREGDPV R+VFIVRG  + SQ  SKG++AT
Sbjct  442   PLFHSLDDLILENVCDRVKPLIYSKDEKIIREGDPVPRMVFIVRGHARRSQGFSKGIIAT  501

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
             S+LEPGGFLGDELLSWCLRRPF+DRLP SSATFTC + TEAFGLDA+ LR+IT+HFRY+F
Sbjct  502   SVLEPGGFLGDELLSWCLRRPFLDRLPTSSATFTCDEFTEAFGLDADDLRYITEHFRYRF  561

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDG-DRRLRQYAAM  2332
             A+ +LKRTARYYS+NWRTWAAVN+Q AWR Y++RTRG    +P  A+ G + RLR+YAAM
Sbjct  562   AHNKLKRTARYYSSNWRTWAAVNIQFAWRFYKMRTRGP--LIPVTANGGMEGRLRKYAAM  619

Query  2333  FLSIRPHDHLE  2365
             F+S+RPHDHLE
Sbjct  620   FMSLRPHDHLE  630


 Score =   283 bits (725),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 169/226 (75%), Gaps = 11/226 (5%)
 Frame = +2

Query  236  MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFISTECYACTQVGVPVFHSTSC  415
            MPS P       RWFG + R      D+   +  +     S ECYACTQVGVPVFHSTSC
Sbjct  1    MPSLP-----FPRWFG-LARTWGFNNDSRSSSEQDGSVSNSIECYACTQVGVPVFHSTSC  54

Query  416  DNAHQPEWEASAGSSLIPIK--NRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
            D+ HQP+WEA AGSSL P++  + P   + R+   F  SGPFG+ LDPRS  VQRWNR  
Sbjct  55   DSVHQPQWEAFAGSSLFPVQAASDPTKNSTRTRSRFS-SGPFGKALDPRSALVQRWNRVL  113

Query  590  LLARGMALAIDPLFFYALSI--GRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFR  763
            L+ARG+ALA+DPLFFY L++     G PC+++D GLAAIVTV+RTC+DAVH+ H+WLQFR
Sbjct  114  LVARGIALAVDPLFFYTLTLITREDGAPCVFLDSGLAAIVTVVRTCVDAVHLWHIWLQFR  173

Query  764  LAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
            LAYVS+ESLVVGCGKLVWDARA+ASHYVRSLKGFWFD FVILP+PQ
Sbjct  174  LAYVSKESLVVGCGKLVWDARAIASHYVRSLKGFWFDVFVILPVPQ  219



>ref|XP_001768026.1| predicted protein [Physcomitrella patens]
 gb|EDQ67098.1| predicted protein [Physcomitrella patens]
Length=696

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/687 (47%), Positives = 445/687 (65%), Gaps = 35/687 (5%)
 Frame = +2

Query  365   CYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRV  544
             CYAC+ VG P+FHST C+     ++ +S  ++      R   + +  T+D      FG V
Sbjct  24    CYACSGVGPPLFHSTVCE-----KYPSSLETTPRTCLERRRHIGYYRTKDSKSKWIFGEV  78

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             LDPR+  ++R+N+ FLL+  +  A+DPLF   LSI +  + CLY+  G A  VT+LR  +
Sbjct  79    LDPRNSTIRRYNKWFLLSCVLGAAVDPLFISVLSINKDLS-CLYVQKGYAIGVTILRCMV  137

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQA  904
             D V+I H+WLQ +LAYVS++SL +G G+LVWDAR VA  Y+RSL  FWFD FVILPIPQ 
Sbjct  138   DLVYIWHMWLQLKLAYVSKKSLFLGQGELVWDARTVAIQYLRSLPQFWFDIFVILPIPQV  197

Query  905   VFWLVVP-KLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
             + W+++P ++++      IM  +LL FL Q++P++   I++  R+Q VTGYIFG+  WGF
Sbjct  198   MLWVILPNQVVKGGDTTWIMNYMLLTFLIQYVPKVLRFIFIAWRLQHVTGYIFGSASWGF  257

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCH-YQKSTCNLRLSCSEEVCYELLLPG  1258
              LNL  YF A+HVAG  WY+L +QRV SC+  +C        N  + C   + Y      
Sbjct  258   VLNLAVYFCAAHVAGSIWYLLTVQRVESCIYLQCKGMTNCQVNSYMGCPNPISY------  311

Query  1259  GVEGNSCAGNSTAAALMRKPL----CL-----DVNGPFRFGIYKWALPVVSS-RSIAVKI  1408
                G   + ++   A    P     CL      + G F FGIY  A+P+V   R+   +I
Sbjct  312   ---GAQPSSDTNRLAWAEDPAFDFQCLKGGAHSLTGNFSFGIYSLAVPIVQDIRTPINRI  368

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             + P+FWG+MT+S+FGN L PT + +EV FSI +++ GL+LFTLLIGNIQVFLH+  A+K 
Sbjct  369   VLPLFWGIMTMSSFGNALSPTPHIVEVTFSILVIICGLLLFTLLIGNIQVFLHSTTARKV  428

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
             K QLR RD+EWWM+RRQLP+ +R+RVR +ER  WAA  G DE+  I+DLPE LRRDIKR 
Sbjct  429   KSQLRARDIEWWMRRRQLPNEIRRRVRQYERHMWAATRGIDEVATIRDLPESLRRDIKRH  488

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LC +L++KVPLF  +DD IL+ IC+R+KP +F+K+E ++ EG+PV++++FIVRG + SS 
Sbjct  489   LCYELVRKVPLFEQVDDQILNIICERLKPKLFTKNETVLNEGEPVRQMLFIVRGNIGSSY  548

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L     +  +L P  F GDEL+SWCL +P  D LP S+ T T +  TEAF LDA  L++
Sbjct  549   RLRHNRTSKCVLGPSHFCGDELISWCLSKPLRDNLPLSTTTLTTLTVTEAFALDALDLKY  608

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR---TRGQPNTVPEN--A  2293
             +T HF++KFANE LKR  R +S +W+TWAAV +QL WRR+R R   +     T P++  A
Sbjct  609   LTQHFQHKFANENLKRAVRSHSCSWQTWAAVTIQLGWRRHRARLSLSNTIATTTPDHSYA  668

Query  2294  DDGD---RRLRQYAAMFLSIRPHDHLE  2365
             DD     R LR YAA+  S +P D+L 
Sbjct  669   DDHSETLRSLRLYAAILCSPKPKDYLS  695



>ref|XP_004487653.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Cicer 
arietinum]
Length=677

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/630 (50%), Positives = 421/630 (67%), Gaps = 40/630 (6%)
 Frame = +2

Query  524   SGPFGRVL-DPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             S   GRVL DPR K V+ WNR FLL   M L +DPLFFYALSI  +   CL++DG L   
Sbjct  63    SFSLGRVLFDPRGKWVEEWNRVFLLVCAMGLFVDPLFFYALSISDTCM-CLFVDGWLLVT  121

Query  701   VTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAF  880
             VTV+R   DA+H+ ++WLQF   Y+ R S   G         + A HY +  K F FD F
Sbjct  122   VTVIRCMTDALHLWNIWLQF---YIHRRS-SFGFIHHHRHHTSHALHYFKHNKAFLFDIF  177

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             V+LP+PQ V W+ +P L+ +  + L+MTILL++FLFQ+LP+IYHS+  +RR   ++GY F
Sbjct  178   VLLPLPQIVLWVTIPSLLEKGSIPLLMTILLIMFLFQYLPKIYHSVCFVRR--NLSGYTF  235

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY  1240
             GT+WWGF LN+IAYF+ASH AG CWY+L +QR A CL ++C    S C +R  C +E  Y
Sbjct  236   GTVWWGFALNMIAYFVASHAAGACWYLLGLQRAAKCLEEQC-VNTSGCGMRTLCCKEPIY  294

Query  1241  ELLLPGGVEGNSCAGNSTAAALMRKPL-----------CLDVNGPFRFGIYKWALPVVSS  1387
                            NS    L R  L           CL     + +G+Y+W++ +V++
Sbjct  295   Y------------GSNSMVKKLERTRLVWAQNREARSTCLTSADNYDYGVYEWSVQLVTN  342

Query  1388  RSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLH  1567
              S   KIL PIFWGLMTLSTFGN L+ T+  +EV+F+I ++ SGL+L T+LIGNI+VFLH
Sbjct  343   DSRLEKILLPIFWGLMTLSTFGN-LQSTTERMEVVFNIIVLTSGLLLVTMLIGNIKVFLH  401

Query  1568  AVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGL  1747
             A  +KK+ M+L+  ++EWWM++RQLP  LRQRVR +ERQRWAAM G DE +LIK+LPEGL
Sbjct  402   ATTSKKQVMRLKMTNIEWWMRKRQLPQGLRQRVRNYERQRWAAMRGVDECQLIKNLPEGL  461

Query  1748  RRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVR  1927
             RRDIK  LCL L+++VPLF  +D+L+L+NICDR+K LVF+K E + REGDPVQR++F+VR
Sbjct  462   RRDIKYHLCLGLVRQVPLFQHMDELVLENICDRVKSLVFTKGETLTREGDPVQRMLFVVR  521

Query  1928  GRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGL  2107
             G ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS T   +++TE FGL
Sbjct  522   GHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPTSSTTLVTLETTEVFGL  581

Query  2108  DANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRR--YRLRTRGQPNTV  2281
             DA  ++++T HFRY F  E ++R+ RYYS  WRTWAAV +QLAWRR  +RL        +
Sbjct  582   DAEDVKYVTQHFRYTFVKENVRRSVRYYSPGWRTWAAVAIQLAWRRSKHRLTLTSLSFIM  641

Query  2282  P-----ENADDGDRRLRQYAAMFLSIRPHD  2356
             P      +    + RLR Y A+  S +P+ 
Sbjct  642   PRRPLSRSTSLEEDRLRLYTALLTSPKPNQ  671



>ref|XP_003568162.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Brachypodium 
distachyon]
Length=706

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/638 (47%), Positives = 411/638 (64%), Gaps = 38/638 (6%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGT-PCLYMDGGLAAIVTVLRT  718
              LDPR++ V+ W+RA+L+A    L +DPLF YA+S+  SGT  C+++D  LAA VT LR 
Sbjct  70    ALDPRARWVREWDRAYLVACAAGLVVDPLFLYAVSV--SGTLMCVFLDAWLAAAVTALRC  127

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWD-------------ARAVAS-------  838
              +DA+H  +   Q RLA  +      G G  V D             A A  S       
Sbjct  128   AVDAMHAWNFLTQLRLARAASAPKSGGTGTGVADEEQADAADQLLDGAAAAGSNNNRMPP  187

Query  839   -HYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHS  1015
              +  RS KG   D FV+LP+ Q V W+  P +IR      +MT+LL+ FL ++LP+IYHS
Sbjct  188   PYARRSRKGMALDFFVLLPVMQVVVWVAAPAMIRAGSTTAVMTVLLVAFLLEYLPKIYHS  247

Query  1016  IYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK  1195
             +  +RRMQ  +G+IFGTIWWG  LNL+AYF+A+H  G CWY+L +QR   CL+++C   +
Sbjct  248   VSFLRRMQNQSGHIFGTIWWGIVLNLMAYFVAAHAVGACWYLLGVQRATKCLKEQCFLLQ  307

Query  1196  STCNLRLSCSEEVCYELLLPGGVEGNSCAGNST---AAALMRKPLCLDVNGP-FRFGIYK  1363
             S C+   S +   C   L  G  +    AG      A     +  CL  +G  +++G YK
Sbjct  308   SGCSS--SGAAVACANPLYYGAAKSVVSAGGDRLAWANDGRARNTCLGGSGENYQYGAYK  365

Query  1364  WALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLI  1543
             W + +V++ S   K+L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LI
Sbjct  366   WTVMLVANTSRLEKMLLPIFWGLMTLSTFGN-LESTTEWLEIVFNIVTITGGLILVTMLI  424

Query  1544  GNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMEL  1723
             GNI+VFL+A  +KK+ M  R R +EWWMKR+ LP   R RVR FERQRWAA  G DE ++
Sbjct  425   GNIKVFLNATTSKKQAMHTRLRSVEWWMKRKNLPQEYRHRVRQFERQRWAATRGVDECQI  484

Query  1724  IKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPV  1903
             ++DLPE LRRDIK  LCLDL+++VP F  +DDL+L+N+CDR+K L+F K E I+REGDPV
Sbjct  485   VRDLPESLRRDIKYHLCLDLVRQVPFFQHMDDLVLENMCDRVKSLIFPKGETIVREGDPV  544

Query  1904  QRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCI  2083
             QR++FIVRG ++ SQ L  G  ++  L PG F GDELLSWCLRRPF++RLPASS+T   +
Sbjct  545   QRMLFIVRGHLECSQALRNGATSSCTLGPGNFSGDELLSWCLRRPFMERLPASSSTLVTM  604

Query  2084  DSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR  2263
             +STE FGLDA  ++++T HFRY F NE+++R+ARYYS  WRTWAAV VQLAWRRY+ R  
Sbjct  605   ESTEVFGLDAADVKYVTRHFRYTFTNEKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKT  664

Query  2264  GQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                 +       +   +  G+ +LR Y A+  S +P+ 
Sbjct  665   LASLSFIRPRRPLSRCSSMGEEKLRLYTAILASPKPNQ  702



>ref|XP_002458600.1| hypothetical protein SORBIDRAFT_03g036490 [Sorghum bicolor]
 gb|EES03720.1| hypothetical protein SORBIDRAFT_03g036490 [Sorghum bicolor]
Length=677

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/608 (49%), Positives = 407/608 (67%), Gaps = 21/608 (3%)
 Frame = +2

Query  575   WNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWL  754
             W+RA+LLA    L +DPLF YA+S+  +   C+++DG  AA VT LR  +DA+H  +L L
Sbjct  73    WDRAYLLACAAGLLVDPLFLYAVSVS-APLMCVFLDGWFAAAVTALRCAVDAMHAANLLL  131

Query  755   QFRLAYVS---RESLVVGCGKLVWDARAVAS--HYVRSLKGFWFDAFVILPIPQAVFWLV  919
             Q R A  S    ++   G      DAR         RS KG + D  VILP+ Q V W+ 
Sbjct  132   QLREACSSPRREDTDEEGAQPGRDDARGAGGVPQRGRSKKGVFLDVLVILPVMQVVVWVA  191

Query  920   VPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIA  1099
              P +IR      +MT+LL+ FL ++LP+IYHS+ ++RRMQ  +GY+FGTIWWG  LNL+A
Sbjct  192   SPAMIRAGSTTAVMTVLLVAFLLEYLPKIYHSVRVLRRMQDFSGYLFGTIWWGIALNLMA  251

Query  1100  YFIASHVAGGCWYVLAIQRVASCLRQRC-HYQKSTCN-LRLSCSEEVCYELLLPGGVEGN  1273
             YF+A+H  G CWY+L  QR   CLR++C     S C    L+C+E + Y   +  G +  
Sbjct  252   YFVAAHAVGACWYLLGAQRATKCLREQCAQAGGSGCAPWALACAEPLYYGRGVTVGADRL  311

Query  1274  SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFG  1453
             + AGN+TA     +  CLD    +++G Y+W + +V++ S   +IL PIFWGLMTLSTFG
Sbjct  312   AWAGNATA-----RGTCLDSADNYQYGAYQWTVMLVANPSRVERILLPIFWGLMTLSTFG  366

Query  1454  NDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKR  1633
             N LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M  R R +E WMKR
Sbjct  367   N-LESTTEWLEIVFNIITITGGLILVTMLIGNIKVFLNATTSKKQAMHTRLRGVELWMKR  425

Query  1634  RQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSL  1813
             + LP + R RVR +ERQRWAA  G DE  +++DLPEGLRRDIK  LCL L+++VPLF  +
Sbjct  426   KNLPRSYRHRVRQYERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCLGLVRQVPLFQHM  485

Query  1814  DDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPG  1993
             DDL+L+NICDR+K L+F K E I+REGDPV+R++FIVRG ++SSQ L  G  +  +L PG
Sbjct  486   DDLVLENICDRVKSLIFPKGEVIVREGDPVKRMLFIVRGHLQSSQVLRNGAESCCMLGPG  545

Query  1994  GFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLK  2173
              F GDELLSWCLRRPF++RLPASS+T T ++STEAFGLDA  ++++T HFRY F N++++
Sbjct  546   NFSGDELLSWCLRRPFLERLPASSSTLTTLESTEAFGLDAADVKYVTQHFRYTFTNDKVR  605

Query  2174  RTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPENADDGDRRLRQYAAM  2332
             R+ARYYS  WRTWAAV VQLAWRRY+ R              +   +  G+ +LR Y A+
Sbjct  606   RSARYYSPGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTAL  665

Query  2333  FLSIRPHD  2356
               S +P+ 
Sbjct  666   LTSPKPNQ  673



>ref|XP_004972200.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Setaria 
italica]
Length=663

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/627 (48%), Positives = 409/627 (65%), Gaps = 23/627 (4%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             R G +   LD R +    W+RA+LLA    L +DPLF YA+ +  +   C+++DG  AA 
Sbjct  41    RRGAWAAALDHR-RAGWGWDRAYLLACAAGLVVDPLFLYAVCLS-APLMCVFLDGWFAAA  98

Query  701   VTVLRTCLDAVHICHLWLQFR------LAYVSRESLVVGCGKLVWDARAVASHYVRSLKG  862
             VT LR   DA+H  +L L+ R      L   +RE       +   D  A      RS KG
Sbjct  99    VTALRCAPDAMHAWNLLLRLRDARAPPLPPPAREDADEEAARPGRDGAAAVPGRARSKKG  158

Query  863   FWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQK  1042
                D FVILP+ Q V W+  P +IR      +MT+LL+ FLF++LP+IYHS+ ++RRMQ 
Sbjct  159   ILLDVFVILPVMQVVVWVAAPAMIRAGSTTAVMTVLLVAFLFEYLPKIYHSVRVLRRMQD  218

Query  1043  VTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN-LRLS  1219
              +GY+FGTIWWG  LNL+AYF+A+H  G CWY+L  QR   CLR++C    S C    L+
Sbjct  219   ASGYVFGTIWWGIALNLMAYFVAAHAVGACWYLLGAQRATKCLREQCAQGGSGCAPWALA  278

Query  1220  CSEEVCYELLLPGGVEGN-SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSI  1396
             C++ + Y         G  + AGN+TA     +  CLD    +++G YKW + +V++ S 
Sbjct  279   CADPLYYGGATAAAAPGRLAWAGNATA-----RGTCLDSGDHYQYGAYKWTVMLVANPSR  333

Query  1397  AVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVM  1576
               +IL PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  
Sbjct  334   VERILLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVLVTMLIGNIKVFLNATT  392

Query  1577  AKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRD  1756
             ++K+ M  R R +E WMKR+ LP + R RVR +ERQRWAA  G DE  +++DLPEGLRRD
Sbjct  393   SRKQAMHTRLRSVELWMKRKSLPKSFRHRVRQYERQRWAATRGVDECRIVRDLPEGLRRD  452

Query  1757  IKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRV  1936
             IK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I+REGDPV+R++FIVRG +
Sbjct  453   IKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGEVIVREGDPVRRMLFIVRGHL  512

Query  1937  KSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDAN  2116
             +SSQ L  G  +   L PG F GDELLSWCLRRPF++RLPASS+T   ++STEAFGLDA 
Sbjct  513   QSSQALRNGGTSCCTLGPGNFSGDELLSWCLRRPFMERLPASSSTLATLESTEAFGLDAA  572

Query  2117  HLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------N  2275
              ++++T HFRY F N+R++R+ARYYS  WRTWAAV VQLAWRRYR R             
Sbjct  573   DVKYVTQHFRYTFTNDRVRRSARYYSPGWRTWAAVAVQLAWRRYRHRKTLTSLSFIRPRR  632

Query  2276  TVPENADDGDRRLRQYAAMFLSIRPHD  2356
              +   +  G+ +LR Y A+  S +P+ 
Sbjct  633   PLSRCSSLGEEKLRLYTALLTSPKPNQ  659



>gb|KHN47873.1| Cyclic nucleotide-gated ion channel 4 [Glycine soja]
Length=581

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/582 (50%), Positives = 403/582 (69%), Gaps = 26/582 (4%)
 Frame = +2

Query  668   CLYMDGGLAAIVTVLRTCLDAVHICHLWLQ-------FRLAYVSRESLVVGCGKLVWDAR  826
             C+++DG LA  VTVLR   DA+H+ ++ ++       F L   +           + D R
Sbjct  2     CVFVDGWLAVTVTVLRCMTDALHVWNMVIRSKMAKRTFGLGAATASGRGSSSSIGLRDTR  61

Query  827   --AVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflP  1000
               +VA  Y++S  GF+FD FVILP+PQ V W+ +P L+ +  V L+MT+ L+IFLFQ+LP
Sbjct  62    PCSVAIGYLKSRTGFFFDLFVILPLPQIVLWVAIPSLLEKGSVTLVMTVFLIIFLFQYLP  121

Query  1001  RIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQR  1180
             +IYHS+  +RR Q ++GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A CL+ +
Sbjct  122   KIYHSVCHLRRTQNLSGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRAAKCLKVQ  181

Query  1181  CHYQKSTCNLR-LSCSEEVCY--ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRF  1351
             C  + S C ++ LSC   + Y    LL       + A N        +  CL+    + +
Sbjct  182   CA-KTSGCGMKILSCQTPIYYGSNSLLVRDKARLAWAENREV-----RHTCLNGPDSYNY  235

Query  1352  GIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLF  1531
             G Y+W + +V++ +   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L 
Sbjct  236   GAYRWTVQLVTNDNRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLV  294

Query  1532  TLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGED  1711
             T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM++R+LP   RQRVR +ERQRWAAM G D
Sbjct  295   TMLIGNIKVFLHATTSKKQAMQLKMRNIEWWMRKRRLPLGFRQRVRNYERQRWAAMRGVD  354

Query  1712  EMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIRE  1891
             E E+ K+LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I RE
Sbjct  355   EFEMTKNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETIARE  414

Query  1892  GDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSAT  2071
             GDPVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T
Sbjct  415   GDPVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSST  474

Query  2072  FTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR  2251
                +++TEAFGL+A  ++++T HFRY F  E++KR+ARYYS  WRTWAAV +QLAWRRY+
Sbjct  475   LITLETTEAFGLEAQDVKYVTQHFRYTFVKEKVKRSARYYSPGWRTWAAVAIQLAWRRYK  534

Query  2252  LRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
              R      +       +  ++  G+ +LR Y A+  S +P+ 
Sbjct  535   HRLTLTSLSFIRPRRPLSRSSSIGEDKLRLYTALLTSPKPNQ  576



>gb|AES66743.2| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=669

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/615 (48%), Positives = 410/615 (67%), Gaps = 24/615 (4%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             +LDPR K  + WNR FLL   M L +DPLFFYA+SI  +   CL++DG     VTV+R  
Sbjct  63    LLDPRGKWAEEWNRVFLLVCAMGLFVDPLFFYAISISDTCM-CLFIDGWFLVTVTVIRCM  121

Query  722   LDAVHICHLWLQFRLAYVSRESL-VVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
              D +H+ ++WLQF +    R S   +  G L       +S+  +  K F+F+ F++LP+P
Sbjct  122   TDMLHLWNIWLQFYIHKHKRSSFGFIHHGTL-------SSNSFKVNKAFFFNIFILLPLP  174

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V W+ +P L+ +  +  ++T+LL++FLFQ+LP+IYHS+  +RR     G+IFGT+WWG
Sbjct  175   QIVLWVTIPSLLEQGSIARVITVLLIMFLFQYLPKIYHSVCFVRR-NLTNGFIFGTVWWG  233

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY--ELLL  1252
             F +N+IAYF+ASH AG CWY+L +QR A CL ++C      C LR  C +E  Y     +
Sbjct  234   FAINMIAYFVASHAAGSCWYLLGLQRAAKCLEEQCE-TTPGCGLRTLCCKEPIYYGNYNM  292

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                ++      +    A   +  CL     + FG+Y+W++ +V++ S   KIL PIFWGL
Sbjct  293   LKKLDRTRLVWSQNTEA---RSTCLASADNYEFGVYEWSVQLVTNNSRIEKILLPIFWGL  349

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN L+ T+  +EV+F+  I+ SGL+L T+LIGNI+VFLHA  +KK+ M+L+  +
Sbjct  350   MTLSTFGN-LQSTTERMEVVFNTIILTSGLLLVTMLIGNIKVFLHATTSKKQAMKLKMTN  408

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWM +R+LP  LRQRVR +ERQ WAAM G DE +LIK+LPEGLRRDIK  LCL L+++
Sbjct  409   MEWWMNKRRLPQGLRQRVRNYERQCWAAMRGVDECQLIKNLPEGLRRDIKYHLCLGLVRQ  468

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+ ICDR+K LVF+K E + REGDPV+R++F+VRG ++SSQ L  GV +
Sbjct  469   VPLFQHMDELVLEYICDRVKSLVFTKGETLTREGDPVRRMLFVVRGHLQSSQFLRDGVKS  528

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPFI+RLP SS+T   + + E FGL+A  ++++T +FRY 
Sbjct  529   CCMLGPGNFSGDELLSWCLRRPFIERLPTSSSTLVTLTTVEVFGLEAEDVKYVTQNFRYT  588

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             FA E ++R+ RYYS  WRTWAAV +QLAWRRYR R      +       +  +    + R
Sbjct  589   FAKENVRRSVRYYSPGWRTWAAVAIQLAWRRYRHRLTLSSLSFIRPRRPLSRSTSLEEDR  648

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  649   LRLYTALLTSPKPNQ  663



>gb|ACN33282.1| unknown [Zea mays]
 gb|AFW78574.1| cyclic nucleotide-gated ion channel 2 [Zea mays]
Length=666

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/619 (48%), Positives = 411/619 (66%), Gaps = 23/619 (4%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             LDPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  +
Sbjct  52    LDPRARWVRDWNRAYLLACAAGLMVDPLFLYAVSLS-GPLMCIFVDGWLAAAVTALRCGV  110

Query  725   DAVHICHLWLQFRLAYVSRESLVVG---CGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             DA+H+ ++  Q R A       V G     + V +A         S +G   D FVILP+
Sbjct  111   DAMHVWNVATQLRTAKAPPGKRVAGDEEQQQTVAEAARKLPEDAASRRGLLLDFFVILPV  170

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
              Q V W+  P +IR      +MT+LL+ FL ++LP+IYH+  L+RRMQ+ +GYIFGTIWW
Sbjct  171   MQVVVWVAAPAMIRAGLTTPVMTVLLVSFLLEYLPKIYHAARLLRRMQRQSGYIFGTIWW  230

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC--NLRLSCSEEVCYELL  1249
             G  LNL+AYF+A+H  G CWY+L +QR + CL+++C  Q + C     ++C+  + Y   
Sbjct  231   GIALNLMAYFVAAHAVGACWYLLGVQRASKCLKEQC-LQAAGCARGSAVACAAPLYYGGS  289

Query  1250  LPGGVEGN---SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPI  1420
                GV G    + AGN+ A     +  CL     +++G Y W + +V++ S   ++L PI
Sbjct  290   PSPGVGGGDRLAWAGNAQA-----RGTCLASGDNYQYGAYTWTVMLVANPSRVERMLLPI  344

Query  1421  FWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQL  1600
             FWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M  
Sbjct  345   FWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVLVTMLIGNIKVFLNATTSKKQAMHT  403

Query  1601  RCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLD  1780
             R R +EWWMKR++LP + R RVR FERQRWAA  G DE ++++DLPEGLRRDIK  LCLD
Sbjct  404   RLRGVEWWMKRKKLPRSFRGRVRQFERQRWAATRGVDECQIVRDLPEGLRRDIKYHLCLD  463

Query  1781  LIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSK  1960
             L+++VP F  +DDL+L+NICDR+K L+F K E I+REGD VQR++FIVRG ++ SQ L  
Sbjct  464   LVRQVPFFQHMDDLVLENICDRVKSLIFPKGETIVREGDVVQRMLFIVRGHLQCSQVLRN  523

Query  1961  GVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDH  2140
             G  ++  L PG F GDELLSWCLRRPF++RLP SSAT   ++STE FGLDA  ++++T H
Sbjct  524   GATSSCTLGPGNFSGDELLSWCLRRPFLERLPTSSATLVTLESTEVFGLDAADVKYVTQH  583

Query  2141  FRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADD  2299
             FRY F N++++R+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   +  
Sbjct  584   FRYTFTNDKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLSSLSFIRPRRPLSRCSSL  643

Query  2300  GDRRLRQYAAMFLSIRPHD  2356
             G+ +LR Y A+  S +P+ 
Sbjct  644   GEEKLRLYTAILTSPKPNQ  662



>emb|CDM84450.1| unnamed protein product [Triticum aestivum]
Length=672

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/620 (49%), Positives = 404/620 (65%), Gaps = 21/620 (3%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             + PR++  + W+RA+LLA    L +DPLF YA+S+      C+++DG  AA VT LR  +
Sbjct  53    IGPRARWAREWDRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWFAAAVTALRCMV  111

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDAR----AVASHYVRSLKG-FWFDAFVIL  889
             DA+H  +L L+ R+A    E             R    A A+   RS KG    D FVIL
Sbjct  112   DALHAWNLLLRLRMACAPGEEEKEEADADEEAQRVGGGAAAARLPRSKKGGLLLDVFVIL  171

Query  890   PIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTI  1069
             P+ Q V W+ +P +IR      +MT+L++ FLF++LP+IYHS+  +RRMQ V GYIFGTI
Sbjct  172   PVMQVVMWVGIPAMIRAGSTTSVMTVLMVAFLFEYLPKIYHSVRFLRRMQNVAGYIFGTI  231

Query  1070  WWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLR-QRCHYQKSTCNLRLSCSEEVCY--  1240
             WWG  LNL+AYF+A+H  G CWY+L  QR   CLR Q C  +   C        E  Y  
Sbjct  232   WWGIALNLMAYFVAAHAVGACWYLLGAQRATKCLREQYCAGRVGGCAAGALACAEPLYYG  291

Query  1241  -ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYP  1417
                 L G V  +  A    A+A   +  CLD    +++G YKW + +V++ S   KIL P
Sbjct  292   GAGRLGGAVGADRLAWGRNASA---RATCLDSGDNYQYGAYKWTVMLVANPSRLEKILLP  348

Query  1418  IFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ  1597
             IFWGLMTLSTFGN L  T+ W E++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M 
Sbjct  349   IFWGLMTLSTFGN-LASTTEWSEIVFNIITITGGLILVTMLIGNIKVFLNATTSKKQAMH  407

Query  1598  LRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCL  1777
              R R +EWWMKR+ LP + R RVR  ERQRWAA  G DE  +++DLPEGLRRDIK  LCL
Sbjct  408   TRLRSVEWWMKRKNLPQSFRHRVRQHERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCL  467

Query  1778  DLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS  1957
             DL+++VPLFH +DDL+L+NICDR+K LVF K E I+REGDPVQR++FIVRG ++SSQ L 
Sbjct  468   DLVRQVPLFHHMDDLVLENICDRVKSLVFPKGEVIVREGDPVQRMLFIVRGHLQSSQVLR  527

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G  +  +L PG F GDELLSWCLRRPF +RLPA+S+T   ++STEAFGL+A  ++++T 
Sbjct  528   NGGTSCCMLGPGNFSGDELLSWCLRRPFRERLPAASSTLVTLESTEAFGLEAADVKYVTQ  587

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENAD  2296
             HFRY FANE+++R+ARYYS  WRTWAAV VQLAWRRYR R      +       +   + 
Sbjct  588   HFRYTFANEKVRRSARYYSHGWRTWAAVAVQLAWRRYRHRKTLTSLSFIRPRRPLSRCSS  647

Query  2297  DGDRRLRQYAAMFLSIRPHD  2356
              G+ +LR Y A+  S +P+ 
Sbjct  648   LGEEKLRLYTALLTSPKPNQ  667



>gb|EAY98601.1| hypothetical protein OsI_20517 [Oryza sativa Indica Group]
Length=665

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 410/632 (65%), Gaps = 37/632 (6%)
 Frame = +2

Query  548   DPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLD  727
             DPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  +D
Sbjct  38    DPRARWVREWNRAYLLACAAGLMVDPLFLYAVSLS-GPLMCVFLDGWLAAAVTALRCMVD  96

Query  728   AVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVAS----------------HYVRSLK  859
             A+H  ++  Q R++   RE                A+                 + R  K
Sbjct  97    AMHAWNIVTQLRVSRAGRERACAAGPDEEQPEAEAAAPAPAADADAAASNKLRDHGRYRK  156

Query  860   GFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQ  1039
                 D FVILP+ Q V W+  P +IR      +MT++L+ F+ ++LP+IYHS+  +RRMQ
Sbjct  157   WLVLDFFVILPVMQVVVWVAAPAMIRAGSTTAVMTVMLVAFMLEYLPKIYHSVVFLRRMQ  216

Query  1040  KVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK----STCN  1207
               +G+IFGTIWWG  LNLIAYF+A+H  G CWY+L +QR   CL+++C        ++  
Sbjct  217   NQSGHIFGTIWWGIALNLIAYFVAAHAVGACWYLLGVQRATKCLKEQCLLAGLPACASST  276

Query  1208  LRLSCSEEVCYELLLPGGVEGNSCA--GNSTAAALMRKPLCLDVNGPFRFGIYKWALPVV  1381
               ++C + + Y   +   V G+  A  GN+TA     + +CL     +++G YKW + +V
Sbjct  277   AAVACVDPLYYGAAV-ASVGGDRLAWGGNATA-----RNVCLSSGDNYQYGAYKWTVMLV  330

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             S+ S   K+L PIFWGLMTLSTFGN LE T+ W+E++F+I  +  GL+L T+LIGNI+VF
Sbjct  331   SNPSRLEKMLLPIFWGLMTLSTFGN-LESTTEWVEIVFNIMTITGGLILVTMLIGNIKVF  389

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             L+A  +KK+ MQ R R +EWWM+ + +P   RQRVR FERQRWAA  G DE ++++DLPE
Sbjct  390   LNATTSKKQAMQTRLRGLEWWMEHKGVPHGFRQRVRQFERQRWAATRGVDECQIVRDLPE  449

Query  1742  GLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFI  1921
             GLRRDIK  LCLDL+++VPLFH +DDL+L+NICDR+K L+F K E I+REGDPVQR++FI
Sbjct  450   GLRRDIKYHLCLDLVRQVPLFHHMDDLVLENICDRVKSLIFPKGEIIVREGDPVQRMLFI  509

Query  1922  VRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAF  2101
             VRG ++ SQ +  G  +   L PG F GDELLSWC+RRPF+DRLPASS+T    +STEAF
Sbjct  510   VRGHLQCSQVMRNGATSWCTLGPGNFSGDELLSWCMRRPFMDRLPASSSTLMTAESTEAF  569

Query  2102  GLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-  2278
             GL+A  ++++T HFRY F +++++R+ARYYS  WRTWAAV VQLAWRRY+ R      + 
Sbjct  570   GLEAGDVKYVTQHFRYTFTSDKVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLASLSF  629

Query  2279  ------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                   +   +  G+ +LR Y A+  S +P+ 
Sbjct  630   IRPRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  661



>gb|ACF84256.1| unknown [Zea mays]
Length=364

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/353 (75%), Positives = 306/353 (87%), Gaps = 5/353 (1%)
 Frame = +2

Query  1322  CLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSI  1501
             CL   G F +GIY  ALPV+SS S+AVKILYPIFWGLMTLSTFGNDL PTSN +EVIFSI
Sbjct  12    CLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFWGLMTLSTFGNDLAPTSNGIEVIFSI  71

Query  1502  CIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFER  1681
               VLSGLMLFTLLIGNIQVFLHAV+A+KRKMQLR RDMEWWM+RRQLPS LRQRVR +ER
Sbjct  72    INVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEWWMRRRQLPSRLRQRVRKYER  131

Query  1682  QRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLV  1861
             +RWAA+ G++EME+IKDLPEGLRRDIKR+LCL+L+K+VPLFH +DDLILDNICDR++PLV
Sbjct  132   ERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPLFHGMDDLILDNICDRLRPLV  191

Query  1862  FSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPF  2041
             FS  EK+IREGDPVQR+VFI++G+++S+Q L+KGVVAT +L  G FLGDELLSWCLRRPF
Sbjct  192   FSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVATCMLGAGNFLGDELLSWCLRRPF  251

Query  2042  IDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAV  2221
             +DRLPASSATF C+++ +AF LDA  LRFIT+HFRYKFANE+L+RTARYYS+NWRTWAAV
Sbjct  252   VDRLPASSATFECVEAAQAFCLDAPDLRFITEHFRYKFANEKLRRTARYYSSNWRTWAAV  311

Query  2222  NVQLAWRRYRLRTRGQPNTVPE-----NADDGDRRLRQYAAMFLSIRPHDHLE  2365
             N+QLAWRRYR R       +         DDGDRRLR YAAMF+S+RPHDHLE
Sbjct  312   NIQLAWRRYRARASTDLAAMAAPPLAGGPDDGDRRLRHYAAMFMSLRPHDHLE  364



>ref|XP_008655080.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Zea 
mays]
Length=663

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/614 (47%), Positives = 400/614 (65%), Gaps = 18/614 (3%)
 Frame = +2

Query  548   DPRSKRV--QRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             DPR+       W+RA+LLA    L +DPLF YA+++  +   C+++D   AA VT LR  
Sbjct  53    DPRASWAWETEWDRAYLLACAAGLLVDPLFLYAVAVS-APLMCVFLDAWFAAAVTALRCA  111

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
             +DA+H  +L L+ R A   R                V     RS +G + D  VILP+ Q
Sbjct  112   VDAMHASNLLLRLRGACSPRREDTDEEEAQPGRDGGVPGRGTRSKEGVFLDVLVILPVMQ  171

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              V W+  P +IR      +M +LL  FL ++LP+IYH++ ++RRMQ V+GY+FGTIWWG 
Sbjct  172   VVVWVATPAMIRAGSTTDVMIVLLTAFLLEYLPKIYHAVRVLRRMQGVSGYLFGTIWWGI  231

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN-LRLSCSEEVCYELLLPG  1258
              LNL+AYF+A+H  G CWY+L  QR   CLR++C    S C    L+C+E + Y      
Sbjct  232   ALNLMAYFVAAHAVGACWYLLGAQRATKCLREQCAQAGSGCAPWALACAEPLYYGATASS  291

Query  1259  -GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
              G    + AGN+TA     +  CLD    +++G Y+W + +V++ S   ++L PIFWGLM
Sbjct  292   VGAARLAWAGNATA-----RGTCLDSADNYQYGAYQWTVMLVANPSRVERVLLPIFWGLM  346

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDM  1615
             TLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M  R R +
Sbjct  347   TLSTFGN-LESTTEWLEIVFNIVTITGGLILVTMLIGNIKVFLNATTSKKQAMHTRLRSV  405

Query  1616  EWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKV  1795
             E WMKR+ LP + R RVR +ERQRWAA  G DE  +++DLPEGLRRDIK  LCL L+++V
Sbjct  406   ELWMKRKDLPRSYRHRVRQYERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCLGLVRQV  465

Query  1796  PLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVAT  1975
             PLF  +DDL+L+NICDR+K L+F K E I+REGDPV+R++FIVRG ++SSQ L  G  + 
Sbjct  466   PLFQHMDDLVLENICDRVKSLIFPKGEVIVREGDPVKRMLFIVRGHLQSSQVLRNGAESC  525

Query  1976  SILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKF  2155
              +L PG F GDELLSWCLRRPF++RLP SS+T   ++STEAFGLDA  ++++T HFRY F
Sbjct  526   CMLGPGNFSGDELLSWCLRRPFLERLPGSSSTLATLESTEAFGLDAADVKYVTQHFRYTF  585

Query  2156  ANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPENADDGDRRL  2314
              N++++R+ARYYS  WRTWAAV VQLAWRRY+ R              +   +  G+ +L
Sbjct  586   TNDKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSRCSSLGEEKL  645

Query  2315  RQYAAMFLSIRPHD  2356
             R Y A+  S +P+ 
Sbjct  646   RLYTALLTSPKPNQ  659



>ref|NP_001141448.1| uncharacterized protein LOC100273558 [Zea mays]
 gb|ACF86388.1| unknown [Zea mays]
Length=666

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/620 (48%), Positives = 410/620 (66%), Gaps = 23/620 (4%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
              LDPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  
Sbjct  51    ALDPRARWVRDWNRAYLLACAAGLMVDPLFLYAVSLS-GPLMCIFVDGWLAAAVTALRCG  109

Query  722   LDAVHICHLWLQFRLAYVSRESLVVG---CGKLVWDARAVASHYVRSLKGFWFDAFVILP  892
             +DA+H+ ++  Q R A       V G     + V +A         S +G   D FVILP
Sbjct  110   VDAMHVWNVATQLRTAKAPPGKRVAGDEEQQQTVAEAARKLPEDAASRRGLLLDFFVILP  169

Query  893   IPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIW  1072
             + Q V W+  P +IR      +MT+LL+ FL ++LP+IYH+  L+RRMQ+ +GYIFGTIW
Sbjct  170   VMQVVVWVAAPAMIRAGLTTPVMTVLLVSFLLEYLPKIYHAARLLRRMQRQSGYIFGTIW  229

Query  1073  WGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTC--NLRLSCSEEVCYEL  1246
             WG  LNL+AYF+A+H  G CWY+L +QR + CL+++C  Q + C     ++C+  + Y  
Sbjct  230   WGIALNLMAYFVAAHAVGACWYLLGVQRASKCLKEQC-LQAAGCARGSAVACAAPLYYGG  288

Query  1247  LLPGGVEGN---SCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYP  1417
                 GV G    + AGN+ A     +  CL     +++G Y W + +V++ S   ++L P
Sbjct  289   SPSPGVGGGDRLAWAGNAQA-----RGTCLASGDNYQYGAYTWTVMLVANPSRVERMLLP  343

Query  1418  IFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQ  1597
             IFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+  T+LIGNI+VFL+A  +KK+ M 
Sbjct  344   IFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVPVTMLIGNIKVFLNATTSKKQAMH  402

Query  1598  LRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCL  1777
              R R +EWWMKR++LP + R RVR FERQRWAA  G DE ++++DLPEGLRRDIK  LCL
Sbjct  403   TRLRGVEWWMKRKKLPRSFRGRVRQFERQRWAATRGVDECQIVRDLPEGLRRDIKYHLCL  462

Query  1778  DLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS  1957
             DL+++VP F  +DDL+L+NICDR+K L+F K E I+REGD VQR++FIVRG ++ SQ L 
Sbjct  463   DLVRQVPFFQHMDDLVLENICDRVKSLIFPKGETIVREGDVVQRMLFIVRGHLQCSQVLR  522

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G  ++  L PG F GDELLSWCLRRPF++RLP SSAT   ++STE FGLDA  ++++T 
Sbjct  523   NGATSSCTLGPGNFSGDELLSWCLRRPFLERLPTSSATLVTLESTEVFGLDAADVKYVTQ  582

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENAD  2296
             HFRY F N++++R+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   + 
Sbjct  583   HFRYTFTNDKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLSSLSFIRPRRPLSRCSS  642

Query  2297  DGDRRLRQYAAMFLSIRPHD  2356
              G+ +LR Y A+  S +P+ 
Sbjct  643   LGEEKLRLYTAILTSPKPNQ  662



>gb|AAY58304.1| cyclic nucleotide-gated ion channel 4 [Hordeum vulgare subsp. 
vulgare]
Length=686

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/623 (48%), Positives = 410/623 (66%), Gaps = 25/623 (4%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             LDPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  +
Sbjct  66    LDPRARWVRDWNRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWLAAAVTALRCMV  124

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASH--------YVRSLKGFWFDAF  880
             DA+H  +L  Q R+A  +  ++  G   +  + +A A          Y RS +G   D F
Sbjct  125   DAMHAWNLLTQLRVARAAAAAVARGRRGVADEEQAEADAAAARSLPAYARSRRGMALDFF  184

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP+ Q V W+  P +IR      +MT+LL+ FL ++LP+IYHS+  +RR Q  +G+IF
Sbjct  185   VILPVMQVVVWVAAPAMIRAGSTTAVMTVLLVAFLLEYLPKIYHSVSFLRRTQDQSGHIF  244

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK--STCNLRLSCSEEV  1234
             GTIWWG  LNL+AYF+A+H  G CWY+L +QR   CL+++C         +  ++C+  +
Sbjct  245   GTIWWGIVLNLMAYFVAAHAVGACWYLLGVQRATKCLKEQCLLTGPPGCASGPVACAAPL  304

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              Y     G     S  G+  A A   K   +CL     ++FG YKW + +V++ S   K+
Sbjct  305   YYG----GAGAAASVVGDRLAWATDDKARSVCLVSGDKYQFGAYKWTVMLVANTSRLEKM  360

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+
Sbjct  361   LLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVLVTMLIGNIKVFLNATTSKKQ  419

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              M  R R +EWWMKR+ LP + R RVR FERQRWAA  G DE ++++DLPE LRRDIK  
Sbjct  420   AMHTRLRSLEWWMKRKDLPQSYRHRVRQFERQRWAATRGVDECQIVRDLPEALRRDIKYH  479

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+++VPLFH +DDL+L+N+CDR++ L++ K E I+REGDPVQR+VFIVRG ++ SQ
Sbjct  480   LCLDLVRQVPLFHHMDDLVLENMCDRVRSLIYPKGETIVREGDPVQRMVFIVRGHLQCSQ  539

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  G  +  +L PG F GDELL WCLRRPF +RLPASS+T   ++STE FGL+A  +++
Sbjct  540   ELRNGGTSCCMLGPGNFTGDELLPWCLRRPFAERLPASSSTLVTLESTEVFGLEAADVKY  599

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPE  2287
             +T HFRY F NER++R+ARYYS  WRTWAAV VQLAWRRY+ R      +       +  
Sbjct  600   VTQHFRYTFTNERVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLSSLSFIRPRRPLSR  659

Query  2288  NADDGDRRLRQYAAMFLSIRPHD  2356
              +  G+ +LR Y A+  S +P+ 
Sbjct  660   CSSLGEEKLRLYTAILASPKPNQ  682



>ref|XP_009419614.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Musa acuminata 
subsp. malaccensis]
Length=638

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/630 (47%), Positives = 406/630 (64%), Gaps = 35/630 (6%)
 Frame = +2

Query  515   FHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLA  694
             F R  P     D ++K +  WNR FLL     L +DPLFFYALSI  S   CL++DG  A
Sbjct  21    FRRRNPSS---DRQAKWLHEWNRIFLLICAAGLVVDPLFFYALSIS-STCMCLFVDGWFA  76

Query  695   AIVTVLRTCLDAVHICHLWLQFRLAY-----VSRESLVVGCGKLVWDARAVASHYVRSLK  859
               VT LR   DAVH+ ++ LQ  + Y      S E      G+ +    A +  Y+R+  
Sbjct  77    VTVTALRCMTDAVHLLNMCLQLAMTYDATPRSSVEEKDASAGRPM----AHSQSYLRAKT  132

Query  860   GFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQ  1039
             GF  D F+ILP+PQ V W+V P ++ +     +MT+ L+ FL Q+LP++YHS+  +RR+Q
Sbjct  133   GFLLDLFIILPVPQVVLWVVAPAMLCQGMTSTVMTVFLISFLSQYLPKVYHSVCFLRRLQ  192

Query  1040  KVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLS  1219
                GYIFG IW G  LNLIAYF+ASH AG CWY+L IQR   CL+Q+C       N  ++
Sbjct  193   NSLGYIFGNIWGGIALNLIAYFVASHAAGACWYLLGIQRATECLKQQCVATDGCRNRTVA  252

Query  1220  CSEEVCYELLLPGGVEGNSCAGNSTAAA--LMRKPLCLDVNGPFRFGIYKWALPVVSSRS  1393
             C + + Y      G    +  G   A A  L  + +CLD +  F +G YKW + +V++ +
Sbjct  253   CVDPMYY------GTTRAAMDGERLAWAKNLHVRSMCLDSSDNFEYGSYKWIVNLVTNPN  306

Query  1394  IAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAV  1573
                K+L+PIFWGLMTLSTFG  +E T+ W+E+ F+I IV S L+L T LIGNI+VFLHA 
Sbjct  307   RLEKVLFPIFWGLMTLSTFGT-IESTTEWVEITFNIIIVTSALLLVTTLIGNIKVFLHAT  365

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
              +KK+ +  + R ++ WM+RR LP  +R+RVR +ERQRWAA  G DE E+ + LPEG+RR
Sbjct  366   TSKKQALHSKMRSLDRWMRRRSLPFEIRRRVRQYERQRWAATRGVDESEMARRLPEGMRR  425

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGR  1933
             DIK  LCLDL+++VPLF  +D+L+L+NICDR+K L+  K E +IREGDPV R++F+VRG 
Sbjct  426   DIKYHLCLDLVRQVPLFQHMDELVLENICDRVKSLLIPKGETVIREGDPVPRMLFVVRGH  485

Query  1934  VKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDA  2113
             ++SSQ L  GV +  +L PG F GDELLSWCL R F++RLP SS+T    +STEAFGLDA
Sbjct  486   LQSSQVLRDGVKSYCMLGPGNFSGDELLSWCLIRKFVERLPPSSSTLVAAESTEAFGLDA  545

Query  2114  NHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR----------LRTR  2263
             + L+++T+HFRY F +ER+KR+ARYYS  WRTWAAV +QLAW RY+          +R R
Sbjct  546   DDLKYVTEHFRYTFVSERVKRSARYYSPGWRTWAAVAIQLAWWRYKHRLTLTSLSFIRPR  605

Query  2264  GQPNTVPENADDGDRRLRQYAAMFLSIRPH  2353
               P+      +D   +LR Y A+  S +P+
Sbjct  606   RPPSRCSSMEED---KLRLYTALLTSPKPN  632



>dbj|BAJ97059.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/626 (48%), Positives = 411/626 (66%), Gaps = 31/626 (5%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             LDPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  +
Sbjct  66    LDPRARWVRDWNRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWLAAAVTALRCMV  124

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASH--------YVRSLKGFWFDAF  880
             DA+H  +L  Q R+A  +  ++  G   +  + +A A          Y RS +G   D F
Sbjct  125   DAMHAWNLLTQLRVARAAAAAVARGRRGVADEEQAEADAAAARSLPAYARSRRGMALDFF  184

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP+ Q V W+  P +IR      +MT+LL+ FL ++LP+IYHS+  +RR Q  +G+IF
Sbjct  185   VILPVMQVVVWVAAPAMIRAGSTTAVMTVLLVAFLLEYLPKIYHSVSFLRRTQDQSGHIF  244

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK--STCNLRLSCSEEV  1234
             GTIWWG  LNL+AYF+A+H  G CWY+L +QR   CL+++C         +  ++C+  +
Sbjct  245   GTIWWGIVLNLMAYFVAAHAVGACWYLLGVQRATKCLKEQCLLTGPPGCASGPVACAAPL  304

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              Y     G     S  G+  A A   K   +CL     ++FG YKW + +V++ S   K+
Sbjct  305   YYG----GAGAAASVVGDRLAWATDDKARSVCLVSGDKYQFGAYKWTVMLVANTSRLEKM  360

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+
Sbjct  361   LLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVLVTMLIGNIKVFLNATTSKKQ  419

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              M  R R +EWWMKR+ LP + R RVR FERQRWAA  G DE ++++DLPE LRRDIK  
Sbjct  420   AMHTRLRSLEWWMKRKDLPQSYRHRVRQFERQRWAATRGVDECQIVRDLPEALRRDIKYH  479

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+++VPLFH +DDL+L+N+CDR++ L++ K E I+REGDPVQR+VFIVRG ++ SQ
Sbjct  480   LCLDLVRQVPLFHHMDDLVLENMCDRVRSLIYPKGETIVREGDPVQRMVFIVRGHLQCSQ  539

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  G  +  +L PG F GDELL WCLRRPF +RLPASS+T   ++STE FGL+A  +++
Sbjct  540   ELRNGGTSCCMLGPGNFTGDELLPWCLRRPFAERLPASSSTLVTLESTEVFGLEAADVKY  599

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR----------LRTRGQPNT  2278
             +T HFRY F NER++R+ARYYS  WRTWAAV VQLAWRRY+          +R R   + 
Sbjct  600   VTQHFRYTFTNERVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLSSLSFIRPRRPLSR  659

Query  2279  VPENADDGDRRLRQYAAMFLSIRPHD  2356
              P     G+ +LR Y A+  S +P+ 
Sbjct  660   CPSL---GEEKLRLYTAILASPKPNQ  682



>dbj|BAK01648.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/623 (48%), Positives = 410/623 (66%), Gaps = 25/623 (4%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             LDPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  +
Sbjct  66    LDPRARWVRDWNRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWLAAAVTALRCMV  124

Query  725   DAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASH--------YVRSLKGFWFDAF  880
             DA+H  +L  Q R+A  +  ++  G   +  + +A A          Y RS +G   D F
Sbjct  125   DAMHAWNLLTQLRVARAAAAAVARGRRGVADEEQAEADAAAARSLPAYARSRRGMALDFF  184

Query  881   VILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIF  1060
             VILP+ Q V W+  P +IR      +MT+LL+ FL ++LP+IYHS+  +RR Q  +G+IF
Sbjct  185   VILPVMQVVVWVAAPAMIRAGSTTAVMTVLLVAFLLEYLPKIYHSVSFLRRTQDQSGHIF  244

Query  1061  GTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK--STCNLRLSCSEEV  1234
             GTIWWG  LNL+AYF+A+H  G CWY+L +QR   CL+++C         +  ++C+  +
Sbjct  245   GTIWWGIVLNLMAYFVAAHAVGACWYLLGVQRATKCLKEQCLLTGPPGCASGPVACAAPL  304

Query  1235  CYELLLPGGVEGNSCAGNSTAAALMRKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              Y     G     S  G+  A A   K   +CL     ++FG YKW + +V++ S   K+
Sbjct  305   YYG----GAGAAASVVGDRLAWATDDKARSVCLVSGDKYQFGAYKWTVMLVANTSRLEKM  360

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+
Sbjct  361   LLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVLVTMLIGNIKVFLNATTSKKQ  419

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              M  R R +EWWMKR+ LP + R RVR FERQRWAA  G DE ++++DLPE LRRDIK  
Sbjct  420   AMHTRLRSLEWWMKRKDLPQSYRHRVRQFERQRWAATRGVDECQIVRDLPEALRRDIKYH  479

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+++VPLFH +DDL+L+N+CDR++ L++ K E I+REGDPVQR+VFIVRG ++ SQ
Sbjct  480   LCLDLVRQVPLFHHMDDLVLENMCDRVRSLIYPKGETIVREGDPVQRMVFIVRGHLQCSQ  539

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  G  +  +L PG F GDELL WCLRRPF +RLPASS+T   ++STE FGL+A  +++
Sbjct  540   ELRNGGTSCCMLGPGNFTGDELLPWCLRRPFAERLPASSSTLVTLESTEVFGLEAADVKY  599

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPE  2287
             +T HFRY F NER++R+ARYYS  WRTWAAV VQLAWRRY+ R      +       +  
Sbjct  600   VTQHFRYTFTNERVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLSSLSFIRPRRPLSR  659

Query  2288  NADDGDRRLRQYAAMFLSIRPHD  2356
              +  G+ +LR Y A+  S +P+ 
Sbjct  660   CSSLGEEKLRLYTAILASPKPNQ  682



>ref|NP_001055973.1| Os05g0502000 [Oryza sativa Japonica Group]
 gb|AAU90233.1| putative cyclic nucleotide gated ion channel [Oryza sativa Japonica 
Group]
 dbj|BAF17887.1| Os05g0502000 [Oryza sativa Japonica Group]
Length=691

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/632 (46%), Positives = 410/632 (65%), Gaps = 37/632 (6%)
 Frame = +2

Query  548   DPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLD  727
             DPR++ V+ WNRA+LLA    L +DPLF YA+S+      C+++DG LAA VT LR  +D
Sbjct  64    DPRARWVREWNRAYLLACAAGLMVDPLFLYAVSLS-GPLMCVFLDGWLAAAVTALRCMVD  122

Query  728   AVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVAS----------------HYVRSLK  859
             A+H  ++  Q R++   RE                A+                 + R  K
Sbjct  123   AMHAWNIVTQLRVSRAGRERACAAGPDEEQPEAEAAAPAPAADADAAASNKLRDHGRYRK  182

Query  860   GFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQ  1039
                 D FVILP+ Q V W+  P +IR      +MT++L+ F+ ++LP+IYHS+  +RRMQ
Sbjct  183   WLVLDFFVILPVMQVVVWVAAPAMIRAGSTTAVMTVMLVAFMLEYLPKIYHSVVFLRRMQ  242

Query  1040  KVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQK----STCN  1207
               +G+IFGTIWWG  LNLIAYF+A+H  G CWY+L +QR   CL+++C        ++  
Sbjct  243   NQSGHIFGTIWWGIALNLIAYFVAAHAVGACWYLLGVQRATKCLKEQCLLAGLPACASST  302

Query  1208  LRLSCSEEVCYELLLPGGVEGNSCA--GNSTAAALMRKPLCLDVNGPFRFGIYKWALPVV  1381
               ++C + + Y   +   V G+  A  GN+TA     + +CL     +++G YKW + +V
Sbjct  303   AAVACVDPLYYGAAV-ASVGGDRLAWGGNATA-----RNVCLSSGDNYQYGAYKWTVMLV  356

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             S+ S   K+L PIFWGLMTLSTFGN LE T+ W+E++F+I  +  GL+L T+LIGNI+VF
Sbjct  357   SNPSRLEKMLLPIFWGLMTLSTFGN-LESTTEWVEIVFNIMTITGGLILVTMLIGNIKVF  415

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             L+A  +KK+ MQ R R +EWWM+ + +P   RQRVR FERQRWAA  G DE ++++DLPE
Sbjct  416   LNATTSKKQAMQTRLRGLEWWMEHKGVPHGFRQRVRQFERQRWAATRGVDECQIVRDLPE  475

Query  1742  GLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFI  1921
             GLRRDIK  LCLDL+++VPLFH +DDL+L+NICDR+K L+F K E I+REGDPVQR++FI
Sbjct  476   GLRRDIKYHLCLDLVRQVPLFHHMDDLVLENICDRVKSLIFPKGEIIVREGDPVQRMLFI  535

Query  1922  VRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAF  2101
             VRG ++ SQ +  G  +   L PG F GDELLSWC+RRPF++RLPASS+T    +STEAF
Sbjct  536   VRGHLQCSQVMRNGATSWCTLGPGNFSGDELLSWCMRRPFMERLPASSSTLVTAESTEAF  595

Query  2102  GLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-  2278
             GL+A  ++++T HFRY F +++++R+ARYYS  WRTWAAV VQLAWRRY+ R      + 
Sbjct  596   GLEAGDVKYVTQHFRYTFTSDKVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLASLSF  655

Query  2279  ------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                   +   +  G+ +LR Y A+  S +P+ 
Sbjct  656   IRPRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  687



>ref|XP_008655079.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X1 [Zea 
mays]
Length=664

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/615 (47%), Positives = 400/615 (65%), Gaps = 19/615 (3%)
 Frame = +2

Query  548   DPRSKRV--QRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             DPR+       W+RA+LLA    L +DPLF YA+++  +   C+++D   AA VT LR  
Sbjct  53    DPRASWAWETEWDRAYLLACAAGLLVDPLFLYAVAVS-APLMCVFLDAWFAAAVTALRCA  111

Query  722   LDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQ  901
             +DA+H  +L L+ R A   R                V     RS +G + D  VILP+ Q
Sbjct  112   VDAMHASNLLLRLRGACSPRREDTDEEEAQPGRDGGVPGRGTRSKEGVFLDVLVILPVMQ  171

Query  902   AVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGF  1081
              V W+  P +IR      +M +LL  FL ++LP+IYH++ ++RRMQ V+GY+FGTIWWG 
Sbjct  172   VVVWVATPAMIRAGSTTDVMIVLLTAFLLEYLPKIYHAVRVLRRMQGVSGYLFGTIWWGI  231

Query  1082  CLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN-LRLSCSEEVCYELLLPG  1258
              LNL+AYF+A+H  G CWY+L  QR   CLR++C    S C    L+C+E + Y      
Sbjct  232   ALNLMAYFVAAHAVGACWYLLGAQRATKCLREQCAQAGSGCAPWALACAEPLYYGATASS  291

Query  1259  -GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLM  1435
              G    + AGN+TA     +  CLD    +++G Y+W + +V++ S   ++L PIFWGLM
Sbjct  292   VGAARLAWAGNATA-----RGTCLDSADNYQYGAYQWTVMLVANPSRVERVLLPIFWGLM  346

Query  1436  TLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNI-QVFLHAVMAKKRKMQLRCRD  1612
             TLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI QVFL+A  +KK+ M  R R 
Sbjct  347   TLSTFGN-LESTTEWLEIVFNIVTITGGLILVTMLIGNIKQVFLNATTSKKQAMHTRLRS  405

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +E WMKR+ LP + R RVR +ERQRWAA  G DE  +++DLPEGLRRDIK  LCL L+++
Sbjct  406   VELWMKRKDLPRSYRHRVRQYERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCLGLVRQ  465

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +DDL+L+NICDR+K L+F K E I+REGDPV+R++FIVRG ++SSQ L  G  +
Sbjct  466   VPLFQHMDDLVLENICDRVKSLIFPKGEVIVREGDPVKRMLFIVRGHLQSSQVLRNGAES  525

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPF++RLP SS+T   ++STEAFGLDA  ++++T HFRY 
Sbjct  526   CCMLGPGNFSGDELLSWCLRRPFLERLPGSSSTLATLESTEAFGLDAADVKYVTQHFRYT  585

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPENADDGDRR  2311
             F N++++R+ARYYS  WRTWAAV VQLAWRRY+ R              +   +  G+ +
Sbjct  586   FTNDKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSRCSSLGEEK  645

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  646   LRLYTALLTSPKPNQ  660



>emb|CBI20380.3| unnamed protein product [Vitis vinifera]
Length=539

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/520 (53%), Positives = 368/520 (71%), Gaps = 12/520 (2%)
 Frame = +2

Query  818   DARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqfl  997
              A  VA  Y+++ KGF+FD FVILP+PQ V W+ +P L+       +MT+LL+IFLFQ+L
Sbjct  20    SASTVALRYLKAKKGFFFDLFVILPLPQIVLWVAIPSLLERGLTTTVMTVLLIIFLFQYL  79

Query  998   PRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQ  1177
             P+IYHS+ L+ RMQ V+GYIFGTIWWG  LN+IAYF+ASH AG CWY+L +QR A CL++
Sbjct  80    PKIYHSVCLLLRMQNVSGYIFGTIWWGIVLNMIAYFVASHAAGACWYLLGLQRAAKCLKE  139

Query  1178  RCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGI  1357
              C          L+C   + Y               N+  A    +  CLD    F +G 
Sbjct  140   ECAVANYCSTKTLACKNPIYYGTTSLLKDRARLAWANNKHA----RSTCLDSADNFEYGG  195

Query  1358  YKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTL  1537
             Y+W + +V++ +   KIL+P+FWGLMTLSTFGN LE T+ WLEVIF+I ++ SGL+L T+
Sbjct  196   YRWTIQLVTNDNRLEKILFPLFWGLMTLSTFGN-LESTTEWLEVIFNIIVLTSGLILVTM  254

Query  1538  LIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEM  1717
             LIGNI+VFLHA  +KK+ MQL+ R++EWWM+RR+LP   RQRVR +ERQ+WAAM G DE 
Sbjct  255   LIGNIKVFLHATTSKKQTMQLKMRNIEWWMRRRKLPLGFRQRVRNYERQKWAAMRGVDEC  314

Query  1718  ELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGD  1897
             ++ K+LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E I REGD
Sbjct  315   QMTKNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGEVITREGD  374

Query  1898  PVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFT  2077
             PVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS+T  
Sbjct  375   PVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFIERLPPSSSTLI  434

Query  2078  CIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR  2257
              +++TEAFGL+A+ ++++T HFRY F  ER+KR+ARYYS  WRTWAAV +QLAWRRY+ R
Sbjct  435   TLETTEAFGLEADDVKYVTQHFRYTFVKERVKRSARYYSPGWRTWAAVAIQLAWRRYKHR  494

Query  2258  TRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                   +       V   +  G+ RLR Y AM  S +P+ 
Sbjct  495   LTLTSLSFIRPRRPVSRCSSLGEDRLRLYTAMLTSPKPNQ  534



>ref|XP_003567182.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Brachypodium 
distachyon]
Length=670

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/656 (47%), Positives = 403/656 (61%), Gaps = 44/656 (7%)
 Frame = +2

Query  479   RPGSVTHRSTQDFHRSGPFGR--------VLDPRSKRVQRWNRAFLLARGMALAIDPLFF  634
             RPG    R+    H  G   R         +DPR +    W+RA+LLA    L +DPLF 
Sbjct  21    RPGEREKRAPPQTHAGGGKKRQRRLAAWAAVDPRRRE---WDRAYLLACAAGLVVDPLFL  77

Query  635   YALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGC----  802
             YA+S+      C+++DG  AA VT LR  +DAVH    W   R A  + +          
Sbjct  78    YAVSLS-GPLMCVFLDGWFAAAVTALRCAVDAVHA---WNVLRSACATVQLDDEDEDDDA  133

Query  803   ---------GKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKl  955
                      G  V  A A       S KG + D FVILP+ Q V W+V+P +IR      
Sbjct  134   DEEAQQRERGHAVGGA-AAQPQLATSRKGLFLDLFVILPVMQVVIWVVIPAMIRGGSTTA  192

Query  956   imtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCW  1135
             +MT+LL+ FLF++LP+IYHS+  +RRMQ V+GYIFGTIWWG  LNL+AYF+A+H  G CW
Sbjct  193   VMTVLLVSFLFEYLPKIYHSVRFLRRMQNVSGYIFGTIWWGIALNLMAYFVAAHAVGACW  252

Query  1136  YVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR-  1312
             Y+L +QR   CLR+             +     C E L  G   G   A      A  R 
Sbjct  253   YLLGVQRATKCLRE---QCAQAAAGACAPGALACAEPLYYGATTGGLGAVADYRLAWARD  309

Query  1313  ---KPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWL  1483
                +  CLD    +++G YKW + +V++ +   KIL PIFWGLMTLSTFGN L  T+ W 
Sbjct  310   AGARATCLDSGDSYQYGAYKWTVMLVANPNRLEKILLPIFWGLMTLSTFGN-LASTTEWQ  368

Query  1484  EVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQR  1663
             E++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M  R R +EWWMKR+ LP + R R
Sbjct  369   EIVFNIITITGGLILVTMLIGNIKVFLNATTSKKQAMHTRLRSVEWWMKRKNLPQSFRHR  428

Query  1664  VRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICD  1843
             VR  ERQRWAA  G DE  +++DLPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICD
Sbjct  429   VRQHERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICD  488

Query  1844  RIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSW  2023
             R+K LVF K E I+REGDPVQR++FIVRG ++SSQ L  G  +   L PG F GDELLSW
Sbjct  489   RVKSLVFPKGEVIVREGDPVQRMLFIVRGHLQSSQQLRNGATSCCTLGPGNFSGDELLSW  548

Query  2024  CLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANW  2203
             CLRRPF++RLPASS+    ++STEAFGL+A  ++++T HFRY F N++++R+ARYYS  W
Sbjct  549   CLRRPFLERLPASSSGLVTLESTEAFGLEAADVKYVTRHFRYTFTNDKVRRSARYYSHGW  608

Query  2204  RTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRP  2350
             RTWAAV VQLAWRRY+ R      +       +   +  G+ +LR Y A+  S +P
Sbjct  609   RTWAAVAVQLAWRRYKHRKTLTSLSFIRPRRPLSRCSSLGEEKLRLYTALLTSPKP  664



>ref|XP_004961594.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Setaria 
italica]
Length=710

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/643 (47%), Positives = 407/643 (63%), Gaps = 42/643 (7%)
 Frame = +2

Query  545   LDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCL  724
             LDPR++ V++WNRA+LLA    L +DPLF Y +S+      CL++DG LAA VT LR  +
Sbjct  67    LDPRARWVRQWNRAYLLACAAGLMVDPLFLYTVSVS-GPLMCLFLDGWLAAAVTALRCAV  125

Query  725   DAVHICHLWLQFRL----AYVSRESLVVGCGKLVWD-----------------ARAVASH  841
             DA+H+ ++  Q RL    A   R     G  +                     AR + + 
Sbjct  126   DAMHVWNIATQLRLTRGTAGSKRAEGSSGDEEQQAAAAAGEEEDDDEEGADEVARKLPAG  185

Query  842   YVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIY  1021
               RS K    D FVILP+ Q V W+  P +IR      +MT+LL+ FL ++LP+IYH++ 
Sbjct  186   -ARSKKASVLDLFVILPVMQVVVWVAAPAMIRAGLTTPVMTVLLVAFLLEYLPKIYHAVR  244

Query  1022  LMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
              +RRMQ  +GY+FGTIWWG  LNL+AYF+A+H  G CWY+L +QR + CL+++C  Q + 
Sbjct  245   FLRRMQGHSGYVFGTIWWGIVLNLMAYFVAAHAVGACWYLLGVQRASKCLKEQCQLQAAA  304

Query  1202  CNLRLSCSEEVCYELLLPGGVEGN-----------SCAGNSTAAALMRKPLCLDVNGPFR  1348
                  S +   C   L  GG               + A N+ A A        D +G ++
Sbjct  305   GGCARSGAVVACAAPLYYGGSPSAAAAGHLGAGRLAWARNAPARATCLASSSGDGSGGYQ  364

Query  1349  FGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLML  1528
             +G YKW + +V++ S   ++L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L
Sbjct  365   YGAYKWTVMLVANPSRVERMLLPIFWGLMTLSTFGN-LESTTEWLEIVFNILTITGGLIL  423

Query  1529  FTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGE  1708
              T+LIGNI+VFL+A  +KK+ M  R R +EWWM+R+ LP   R RVR FERQRWAA  G 
Sbjct  424   VTMLIGNIKVFLNATTSKKQAMHTRLRAVEWWMRRKGLPRGFRHRVRQFERQRWAATRGV  483

Query  1709  DEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIR  1888
             DE ++++DLPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I+R
Sbjct  484   DECQIVRDLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGETIVR  543

Query  1889  EGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSA  2068
             EGD V+R++FIVRG +  SQ L  G  ++  L PG F GDELLSWCLRRPF DRLP +SA
Sbjct  544   EGDVVRRMLFIVRGHLACSQALRNGATSSCTLGPGNFSGDELLSWCLRRPFRDRLPTASA  603

Query  2069  TFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRY  2248
             T   ++STEAFGLDA  ++++T HFRY FANE+++R+ARYYS  WRTWAAV VQLAWRRY
Sbjct  604   TLVTLESTEAFGLDAADVKYVTQHFRYTFANEKVRRSARYYSPGWRTWAAVAVQLAWRRY  663

Query  2249  RLRTRGQP-------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
             + R              +   +  G+ +LR Y A+  S +P+ 
Sbjct  664   KHRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  706



>ref|XP_003596492.1| Cyclic nucleotide-gated ion channel [Medicago truncatula]
Length=692

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/638 (46%), Positives = 410/638 (64%), Gaps = 47/638 (7%)
 Frame = +2

Query  542   VLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTC  721
             +LDPR K  + WNR FLL   M L +DPLFFYA+SI  +   CL++DG     VTV+R  
Sbjct  63    LLDPRGKWAEEWNRVFLLVCAMGLFVDPLFFYAISISDTCM-CLFIDGWFLVTVTVIRCM  121

Query  722   LDAVHICHLWLQFRLAYVSRESL-VVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
              D +H+ ++WLQF +    R S   +  G L       +S+  +  K F+F+ F++LP+P
Sbjct  122   TDMLHLWNIWLQFYIHKHKRSSFGFIHHGTL-------SSNSFKVNKAFFFNIFILLPLP  174

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V W+ +P L+ +  +  ++T+LL++FLFQ+LP+IYHS+  +RR     G+IFGT+WWG
Sbjct  175   QIVLWVTIPSLLEQGSIARVITVLLIMFLFQYLPKIYHSVCFVRR-NLTNGFIFGTVWWG  233

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCY--ELLL  1252
             F +N+IAYF+ASH AG CWY+L +QR A CL ++C      C LR  C +E  Y     +
Sbjct  234   FAINMIAYFVASHAAGSCWYLLGLQRAAKCLEEQCE-TTPGCGLRTLCCKEPIYYGNYNM  292

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                ++      +    A   +  CL     + FG+Y+W++ +V++ S   KIL PIFWGL
Sbjct  293   LKKLDRTRLVWSQNTEA---RSTCLASADNYEFGVYEWSVQLVTNNSRIEKILLPIFWGL  349

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN L+ T+  +EV+F+  I+ SGL+L T+LIGNI+VFLHA  +KK+ M+L+  +
Sbjct  350   MTLSTFGN-LQSTTERMEVVFNTIILTSGLLLVTMLIGNIKVFLHATTSKKQAMKLKMTN  408

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             MEWWM +R+LP  LRQRVR +ERQ WAAM G DE +LIK+LPEGLRRDIK  LCL L+++
Sbjct  409   MEWWMNKRRLPQGLRQRVRNYERQCWAAMRGVDECQLIKNLPEGLRRDIKYHLCLGLVRQ  468

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+ ICDR+K LVF+K E + REGDPV+R++F+VRG ++SSQ L  GV +
Sbjct  469   VPLFQHMDELVLEYICDRVKSLVFTKGETLTREGDPVRRMLFVVRGHLQSSQFLRDGVKS  528

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFR--  2146
               +L PG F GDELLSWCLRRPFI+RLP SS+T   + + E FGL+A  ++++T +FR  
Sbjct  529   CCMLGPGNFSGDELLSWCLRRPFIERLPTSSSTLVTLTTVEVFGLEAEDVKYVTQNFRYL  588

Query  2147  ---------------------YKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTR  2263
                                  Y FA E ++R+ RYYS  WRTWAAV +QLAWRRYR R  
Sbjct  589   FFNHIISAKYYQVSVYNNFCTYTFAKENVRRSVRYYSPGWRTWAAVAIQLAWRRYRHRLT  648

Query  2264  GQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
                 +       +  +    + RLR Y A+  S +P+ 
Sbjct  649   LSSLSFIRPRRPLSRSTSLEEDRLRLYTALLTSPKPNQ  686



>ref|XP_009765748.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X2 [Nicotiana sylvestris]
Length=616

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/526 (52%), Positives = 379/526 (72%), Gaps = 28/526 (5%)
 Frame = +2

Query  824   RAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPR  1003
             R+VA  Y+++ KGF+FD FVILP+PQ V W+ +P L+ +  +  +MT+LL++FLFQ+LP+
Sbjct  99    RSVALRYLKAKKGFFFDLFVILPLPQIVMWVAIPDLLEKGSITTVMTVLLIMFLFQYLPK  158

Query  1004  IYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRC  1183
             IYHS+ L+RRMQ  +GYIFGT+WWG  LNLIAYF+ASH  G CWY+L IQR A CL+++C
Sbjct  159   IYHSVCLLRRMQGFSGYIFGTVWWGIALNLIAYFVASHAVGACWYLLGIQRAAKCLKEQC  218

Query  1184  HYQKSTCNLR-LSCSEEVCYELLLPGGVEGNSCAGNST----AAALMRKPLCLDVNGPFR  1348
                K  C +R L+C E + Y          NS   + +        + +  CL     F 
Sbjct  219   GVTKG-CGVRMLACEESIYYG--------TNSLVKHKSRIIWGETKLARTTCLSSEESFD  269

Query  1349  FGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLML  1528
             +G YKW + +V++ +   KIL+PIFWGLMTLSTFGN LE T++WLE++F I ++ SGL+L
Sbjct  270   YGAYKWTVQLVTNENRLEKILFPIFWGLMTLSTFGN-LESTTDWLELVFIIIVLTSGLIL  328

Query  1529  FTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGE  1708
              T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM+RR+LP N +QR+R +ERQ++AA  G 
Sbjct  329   VTMLIGNIKVFLHATTSKKQAMQLKMRNVEWWMRRRRLPQNYKQRMRNYERQKYAATRGV  388

Query  1709  DEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIR  1888
             DE E+I++LPEGLRRDIK  LCLDL+++VPLF  +D+L+L+NICDR+K L+F+K E I R
Sbjct  389   DECEMIQNLPEGLRRDIKYHLCLDLVRQVPLFQHMDNLVLENICDRVKSLIFTKGETITR  448

Query  1889  EGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSA  2068
             EGDPVQR++FIVRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPF++RLP SS+
Sbjct  449   EGDPVQRMLFIVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSS  508

Query  2069  TFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRY  2248
             +   +++TEAFGL+A+ ++++T HFRY F +E++KR+ARYYS  WRTWAAV +QLAWRRY
Sbjct  509   SLVTLETTEAFGLEADDVKYVTQHFRYTFVDEKVKRSARYYSPGWRTWAAVAIQLAWRRY  568

Query  2249  R----------LRTRGQPNTVPENADDGDRRLRQYAAMFLSIRPHD  2356
             +          +R R   +      +D   RLR Y A+  S +P+ 
Sbjct  569   KHRLTLTSLSFIRPRRPLSRCSSLTED---RLRLYTALLTSPKPNQ  611



>ref|NP_001172593.1| Os01g0782700 [Oryza sativa Japonica Group]
 dbj|BAD53284.1| putative cyclic nucleotide and calmodulin-regulated ion channel 
[Oryza sativa Japonica Group]
 dbj|BAH91323.1| Os01g0782700 [Oryza sativa Japonica Group]
Length=666

 Score =   548 bits (1412),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 296/622 (48%), Positives = 402/622 (65%), Gaps = 27/622 (4%)
 Frame = +2

Query  545   LDPRSKR--VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
             L+PR      + W+RA+LLA    L +DPLF YA+S+      C+++DG  AA VTVLR 
Sbjct  46    LEPRRAGWWAREWDRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWFAAAVTVLRC  104

Query  719   CLDAVHICHLWLQFRLAYV-------SRESLVVGCGKLVWDARAVASHYVR--SLKGFWF  871
              +DA+H  +L ++ R A         + E +    G          +   R  S KG   
Sbjct  105   TVDAMHAWNLLMRLRAAVRPPEEDDGADEEVAAERGAGGNGGGPAPAQVARPVSRKGLML  164

Query  872   DAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTG  1051
             D FVILP+ Q + W+  P +IR      +MT+LL+ FLF++LP+IYH++ L+RRMQ    
Sbjct  165   DMFVILPVMQVIVWVAAPAMIRAGSTTAVMTVLLVSFLFEYLPKIYHAVRLLRRMQNT--  222

Query  1052  YIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSE  1228
             Y+FGTIWWG  LNL+AYF+A+H  G CWY+L  QR   CL+++C    S C    L+C+ 
Sbjct  223   YVFGTIWWGIALNLMAYFVAAHAVGACWYLLGAQRATKCLKEQCAQGGSGCAPGALACAA  282

Query  1229  EVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              + Y   + G            +A    +  CLD    +++G YKW + +V++ S   KI
Sbjct  283   PLYYGGAVGGVGADRLAWALDASA----RGTCLDSGDNYQYGAYKWTVMLVANPSRLEKI  338

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L PIFWGLMTLSTFGN L  T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+
Sbjct  339   LLPIFWGLMTLSTFGN-LASTTEWLEIVFNIITITGGLILVTMLIGNIKVFLNAATSKKQ  397

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              MQ R R +EWWMKR++LP + R RVR  ERQRWAA  G DE  +++DLPEGLRRDIK  
Sbjct  398   AMQTRLRGVEWWMKRKKLPQSFRHRVRQHERQRWAATRGVDECRIVRDLPEGLRRDIKYH  457

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+++VPLF  +DDL+L+NICDR+K LVF K E I+REGDPVQR++FIVRG ++SSQ
Sbjct  458   LCLDLVRQVPLFQHMDDLVLENICDRVKSLVFPKGEIIVREGDPVQRMLFIVRGHLQSSQ  517

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  G  +   L PG F GDELLSWC+RRPF++RLPASS+T   ++STEAFGL+A  +++
Sbjct  518   VLRTGATSCCTLGPGNFSGDELLSWCMRRPFLERLPASSSTLVTMESTEAFGLEAADVKY  577

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPE  2287
             +T HFRY F N+R++R+ARYYS  WRTWAAV VQLAWRRY+ R              +  
Sbjct  578   VTQHFRYTFTNDRVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSR  637

Query  2288  NADDGDRRLRQYAAMFLSIRPH  2353
              +  G+ +LR Y A+  S +P+
Sbjct  638   CSSLGEEKLRLYTAILTSPKPN  659



>ref|XP_006646393.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Oryza 
brachyantha]
Length=641

 Score =   547 bits (1409),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 288/613 (47%), Positives = 394/613 (64%), Gaps = 49/613 (8%)
 Frame = +2

Query  566   VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICH  745
              + W+RA+LLA    L +DPLF YA+S+      C+++DG  AA VTVLR  +D +H  +
Sbjct  58    AREWDRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWFAAAVTVLRCMVDVMHAWN  116

Query  746   LWLQFRLAYVSRESLVVGCGKLVWDARA-------VASHYVR--SLKGFWFDAFVILPIP  898
             L L+ R A    +    G G+     RA         +   R  S KG   D FVILP+ 
Sbjct  117   LLLRLRTAVRPEDD---GAGEEEAQRRADDGNGGAAPAQVARPVSKKGLVLDLFVILPLM  173

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q + W+  P +IR      +MT+LL+ FLF++LP+IYH+I  +RRMQ  +GY+FGTIWWG
Sbjct  174   QVIMWVTAPAMIRAGSTTAVMTMLLVSFLFEYLPKIYHAIRFLRRMQNASGYVFGTIWWG  233

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
               LNL+AYF+A+H  G CWY+L  QR   CL+++C                         
Sbjct  234   IALNLMAYFVAAHAVGACWYLLGAQRATKCLKEQCAV-----------------------  270

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMT  1438
             G +  S A + TA     +  CLD    +++G YKW + +V++ S   KIL PIFWGLMT
Sbjct  271   GADRLSWARDDTA-----RGTCLDSGDNYQYGAYKWTVMLVANPSRLEKILLPIFWGLMT  325

Query  1439  LSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDME  1618
             LSTFGN L  T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  ++K+ MQ R R +E
Sbjct  326   LSTFGN-LASTTEWLEIVFNIITITGGLILVTMLIGNIKVFLNATTSRKQAMQARLRGLE  384

Query  1619  WWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVP  1798
             WWMKR++LP + R R R  ERQRWAA  G DE  +++DLPEGLRRDIK  LCLDL+++VP
Sbjct  385   WWMKRKKLPQSFRHRARQHERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCLDLVRQVP  444

Query  1799  LFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATS  1978
             LF  +DDL+L+NICD++K LVF K E I+REGDPVQR++FIVRG ++SSQ L  G  +  
Sbjct  445   LFQHMDDLVLENICDKVKSLVFPKGEVIVREGDPVQRMLFIVRGHLQSSQVLRNGATSCC  504

Query  1979  ILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFA  2158
              L PG F GDELLSWC+RRPF++RLPASS+T   ++STE FGL+A  ++++T HFR+ F 
Sbjct  505   TLGPGNFSGDELLSWCMRRPFLERLPASSSTLVTMESTEGFGLEAADVKYVTQHFRHTFT  564

Query  2159  NERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRRLR  2317
             N++++R+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   +  G+ +LR
Sbjct  565   NDKVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSRCSSLGEEKLR  624

Query  2318  QYAAMFLSIRPHD  2356
              Y A+  S +P+ 
Sbjct  625   LYTAILTSPKPNQ  637



>gb|EAY76065.1| hypothetical protein OsI_03993 [Oryza sativa Indica Group]
Length=673

 Score =   548 bits (1412),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 296/622 (48%), Positives = 402/622 (65%), Gaps = 27/622 (4%)
 Frame = +2

Query  545   LDPRSKR--VQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
             L+PR      + W+RA+LLA    L +DPLF YA+S+      C+++DG  AA VTVLR 
Sbjct  53    LEPRRAGWWAREWDRAYLLACAAGLMVDPLFLYAVSVS-GPLMCVFLDGWFAAAVTVLRC  111

Query  719   CLDAVHICHLWLQFRLAYV-------SRESLVVGCGKLVWDARAVASHYVR--SLKGFWF  871
              +DA+H  +L ++ R A         + E +    G          +   R  S KG   
Sbjct  112   TVDAMHAWNLLMRLRAAVRPPEEDDGADEEVAAERGAGGNGGGPAPAQVARPVSRKGLML  171

Query  872   DAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTG  1051
             D FVILP+ Q + W+  P +IR      +MT+LL+ FLF++LP+IYH++ L+RRMQ    
Sbjct  172   DMFVILPVMQVIVWVAAPAMIRAGSTTAVMTVLLVSFLFEYLPKIYHAVRLLRRMQNT--  229

Query  1052  YIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL-RLSCSE  1228
             Y+FGTIWWG  LNL+AYF+A+H  G CWY+L  QR   CL+++C    S C    L+C+ 
Sbjct  230   YVFGTIWWGIALNLMAYFVAAHAVGACWYLLGAQRATKCLKEQCAQGGSGCAPGALACAA  289

Query  1229  EVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKI  1408
              + Y   + G            +A    +  CLD    +++G YKW + +V++ S   KI
Sbjct  290   PLYYGGAVGGVGADRLAWALDASA----RGTCLDSGDNYQYGAYKWTVMLVANPSRLEKI  345

Query  1409  LYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKR  1588
             L PIFWGLMTLSTFGN L  T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+
Sbjct  346   LLPIFWGLMTLSTFGN-LASTTEWLEIVFNIITITGGLILVTMLIGNIKVFLNAATSKKQ  404

Query  1589  KMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRF  1768
              MQ R R +EWWMKR++LP + R RVR  ERQRWAA  G DE  +++DLPEGLRRDIK  
Sbjct  405   AMQTRLRGVEWWMKRKKLPQSFRHRVRQHERQRWAATRGVDECRIVRDLPEGLRRDIKYH  464

Query  1769  LCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQ  1948
             LCLDL+++VPLF  +DDL+L+NICDR+K LVF K E I+REGDPVQR++FIVRG ++SSQ
Sbjct  465   LCLDLVRQVPLFQHMDDLVLENICDRVKSLVFPKGEIIVREGDPVQRMLFIVRGHLQSSQ  524

Query  1949  NLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRF  2128
              L  G  +   L PG F GDELLSWC+RRPF++RLPASS+T   ++STEAFGL+A  +++
Sbjct  525   VLRTGATSCCTLGPGNFSGDELLSWCMRRPFLERLPASSSTLVTMESTEAFGLEAADVKY  584

Query  2129  ITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPE  2287
             +T HFRY F N+R++R+ARYYS  WRTWAAV VQLAWRRY+ R              +  
Sbjct  585   VTQHFRYTFTNDRVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSR  644

Query  2288  NADDGDRRLRQYAAMFLSIRPH  2353
              +  G+ +LR Y A+  S +P+
Sbjct  645   CSSLGEEKLRLYTAILTSPKPN  666



>gb|AAP38210.1| putative cyclic nucleotide and calmodulin-regulated ion channel 
protein [Hordeum vulgare subsp. vulgare]
Length=587

 Score =   528 bits (1360),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 278/582 (48%), Positives = 383/582 (66%), Gaps = 24/582 (4%)
 Frame = +2

Query  668   CLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASH--  841
             C+++DG LAA VT LR  +DA+H  +L  Q R+A  +  ++  G   +  + +A A    
Sbjct  7     CVFLDGWLAAAVTALRCMVDAMHAWNLLTQLRVARAAAAAVARGRRGVADEEQAEADAAA  66

Query  842   ------YVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPR  1003
                   Y RS +G   D FVILP+ Q V W+  P +IR      +MT+LL+ FL ++LP+
Sbjct  67    ARSLPAYARSRRGMALDFFVILPVMQVVVWVAAPAMIRAGSTTAVMTVLLVAFLLEYLPK  126

Query  1004  IYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRC  1183
             IYHS+  +RR Q  +G+IFGTIWWG  LNL+AYF+A+H  G CWY+L +QR   CL+++C
Sbjct  127   IYHSVSFLRRTQDQSGHIFGTIWWGIVLNLMAYFVAAHAVGACWYLLGVQRATKCLKEQC  186

Query  1184  HYQK--STCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKP--LCLDVNGPFRF  1351
                      +  ++C+  + Y     G     S  G+  A A   K   +CL     ++F
Sbjct  187   LLTGPPGCASGPVACAAPLYYG----GAGAAASVVGDRLAWATDDKARSVCLVSGDKYQF  242

Query  1352  GIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLF  1531
             G YKW + +V++ S   K+L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L 
Sbjct  243   GAYKWTVMLVANTSRLEKMLLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLVLV  301

Query  1532  TLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGED  1711
             T+LIGNI+VFL+A  +KK+ M  R R +EWWMKR+ LP + R RVR FERQRWAA  G D
Sbjct  302   TMLIGNIKVFLNATTSKKQAMHTRLRSLEWWMKRKDLPQSYRHRVRQFERQRWAATRGVD  361

Query  1712  EMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIRE  1891
             E ++++DLPE LRRDIK  LCLDL+++VPLFH +DDL+L+N+CDR++ L++ K E I+RE
Sbjct  362   ECQIVRDLPEALRRDIKYHLCLDLVRQVPLFHHMDDLVLENMCDRVRSLIYPKGETIVRE  421

Query  1892  GDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSAT  2071
             GDPVQR+VFIVRG ++ SQ L  G  +  +L PG F GDELL WCLRRPF +RLPASS+T
Sbjct  422   GDPVQRMVFIVRGHLQCSQELRNGGTSCCMLGPGNFTGDELLPWCLRRPFAERLPASSST  481

Query  2072  FTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR  2251
                ++STE FGL+A  ++++T HFRY F NER++R+ARYYS  WRTWAAV VQLAWRRY+
Sbjct  482   LVTLESTEVFGLEAADVKYVTQHFRYTFTNERVRRSARYYSPGWRTWAAVAVQLAWRRYK  541

Query  2252  LRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
              R      +       +   +  G+ +LR Y A+  S +P+ 
Sbjct  542   HRKTLSSLSFIRPRRPLSRCSSLGEEKLRLYTAILASPKPNQ  583



>ref|XP_002526068.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF36262.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=359

 Score =   514 bits (1325),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 250/360 (69%), Positives = 297/360 (83%), Gaps = 4/360 (1%)
 Frame = +2

Query  1022  LMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKST  1201
             +M RM+KVTGYIFGTIWWG  LNLIAY IASHV GGCWYVLA Q V  CL+++C  +   
Sbjct  1     MMSRMRKVTGYIFGTIWWGLGLNLIAYLIASHVIGGCWYVLATQSVVKCLKEQCE-RNGN  59

Query  1202  CNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVV  1381
               L LSCS  VCY+ + P    GN+C GNST   L+ KPLCLD +GPF  GIY   L VV
Sbjct  60    YKLSLSCSGGVCYQFMYPEDKFGNTC-GNSTK--LIAKPLCLDDDGPFNHGIYSQGLLVV  116

Query  1382  SSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVF  1561
             +S S+AV+ILYPIFWGL+ LS+FGN+L PTSN +EV+FSI IVL GL LFTL++GNIQVF
Sbjct  117   TSHSLAVRILYPIFWGLLNLSSFGNELAPTSNLVEVMFSIFIVLCGLTLFTLMVGNIQVF  176

Query  1562  LHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPE  1741
             L  ++AK + MQL+ RD+EWWM+RRQLPS+LR+R+R+F+ QRWA MGGEDE++ I++LPE
Sbjct  177   LSVMLAKNKDMQLKRRDIEWWMRRRQLPSDLRRRMRHFDSQRWAIMGGEDEIKWIEELPE  236

Query  1742  GLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFI  1921
             GLRRDIKRFLCLDLIKK PLFH+LDDLILDNICDR+KPL+F K EKIIREGDPV R+ FI
Sbjct  237   GLRRDIKRFLCLDLIKKAPLFHNLDDLILDNICDRVKPLIFCKGEKIIREGDPVPRMYFI  296

Query  1922  VRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAF  2101
             VRGR K SQ+LSKG+V +S+LEPGGFLGDELLSWCL+RPF DRLPASSATF C++ TEAF
Sbjct  297   VRGRAKRSQSLSKGMVGSSVLEPGGFLGDELLSWCLQRPFRDRLPASSATFVCLEPTEAF  356



>ref|XP_001767134.1| predicted protein [Physcomitrella patens]
 gb|EDQ68055.1| predicted protein [Physcomitrella patens]
Length=540

 Score =   513 bits (1322),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 273/549 (50%), Positives = 372/549 (68%), Gaps = 11/549 (2%)
 Frame = +2

Query  605   MALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLAYVSRE  784
             + +A+DPLF   LSI      CLY+  G    +T LR  +D  ++  +W+Q + AYVS+E
Sbjct  1     LGIALDPLFLSVLSIN-PKLSCLYVQKGSLIALTTLRALIDFGYLSQVWMQLKTAYVSKE  59

Query  785   SLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIRE-EQVKlim  961
             SLV+G G+LVWDA+ +A +Y+  L GF FD ++ILP+PQ + W+V P+LI         +
Sbjct  60    SLVLGRGELVWDAKKIARNYLVPLSGFAFDMYIILPVPQIMLWMVTPRLIESGRDPTECV  119

Query  962   tillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYV  1141
             T +L+ FL Q+LP++ H+  ++RR+Q VTGYIFGT   GF LNLIAYFI++HVAG  WY+
Sbjct  120   TFILVTFLVQYLPKVVHTALVIRRLQHVTGYIFGTASSGFFLNLIAYFISAHVAGSFWYL  179

Query  1142  LAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPL  1321
             L +QRV +CL  +C       ++  +C   V +    P      + A N+          
Sbjct  180   LTVQRVETCLSFQCGGMVHCPSIPFACPLPVSFGHQ-PDDSARITWAQNANVQG------  232

Query  1322  CLDVNG-PFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFS  1498
             CL      F +GIY WA+P+V+      KILYP+FWG+MT S+FGN L P++++ EV+FS
Sbjct  233   CLQAKANDFSYGIYLWAVPLVTDGRFLQKILYPLFWGIMTFSSFGNALVPSNHFFEVLFS  292

Query  1499  ICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFE  1678
             I ++  GL+LFTLLIGNIQVFL ++ +KK +MQL  RD+EWWM+RR LP  LR RVR  E
Sbjct  293   IIVITCGLLLFTLLIGNIQVFLQSITSKKSEMQLHNRDLEWWMRRRLLPHRLRVRVRQQE  352

Query  1679  RQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPL  1858
             R RWAA  G DE  ++ +LPEGLRRDIKR LCLDL++KVPLF  LDDLIL+NICDR+KP+
Sbjct  353   RCRWAATRGIDEESILANLPEGLRRDIKRHLCLDLLRKVPLFEHLDDLILNNICDRLKPV  412

Query  1859  VFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRP  2038
             +F K E II EG+PV++++F VRG+V S   +    ++   L PG F GDEL+SWCL + 
Sbjct  413   LFIKQEPIIYEGNPVRQILFFVRGKVLSMYKIHDNKMSNCTLGPGDFFGDELISWCLSKS  472

Query  2039  FIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAA  2218
                RLP ++A+   ++ TEAF L +N L++ITDHFRYK A+E+LKRT RYYS  WR WAA
Sbjct  473   -TGRLPLANASLITLEMTEAFSLSSNDLKYITDHFRYKVASEQLKRTTRYYSTTWRMWAA  531

Query  2219  VNVQLAWRR  2245
             + +QLAWRR
Sbjct  532   MAIQLAWRR  540



>ref|XP_010661110.1| PREDICTED: cyclic nucleotide-gated ion channel 2 isoform X2 [Vitis 
vinifera]
Length=622

 Score =   512 bits (1319),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 257/308 (83%), Positives = 279/308 (91%), Gaps = 0/308 (0%)
 Frame = +2

Query  1442  STFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEW  1621
             STF N+L PTSNWLEVIFSICIVLSGL+LFTLLIGNIQVFL +VMAKKRKMQLR R++EW
Sbjct  315   STFANELAPTSNWLEVIFSICIVLSGLLLFTLLIGNIQVFLQSVMAKKRKMQLRYREIEW  374

Query  1622  WMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPL  1801
             WM+RRQLPS+LRQRVR FER  WAAMGGEDEMELI+DLPEGLRRDIKR LCLDLIKKVPL
Sbjct  375   WMRRRQLPSHLRQRVRRFERHSWAAMGGEDEMELIQDLPEGLRRDIKRHLCLDLIKKVPL  434

Query  1802  FHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSI  1981
             F SLDDLILDNICDR+KPLVF KDEKIIREGDPV R+VFI RG +KSSQNLSKG+VATS+
Sbjct  435   FQSLDDLILDNICDRVKPLVFCKDEKIIREGDPVHRMVFITRGHIKSSQNLSKGMVATSL  494

Query  1982  LEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFAN  2161
             LEPG FLGDELLSWC+RRPFIDR PASSATF C++STEAFGLDANHLRFIT+HFRYKFAN
Sbjct  495   LEPGDFLGDELLSWCIRRPFIDRHPASSATFVCVESTEAFGLDANHLRFITEHFRYKFAN  554

Query  2162  ERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENADDGDRRLRQYAAMFLS  2341
             ERLKRTARYYS+NWRTWAAVN+QLAWRRY +RTRG P          DRRLRQ AAMF+S
Sbjct  555   ERLKRTARYYSSNWRTWAAVNIQLAWRRYIIRTRGAPAIPVIENGGSDRRLRQCAAMFMS  614

Query  2342  IRPHDHLE  2365
             +RPHDHLE
Sbjct  615   LRPHDHLE  622


 Score =   468 bits (1205),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 243/326 (75%), Positives = 272/326 (83%), Gaps = 9/326 (3%)
 Frame = +2

Query  236   MPSYPGLHFSLSRWFGTILRRKSVQPDNSDDTYDENPNFIST--ECYACTQVGVPVFHST  409
             M + P    SL RW G   RRK+    NSD+ Y+E+   IS   ECYACTQVGVPVFHST
Sbjct  1     MDAPPNFQISLPRWIGIFRRRKA----NSDENYEEDDGPISNSIECYACTQVGVPVFHST  56

Query  410   SCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAF  589
             SCD AHQPEWEASAGSSLIPI++R    T ++  +   SGPFG VLDPR+K VQRWNRAF
Sbjct  57    SCDQAHQPEWEASAGSSLIPIQDRR---TGKARSNGRPSGPFGPVLDPRTKPVQRWNRAF  113

Query  590   LLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA  769
             LL RGM+LA+DPLFFY +SIG  G PCLYMDGGLAAIVTVLRTC+DAVH+ HLWLQFRLA
Sbjct  114   LLVRGMSLAVDPLFFYVISIGGEGGPCLYMDGGLAAIVTVLRTCVDAVHLFHLWLQFRLA  173

Query  770   YVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQV  949
             YVSRESLVVGCGKLVWDARA+ASHYVRSLKGFWFD FVILP+PQ VFWLVVPKLI++E++
Sbjct  174   YVSRESLVVGCGKLVWDARAIASHYVRSLKGFWFDLFVILPVPQVVFWLVVPKLIKQEEI  233

Query  950   KlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGG  1129
             KL+MTILLL+FLFQFLP++YHS+ LMRRMQKV GYIFGTIWW F LNLIAY IASHVAGG
Sbjct  234   KLMMTILLLMFLFQFLPKVYHSVCLMRRMQKVMGYIFGTIWWRFVLNLIAYLIASHVAGG  293

Query  1130  CWYVLAIQRVASCLRQRCHYQKSTCN  1207
             CWYVLAIQRVASCLRQ+C    +  N
Sbjct  294   CWYVLAIQRVASCLRQQCDRNSTFAN  319



>gb|AFW84890.1| cyclic nucleotide-gated ion channel 2 [Zea mays]
Length=505

 Score =   506 bits (1304),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 250/495 (51%), Positives = 342/495 (69%), Gaps = 15/495 (3%)
 Frame = +2

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V W+  P +IR      +M +LL  FL ++LP+IYH++ ++RRMQ V+GY+FGTIWWG
Sbjct  13    QVVVWVATPAMIRAGSTTDVMIVLLTAFLLEYLPKIYHAVRVLRRMQGVSGYLFGTIWWG  72

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN-LRLSCSEEVCYELLLP  1255
               LNL+AYF+A+H  G CWY+L  QR   CLR++C    S C    L+C+E + Y     
Sbjct  73    IALNLMAYFVAAHAVGACWYLLGAQRATKCLREQCAQAGSGCAPWALACAEPLYYGATAS  132

Query  1256  G-GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
               G    + AGN+TA     +  CLD    +++G Y+W + +V++ S   ++L PIFWGL
Sbjct  133   SVGAARLAWAGNATA-----RGTCLDSADNYQYGAYQWTVMLVANPSRVERVLLPIFWGL  187

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M  R R 
Sbjct  188   MTLSTFGN-LESTTEWLEIVFNIVTITGGLILVTMLIGNIKVFLNATTSKKQAMHTRLRS  246

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +E WMKR+ LP + R RVR +ERQRWAA  G DE  +++DLPEGLRRDIK  LCL L+++
Sbjct  247   VELWMKRKDLPRSYRHRVRQYERQRWAATRGVDECRIVRDLPEGLRRDIKYHLCLGLVRQ  306

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +DDL+L+NICDR+K L+F K E I+REGDPV+R++FIVRG ++SSQ L  G  +
Sbjct  307   VPLFQHMDDLVLENICDRVKSLIFPKGEVIVREGDPVKRMLFIVRGHLQSSQVLRNGAES  366

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPF++RLP SS+T   ++STEAFGLDA  ++++T HFRY 
Sbjct  367   CCMLGPGNFSGDELLSWCLRRPFLERLPGSSSTLATLESTEAFGLDAADVKYVTQHFRYT  426

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             F N++++R+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   +  G+ +
Sbjct  427   FTNDKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRRPLSRCSSLGEEK  486

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  487   LRLYTALLTSPKPNQ  501



>gb|KHN28017.1| Cyclic nucleotide-gated ion channel 4 [Glycine soja]
Length=467

 Score =   504 bits (1298),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 328/464 (71%), Gaps = 20/464 (4%)
 Frame = +2

Query  998   PRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQ  1177
             P+IYHS+ L+RRMQ ++GYI GT+WWG  LNLIAYF+ASH AG CWY+L +QR A CL +
Sbjct  8     PKIYHSVCLLRRMQDLSGYISGTVWWGIALNLIAYFVASHAAGACWYLLGLQRAAKCLEE  67

Query  1178  RCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNST----AAALMRKPLCLDVNGPF  1345
             +C  + + C LR  C    C E +  GG+   +   + T    A     +  CLD    +
Sbjct  68    QCA-KTTGCGLRTLC----CKEPIYYGGI---NIVRDKTRLLWAQNREARSTCLDSADNY  119

Query  1346  RFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLM  1525
              +G+Y+W++ +V++ S   KIL+PIFWGLMTLSTFGN LE T   LEVIF+I ++ SGL+
Sbjct  120   DYGVYEWSVQLVTNDSRLEKILFPIFWGLMTLSTFGN-LESTPERLEVIFNIIVLTSGLL  178

Query  1526  LFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGG  1705
             L T+LIGNI+VFLH+  +KK+ M LR R++EWWM +R+LP   RQRVR +ER RWAA  G
Sbjct  179   LVTMLIGNIKVFLHSTTSKKQAMLLRMRNIEWWMSKRRLPQGFRQRVRNYERMRWAATRG  238

Query  1706  EDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKII  1885
              DE ++IK+LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K LVF+K E I 
Sbjct  239   VDECQMIKNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLVFTKGETIT  298

Query  1886  REGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASS  2065
             +EGDPVQR++F+VRG ++SSQ L  GV +  +L PG F GDELLSWCLRRPFI+RLP SS
Sbjct  299   KEGDPVQRMLFVVRGHLQSSQVLRDGVKSFCMLGPGNFSGDELLSWCLRRPFIERLPPSS  358

Query  2066  ATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRR  2245
              T   +++TEAFGL+A  ++++T HFRY F NE++KR+ARYYS  WRTWAAV +QLAWRR
Sbjct  359   CTLVTLETTEAFGLEAQDVKYVTQHFRYTFVNEKVKRSARYYSPAWRTWAAVAIQLAWRR  418

Query  2246  YRLRTRGQP-------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
             Y+ R              +  +    + RLR Y AM  S +P+ 
Sbjct  419   YQHRLTLTSLSFIRPRRPLSRSTSMEEDRLRLYTAMLTSPKPNQ  462



>ref|XP_002440030.1| hypothetical protein SORBIDRAFT_09g024770 [Sorghum bicolor]
 gb|EES18460.1| hypothetical protein SORBIDRAFT_09g024770 [Sorghum bicolor]
Length=672

 Score =   507 bits (1306),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 252/517 (49%), Positives = 344/517 (67%), Gaps = 16/517 (3%)
 Frame = +2

Query  851   SLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMR  1030
             S KG   D FVILP+ Q V W+  P +IR      +MT++L+ FL ++LP+IYH+  L+R
Sbjct  153   SRKGMLLDFFVILPVMQVVVWVAAPAMIRAGLTTPVMTVMLVAFLLEYLPKIYHAARLLR  212

Query  1031  RMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNL  1210
             R Q+ +GYIFGTIWWG  LNL+AYF+A+H  G CWY+L +QR + CL+++C    +    
Sbjct  213   RTQRQSGYIFGTIWWGIALNLMAYFVAAHAVGACWYLLGVQRASKCLKEQCLQAAAAGGC  272

Query  1211  RLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMR----KPLCLDVNGP----FRFGIYKW  1366
               S +      L   G    +   G+    A  R    +  CL   G     +++G Y W
Sbjct  273   ARSSAVACAAPLYYGGSPSTSGVIGSGDRLAWSRNAQARGTCLSSGGGGGDNYQYGAYSW  332

Query  1367  ALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIG  1546
              + +V++ S   ++L PIFWGLMTLSTFGN LE T+ W+E++F+I  +  GL+L T+LIG
Sbjct  333   TVMLVANPSRVERMLLPIFWGLMTLSTFGN-LESTTEWVEIVFNIVTITGGLVLVTMLIG  391

Query  1547  NIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELI  1726
             NI+VFL+A  +KK+ M  R R +EWWMKR+ LP + R RVR FERQRWAA  G DE +++
Sbjct  392   NIKVFLNATTSKKQAMHTRLRSVEWWMKRKNLPRSFRARVRQFERQRWAATRGVDECQIV  451

Query  1727  KDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQ  1906
             +DLPEGLRRDIK  LCLDL+++VP F  +DDL+L+NICDR+K L+F K E I+REGD VQ
Sbjct  452   RDLPEGLRRDIKYHLCLDLVRQVPFFQHMDDLVLENICDRVKSLIFPKGETIVREGDVVQ  511

Query  1907  RVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCID  2086
             R++FIVRG ++ SQ L  G  ++  L PG F GDELLSWCLRRPF++RLP SSAT   ++
Sbjct  512   RMLFIVRGHLQCSQVLRNGATSSCTLGPGNFSGDELLSWCLRRPFLERLPTSSATLVTLE  571

Query  2087  STEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRG  2266
             STE FGLDA  ++++T HFRY F N++++R+ARYYS  WRTWAAV VQLAWRRY+ R   
Sbjct  572   STEVFGLDAADVKYVTQHFRYTFTNDKVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTL  631

Query  2267  QP-------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
                        +   +  G+ +LR Y A+  S +P+ 
Sbjct  632   SSLSFIRPRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  668



>gb|ACL53896.1| unknown [Zea mays]
 gb|ACN29121.1| unknown [Zea mays]
Length=483

 Score =   498 bits (1281),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 323/462 (70%), Gaps = 15/462 (3%)
 Frame = +2

Query  998   PRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQ  1177
             P+IYH++ ++RRMQ V+GY+FGTIWWG  LNL+AYF+A+H  G CWY+L  QR   CLR+
Sbjct  24    PKIYHAVRVLRRMQGVSGYLFGTIWWGIALNLMAYFVAAHAVGACWYLLGAQRATKCLRE  83

Query  1178  RCHYQKSTCN-LRLSCSEEVCYELLLPG-GVEGNSCAGNSTAAALMRKPLCLDVNGPFRF  1351
             +C    S C    L+C+E + Y       G    + AGN+TA     +  CLD    +++
Sbjct  84    QCAQAGSGCAPWALACAEPLYYGATASSVGAARLAWAGNATA-----RGTCLDSADNYQY  138

Query  1352  GIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLF  1531
             G Y+W + +V++ S   ++L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L 
Sbjct  139   GAYQWTVMLVANPSRVERVLLPIFWGLMTLSTFGN-LESTTEWLEIVFNIVTITGGLILV  197

Query  1532  TLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGED  1711
             T+LIGNI+VFL+A  +KK+ M  R R +E WMKR+ LP + R RVR +ERQRWAA  G D
Sbjct  198   TMLIGNIKVFLNATTSKKQAMHTRLRSVELWMKRKDLPRSYRHRVRQYERQRWAATRGVD  257

Query  1712  EMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIRE  1891
             E  +++DLPEGLRRDIK  LCL L+++VPLF  +DDL+L+NICDR+K L+F K E I+RE
Sbjct  258   ECRIVRDLPEGLRRDIKYHLCLGLVRQVPLFQHMDDLVLENICDRVKSLIFPKGEVIVRE  317

Query  1892  GDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSAT  2071
             GDPV+R++FIVRG ++SSQ L  G  +  +L PG F GDELLSWCLRRPF++RLP SS+T
Sbjct  318   GDPVKRMLFIVRGHLQSSQVLRNGAESCCMLGPGNFSGDELLSWCLRRPFLERLPGSSST  377

Query  2072  FTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYR  2251
                ++STEAFGLDA  ++++T HFRY F N++++R+ARYYS  WRTWAAV VQLAWRRY+
Sbjct  378   LATLESTEAFGLDAADVKYVTQHFRYTFTNDKVRRSARYYSPGWRTWAAVAVQLAWRRYK  437

Query  2252  LRTRGQP-------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
              R              +   +  G+ +LR Y A+  S +P+ 
Sbjct  438   HRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTALLTSPKPNQ  479



>gb|AAY58309.1| cyclic nucleotide-gated ion channel 4 [Hordeum vulgare subsp. 
vulgare]
 gb|AAY58310.1| cyclic nucleotide-gated ion channel 4 [Hordeum vulgare subsp. 
vulgare]
 gb|AAY58311.1| cyclic nucleotide-gated ion channel 4 [Hordeum vulgare subsp. 
vulgare]
 gb|AAY58312.1| cyclic nucleotide-gated ion channel 4 [Hordeum vulgare subsp. 
vulgare]
Length=495

 Score =   496 bits (1278),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 247/495 (50%), Positives = 336/495 (68%), Gaps = 16/495 (3%)
 Frame = +2

Query  905   VFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFC  1084
             V W+  P +IR      +MT+LL+ FL ++LP+IYHS+  +RR Q  +G+IFGTIWWG  
Sbjct  2     VVWVAAPAMIRAGSTTAVMTVLLVAFLLEYLPKIYHSVSFLRRTQDQSGHIFGTIWWGIV  61

Query  1085  LNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQ--KSTCNLRLSCSEEVCYELLLPG  1258
             LNL+AYF+A+H  G CWY+L +QR   CL+++C         +  ++C+  + Y     G
Sbjct  62    LNLMAYFVAAHAVGACWYLLGVQRATKCLKEQCLLTGPPGCASGPVACAAPLYYG----G  117

Query  1259  GVEGNSCAGNSTAAALMRKP--LCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                  S  G+  A A   K   +CL     ++FG YKW + +V++ S   K+L PIFWGL
Sbjct  118   AGAAASVVGDRLAWATDDKARSVCLVSGDKYQFGAYKWTVMLVANTSRLEKMLLPIFWGL  177

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+A  +KK+ M  R R 
Sbjct  178   MTLSTFGN-LESTTEWLEIVFNIITITGGLVLVTMLIGNIKVFLNATTSKKQAMHTRLRS  236

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +EWWMKR+ LP + R RVR FERQRWAA  G DE ++++DLPE LRRDIK  LCLDL+++
Sbjct  237   LEWWMKRKDLPQSYRHRVRQFERQRWAATRGVDECQIVRDLPEALRRDIKYHLCLDLVRQ  296

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLFH +DDL+L+N+CDR++ L++ K E I+REGDPVQR+VFIVRG ++ SQ L  G  +
Sbjct  297   VPLFHHMDDLVLENMCDRVRSLIYPKGETIVREGDPVQRMVFIVRGHLQCSQELRNGGTS  356

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELL WCLRRPF +RLPASS+T   ++STE FGL+A  ++++T HFRY 
Sbjct  357   CCMLGPGNFTGDELLPWCLRRPFAERLPASSSTLVTLESTEVFGLEAADVKYVTQHFRYT  416

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPENADDGDRR  2311
             F NER++R+ARYYS  WRTWAAV VQLAWRRY+ R              +   +  G+ +
Sbjct  417   FTNERVRRSARYYSPGWRTWAAVAVQLAWRRYKHRKTLSSLSFIRPRRPLSRCSSLGEEK  476

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  477   LRLYTAILASPKPNQ  491



>gb|EEE64270.1| hypothetical protein OsJ_19103 [Oryza sativa Japonica Group]
Length=476

 Score =   494 bits (1271),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 326/466 (70%), Gaps = 20/466 (4%)
 Frame = +2

Query  998   PRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQ  1177
             P+IYHS+  +RRMQ  +G+IFGTIWWG  LNLIAYF+A+H  G CWY+L +QR   CL++
Sbjct  14    PKIYHSVVFLRRMQNQSGHIFGTIWWGIALNLIAYFVAAHAVGACWYLLGVQRATKCLKE  73

Query  1178  RCHYQK----STCNLRLSCSEEVCYELLLPGGVEGNSCA--GNSTAAALMRKPLCLDVNG  1339
             +C        ++    ++C + + Y   +   V G+  A  GN+TA     + +CL    
Sbjct  74    QCLLAGLPACASSTAAVACVDPLYYGAAV-ASVGGDRLAWGGNATA-----RNVCLSSGD  127

Query  1340  PFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSG  1519
              +++G YKW + +VS+ S   K+L PIFWGLMTLSTFGN LE T+ W+E++F+I  +  G
Sbjct  128   NYQYGAYKWTVMLVSNPSRLEKMLLPIFWGLMTLSTFGN-LESTTEWVEIVFNIMTITGG  186

Query  1520  LMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAM  1699
             L+L T+LIGNI+VFL+A  +KK+ MQ R R +EWWM+ + +P   RQRVR FERQRWAA 
Sbjct  187   LILVTMLIGNIKVFLNATTSKKQAMQTRLRGLEWWMEHKGVPHGFRQRVRQFERQRWAAT  246

Query  1700  GGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEK  1879
              G DE ++++DLPEGLRRDIK  LCLDL+++VPLFH +DDL+L+NICDR+K L+F K E 
Sbjct  247   RGVDECQIVRDLPEGLRRDIKYHLCLDLVRQVPLFHHMDDLVLENICDRVKSLIFPKGEI  306

Query  1880  IIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPA  2059
             I+REGDPVQR++FIVRG ++ SQ +  G  +   L PG F GDELLSWC+RRPF++RLPA
Sbjct  307   IVREGDPVQRMLFIVRGHLQCSQVMRNGATSWCTLGPGNFSGDELLSWCMRRPFMERLPA  366

Query  2060  SSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAW  2239
             SS+T    +STEAFGL+A  ++++T HFRY F +++++R+ARYYS  WRTWAAV VQLAW
Sbjct  367   SSSTLVTAESTEAFGLEAGDVKYVTQHFRYTFTSDKVRRSARYYSHGWRTWAAVAVQLAW  426

Query  2240  RRYRLRTRGQPNT-------VPENADDGDRRLRQYAAMFLSIRPHD  2356
             RRY+ R      +       +   +  G+ +LR Y A+  S +P+ 
Sbjct  427   RRYKHRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  472



>ref|NP_001151488.1| cyclic nucleotide-gated ion channel 2 [Zea mays]
 gb|ACG43048.1| cyclic nucleotide-gated ion channel 2 [Zea mays]
Length=484

 Score =   492 bits (1266),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 323/463 (70%), Gaps = 16/463 (3%)
 Frame = +2

Query  998   PRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQ  1177
             P+IYH++ ++RRMQ V+GY+FGTIWWG  LNL+AYF+A+H  G CWY+L  QR   CLR+
Sbjct  24    PKIYHAVRVLRRMQGVSGYLFGTIWWGIALNLMAYFVAAHAVGACWYLLGAQRATKCLRE  83

Query  1178  RCHYQKSTCN-LRLSCSEEVCYELLLP--GGVEGNSCAGNSTAAALMRKPLCLDVNGPFR  1348
             +C    S C    L+ +E + Y       G     + AGN+TA     +  CLD    ++
Sbjct  84    QCAQAGSGCAPWALAFAEPLYYGATASSVGAPARLAWAGNATA-----RGTCLDSADNYQ  138

Query  1349  FGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLML  1528
             +G Y+W + +V++ S   ++L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L
Sbjct  139   YGAYQWTVMLVANPSRVERVLLPIFWGLMTLSTFGN-LESTTEWLEIVFNIVTITGGLIL  197

Query  1529  FTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGE  1708
              T+LIGNI+VFL+A  +KK+ M  R R +E WMKR+ LP + R RVR ++RQRWAA  G 
Sbjct  198   VTMLIGNIKVFLNATTSKKQAMHTRLRSVELWMKRKDLPRSYRHRVRQYKRQRWAATRGV  257

Query  1709  DEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIR  1888
             DE  +++DLPEGLRRDIK  LCL L+++VPLF  +DDL+L+NICDR+K L+F K E I+R
Sbjct  258   DECRIVRDLPEGLRRDIKYHLCLGLVRQVPLFQHMDDLVLENICDRVKSLIFPKGEVIVR  317

Query  1889  EGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSA  2068
             EGDPV+R++FIVRG ++SSQ L  G  +  +L PG F GDELLSWCLRRPF++RLPASS+
Sbjct  318   EGDPVKRMLFIVRGHLQSSQVLRNGAESCCMLGPGNFSGDELLSWCLRRPFLERLPASSS  377

Query  2069  TFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRY  2248
             T   ++STEAFGLDA  ++++T HFRY F N++++R+ARYYS  WRTWAAV VQLAWRRY
Sbjct  378   TLATLESTEAFGLDAADVKYVTQHFRYTFTNDKVRRSARYYSPGWRTWAAVAVQLAWRRY  437

Query  2249  RLRTRGQP-------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
             + R              +   +  G+ +LR Y A+  S +P+ 
Sbjct  438   KHRKTLASLSFIRPRRPLSRCSSLGEEKLRLYTALLTSPKPNQ  480



>gb|ACG46083.1| cyclic nucleotide-gated ion channel 2 [Zea mays]
Length=504

 Score =   492 bits (1267),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 323/465 (69%), Gaps = 19/465 (4%)
 Frame = +2

Query  998   PRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQ  1177
             P+IYH+  L+RRMQ+ +GYIFGTIWWG  LNL+AYF+A+H  G CWY+L +QR + CL++
Sbjct  43    PKIYHAARLLRRMQRQSGYIFGTIWWGIALNLMAYFVAAHAVGACWYLLGVQRASKCLKE  102

Query  1178  RCHYQKSTC--NLRLSCSEEVCYELLLPGGVEGN---SCAGNSTAAALMRKPLCLDVNGP  1342
             +C  Q + C     ++C+  + Y      GV G    + AGN+ A     +  CL     
Sbjct  103   QC-LQAAGCARGSAVACAAPLYYGGSPSPGVVGGDRLAWAGNAQA-----RGTCLASGDN  156

Query  1343  FRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGL  1522
             +++G Y W + +V++ S   ++L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL
Sbjct  157   YQYGAYTWTVMLVANPSRVERMLLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGL  215

Query  1523  MLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMG  1702
             +L T+LIGNI+VFL+A  +KK+ M  R R +EWWMKR++LP + R RVR FERQRWAA  
Sbjct  216   VLVTMLIGNIKVFLNATTSKKQAMHTRLRGVEWWMKRKKLPRSFRGRVRQFERQRWAATR  275

Query  1703  GEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKI  1882
             G DE ++++DLPEGLRRDIK  LCLDL+++VP F  +DDL+L+NICDR+K L+F K E I
Sbjct  276   GVDECQIVRDLPEGLRRDIKYHLCLDLVRQVPFFQHMDDLVLENICDRVKSLIFPKGETI  335

Query  1883  IREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPAS  2062
             +REGD VQR++FIVRG ++ SQ L  G  ++  L PG F GDELLSWCLRRPF++RLP S
Sbjct  336   VREGDVVQRMLFIVRGHLQCSQVLRNGATSSCTLGPGNFSGDELLSWCLRRPFLERLPTS  395

Query  2063  SATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWR  2242
             SAT   ++STE FGLDA  ++++T HFRY F N++++R+ARYYS  WRTWAAV VQLAWR
Sbjct  396   SATLVTLESTEVFGLDAADVKYVTQHFRYTFTNDKVRRSARYYSPGWRTWAAVAVQLAWR  455

Query  2243  RYRLRTRGQP-------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
             RY+ R              +   +  G+ +LR Y A+  S +P+ 
Sbjct  456   RYKHRKTLSSLSFIRPRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  500



>gb|KHG15403.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
 gb|KHG15493.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
 gb|KHG21471.1| Cyclic nucleotide-gated ion channel 2 -like protein [Gossypium 
arboreum]
Length=381

 Score =   459 bits (1180),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 244/366 (67%), Positives = 297/366 (81%), Gaps = 9/366 (2%)
 Frame = +2

Query  356   STECYACTQVGVPVFHSTSCDNAHQPEWEASAGSSLIPIKNRPGSVTHRSTQDFHRSGPF  535
             S ECYACTQVGVPVFHSTSCD+ HQP+WEA AGSSL P++     + + +   + R GPF
Sbjct  20    SIECYACTQVGVPVFHSTSCDSVHQPQWEAYAGSSLFPMEATSDPIKNLTRARYTR-GPF  78

Query  536   GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALS--IGRSGTPCLYMDGGLAAIVTV  709
             G++LDPRS  VQRWNR  L+ARG+ALA+DP+FFY L+  +   G PC+Y+DG LAAIVTV
Sbjct  79    GKILDPRSGLVQRWNRVLLVARGIALAVDPMFFYTLTLMVIDDGPPCVYLDGELAAIVTV  138

Query  710   LRTCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVIL  889
             +RTC+D +H+ HLWLQ ++AYVS+ESLV+GCGKLVWDARA+ASHYVRSLKGFWFD FVIL
Sbjct  139   VRTCVDGLHLWHLWLQLKMAYVSKESLVIGCGKLVWDARAIASHYVRSLKGFWFDVFVIL  198

Query  890   PIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTI  1069
             P+PQAVFWL+VPKL+REEQ KLIMTILL+IFL QFLP++YHS+ LMRRM+KVTGYIFG+I
Sbjct  199   PVPQAVFWLIVPKLLREEQYKLIMTILLVIFLSQFLPKVYHSLCLMRRMRKVTGYIFGSI  258

Query  1070  WWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVC--YE  1243
             WWGF LNLIAY IASHVAGGCWYVLA QRV +CL+Q+C  + + C++  SCS+ VC    
Sbjct  259   WWGFGLNLIAYLIASHVAGGCWYVLATQRVVTCLQQQCE-RSARCDISSSCSKGVCSTQH  317

Query  1244  LLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIF  1423
             L L   ++ + C GNST   LM K  C D +G FR+GIY+ ALPV+SS S+AVKILYPIF
Sbjct  318   LSLANMLKMSRCGGNST---LMTKSFCFDPDGIFRYGIYEPALPVISSNSLAVKILYPIF  374

Query  1424  WGLMTL  1441
             WGL+ L
Sbjct  375   WGLLNL  380



>dbj|BAJ33894.1| unnamed protein product [Thellungiella halophila]
Length=626

 Score =   457 bits (1175),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 305/437 (70%), Gaps = 20/437 (5%)
 Frame = +2

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCY---E  1243
             GF  +L         AG CWY+L +QR A CL+++C      C+LR LSC E V Y   E
Sbjct  193   GFFFDLFVILPLPQAAGACWYLLGVQRSAKCLKEQCE-NTMGCDLRMLSCKEPVYYGTTE  251

Query  1244  LLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIF  1423
             ++L         A  + A     + +CLD+N  + +G Y+W + +VS+ S   KIL+PIF
Sbjct  252   MVLDR-------ARLAWAQNHQARSICLDINTNYTYGAYQWTIQLVSNESRLEKILFPIF  304

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L T+LIGNI+VFLHA  +KK+ M L+
Sbjct  305   WGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQGMHLK  363

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
              R++EWWMK+R LP   RQRVR +ERQRWAAM G DE E++++LPEGLRRDIK  LCLDL
Sbjct  364   MRNIEWWMKKRHLPLGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLCLDL  423

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKG  1963
             +++VPLF  +DDL+L+NICDR+K L+F+K E I +EGD VQR++F+VRG ++SSQ L  G
Sbjct  424   VRQVPLFQHMDDLVLENICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLLRDG  483

Query  1964  VVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHF  2143
             V +  +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGLDA  ++++T HF
Sbjct  484   VKSCCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLDAEDVKYVTQHF  543

Query  2144  RYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDG  2302
             RY F NE++KR+ARYYS  WRTWAAV VQLAWRRY+ R      +       +   A  G
Sbjct  544   RYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCASLG  603

Query  2303  DRRLRQYAAMFLSIRPH  2353
             + +LR Y A+  S +P+
Sbjct  604   EDKLRLYTAILTSPKPN  620


 Score =   106 bits (264),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 81/131 (62%), Gaps = 11/131 (8%)
 Frame = +2

Query  533  FGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVL  712
             GR+LDPRSK VQ WNR FLL     L +DPLF Y LS+  +   CL +DG LA  VT L
Sbjct  81   LGRILDPRSKLVQEWNRVFLLVCATGLFVDPLFLYVLSVN-AACMCLLVDGWLALTVTAL  139

Query  713  RTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDARAVASHYVRSLKGFWF  871
            R+  D +H+ ++WLQF++A    Y  R+S   +  G G  V     VA  YV+  KGF+F
Sbjct  140  RSMTDLLHLWNIWLQFKIARRWPYPGRDSDGDINEGDGTRV--RTRVAPPYVKK-KGFFF  196

Query  872  DAFVILPIPQA  904
            D FVILP+PQA
Sbjct  197  DLFVILPLPQA  207



>ref|XP_007021255.1| Cyclic nucleotide-gated ion channel 4 isoform 2 [Theobroma cacao]
 gb|EOY12780.1| Cyclic nucleotide-gated ion channel 4 isoform 2 [Theobroma cacao]
Length=658

 Score =   452 bits (1163),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 242/471 (51%), Positives = 325/471 (69%), Gaps = 26/471 (6%)
 Frame = +2

Query  521   RSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAI  700
             R    G+VLDPR+K VQ WNR FLL     L +DPLFFY LSI  +   CL++DG  A  
Sbjct  192   RGWSLGQVLDPRAKWVQEWNRVFLLVCATGLFVDPLFFYVLSISDTCM-CLFIDGWFAIT  250

Query  701   VTVLRTCLDAVHICHLWLQFRLA----YVSRESLVVG----------CGKLVWDARAVAS  838
             VT LR   DA+H+ ++WLQ ++A    Y S  +               G L  +AR VA 
Sbjct  251   VTALRCMTDALHVWNMWLQLKMAKRSSYGSNATHGGSDVGGGGGRERSGPLGANARRVAI  310

Query  839   HYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSI  1018
              Y+++ KGF+FD FVILP+PQAV W+ +P L+ +  V L+MT+ L+IFLFQ+LP+IYHS+
Sbjct  311   KYLKARKGFFFDLFVILPLPQAVLWVAIPSLLEKGSVTLVMTVFLIIFLFQYLPKIYHSV  370

Query  1019  YLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKS  1198
              L+RRMQ ++GYIFGT+WWG  LN+IAYF+ASH AG CWY+L IQR A C++++C   + 
Sbjct  371   CLLRRMQNLSGYIFGTVWWGIALNMIAYFVASHAAGACWYLLGIQRSAKCMKEQCRVVE-  429

Query  1199  TCNLRL-SCSEEVCYELLLPGGVEG--NSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWA  1369
              C+ RL +C E + Y      G        A  + A     +  C+D    + +G YKW 
Sbjct  430   VCDPRLLACKEPIYY------GTSNMVRDRARLAWAENKQARRTCIDSPENYDYGAYKWT  483

Query  1370  LPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGN  1549
             + +V++ S   KIL+PIFWGLMTLSTFGN LE T+ WLEV+F+I ++ SGL+L T+LIGN
Sbjct  484   VQLVTNDSRLEKILFPIFWGLMTLSTFGN-LESTTEWLEVVFNIIVLTSGLLLVTMLIGN  542

Query  1550  IQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIK  1729
             I+VFLHA  +KK+ MQL+ R++EWWM++R LPS  RQRVR +ERQRWAAM G DE E+I+
Sbjct  543   IKVFLHATTSKKQAMQLKMRNIEWWMRKRHLPSGFRQRVRNYERQRWAAMRGVDECEMIR  602

Query  1730  DLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKI  1882
             +LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E +
Sbjct  603   NLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETV  653



>emb|CAN75352.1| hypothetical protein VITISV_031046 [Vitis vinifera]
Length=720

 Score =   448 bits (1153),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/419 (52%), Positives = 290/419 (69%), Gaps = 12/419 (3%)
 Frame = +2

Query  1118  VAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPGGVEGNSCAGNSTA  1297
              AG CWY+L +QR A CL++ C          L+C   + Y               N+  
Sbjct  301   AAGACWYLLGLQRAAKCLKEECAVANYCSTKTLACKNPIYYGTTSLLKDRARLAWANNKH  360

Query  1298  AALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSN  1477
             A    +  CLD    F +G Y+W + +V++ +   KIL+P+FWGLMTLSTFGN LE T+ 
Sbjct  361   A----RSTCLDSADNFEYGGYRWTIQLVTNDNRLEKILFPLFWGLMTLSTFGN-LESTTE  415

Query  1478  WLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLR  1657
             WLEVIF+I ++ SGL+L T+LIGNI+VFLHA  +KK+ MQL+ R++EWWM+RR+LP   R
Sbjct  416   WLEVIFNIIVLTSGLILVTMLIGNIKVFLHATTSKKQTMQLKMRNIEWWMRRRKLPXGFR  475

Query  1658  QRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNI  1837
             QRVR +ERQ+WAAM G DE ++ K+LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NI
Sbjct  476   QRVRNYERQKWAAMRGVDECQMTKNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENI  535

Query  1838  CDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVATSILEPGGFLGDELL  2017
             CDR+K L+F+K E I REGDPVQR++F+VRG ++SSQ L  GV +  +L PG F GDELL
Sbjct  536   CDRVKSLIFTKGEVITREGDPVQRMLFVVRGHLQSSQVLRDGVKSCCMLGPGNFSGDELL  595

Query  2018  SWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRTARYYSA  2197
             SWCLRRPFI+RLP SS+T   +++TEAFGL+A+ ++++T HFRY F  ER+KR+ARYYS 
Sbjct  596   SWCLRRPFIERLPPSSSTLITLETTEAFGLEADDVKYVTQHFRYTFVKERVKRSARYYSP  655

Query  2198  NWRTWAAVNVQLAWRRYRLRTRGQP-------NTVPENADDGDRRLRQYAAMFLSIRPH  2353
              WRTWAAV +QLAWRRY+ R              V   +  G+ RLR Y AM  S +P+
Sbjct  656   GWRTWAAVAIQLAWRRYKHRLTLTSLSFIRPRRPVSRCSSLGEDRLRLYTAMLTSPKPN  714



>ref|XP_009792557.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like isoform 
X3 [Nicotiana sylvestris]
Length=585

 Score =   443 bits (1140),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/435 (50%), Positives = 295/435 (68%), Gaps = 14/435 (3%)
 Frame = +2

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLR-LSCSEEVCYELLL  1252
             GF  +L          G CWY+L IQR A CL+++C      C L+ L+C E + Y    
Sbjct  152   GFLFDLFVILPLPQAVGACWYLLGIQRAAKCLKEQCRVTNG-CGLKMLACQEPIYYGTSN  210

Query  1253  PGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSSRSIAVKILYPIFWGL  1432
                 +     G ++ A       CL+    F +G YKW + + ++ +   KIL PIFWGL
Sbjct  211   LVKEKSRLIWGETSNARFT----CLNNGENFDYGAYKWTVQLFANENRFEKILLPIFWGL  266

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
             MTLSTFGN LE T++WLEVIF I ++ SGL+L T+ IGNI+VFLHA  +KK+ MQL+ R+
Sbjct  267   MTLSTFGN-LESTTDWLEVIFIIIVLTSGLILVTMFIGNIKVFLHATTSKKQAMQLKMRN  325

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
             +EWWM+RR LP  L+QR R FERQ+WAAM G DE E+I++LPEGLRRDIK  LCLDL+++
Sbjct  326   IEWWMRRRHLPRELKQRTRNFERQKWAAMRGVDECEMIRNLPEGLRRDIKYHLCLDLVRQ  385

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLSKGVVA  1972
             VPLF  +D+L+L+NICDR+K L+F+K E I +EGDPVQR++FIVRG ++SSQ L  GV +
Sbjct  386   VPLFQHMDNLVLENICDRVKSLIFTKGETITKEGDPVQRMLFIVRGHLQSSQLLRDGVKS  445

Query  1973  TSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYK  2152
               +L PG F GDELLSWCLRRPF++RLP SS+T   +++TEAFGL+A  ++++T HFRY 
Sbjct  446   CCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYT  505

Query  2153  FANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT-------VPENADDGDRR  2311
             F  E++KR+ARYYS  WRTW AV +QLAWRRY+ R      +       +   +  G+ R
Sbjct  506   FVKEKVKRSARYYSPGWRTWGAVAIQLAWRRYKHRLTLTSLSFIRPRRPLSRCSSLGEDR  565

Query  2312  LRQYAAMFLSIRPHD  2356
             LR Y A+  S +P+ 
Sbjct  566   LRIYTALLTSPKPNQ  580


 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 78/124 (63%), Gaps = 13/124 (10%)
 Frame = +2

Query  536  GRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLR  715
             +++DPR++ VQ WNR FLLA  + L +DPLFFYALSI  S   CL++DG  A  VT LR
Sbjct  57   NKIIDPRAQWVQEWNRVFLLACAIGLFLDPLFFYALSISESCM-CLFVDGWFAVTVTALR  115

Query  716  TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
               DA+H+ ++WLQF++   SR +              VA  Y ++ KGF FD FVILP+
Sbjct  116  CMTDALHVWNMWLQFKMINRSRRN------------HMVAQPYFKAKKGFLFDLFVILPL  163

Query  896  PQAV  907
            PQAV
Sbjct  164  PQAV  167



>ref|XP_006655461.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Oryza 
brachyantha]
Length=453

 Score =   432 bits (1112),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 231/510 (45%), Positives = 311/510 (61%), Gaps = 84/510 (16%)
 Frame = +2

Query  848   RSLKGFWFDAFVILPIPQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLM  1027
             R  KG   D FVILP+ Q V W+  P +IR      +MT+LL+ FLF++LP+IYHS+  +
Sbjct  17    RCRKGLVLDFFVILPVMQLVVWVAAPAMIRAGSTTAVMTVLLVSFLFEYLPKIYHSVVFL  76

Query  1028  RRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCN  1207
             RRMQ  +G++FGTIWWG  LNL+AYF+A+H  G CWY+L +Q                  
Sbjct  77    RRMQNQSGHVFGTIWWGIALNLMAYFVAAHAVGACWYLLGVQ------------------  118

Query  1208  LRLSCSEEVCYELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALPVVSS  1387
                                               R   CL  +  +++G YKW + +V++
Sbjct  119   ----------------------------------RATKCLKEH--YQYGAYKWTVMLVAN  142

Query  1388  RSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLH  1567
              S   K+L PIFWGLMTLSTFGN LE T+ WLE++F+I  +  GL+L T+LIGNI+VFL+
Sbjct  143   PSRLEKMLLPIFWGLMTLSTFGN-LESTTEWLEIVFNIITITGGLILVTMLIGNIKVFLN  201

Query  1568  AVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGL  1747
             A  +KK+ M  R R +EWWMKR+++P   RQRVR FERQRWAA  G DE  +++DLPEGL
Sbjct  202   ATTSKKQAMHTRLRSLEWWMKRKEVPQGFRQRVRQFERQRWAATRGVDECRIVRDLPEGL  261

Query  1748  RRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVR  1927
             RRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F K E I+REG+PVQR++FIVR
Sbjct  262   RRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFPKGEIIVREGEPVQRMLFIVR  321

Query  1928  GRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGL  2107
             G ++ SQ +  G  +   L PG F GDELLS                       TEAFGL
Sbjct  322   GHLQCSQAMRNGAASCCTLGPGNFSGDELLS----------------------CTEAFGL  359

Query  2108  DANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNT---  2278
             +A  ++++T HFRY F N+R++ +ARYYS  WRTWAAV VQLAWRRY+ R      +   
Sbjct  360   EAADVKYVTQHFRYTFTNDRVRWSARYYSPGWRTWAAVAVQLAWRRYKHRKTLASLSFIR  419

Query  2279  ----VPENADDGDRRLRQYAAMFLSIRPHD  2356
                 +   +  G+ +LR Y A+  S +P+ 
Sbjct  420   PRRPLSRCSSLGEEKLRLYTAILTSPKPNQ  449



>emb|CDY66570.1| BnaC02g44680D [Brassica napus]
Length=530

 Score =   429 bits (1102),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 239/478 (50%), Positives = 325/478 (68%), Gaps = 25/478 (5%)
 Frame = +2

Query  485   GSVTHRSTQDFHRSGPFGRVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGT  664
             G   + S   +++    GR+LDPRSK VQ WNR FLL     L +DPLF Y LS+     
Sbjct  62    GGRRNGSPGSYNKWMMLGRILDPRSKLVQEWNRVFLLVCATGLFVDPLFLYTLSVN-DAC  120

Query  665   PCLYMDGGLAAIVTVLRTCLDAVHICHLWLQFRLA----YVSRES---LVVGCGKLVWDA  823
              CL +DG LA  VT LR+  D +H+ ++ +QF++A    Y   ES   +  G G  V   
Sbjct  121   MCLLVDGWLALTVTALRSMTDLLHLWNILIQFKIARRWPYPGGESDGDINKGDGTRV--R  178

Query  824   RAVASHYVRSLKGFWFDAFVILPIPQ-AVFWLVVPKLIREEQVKlimtillliflfqflP  1000
               VA  YV+   GF+FD FVILP+PQ  V W+V+P L++   V L+++ILLL FLFQ+LP
Sbjct  179   TRVAPPYVKK-NGFFFDLFVILPLPQQVVLWVVIPSLLKRGSVTLVVSILLLTFLFQYLP  237

Query  1001  RIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQR  1180
             +IYHSI  +R+   ++GYIFGT+WWG  LN++AYF+A+H AG CWY+L +QR A CL+++
Sbjct  238   KIYHSIRHLRQNATLSGYIFGTVWWGIALNMVAYFVAAHAAGACWYLLGVQRSAKCLKEQ  297

Query  1181  CHYQKSTCNLR-LSCSEEVCY---ELLLPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFR  1348
             C      C+LR LSC E V Y   E++L       + A N  A     + +CLD +  + 
Sbjct  298   CE-NTMGCDLRMLSCKEPVYYGTTEMVLDRARL--AWARNHQA-----RSVCLDSDTNYT  349

Query  1349  FGIYKWALPVVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLML  1528
             +G Y+W + +VS+ S   KIL+PIFWGLMTLSTFGN LE T+ W EV+F+I ++ SGL+L
Sbjct  350   YGAYQWTIQLVSNESRLEKILFPIFWGLMTLSTFGN-LESTTEWSEVVFNIIVLTSGLLL  408

Query  1529  FTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGE  1708
              T+LIGNI+VFLHA  +KK+ M L+ R++EWWMK+R LP   RQRVR +ERQRWAAM G 
Sbjct  409   VTMLIGNIKVFLHATTSKKQAMHLKMRNIEWWMKKRHLPFGFRQRVRNYERQRWAAMRGV  468

Query  1709  DEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKI  1882
             DE E++++LPEGLRRDIK  LCLDL+++VPLF  +DDL+L+NICDR+K L+F+K E +
Sbjct  469   DECEMVQNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLENICDRVKSLIFTKGETV  526



>ref|XP_006848731.1| hypothetical protein AMTR_s00177p00063110 [Amborella trichopoda]
 gb|ERN10312.1| hypothetical protein AMTR_s00177p00063110 [Amborella trichopoda]
Length=259

 Score =   411 bits (1056),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/264 (74%), Positives = 226/264 (86%), Gaps = 5/264 (2%)
 Frame = +2

Query  1574  MAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRR  1753
             MAKKR MQ R  DMEWWMKRRQLPS LRQRVR++E+Q+WA M GEDEME+IKDLP+GLRR
Sbjct  1     MAKKRMMQRRVSDMEWWMKRRQLPSRLRQRVRHYEQQKWATMKGEDEMEMIKDLPQGLRR  60

Query  1754  DIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGR  1933
             DIKR LCLDLIK+VPLF SLDDLILDNICDR++PLVFSK+EKII EGDPVQR+VFIV+G 
Sbjct  61    DIKRHLCLDLIKQVPLFKSLDDLILDNICDRVRPLVFSKEEKIITEGDPVQRMVFIVKGH  120

Query  1934  VKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDA  2113
             +K SQ LSKG+ AT  L PG FLGDEL SWCLRRPF+DRLP SSATF  ++ TEAF L+A
Sbjct  121   LKRSQKLSKGMTATCTLGPGNFLGDELFSWCLRRPFVDRLPPSSATFVSLEPTEAFALEA  180

Query  2114  NHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPENA  2293
               L++IT+HFRYKFANERLKRTARYYS+NWRTWAAVN+QLAWR+++     +  TV   A
Sbjct  181   PDLKYITEHFRYKFANERLKRTARYYSSNWRTWAAVNIQLAWRKHK-----KAMTVTIVA  235

Query  2294  DDGDRRLRQYAAMFLSIRPHDHLE  2365
              D +RRLR+YA+MFLS+RPHDHLE
Sbjct  236   QDDERRLRRYASMFLSLRPHDHLE  259



>ref|NP_001140335.1| uncharacterized protein LOC100272382 [Zea mays]
 gb|ACF83604.1| unknown [Zea mays]
Length=260

 Score =   407 bits (1046),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/260 (73%), Positives = 226/260 (87%), Gaps = 2/260 (1%)
 Frame = +2

Query  1592  MQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFL  1771
             MQLR RDMEWWM+RRQLPS LRQRVR +ER+RWAA+ G++EME+IKDLPEGLRRDIKR+L
Sbjct  1     MQLRFRDMEWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYL  60

Query  1772  CLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQN  1951
             CL+L+K+VPLFH +DDLILDNICDR++PLV S  EK+IREGDPVQR+VFI++G+++S+Q 
Sbjct  61    CLELVKQVPLFHGMDDLILDNICDRLRPLVLSSGEKVIREGDPVQRMVFILQGKLRSTQP  120

Query  1952  LSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFI  2131
             L+KGVVAT +L  G FLGDELLSWCLRRPF+DRLPASSATF C+++ +AF L A  LRFI
Sbjct  121   LTKGVVATCMLGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLGAPDLRFI  180

Query  2132  TDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVP--ENADDGD  2305
             T+HFRY FANE+LKRTARYYS+NWRTWAAVN+QLAWRRYR RT       P     DDGD
Sbjct  181   TEHFRYNFANEKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTSADLAAPPLVGGPDDGD  240

Query  2306  RRLRQYAAMFLSIRPHDHLE  2365
             RRLR YAAMF+S+RPHDHLE
Sbjct  241   RRLRHYAAMFMSLRPHDHLE  260



>gb|KHN31833.1| Putative cyclic nucleotide-gated ion channel 17, partial [Glycine 
soja]
Length=672

 Score =   406 bits (1044),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 239/609 (39%), Positives = 354/609 (58%), Gaps = 28/609 (5%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALS-IGRSGTPCLYMDGGLAAIVTVLR  715
             R+LDP S  V +WNR F+++  +AL +DPL+FY  S I  +G+ C+  D  L  +VT LR
Sbjct  27    RILDPGSDIVLKWNRVFIVSCLVALFVDPLYFYLPSVIENTGSTCVRTDLTLRIVVTFLR  86

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             T  D  ++ HL ++FR AYV+  S V G G+LV D + +A  Y+RS   F+ D    LP+
Sbjct  87    TIADLFYLLHLIIKFRTAYVAPSSRVFGRGELVMDPKKIARRYIRS--DFFIDFIATLPL  144

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W ++P   R  Q       L LI L Q++PR+Y    L  ++ K TG +  T W 
Sbjct  145   PQMVIWFIIPA-TRTPQTDHKNNALALIVLLQYVPRLYLIFPLSSQIIKATGVVTKTAWA  203

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRC--HYQKSTCNLRLSCSEEVCYELL  1249
             G   NL+ Y +ASHV G  WY+L++ R  +C +  C   +    C L L C+        
Sbjct  204   GAAYNLLLYMLASHVLGAAWYLLSVDRYTTCWKSFCKKEHDPENCFLYLDCTSL------  257

Query  1250  LPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALP--VVSSRSIAVKILYPIF  1423
                 ++      NST+      P   ++N  F++GI++ A+   VVSS  I  K LY ++
Sbjct  258   ---NIKLREIWANSTSVFSSCDPSNDNIN--FKYGIFENAVKKHVVSSNFIP-KYLYCLW  311

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGL  LS++G +LE ++   E  F+I I + GL+LF+ LIGN+Q +L ++  +  + +L+
Sbjct  312   WGLQQLSSYGQNLETSTFIGETSFAIVIAILGLVLFSHLIGNMQTYLQSITIRLEEWRLK  371

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
              RD E WM+ RQLP +LR RVR F + +W A  G DE  +++ LP  LRRDI+R LCLDL
Sbjct  372   RRDTEEWMRHRQLPEDLRSRVRRFVQYKWLATRGVDEETILRALPADLRRDIQRHLCLDL  431

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS--  1957
             +++VP F  +DD +LD IC+R+   + ++   I+REGDPV  ++FI+RGR+ SS      
Sbjct  432   VRRVPFFSQMDDQLLDAICERLVSSLSTQGTYIVREGDPVTEMLFIIRGRLDSSTTNGGR  491

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G   + IL PG F G+ELLSW L       LP+S+ T   +   EAF L A  L+F+ +
Sbjct  492   SGFFNSIILRPGDFCGEELLSWALLPKSTINLPSSTRTVKALSEVEAFALRAEDLKFVAN  551

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP----NTVP-ENADDG  2302
              FR +  +++L+ T R+YS +WRTWAA  +Q AWRRY+ R   +      T+P + A  G
Sbjct  552   QFR-RLHSKKLQHTFRFYSHHWRTWAACFIQAAWRRYKKRMTMKDLSLRETIPLDEAVAG  610

Query  2303  DRRLRQYAA  2329
             +R+   Y+A
Sbjct  611   ERKHGDYSA  619



>ref|XP_003522943.1| PREDICTED: probable cyclic nucleotide-gated ion channel 17-like 
[Glycine max]
Length=713

 Score =   407 bits (1045),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 239/609 (39%), Positives = 354/609 (58%), Gaps = 28/609 (5%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALS-IGRSGTPCLYMDGGLAAIVTVLR  715
             R+LDP S  V +WNR F+++  +AL +DPL+FY  S I  +G+ C+  D  L  +VT LR
Sbjct  68    RILDPGSDIVLKWNRVFIVSCLVALFVDPLYFYLPSVIENTGSTCVRTDLTLRIVVTFLR  127

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             T  D  ++ HL ++FR AYV+  S V G G+LV D + +A  Y+RS   F+ D    LP+
Sbjct  128   TIADLFYLLHLIIKFRTAYVAPSSRVFGRGELVMDPKKIARRYIRS--DFFIDFIATLPL  185

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W ++P   R  Q       L LI L Q++PR+Y    L  ++ K TG +  T W 
Sbjct  186   PQMVIWFIIPA-TRTPQTDHKNNALALIVLLQYVPRLYLIFPLSSQIIKATGVVTKTAWA  244

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRC--HYQKSTCNLRLSCSEEVCYELL  1249
             G   NL+ Y +ASHV G  WY+L++ R  +C +  C   +    C L L C+        
Sbjct  245   GAAYNLLLYMLASHVLGAAWYLLSVDRYTTCWKSFCKKEHDPENCFLYLDCTSL------  298

Query  1250  LPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALP--VVSSRSIAVKILYPIF  1423
                 ++      NST+      P   ++N  F++GI++ A+   VVSS  I  K LY ++
Sbjct  299   ---NIKLREIWANSTSVFSSCDPSNDNIN--FKYGIFENAVKKHVVSSNFIP-KYLYCLW  352

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGL  LS++G +LE ++   E  F+I I + GL+LF+ LIGN+Q +L ++  +  + +L+
Sbjct  353   WGLQQLSSYGQNLETSTFIGETSFAIVIAILGLVLFSHLIGNMQTYLQSITIRLEEWRLK  412

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
              RD E WM+ RQLP +LR RVR F + +W A  G DE  +++ LP  LRRDI+R LCLDL
Sbjct  413   RRDTEEWMRHRQLPEDLRSRVRRFVQYKWLATRGVDEETILRALPADLRRDIQRHLCLDL  472

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS--  1957
             +++VP F  +DD +LD IC+R+   + ++   I+REGDPV  ++FI+RGR+ SS      
Sbjct  473   VRRVPFFSQMDDQLLDAICERLVSSLSTQGTYIVREGDPVTEMLFIIRGRLDSSTTNGGR  532

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G   + IL PG F G+ELLSW L       LP+S+ T   +   EAF L A  L+F+ +
Sbjct  533   SGFFNSIILRPGDFCGEELLSWALLPKSTINLPSSTRTVKALSEVEAFALRAEDLKFVAN  592

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP----NTVP-ENADDG  2302
              FR +  +++L+ T R+YS +WRTWAA  +Q AWRRY+ R   +      T+P + A  G
Sbjct  593   QFR-RLHSKKLQHTFRFYSHHWRTWAACFIQAAWRRYKKRMTMKDLSLRETIPLDEAVAG  651

Query  2303  DRRLRQYAA  2329
             +R+   Y+A
Sbjct  652   ERKHGDYSA  660



>dbj|BAK06788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   393 bits (1010),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/334 (57%), Positives = 245/334 (73%), Gaps = 8/334 (2%)
 Frame = +2

Query  1376  VVSSRSIAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQ  1555
             +V++ S   KIL PIFWGLMTLSTFGN L  T+ W E++F+I  +  GL+L T+LIGNI+
Sbjct  2     LVANPSRLEKILLPIFWGLMTLSTFGN-LASTTEWSEIVFNIVTITGGLILVTMLIGNIK  60

Query  1556  VFLHAVMAKKRKMQLRCRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDL  1735
             VFL+A  +KK+ M  R R +EWWMKR+ LP + R RVR  ERQRWAA  G DE  +++DL
Sbjct  61    VFLNATTSKKQAMHTRLRSVEWWMKRKNLPQSFRHRVRQQERQRWAATRGVDECRIVRDL  120

Query  1736  PEGLRRDIKRFLCLDLIKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVV  1915
             PEGLRRDIK  LCLDL+++VPLFH +DDL+LDNICDR+K LVF K E I+REGDPV+R+V
Sbjct  121   PEGLRRDIKYHLCLDLVRQVPLFHHMDDLVLDNICDRVKSLVFPKGEVIVREGDPVRRMV  180

Query  1916  FIVRGRVKSSQNLSKGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTE  2095
             FIVRG ++SSQ L  G  +  +L PG F GDELLSWCLRRPF +RLPA+S+T   ++STE
Sbjct  181   FIVRGHLESSQALRNGGTSCCMLGPGNFSGDELLSWCLRRPFQERLPAASSTLATLESTE  240

Query  2096  AFGLDANHLRFITDHFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQP-  2272
             AFGL+A  ++++T HFRY FANE+++R+ARYYS  WRTWAAV VQLAWRRY+ R      
Sbjct  241   AFGLEAGDVKYVTQHFRYTFANEKVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLTSL  300

Query  2273  ------NTVPENADDGDRRLRQYAAMFLSIRPHD  2356
                     +   +  G+ +LR Y A+  S +P+ 
Sbjct  301   SFIRPRRPLSRCSSLGEEKLRLYTALLTSPKPNQ  334



>ref|XP_007138411.1| hypothetical protein PHAVU_009G206600g [Phaseolus vulgaris]
 gb|ESW10405.1| hypothetical protein PHAVU_009G206600g [Phaseolus vulgaris]
Length=711

 Score =   403 bits (1035),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 245/626 (39%), Positives = 359/626 (57%), Gaps = 32/626 (5%)
 Frame = +2

Query  428   QPEWEASAG-----SSLIPI-KNRPGSVTHRSTQDF--HRSGPF-GRVLDPRSKRVQRWN  580
             +P W A+       S+L+P+ KNR G     S          P+  R+LDP S+ V +WN
Sbjct  20    KPLWGATESPGLKPSNLLPLGKNRIGETFRISGSKVFPEDHEPWRKRILDPGSEIVLKWN  79

Query  581   RAFLLARGMALAIDPLFFYALS-IGRSGTPCLYMDGGLAAIVTVLRTCLDAVHICHLWLQ  757
             R F+++  +AL +DPL+FY  S I  +G+ C+  D  L  +VT LRT  D  ++ HL ++
Sbjct  80    RVFIVSCLVALFVDPLYFYLPSVIENTGSSCVRTDLTLRIVVTFLRTIADLFYLLHLIIK  139

Query  758   FRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIPQAVFWLVVPKLIR  937
             FR AYV+  S V G G+LV D + +A  Y+RS   F+ D    LP+PQ V W ++P   R
Sbjct  140   FRTAYVAPSSRVFGRGELVMDPKKIARRYIRS--DFFIDFIATLPLPQMVIWFIIPA-TR  196

Query  938   EEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWGFCLNLIAYFIASH  1117
               Q       L LI L Q++PR+Y    L  ++ K TG +  T W G   NL+ Y +ASH
Sbjct  197   SPQTDHKNNALALIVLLQYVPRLYLIFPLSSQIIKATGVVTKTAWAGAAYNLLLYMLASH  256

Query  1118  VAGGCWYVLAIQRVASCLRQRCHYQKS--TCNLRLSCSEEVCYELLLPGGVEGNSCAGNS  1291
             V G  WY+L++ R  +CL+  C  +++   C   L CS             E      NS
Sbjct  257   VLGASWYLLSVDRYTTCLKSFCKKEQNPENCFGYLDCSSL---------NAELRKIWANS  307

Query  1292  TAAALMRKPLCLDVNGPFRFGIYKWALP--VVSSRSIAVKILYPIFWGLMTLSTFGNDLE  1465
             T       P   D+N  F+FGI++ A+   VVSS  I  K LY ++WGL  LS++G +L+
Sbjct  308   TNVFSSCDPSNNDIN--FKFGIFENAVKKHVVSSVFIP-KYLYCLWWGLQQLSSYGQNLD  364

Query  1466  PTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRDMEWWMKRRQLP  1645
              ++   E  F+I I + GL+LF+ LIGN+Q +L ++  +  + +L+ RD E WM+ RQLP
Sbjct  365   TSTFIGETSFAIVIAILGLVLFSHLIGNMQTYLQSITIRLEEWRLKRRDTEEWMRHRQLP  424

Query  1646  SNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKKVPLFHSLDDLI  1825
              +LR RVR F + +W A  G DE  +++ LP  L RDI+R LCLDL+++VP F  +DD +
Sbjct  425   EDLRSRVRRFVQYKWLATRGVDEETILRALPADLSRDIQRHLCLDLVRRVPFFSQMDDQL  484

Query  1826  LDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKS--SQNLSKGVVATSILEPGGF  1999
             LD IC+R+   + ++   I+REGDPV  ++FI+RGR+ S  +     G   + IL PG F
Sbjct  485   LDAICERLVSSLSTQGTYIVREGDPVSEMLFIIRGRLDSCTTNGGRTGFFNSIILRPGDF  544

Query  2000  LGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFRYKFANERLKRT  2179
              G+ELLSW L       LP+S+ T   +   EAF L A  L+F+ + FR +  +++L+ T
Sbjct  545   CGEELLSWALLPKSTINLPSSTRTVKALSEVEAFALRAEDLKFVANQFR-RLHSKKLQHT  603

Query  2180  ARYYSANWRTWAAVNVQLAWRRYRLR  2257
              R+YS +WRTWAA  +Q AWRRY+ R
Sbjct  604   FRFYSHHWRTWAACFIQAAWRRYKKR  629



>gb|KHN08735.1| Putative cyclic nucleotide-gated ion channel 17 [Glycine soja]
Length=713

 Score =   402 bits (1034),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 232/580 (40%), Positives = 341/580 (59%), Gaps = 23/580 (4%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALS-IGRSGTPCLYMDGGLAAIVTVLR  715
             R+LDP S+ V +WNR F+++  +AL +DPL+FY  S I  +G+ C+  D  L  +VT LR
Sbjct  68    RILDPGSEIVLKWNRVFIVSCLVALFVDPLYFYLPSVIENTGSSCVRTDLTLRIVVTFLR  127

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             T  D  ++ HL ++FR AYV+  S V G G+LV D + +A  Y+RS   F+ D    LP+
Sbjct  128   TIADLFYLLHLIIKFRTAYVAPSSRVFGRGELVMDPKKIARRYIRS--DFFIDFIATLPL  185

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W ++P   R  Q       L LI L Q+ PR+Y    L  ++ K TG +  T W 
Sbjct  186   PQMVIWFIIPA-TRSPQTDHKNNALALIVLLQYAPRLYLIFPLSSQIIKATGVVTKTAWA  244

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRC--HYQKSTCNLRLSCSEEVCYELL  1249
             G   NL+ Y +ASHV G  WY+L++ R  +C +  C   +    C L L CS        
Sbjct  245   GAAYNLLLYMLASHVLGAAWYLLSLDRYTTCWKSFCKKEHNPENCFLYLDCSS-------  297

Query  1250  LPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALP--VVSSRSIAVKILYPIF  1423
                 ++ +    NST       P   D+N  F++GI++ A+   VVSS+ I  K LY ++
Sbjct  298   --SNIKLHEIWANSTNVFSSCDPSNDDIN--FKYGIFESAVKKHVVSSKFIP-KYLYCLW  352

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGL  LS++G +LE ++   E  F+I I + GL+LF+ LIGN+Q +L ++  +  + +L+
Sbjct  353   WGLQQLSSYGQNLETSTFIGETSFAIVIAILGLVLFSHLIGNMQTYLQSITIRLEEWRLK  412

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
              RD E WM+ RQLP +LR RVR F + +W A  G DE  +++ LP  LRRDI+  LCL+L
Sbjct  413   QRDTEEWMRHRQLPEDLRSRVRRFVQYKWLATRGVDEEIILRALPADLRRDIQCHLCLNL  472

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS--  1957
             +++VP F  +DD +LD IC+R+   + ++   I+REGDPV  ++FI+RGR+ SS      
Sbjct  473   VRRVPFFSQMDDQLLDAICERLVSSLSTQGTYIVREGDPVTEMLFIIRGRLDSSTTNGGR  532

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G   + IL PG F G+ELLSW L       LP+S+ T   +   EAF L A  L+F+ +
Sbjct  533   SGFFNSIILRPGDFCGEELLSWALLPKSTINLPSSTRTVKALSEVEAFALRAEDLKFVAN  592

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR  2257
              FR +  +++L+ T R+YS +WRTWAA  +Q AWRRY+ R
Sbjct  593   QFR-RLHSKKLQHTFRFYSHHWRTWAACFIQAAWRRYKKR  631



>ref|XP_010278052.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 isoform 
X1 [Nelumbo nucifera]
Length=731

 Score =   403 bits (1035),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 231/588 (39%), Positives = 349/588 (59%), Gaps = 18/588 (3%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALSIGRSGTPCLYMDGGLAAIVTVLRT  718
             R+LDP S+ V +WNR FL++  +AL +DPL+FY  S+G +G+ C+  D  L+ +VT  RT
Sbjct  80    RILDPGSEIVLQWNRVFLISCLLALFVDPLYFYLPSVGGNGSSCIKTDLNLSIVVTCFRT  139

Query  719   CLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPIP  898
               D  ++ H+ ++FR AYV+  S V G G+LV D++ +A  Y++S   F+ D    LP+P
Sbjct  140   VADLFYLLHMIIKFRTAYVAPSSRVFGRGELVMDSKKIARRYLKS--DFFIDLAATLPLP  197

Query  899   QAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWWG  1078
             Q V W ++P  IR          L LI L Q++PR+Y    L  ++ K TG +  T W G
Sbjct  198   QIVIWFIIPA-IRSSHADHNNNALALIVLIQYVPRLYLIFPLSSQIIKATGVVTKTAWAG  256

Query  1079  FCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRCHYQKSTCNLRLSCSEEVCYELLLPG  1258
                NL+ Y IASHV G  WY+L+I+R  +C +  C  +K T  +  S +   C  L    
Sbjct  257   AAYNLLLYMIASHVLGASWYLLSIERHTACWKSEC--KKETAPMFCSLNYLDCSSL----  310

Query  1259  GVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWAL--PVVSSRSIAVKILYPIFWGL  1432
               +      NST       P   D++  F++GI++ A+   VVSS+ +  K  Y ++WGL
Sbjct  311   DNDKRKVWANSTNVFSNCNP-SQDIS--FKYGIFEKAVTNSVVSSKFLE-KYFYCLWWGL  366

Query  1433  MTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLRCRD  1612
               LS++G +L+ ++   E  F+I I + GL+LF  LIGN+Q +L ++  +  + +L+ RD
Sbjct  367   QNLSSYGQNLQTSTFIGETSFAILIAIMGLVLFAHLIGNMQTYLQSLTVRLEEWRLKRRD  426

Query  1613  MEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDLIKK  1792
              E WM+ RQLP +LR+RVR F + +W A  G DE  ++  LP  LRRDIKR LCLDL+++
Sbjct  427   TEEWMRHRQLPQDLRERVRRFVQYKWLATRGVDEEAILHALPTDLRRDIKRHLCLDLVRR  486

Query  1793  VPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS--KGV  1966
             VP F  +DD +LD IC+R+   + ++   I+REGDPV  ++FI+RGR++SS       G 
Sbjct  487   VPFFSQMDDQLLDAICERLVSSLSTEGTYIVREGDPVTEMLFIIRGRLESSTTNGGRTGF  546

Query  1967  VATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITDHFR  2146
               +  L PG F G+ELL+W L       LP+S+ T   +   EAF L A  L+F+ + FR
Sbjct  547   FNSITLRPGDFCGEELLAWALLPKSSVNLPSSTRTVRVLFEVEAFALRAEDLKFVANQFR  606

Query  2147  YKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLRTRGQPNTVPEN  2290
              +  +++L+ T R+YS +WRTWAA  +Q AWRRY+ R   +  T+ E+
Sbjct  607   -RLHSKKLQHTFRFYSHHWRTWAACFIQAAWRRYKKRMMAKDLTMQES  653



>ref|XP_006582102.1| PREDICTED: probable cyclic nucleotide-gated ion channel 17-like 
isoform X1 [Glycine max]
Length=713

 Score =   402 bits (1034),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 232/580 (40%), Positives = 342/580 (59%), Gaps = 23/580 (4%)
 Frame = +2

Query  539   RVLDPRSKRVQRWNRAFLLARGMALAIDPLFFYALS-IGRSGTPCLYMDGGLAAIVTVLR  715
             R+LDP S+ V +WNR F+++  +AL +DPL+FY  S I  +G+ C+  D  L  +VT LR
Sbjct  68    RILDPGSEIVLKWNRVFIVSCLVALFVDPLYFYLPSVIENTGSSCVRTDLTLRIVVTFLR  127

Query  716   TCLDAVHICHLWLQFRLAYVSRESLVVGCGKLVWDARAVASHYVRSLKGFWFDAFVILPI  895
             T  D  ++ HL ++FR AYV+  S V G G+LV D + +A  Y+RS   F+ D    LP+
Sbjct  128   TIADLFYLLHLIIKFRTAYVAPSSRVFGRGELVMDPKKIARRYIRS--DFFIDFIATLPL  185

Query  896   PQAVFWLVVPKLIREEQVKlimtillliflfqflPRIYHSIYLMRRMQKVTGYIFGTIWW  1075
             PQ V W ++P   R  Q       L LI L Q++PR+Y    L  ++ K TG +  T W 
Sbjct  186   PQMVIWFIIPA-TRSPQTDHKNNALALIVLLQYVPRLYLIFPLSSQIIKATGVVTKTAWA  244

Query  1076  GFCLNLIAYFIASHVAGGCWYVLAIQRVASCLRQRC--HYQKSTCNLRLSCSEEVCYELL  1249
             G   NL+ Y +ASHV G  WY+L++ R  +C +  C   +    C L L CS        
Sbjct  245   GAAYNLLLYMLASHVLGAAWYLLSLDRYTTCWKSFCKKEHNPENCFLYLDCSS-------  297

Query  1250  LPGGVEGNSCAGNSTAAALMRKPLCLDVNGPFRFGIYKWALP--VVSSRSIAVKILYPIF  1423
                 ++ +    NST       P   D+N  F++GI++ A+   VVSS+ I  K LY ++
Sbjct  298   --SNIKLHEIWANSTNVFSSCDPSNDDIN--FKYGIFESAVKKHVVSSKFIP-KYLYCLW  352

Query  1424  WGLMTLSTFGNDLEPTSNWLEVIFSICIVLSGLMLFTLLIGNIQVFLHAVMAKKRKMQLR  1603
             WGL  LS++G +LE ++   E  F+I I + GL+LF+ LIGN+Q +L ++  +  + +L+
Sbjct  353   WGLQQLSSYGQNLETSTFIGETSFAIVIAILGLVLFSHLIGNMQTYLQSITIRLEEWRLK  412

Query  1604  CRDMEWWMKRRQLPSNLRQRVRYFERQRWAAMGGEDEMELIKDLPEGLRRDIKRFLCLDL  1783
              RD E WM+ RQLP +LR RVR F + +W A  G DE  +++ LP  LRRDI+  LCL+L
Sbjct  413   QRDTEEWMRHRQLPEDLRSRVRRFVQYKWLATRGVDEEIILRALPADLRRDIQCHLCLNL  472

Query  1784  IKKVPLFHSLDDLILDNICDRIKPLVFSKDEKIIREGDPVQRVVFIVRGRVKSSQNLS--  1957
             +++VP F  +DD +LD IC+R+   + ++   I+REGDPV  ++FI+RGR+ SS      
Sbjct  473   VRRVPFFSQMDDQLLDAICERLVSSLSTQGTYIVREGDPVTEMLFIIRGRLDSSTTNGGR  532

Query  1958  KGVVATSILEPGGFLGDELLSWCLRRPFIDRLPASSATFTCIDSTEAFGLDANHLRFITD  2137
              G   + IL PG F G+ELLSW L       LP+S+ T   +   EAF L A  L+F+ +
Sbjct  533   SGFFNSIILRPGDFCGEELLSWALLPKSTINLPSSTRTVKALSEVEAFALRAEDLKFVAN  592

Query  2138  HFRYKFANERLKRTARYYSANWRTWAAVNVQLAWRRYRLR  2257
              FR +  +++L+ T R+YS +WRTWAA  +Q AWRRY+ R
Sbjct  593   QFR-RLHSKKLQHTFRFYSHHWRTWAACFIQAAWRRYKKR  631



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8096480025632