BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78190_g1_i1 len=730 path=[708:0-729]

Length=730
                                                                      Score     E

gb|KHN31016.1|  hypothetical protein glysoja_020314                   62.4    6e-09   
ref|XP_003636511.1|  hypothetical protein MTR_043s0014                60.8    2e-08   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768  63.2    4e-08   
gb|AFW65836.1|  hypothetical protein ZEAMMB73_825751                  60.8    1e-07   
ref|XP_002531759.1|  conserved hypothetical protein                   58.5    2e-07   Ricinus communis
ref|XP_008337941.1|  PREDICTED: uncharacterized protein LOC103401016  60.5    2e-07   
ref|XP_003598202.1|  60S ribosomal protein L23                        60.5    3e-07   
ref|XP_008343287.1|  PREDICTED: aspartic proteinase-like protein 2    60.5    3e-07   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                60.5    4e-07   
ref|XP_009623190.1|  PREDICTED: uncharacterized protein LOC104114439  58.9    7e-07   
ref|XP_004292185.1|  PREDICTED: putative ribonuclease H protein A...  58.5    1e-06   
gb|AAQ56556.1|  hypothetical protein OSJNBa0070J19.14                 57.4    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298184.1|  PREDICTED: putative ribonuclease H protein A...  57.0    2e-06   
ref|XP_003630976.1|  hypothetical protein MTR_8g105730                57.4    2e-06   
ref|XP_002512628.1|  conserved hypothetical protein                   56.2    3e-06   Ricinus communis
tpg|DAA58527.1|  TPA: hypothetical protein ZEAMMB73_831685            55.8    8e-06   
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...  55.8    1e-05   
ref|XP_002439697.1|  hypothetical protein SORBIDRAFT_09g018530        54.7    2e-05   Sorghum bicolor [broomcorn]
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  53.9    4e-05   
ref|XP_009123737.1|  PREDICTED: uncharacterized protein LOC103848614  53.1    5e-05   
ref|XP_006483704.1|  PREDICTED: uncharacterized protein LOC102620092  53.5    5e-05   
ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255  52.8    9e-05   
gb|EEC83326.1|  hypothetical protein OsI_28710                        53.1    1e-04   Oryza sativa Indica Group [Indian rice]
gb|EEE59647.1|  hypothetical protein OsJ_12023                        52.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002532007.1|  conserved hypothetical protein                   52.0    1e-04   Ricinus communis
gb|AAP44645.1|  putative reverse transcriptase                        52.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003594556.1|  hypothetical protein MTR_2g030550                50.1    2e-04   
gb|AAX95581.1|  hypothetical protein, partial                         51.6    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525921.1|  conserved hypothetical protein                   50.4    2e-04   Ricinus communis
gb|EAY83065.1|  hypothetical protein OsI_38284                        51.6    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002442739.1|  hypothetical protein SORBIDRAFT_08g002035        50.4    2e-04   Sorghum bicolor [broomcorn]
emb|CAH66131.1|  OSIGBa0135L04.5                                      52.0    2e-04   Oryza sativa [red rice]
gb|AAX95549.1|  hypothetical protein                                  51.6    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75888.1|  hypothetical protein OsI_12930                        51.6    3e-04   Oryza sativa Indica Group [Indian rice]
gb|AAU89136.1|  F-box domain containing protein                       51.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003593670.1|  hypothetical protein MTR_2g014850                48.9    3e-04   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       51.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             51.6    3e-04   Oryza sativa [red rice]
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  51.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56417.1|  hypothetical protein OsJ_05582                        50.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007206484.1|  hypothetical protein PRUPE_ppa019056mg           50.8    4e-04   
ref|XP_002468143.1|  hypothetical protein SORBIDRAFT_01g040370        50.4    4e-04   Sorghum bicolor [broomcorn]
ref|XP_006662398.1|  PREDICTED: uncharacterized protein LOC102702136  50.4    5e-04   
ref|XP_002522452.1|  nucleic acid binding protein, putative           50.4    5e-04   Ricinus communis
ref|XP_003604713.1|  hypothetical protein MTR_4g016830                47.8    5e-04   
gb|EEC68887.1|  hypothetical protein OsI_37529                        50.8    6e-04   Oryza sativa Indica Group [Indian rice]
gb|EEC83100.1|  hypothetical protein OsI_28249                        50.8    6e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_003597249.1|  hypothetical protein MTR_2g094480                48.5    7e-04   
ref|XP_004293164.1|  PREDICTED: putative ribonuclease H protein A...  49.3    7e-04   
gb|EEC73134.1|  hypothetical protein OsI_07152                        50.4    7e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002531249.1|  hypothetical protein RCOM_0494170                49.7    8e-04   Ricinus communis
ref|XP_003607468.1|  hypothetical protein MTR_4g078340                48.5    0.001   



>gb|KHN31016.1| hypothetical protein glysoja_020314, partial [Glycine soja]
Length=142

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 58/130 (45%), Gaps = 0/130 (0%)
 Frame = -3

Query  482  DLPMCFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWL  303
            D   C  DAS  +   +      +      FI+          SPL AE+ + +  + W 
Sbjct  5    DFVKCNTDASIFQDQSKFGLATSVQDTDGTFISVMSSWFSGIPSPLEAEARSLQLALDWQ  64

Query  302  KDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVI  123
              +    + L T+C ++ +C+  +    + VG I+  C   ISTF NCI+  V + AN +
Sbjct  65   SSQKQNNLILETDCKQIINCIKAKKFQNNEVGDILRNCVEKISTFQNCIVQFVTQQANQV  124

Query  122  AHSLVVAAVS  93
             HSL  A+ S
Sbjct  125  VHSLARASRS  134



>ref|XP_003636511.1| hypothetical protein MTR_043s0014 [Medicago truncatula]
Length=132

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -3

Query  392  FIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSY  213
            F  A         +PL AE++  K+ + WL + G+ +V +  +C  +   +   ++  S 
Sbjct  10   FFKALTKWFDYYPTPLEAEALGLKDTIVWLGELGLSMVQIELDCKLVVDSIMENSNNQSD  69

Query  212  VGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQASTLY*DSIPSYSISALL  36
             G II  CR+ ++ F N  IS V R AN +AH+L  A    A     D IPSY IS++L
Sbjct  70   FGNIISSCRSLLNQFRNFKISFVRRQANYVAHTLTRALKLDACHHIYDLIPSY-ISSIL  127



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 48/181 (27%), Positives = 85/181 (47%), Gaps = 6/181 (3%)
 Frame = -3

Query  572   WRSFLHAWRQVHLPRTLAALANTI-TAQL-HSDLPMCFFDASF*RSLGRAAFGAVLFSPT  399
             W+S L   +  + P T   +   + T Q+ ++   + +FD +  +  GR   GAV+ +P 
Sbjct  1183  WQSELAQTQSTNKPITGFVVKEIVRTPQVSNTSSSLLYFDGAVDKLNGRVGVGAVVLNPE  1242

Query  398   SGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHIL  219
              G + A   PLP   +P   E++A   G+ + K  G+L VD+  +   + + L+T+    
Sbjct  1243  HGLLGALSIPLPLSLNPKATEALALWYGIEYGKKLGLLNVDIRGDALNVLNGLNTRGWDF  1302

Query  218   SYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQASTLY*DSIPSYSISAL  39
             S +G ++D  R  ++ F       V +  N +AH L   A+S A     DS    S+  L
Sbjct  1303  SEIGGVLDAVRLTMTEFEIVSWRHVKKRFNAVAHELARKALSLAE----DSFRPKSVQEL  1358

Query  38    L  36
             +
Sbjct  1359  V  1359



>gb|AFW65836.1| hypothetical protein ZEAMMB73_825751 [Zea mays]
Length=279

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (51%), Gaps = 4/140 (3%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D S+    G   +G ++      F+AA  G L   SS L AES+AC +G+      G+  
Sbjct  127  DGSYLAKSGLGGWGCIIRGHDGSFLAAGAGTLTGISSTLHAESVACMKGLELAVFLGMQN  186

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAI-STFNNCIISIVPRSANVIAHSLVV  105
            V + T+ + L + L++Q + LS +G++  E R+ + S F  CI+S   R+ N++A  L  
Sbjct  187  VMIETDAAILKTALTSQEYDLSALGVVFKEIRSRMFSEFACCIVSKCQRTCNLVADCLTA  246

Query  104  AAVSQA---STLY*DSIPSY  54
               +     S+L+ D  P +
Sbjct  247  HGANSGDVDSSLWLDHAPDF  266



>ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30615.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = -3

Query  422  GAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSC  243
            G V+      F+ A          P +AE +A +E + W +DR +L V    +C  +   
Sbjct  54   GCVMKDHAGLFVCAMAVSFAGAYIPEIAEGLAIQEALSWARDRQLLNVVFELDCLHIVEA  113

Query  242  LSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
            L  +    S +GLII +C+   S+ +NC  + V RS N +AH L
Sbjct  114  LLRKGTDRSSLGLIIKDCKLLSSSISNCSFAFVKRSRNEVAHKL  157



>ref|XP_008337941.1| PREDICTED: uncharacterized protein LOC103401016 [Malus domestica]
Length=298

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = -3

Query  443  SLGR--AAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLH  270
            ++GR  A FGA++      F+A   G      SPL++E+MA K G+ W  DRG   + + 
Sbjct  180  NVGRLIAGFGAIIRDSDGCFVATRTGSFKDICSPLLSEAMAMKVGLLWAIDRGYQFLIIE  239

Query  269  TNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
            T+  ++   L      LS +G ++++ +  ++T     I+ + R+AN  AH L
Sbjct  240  TDSLQIVEALRDLTLNLSIIGQVVEDYKALLNTITEANITYIHRNANAAAHYL  292



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRG  291
            C  DA+      R   G  +      F+ A       C  P  AE++  ++ + WL    
Sbjct  67   CNVDAAIFSEQNRFGTGMCVRDQRGRFLKAATNWYEGCPPPQEAEAVGLRDAILWLGQLE  126

Query  290  ILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
            +  V L  +C  +   +  + +  +  G IID+CR+ +  F N  IS V R ANV+AHS 
Sbjct  127  LSNVQLELDCKLVVDSIYDKNNNQAEFGSIIDDCRSLLQQFTNFKISFVRRQANVVAHSF  186

Query  110  VVAAVSQ  90
               ++ Q
Sbjct  187  ARVSIFQ  193



>ref|XP_008343287.1| PREDICTED: aspartic proteinase-like protein 2 [Malus domestica]
Length=505

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 0/113 (0%)
 Frame = -3

Query  431  AAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSEL  252
            A FGA+       F+AA  G     SSPL+ E+MA + G+ W  DRG   + + T+  ++
Sbjct  68   AGFGAISKDFNGCFVAATTGRFDDVSSPLIPEAMAVRAGLQWAIDRGYHSLIIETDSLQI  127

Query  251  WSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVS  93
               L       S +G + ++C+  ++T     I+ + R+AN+ AH L    +S
Sbjct  128  VQALRDPTLNSSIIGQVAEDCKALLNTITKANITHIRRNANIDAHCLAKVGLS  180



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 41/125 (33%), Positives = 68/125 (54%), Gaps = 9/125 (7%)
 Frame = -3

Query  398   SGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHIL  219
             S F+AA   P P  + PL+AE++A + G+ +   RG   V   +N  ++ +  +++ ++ 
Sbjct  1727  SSFLAAWCKPYPGITDPLIAEALALRNGVLFAHLRGYSEVVFESNNLDIVNLWNSRHNVR  1786

Query  218   SYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQASTL-----Y*DSIPSY  54
             + V  I+ E R  +  F + +I  V RSANV+AH        QASTL     + DSIPS 
Sbjct  1787  AIVAPILFEIREHVIYFKSFVIQHVGRSANVLAH----LCAKQASTLDVTECWMDSIPSL  1842

Query  53    SISAL  39
              +++L
Sbjct  1843  LVTSL  1847



>ref|XP_009623190.1| PREDICTED: uncharacterized protein LOC104114439 [Nicotiana tomentosiformis]
Length=362

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 62/132 (47%), Gaps = 1/132 (1%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLK-DR  294
            C  DAS+  + GRA  G ++ S    F+     PL A    ++AE +  +E + WLK   
Sbjct  210  CNIDASYDVNSGRAWDGMLIRSTHENFVRGFTTPLEASHDAVIAEILTVREALSWLKMQH  269

Query  293  GILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHS  114
                + +  +C      L    +  SY  +I+ +C+  +  F +  +S V RSAN  AH 
Sbjct  270  HKSPITIEMDCLLAKQALERSDNGNSYFDIIVQDCKVLMCDFTSISLSFVKRSANQCAHM  329

Query  113  LVVAAVSQASTL  78
            LV AA S +  +
Sbjct  330  LVRAASSMSDAM  341



>ref|XP_004292185.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 54/121 (45%), Gaps = 0/121 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D +F  +  R   G VL      FIAA    +   +SP   E +A +EGM  L       
Sbjct  315  DTAFLPNQHREGIGGVLRDAAGNFIAAFTRSISHTASPKQCELLAIREGMDMLYSLQTCN  374

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
            V +H+ C E  + + T  + L   G I+D+ R       N  +  +PR+ N+IAH L   
Sbjct  375  VQIHSECQEAVAEVKTPDYELLANGGIVDDIRLVQQKLMNVCLKHIPRTCNIIAHRLAAI  434

Query  101  A  99
            A
Sbjct  435  A  435



>gb|AAQ56556.1| hypothetical protein OSJNBa0070J19.14 [Oryza sativa Japonica 
Group]
Length=275

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 61/132 (46%), Gaps = 1/132 (1%)
 Frame = -3

Query  500  TAQLHSDLPMCFFD-ASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMAC  324
            T  L+ D    F D  +F R+  + A GAVL      F        P     LM E++AC
Sbjct  112  TGPLNEDNDRRFSDQGAFSRNDSQGATGAVLRDVDGRFKGGRARWHPHGLDALMMEALAC  171

Query  323  KEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIV  144
            ++G+   +++G+L + + T+C EL           S+V  II +     S+F+   +   
Sbjct  172  RDGIQLAREKGVLRIQVETDCQELTKLWKQGGSQRSHVASIISDAIELSSSFHGFTLLYT  231

Query  143  PRSANVIAHSLV  108
            PRS N +AH L 
Sbjct  232  PRSCNHVAHVLA  243



>ref|XP_004298184.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=241

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 1/118 (1%)
 Frame = -3

Query  464  FDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGIL  285
             D ++ R  G    G ++         A    L   +SPL AE+MAC+EG+    ++G L
Sbjct  91   LDGAY-REDGSGGAGMLVRDEKGIVKGAWSVHLTNLNSPLQAEAMACREGLRRAVEQGWL  149

Query  284  VVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
             +D+ ++C  L + L+ +      V  IID CR  +   NN ++  + R AN  AH L
Sbjct  150  NIDVESDCEVLVAALNGENGGGLEVSRIIDNCRYYLILLNNSVVRHIYREANNGAHRL  207



>ref|XP_003630976.1| hypothetical protein MTR_8g105730 [Medicago truncatula]
Length=306

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 61/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACG-GPLPACSSPLMAESMACKEGMPWLKDR  294
            C  DASF  +L    FG  +      FI A      P CSS +  E++     + W+++ 
Sbjct  172  CNVDASFSEALNCVGFGLCIRDEYRNFIKAKTLWSNPVCSSDV-GEALGLYHDIQWVREL  230

Query  293  GILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECR-TAISTFNNCIISIVPRSANVIAH  117
             +  VD   +  ++    +   + +S  G ++DECR  +I  F N  +    R +NV+AH
Sbjct  231  QLSNVDFEMDAKKVVDYFNKGRNDISEFGAVMDECRKNSIDYFENSKVEFSRRQSNVVAH  290

Query  116  SLVVAAVSQAS  84
            +L   A S AS
Sbjct  291  ALAQEATSLAS  301



>ref|XP_002512628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50080.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 74/170 (44%), Gaps = 17/170 (10%)
 Frame = -3

Query  566  SFLHAWRQVHLPRTLAALANTITAQLHSDLPMCFFDASF*RSLGRAAFGAVLFSPTSGFI  387
            SFLH WR+    R  + +  +   Q  +++ +                 AV+      F+
Sbjct  57   SFLHQWRR---SRATSTVLGSTRTQGTNEMKI--------------GMAAVVSDSNGTFV  99

Query  386  AACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVG  207
            A     +     P +AE++A KE + W       +V   ++       + + A   S  G
Sbjct  100  ACMAHAVLGLFEPRLAEAVALKEAIRWAIQMRFSLVVFESDSKIAVDAIRSLAADWSEFG  159

Query  206  LIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQASTLY*DSIPS  57
            +IIDECR+ +S   N  +  V R AN++AH L +++ S AS    + IPS
Sbjct  160  IIIDECRSLLSLGLNFQVYFVKRQANMVAHVLAMSSYSYASLATWNVIPS  209



>tpg|DAA58527.1| TPA: hypothetical protein ZEAMMB73_831685 [Zea mays]
Length=362

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 4/125 (3%)
 Frame = -3

Query  416  VLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLS  237
            ++     GF+ A  G L   SS L AES+AC +G+      G+  V + T+ + L + L+
Sbjct  225  IIRGHDGGFLVAGAGALTGISSALHAESVACMKGLELAVFFGMQNVMIETDAAILKTALT  284

Query  236  TQAHILSYVGLIIDECRTAI-STFNNCIISIVPRSANVIAHSLVVAAVSQA---STLY*D  69
            +Q + LS +G++  E R+ + S F  CI+S   R+ N++A  L     +     S+L+ D
Sbjct  285  SQEYDLSALGVVFKEIRSRMFSEFACCIVSKCQRTCNLVADCLAAHGANSGDVDSSLWLD  344

Query  68   SIPSY  54
              P +
Sbjct  345  HAPDF  349



>ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=1152

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 0/117 (0%)
 Frame = -3

Query  461   DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
             D SF    GR   G V+       +A+   P P  +S +  E  A + G+     +G   
Sbjct  973   DGSFAHEEGRGGVGVVIRDHKGACVASLARPFPNAASAIHMEVEALRAGLLVCVQQGWRD  1032

Query  281   VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
             V++ ++C  L   + T     S VG II++C+  +S FN   +  V R AN +A+ L
Sbjct  1033  VEVESDCMNLVQAMQTDGEDFSMVGRIIEDCQRYVSAFNFFQLQHVCREANSVANRL  1089



>ref|XP_002439697.1| hypothetical protein SORBIDRAFT_09g018530 [Sorghum bicolor]
 gb|EES18127.1| hypothetical protein SORBIDRAFT_09g018530 [Sorghum bicolor]
Length=381

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 66/145 (46%), Gaps = 8/145 (6%)
 Frame = -3

Query  464  FDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGIL  285
             D SF     + A+G V+ S     + A  G L      LMAE+MACK  +      GI 
Sbjct  222  IDGSFMSGTSKGAWGFVILSHDGAIVIAGAGSLGPVHDALMAETMACKYAVEAAVQLGIA  281

Query  284  VVDLHTNCSELWSCLSTQAHILSYVGLIIDECRT-AISTFNNCIISIVPRSANVIAHSLV  108
             V + T+ S+L   L +    LS  G +  E RT A   F +  ++ + RS N +AH L 
Sbjct  282  HVVIETDSSQLRDGLISSELDLSVAGGLFQEIRTSAYEDFLSLSVTKIHRSCNSLAHEL-  340

Query  107  VAAVSQASTL-----Y*DSIPSYSI  48
             A + Q+  L     + D +P + I
Sbjct  341  -ADMGQSCDLGQYHHWIDPLPDFVI  364



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRG  291
            C  DA+   S G   +GAV+ +    F+ A    L +      AE++  +E + WLK   
Sbjct  364  CNVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREAEAIGVREILSWLKGLP  423

Query  290  ILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
             L V +  +  ++++ L+  +   +  GL+ID+CR    +  +   S V RSAN  AHS+
Sbjct  424  FLHVIIEMDSLQVFTALTMDSFSPNGFGLLIDDCRALAQSLGDVTFSFVRRSANSAAHSV  483



>ref|XP_009123737.1| PREDICTED: uncharacterized protein LOC103848614 [Brassica rapa]
Length=252

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 4/141 (3%)
 Frame = -3

Query  488  HSDLP---MCFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKE  318
            H++ P   +C  DA++ +    A  G +   P             A SSPLMAE++A +E
Sbjct  113  HNEGPFAVLCNSDAAWSKETETAGLGWMFDGPAPAARQCMSTTRHAVSSPLMAEALAMRE  172

Query  317  GMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPR  138
             +   K   +  V   T+  EL   +++++  +   G++ D       +F + + S VPR
Sbjct  173  ALQAAKQGLLSNVWFRTDSQELVRAINSKSFSVELYGVLSD-IEFLSRSFISVLFSYVPR  231

Query  137  SANVIAHSLVVAAVSQASTLY  75
            S N+IA SL   A+  A+TLY
Sbjct  232  SQNLIADSLAKNALRSAATLY  252



>ref|XP_006483704.1| PREDICTED: uncharacterized protein LOC102620092 [Citrus sinensis]
Length=340

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            DA+   S G  + GAV+ S    FIAA     P       AE++  +E + WLK      
Sbjct  203  DAAITSSRGMFSLGAVIRSAQCDFIAAKSDFFPGRVEAREAEAIEVREALSWLKKFAFYS  262

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
            V L  +  ++++ L  +    +  G IID+CR  + +    + S V  SAN  A ++   
Sbjct  263  VILDMDSLQVFNALHDKTSYFNGFGSIIDDCRALVRSLGEVVFSFVRGSANSAAFTVAQV  322

Query  101  AVSQAST  81
              S + +
Sbjct  323  GSSMSDS  329



>ref|XP_006470496.1| PREDICTED: uncharacterized protein LOC102617255 [Citrus sinensis]
Length=440

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 57/126 (45%), Gaps = 0/126 (0%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRG  291
            C  D +     G   FG V+      F+AA    +P   S   AE++  +E + W+K   
Sbjct  291  CNVDVALFAFRGYIGFGNVIRDSNCAFMAARCCSIPGRFSARDAEALGVREALSWIKQLQ  350

Query  290  ILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
            +  V +  +C  +++ L       S   LII++CR   ++  +   S V RSAN +AH +
Sbjct  351  LSNVTIEMDCLTVYNALVNNLSGPSSFSLIIEDCRALSNSIRDVSFSFVRRSANSVAHYV  410

Query  110  VVAAVS  93
              A  S
Sbjct  411  AQAGNS  416



>gb|EEC83326.1| hypothetical protein OsI_28710 [Oryza sativa Indica Group]
Length=794

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (46%), Gaps = 0/116 (0%)
 Frame = -3

Query  458  ASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVV  279
             +F R+  +   GAVL      F        P     LM E++AC++G+   +++G+L +
Sbjct  195  GAFSRNDSQGTTGAVLRDVDGRFKGGRARWHPHGLDALMMEALACRDGIQLAREKGVLRI  254

Query  278  DLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
             + T+C EL           S+V  II +     S F+   +   PRS N +AH L
Sbjct  255  QVETDCQELTKLWKQGGSQRSHVASIISDAIELSSGFHGFTLLYTPRSCNHVAHVL  310



>gb|EEE59647.1| hypothetical protein OsJ_12023 [Oryza sativa Japonica Group]
Length=1145

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 62/136 (46%), Gaps = 0/136 (0%)
 Frame = -3

Query  461   DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
             DA+   S      GA++   T   + AC   +     P +AE++A +  +   K+ G+  
Sbjct  1000  DAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGLQH  1059

Query  281   VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
             + + ++C  +   + T     S VG +I++ +   STF  C    V R +N+ AHSL   
Sbjct  1060  IVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLARN  1119

Query  101   AVSQASTLY*DSIPSY  54
             A     T+Y   IP Y
Sbjct  1120  AELSTCTVYRSVIPDY  1135



>ref|XP_002532007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30380.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = -3

Query  434  RAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSE  255
            R  FG +  + +  F AA  G +     P +AE+++ +E + W+K   +  V   ++C  
Sbjct  151  RLGFGFIFQNDSGTFRAATNGLISGPLDPQVAEALSLREDLCWVKGLDLNYVVSESDCLT  210

Query  254  LWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQAS  84
            L + ++      S  GL+I +CR+ +   N+  I  V R  N +AH L     S+  
Sbjct  211  LVNAVNKVGVNSSLFGLLIGDCRSFLKEMNHAHIVFVKRFGNRVAHLLARVTDSEVD  267



>gb|AAP44645.1| putative reverse transcriptase [Oryza sativa Japonica Group]
Length=404

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query  446  RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHT  267
            R++G    GA++   T   + AC   +     P +AE++A +  +   K+ G+  + + +
Sbjct  267  RTMG---VGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGLQHIVMAS  323

Query  266  NCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQA  87
            +C  +   + T     S VG +I++ +   STF  C    V R +N+ AHSL   A    
Sbjct  324  DCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLARNAELST  383

Query  86   STLY*DSIPSY  54
             T+Y   IP Y
Sbjct  384  CTVYRSVIPDY  394



>ref|XP_003594556.1| hypothetical protein MTR_2g030550 [Medicago truncatula]
Length=152

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 61/140 (44%), Gaps = 3/140 (2%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACG-GPLPACSSPLMAESMACKEGMPWLKDR  294
            C  DA+F  SL    FG  +      F+AA      P C S +  E++     + W+ + 
Sbjct  7    CNLDAAFSSSLNVIGFGMCIRDEVGQFVAAKTLRSSPICDSSI-GEALGLSYAIQWVHEL  65

Query  293  GILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRT-AISTFNNCIISIVPRSANVIAH  117
             +  VD   +           ++ +S  G IID+CR    S F N  I    R AN++AH
Sbjct  66   QLTNVDFEMDAKRAVDYYIKGSNDISEFGAIIDDCRRRCCSWFENSKIEFNRRQANIVAH  125

Query  116  SLVVAAVSQASTLY*DSIPS  57
            ++   A+   S+   + +PS
Sbjct  126  TIAREAILLTSSQTFNVVPS  145



>gb|AAX95581.1| hypothetical protein, partial, partial [Oryza sativa Japonica 
Group]
Length=364

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 52/121 (43%), Gaps = 0/121 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D SF  S G+   G +L +     I     PL  C++PL +E  AC EG+       +L 
Sbjct  216  DGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLP  275

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
            + + T+C+ +   L       S +  II E R  +       I  + RS N I+H L   
Sbjct  276  IQVETDCASVVQLLQGTGRDFSVLANIIHEARHLLVGERVISIKKICRSQNCISHHLANT  335

Query  101  A  99
            A
Sbjct  336  A  336



>ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36441.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 64/132 (48%), Gaps = 3/132 (2%)
 Frame = -3

Query  488  HSDLPMCFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMP  309
            H++      DA   ++  R  +G V+ +  +  +AA    +       +AE+MA +E + 
Sbjct  57   HNEYLKINEDAGIFQAQNRTGYGMVVRNHAANLVAARALIIHGVYEANLAEAMAVREALS  116

Query  308  WLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSAN  129
            W+K      V +  +   L  C++  +  LS+ GLIID C+  ++  ++   + + RS N
Sbjct  117  WIKHMNWSRVSI--DMDSLGVCVALTSDNLSF-GLIIDGCKHVVANIHDAAFTCIRRSTN  173

Query  128  VIAHSLVVAAVS  93
              AH L  A+VS
Sbjct  174  HCAHMLARASVS  185



>gb|EAY83065.1| hypothetical protein OsI_38284 [Oryza sativa Indica Group]
Length=290

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D SF  S G+   GAVL   +   I A  G +  C S + AE +ACKEG+        L 
Sbjct  166  DGSFQASDGKGGIGAVLRDSSGNVIFAACGSMLVCGSAMEAELLACKEGIAMALQWTFLP  225

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRT  183
              + T+C E+++ + ++  +LS +  ++ E + 
Sbjct  226  FIVETDCLEVFNLIQSKEKVLSELAFVVKEVQV  258



>ref|XP_002442739.1| hypothetical protein SORBIDRAFT_08g002035 [Sorghum bicolor]
 gb|EES16577.1| hypothetical protein SORBIDRAFT_08g002035 [Sorghum bicolor]
Length=180

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 60/126 (48%), Gaps = 1/126 (1%)
 Frame = -3

Query  485  SDLPMCFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPW  306
            +D+    FD +F ++  + A+G ++   T   + A  G +      L AES AC   +  
Sbjct  18   TDVLKINFDGAFLKAEKKGAWGFIVRDHTGASVVAGAGRINVVHDALSAESQACLAALYV  77

Query  305  LKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAIS-TFNNCIISIVPRSAN  129
              D G+  + L T+ + L   L ++++  S  G++  E +  +S  F    +  VPRS+N
Sbjct  78   AIDHGLSQIILETDSTTLVDALQSRSYDFSACGVLFREAKFLMSMNFIRADVVHVPRSSN  137

Query  128  VIAHSL  111
              AH L
Sbjct  138  RCAHEL  143



>emb|CAH66131.1| OSIGBa0135L04.5 [Oryza sativa Indica Group]
Length=611

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D SF  S G+   GAVL +     I +  G L  CS PL  E +ACKEG+       +L 
Sbjct  463  DGSFDASSGKGGIGAVLRNSQGEVIFSACGFLDRCSGPLEVELLACKEGINMALQWTLLP  522

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
            + +  +CSE    +S+ +   S V  I+++ +  +      II  +  + N  +H L
Sbjct  523  IVVEMDCSEAVKLISSVSKGRSEVAFIVNDIKQLMFGNREIIIRKIHHNQNGCSHIL  579



>gb|AAX95549.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP52527.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=472

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 52/121 (43%), Gaps = 0/121 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D SF  S G+   G +L +     I     PL  C++PL +E  AC EG+       +L 
Sbjct  324  DGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLP  383

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
            + + T+C+ +   L       S +  II E R  +       I  + RS N I+H L   
Sbjct  384  IQVETDCASVVQLLQGTGRDFSVLANIIHEARHLLVGERVISIKKICRSQNCISHHLANT  443

Query  101  A  99
            A
Sbjct  444  A  444



>gb|EEC75888.1| hypothetical protein OsI_12930 [Oryza sativa Indica Group]
Length=834

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query  446  RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHT  267
            R++G    GA++   T   + AC   +     P +AE++A +  +   K+ G+  + + +
Sbjct  697  RTMG---VGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGLQHIVMAS  753

Query  266  NCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQA  87
            +C  +   + T     S VG +I++ +   STF  C    V R +N+ AHSL   A    
Sbjct  754  DCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLARNAELST  813

Query  86   STLY*DSIPSY  54
             T+Y   IP Y
Sbjct  814  CTVYRSVIPDY  824



>gb|AAU89136.1| F-box domain containing protein [Oryza sativa Japonica Group]
Length=855

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query  446  RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHT  267
            R++G    GA++   T   + AC   +     P +AE++A +  +   K+ G+  + + +
Sbjct  718  RTMG---VGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGLQHIVMAS  774

Query  266  NCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQA  87
            +C  +   + T     S VG +I++ +   STF  C    V R +N+ AHSL   A    
Sbjct  775  DCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLARNAELST  834

Query  86   STLY*DSIPSY  54
             T+Y   IP Y
Sbjct  835  CTVYRSVIPDY  845



>ref|XP_003593670.1| hypothetical protein MTR_2g014850 [Medicago truncatula]
Length=114

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 50/114 (44%), Gaps = 18/114 (16%)
 Frame = -3

Query  398  SGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHIL  219
            S FI A       C  P  AE++  ++         IL VD       ++   + QA   
Sbjct  8    SRFIKAATTWYEGCPPPQEAEAVGLRDA--------ILCVD------SIYDKNNNQAEF-  52

Query  218  SYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQASTLY*DSIPS  57
               G IID+CR+ +  F N  IS V R  NV+AHS    ++ QA     D IPS
Sbjct  53   ---GSIIDDCRSLLQKFTNFKISFVRRQVNVVAHSFARVSILQARHQVFDLIPS  103



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query  446   RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHT  267
             R++G    GA++   T   + AC   +     P +AE++A +  +   K+ G+  + + +
Sbjct  1202  RTMG---VGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGLEHIVMAS  1258

Query  266   NCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQA  87
             +C  +   + T     S VG +I++ +   STF  C    V R +N+ AHSL   A    
Sbjct  1259  DCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLARNAELST  1318

Query  86    STLY*DSIPSY  54
              T+Y   IP Y
Sbjct  1319  CTVYRSVIPDY  1329



>gb|AAK39575.1|AC025296_10 putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|AAP54636.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=791

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 52/121 (43%), Gaps = 0/121 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            D SF  S G+   G +L +     I     PL  C++PL +E  AC EG+       +L 
Sbjct  643  DGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLP  702

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
            + + T+C+ +   L       S +  II E R  +       I  + RS N I+H L   
Sbjct  703  IQVETDCASVVQLLQGTGRDFSVLANIIHEARHLLVGERVISIKKICRSQNCISHHLANT  762

Query  101  A  99
            A
Sbjct  763  A  763



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query  446   RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHT  267
             R++G    GA++   T   + AC   +     P +AE++A +  +   K+ G+  + + +
Sbjct  1245  RTMG---VGALIRDNTGKCLVACSEMISDVVLPELAEALAIRRALGLAKEEGLEHIVMAS  1301

Query  266   NCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVAAVSQA  87
             +C  +   + T     S VG +I++ +   STF  C    V R +N+ AHSL   A    
Sbjct  1302  DCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVNRLSNLAAHSLARNAELST  1361

Query  86    STLY*DSIPSY  54
              T+Y   IP Y
Sbjct  1362  CTVYRSVIPDY  1372



>gb|EEE56417.1| hypothetical protein OsJ_05582 [Oryza sativa Japonica Group]
Length=265

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (47%), Gaps = 0/118 (0%)
 Frame = -3

Query  464  FDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGIL  285
             D SF    G+   G VL +     I A  G +  C+  L AE MAC+EG+       +L
Sbjct  116  IDGSFQPDTGKGGLGVVLRNRLGEVIFAACGYIQRCTGALEAELMACREGLLMALQWTLL  175

Query  284  VVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
             + + T+C E+ + L ++  + S +  ++ E    +       ++ V R+ N I+H L
Sbjct  176  PIIIETDCQEMLNLLQSKELVRSELMFLVKEVHDLMMGNRVVSLAKVHRNQNRISHVL  233



>ref|XP_007206484.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
 gb|EMJ07683.1| hypothetical protein PRUPE_ppa019056mg, partial [Prunus persica]
Length=298

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 0/118 (0%)
 Frame = -3

Query  464  FDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGIL  285
            FD +F  + GR A G V      GF+AA    +    S   AE +A +EG+      G  
Sbjct  134  FDGAFDPTSGRGAVGVVARDADGGFVAAVAKSVGEVLSAEHAEILAAREGVALALSLGTA  193

Query  284  VVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
                  + + + S +       S +G I+++ +     F + +    PR AN +AH L
Sbjct  194  SPIFEGDSAVVVSAIKRAGQDYSNIGTIVEDVKHLQQQFPSSLFQFTPREANGVAHRL  251



>ref|XP_002468143.1| hypothetical protein SORBIDRAFT_01g040370 [Sorghum bicolor]
 gb|EER95141.1| hypothetical protein SORBIDRAFT_01g040370 [Sorghum bicolor]
Length=289

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 69/148 (47%), Gaps = 4/148 (3%)
 Frame = -3

Query  485  SDLPMCFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPW  306
            +D+    FD +F ++  + A+G ++   T   + A  G +      L AES AC   +  
Sbjct  127  TDVLKINFDGAFLKTQKKGAWGFIVRDHTGASVVAGAGRINVVHDALSAESQACLAALYV  186

Query  305  LKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAIS-TFNNCIISIVPRSAN  129
              D G+  + L T+ + L   L ++++  S  G++  E +  +S  F    +  VPRS+N
Sbjct  187  AIDHGLSQIILETDSTTLVDALQSRSYDFSACGVLFREAKFLMSMNFIRADVVHVPRSSN  246

Query  128  VIAHSLVVAAVS---QASTLY*DSIPSY  54
              AH L    ++     S ++ D +P +
Sbjct  247  RCAHELARIGLNWDPDRSHVWIDPLPEF  274



>ref|XP_006662398.1| PREDICTED: uncharacterized protein LOC102702136 [Oryza brachyantha]
Length=390

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 66/148 (45%), Gaps = 3/148 (2%)
 Frame = -3

Query  557  HAWRQVHLPRTLAALANTITAQLHSDLPMCFFDASF*RSLGRAAFGAVLFSPTSGFIAAC  378
            H WR +   R   AL+    A   S++  C  DA F      AA G V+       I   
Sbjct  71   HTWRAILAGRE--ALSKGWRAP-SSEVMKCNVDARFHPDELVAAAGVVIRGEHGQMIGGK  127

Query  377  GGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLII  198
                 +  + LMAE++AC++G+ + + RG++ + L T+C  L      +    S V  I+
Sbjct  128  SKWYASVPNALMAEALACRDGLLFAQSRGVVNLWLETDCQVLVRLWEDRVKQRSEVSFIL  187

Query  197  DECRTAISTFNNCIISIVPRSANVIAHS  114
             E     ++F +  +S   R+ N +AH 
Sbjct  188  REMAELSASFVSLTLSFANRNCNRVAHE  215



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 57/123 (46%), Gaps = 0/123 (0%)
 Frame = -3

Query  461  DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
            DAS     G++    VL      +I       P  ++P +AE+ A KE + W+  +G+  
Sbjct  356  DASSSAERGKSGASFVLRDNAGIWITGVLIIRPYIANPDVAEAWALKEALSWIHAKGMEE  415

Query  281  VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
            V + T+C      L  + H  SY+  ++ +C+  +   N C +  V  SAN +AH +  A
Sbjct  416  VQIETDCLRNIELLEEELHPNSYLLCLLKDCQDLLRVLNRCNLVFVYGSANTVAHMISKA  475

Query  101  AVS  93
              S
Sbjct  476  TCS  478



>ref|XP_003604713.1| hypothetical protein MTR_4g016830 [Medicago truncatula]
Length=108

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 0/97 (0%)
 Frame = -3

Query  347  LMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTF  168
            L AE+ A  E +      G   V   T+C  L   + T +  L+ VG II +CR  + T 
Sbjct  4    LEAEATALSEAIKLAISLGFQTVRFETDCMTLADAIHTTSAHLNEVGDIISQCRGLLFTN  63

Query  167  NNCIISIVPRSANVIAHSLVVAAVSQASTLY*DSIPS  57
             +  +S + R AN +AHS+  A++S  S     S+PS
Sbjct  64   TDFKVSYIRRQANRVAHSIARASLSHLSPHLFYSVPS  100



>gb|EEC68887.1| hypothetical protein OsI_37529 [Oryza sativa Indica Group]
Length=1765

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 35/121 (29%), Positives = 52/121 (43%), Gaps = 0/121 (0%)
 Frame = -3

Query  461   DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
             D SF  S G+   G +L +     I     PL  C++PL +E  AC EG+       +L 
Sbjct  1617  DGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELRACVEGLKLAIHWTLLP  1676

Query  281   VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
             + + T+C+ +   L       S +  II E R  +       I  + RS N I+H L   
Sbjct  1677  IQVETDCASVVQLLQGIGRDFSVLANIIHEARHLLVGERVISIKKICRSQNCISHHLANT  1736

Query  101   A  99
             A
Sbjct  1737  A  1737



>gb|EEC83100.1| hypothetical protein OsI_28249 [Oryza sativa Indica Group]
Length=1300

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 36/125 (29%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = -3

Query  461   DASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGILV  282
             D S+    G    GAVL +     I A  G +    S L AE +ACKEG+        L 
Sbjct  1155  DGSYDPRDGSGGIGAVLRNSEGKLIFAACGSMCRPVSALEAELVACKEGIILALQWTFLP  1214

Query  281   VDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSLVVA  102
             + + T+C EL   ++ Q  ++S +G +I E +  +      +I+ V RS ++  H L   
Sbjct  1215  IIVETDCLELVKLVAEQGKVMSDLGFLIREIKDLVKGNREIVINKVTRSQSIGCHFLANK  1274

Query  101   AVSQA  87
               S++
Sbjct  1275  GRSES  1279



>ref|XP_003597249.1| hypothetical protein MTR_2g094480 [Medicago truncatula]
Length=165

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 57/151 (38%), Gaps = 6/151 (4%)
 Frame = -3

Query  491  LHSDLPM-----CFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMA  327
            +H + PM     C  DASF  SL R      +      F+ A            + E++ 
Sbjct  13   IHWEKPMRGSYKCNIDASFSSSLNRVGIDICIRDDAGDFVLARTDWFSPLCEVTIGEAVG  72

Query  326  CKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAI-STFNNCIIS  150
                M W+ D     VD   +  ++ +   T+    S +G II  CR     +F N  + 
Sbjct  73   LHTAMQWILDLQFDNVDFVLDSKQVVNSFHTEVDDDSELGCIITACRQLFQDSFQNSHVK  132

Query  149  IVPRSANVIAHSLVVAAVSQASTLY*DSIPS  57
               R AN + H L   A S  S    D +PS
Sbjct  133  FNMRQANGVTHELARVAPSDPSPTIYDDVPS  163



>ref|XP_004293164.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=212

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (43%), Gaps = 5/152 (3%)
 Frame = -3

Query  521  AALANTITAQLHSDLP-----MCFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPAC  357
            ++L  T+  Q   + P      C  D +F   + R   G V+      F A  G  L   
Sbjct  40   SSLGTTVGRQKKWEKPRHGWYKCSCDGAFVTDIHRGGSGVVIRDEHGQFRAGAGKVLVQV  99

Query  356  SSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAI  177
            +SP  AE +A  EG+   +   I  +   T+C  L   +S     LS +G II E +  +
Sbjct  100  TSPFHAELIALLEGLKLAETLHISKIVFETDCLLLQQAVSQPDTDLSTLGTIIAEVKEFL  159

Query  176  STFNNCIISIVPRSANVIAHSLVVAAVSQAST  81
              + +  +  VP  AN +AH L   A++ + +
Sbjct  160  HRYADFRVLHVPCEANRVAHILANHALNYSES  191



>gb|EEC73134.1| hypothetical protein OsI_07152 [Oryza sativa Indica Group]
Length=647

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 0/118 (0%)
 Frame = -3

Query  464  FDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRGIL  285
             D S+    GR   GAVL       I +  G +  C+  L +E +AC++G+       +L
Sbjct  488  IDGSYGPQDGRGGIGAVLRESFGRVIFSACGFIGRCNGALESELIACRDGLNLALQWTLL  547

Query  284  VVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
             + + ++C E+   L+++  +LS  G I+ E R  ++       + V R+ N ++H L
Sbjct  548  PIAVESDCLEIIQLLNSKEKLLSAEGFIVREIRFLMTGTKEVSFAKVHRNQNRVSHFL  605



>ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis]
 gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis]
Length=329

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 65/147 (44%), Gaps = 3/147 (2%)
 Frame = -3

Query  470  CFFDASF*RSLGRAAFGAVLFSPTSGFIAACGGPLPACSSPLMAESMACKEGMPWLKDRG  291
            C  D +   + GR+ FG V+      F+    G  P   +  +AE++  +E + W+   G
Sbjct  178  CNVDGAVFTASGRSGFGMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREAVQWVLSLG  237

Query  290  ILVVDLHTNCSELWSCLSTQAHILSYVGLIIDECRTAISTFNNCIISIVPRSANVIAHSL  111
               V    +   +   + + A  L   G +I +CR  +    N  +  + + AN++AHSL
Sbjct  238  RSNVIFEYDAKVVVDAVLSGAADLFEFGAVIADCRLLLQHGCNYSVQFIRKQANLVAHSL  297

Query  110  VVAA-VSQASTLY*DSIPSYSISALLP  33
              A+ +     ++  S+P   I  L+P
Sbjct  298  ARASHLQDGFNMF--SVPPDCIRNLVP  322



>ref|XP_003607468.1| hypothetical protein MTR_4g078340 [Medicago truncatula]
Length=181

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 67/160 (42%), Gaps = 3/160 (2%)
 Frame = -3

Query  554  AWRQVHLPRTLA-ALANTITAQLH-SDLPMCFFDASF*RSLGRAAFGAVLFSPTSGFIAA  381
            A +  H P T + +  + IT Q H +    C  DA+F   +     G  +      F+ A
Sbjct  2    AGKSNHQPTTASTSQQHRITWQPHVAGRYKCNIDAAFTSHVNCTCIGICVRDAEGTFVLA  61

Query  380  CGGPLPACSSPLMAESMACKEGMPWLKDRGILVVDLHTNCSELWSCLSTQAHILSYVGLI  201
                 P   S  + E++     + WL D     VD  T+         +  + LS  G I
Sbjct  62   KTMTYPCTVSVDVGEALGMHSALQWLSDMQFDNVDFETDSKLTADAFLSTMNDLSEFGCI  121

Query  200  IDECRTAIST-FNNCIISIVPRSANVIAHSLVVAAVSQAS  84
            I  CR+  ST F+N  +  V + ANV+AH+L     S AS
Sbjct  122  IFSCRSLFSTSFSNFRVEFVRQQANVVAHALTRETTSLAS  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1210457312932