BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78184_g1_i1 len=670 path=[1:0-669]

Length=670
                                                                      Score     E

ref|XP_009600397.1|  PREDICTED: S-type anion channel SLAH2-like         401   2e-133   
ref|XP_009796326.1|  PREDICTED: S-type anion channel SLAH3-like         396   1e-131   
ref|XP_007152105.1|  hypothetical protein PHAVU_004G102800g             395   2e-131   
ref|XP_007152106.1|  hypothetical protein PHAVU_004G102800g             394   3e-131   
ref|XP_011076467.1|  PREDICTED: S-type anion channel SLAH2-like         393   3e-130   
ref|XP_010251595.1|  PREDICTED: S-type anion channel SLAH2-like i...    389   9e-129   
ref|XP_010251593.1|  PREDICTED: S-type anion channel SLAH2-like i...    389   1e-128   
ref|XP_010251594.1|  PREDICTED: S-type anion channel SLAH2-like i...    389   1e-128   
ref|XP_008792390.1|  PREDICTED: S-type anion channel SLAH3-like         382   2e-128   
gb|KEH25755.1|  C4-dicarboxylate transporter/malic acid transporter     381   2e-127   
ref|XP_003549003.1|  PREDICTED: S-type anion channel SLAH3-like         385   2e-127   
ref|XP_004515107.1|  PREDICTED: S-type anion channel SLAH3-like         385   2e-127   
ref|XP_009601842.1|  PREDICTED: S-type anion channel SLAH2-like         384   6e-127   
ref|XP_003533133.1|  PREDICTED: S-type anion channel SLAH3-like         383   6e-127   
emb|CDP19331.1|  unnamed protein product                                383   2e-126   
ref|XP_004240786.1|  PREDICTED: S-type anion channel SLAH2-like         382   2e-126   
ref|XP_010113219.1|  S-type anion channel SLAH3                         377   2e-126   
ref|XP_003619247.1|  hypothetical protein MTR_6g045200                  382   3e-126   
ref|XP_002513622.1|  Tellurite resistance protein tehA, putative        382   3e-126   Ricinus communis
gb|KEH25754.1|  C4-dicarboxylate transporter/malic acid transporter     382   4e-126   
ref|XP_006360208.1|  PREDICTED: S-type anion channel SLAH3-like         382   4e-126   
ref|XP_010105713.1|  S-type anion channel SLAH3                         379   4e-126   
ref|XP_010924777.1|  PREDICTED: S-type anion channel SLAH2-like         382   5e-126   
ref|XP_009805001.1|  PREDICTED: S-type anion channel SLAH2-like         381   6e-126   
ref|XP_010662645.1|  PREDICTED: S-type anion channel SLAH2 isofor...    380   2e-125   
ref|XP_010662647.1|  PREDICTED: S-type anion channel SLAH2 isofor...    380   3e-125   
ref|XP_010662644.1|  PREDICTED: S-type anion channel SLAH2 isofor...    380   3e-125   
ref|XP_010662646.1|  PREDICTED: S-type anion channel SLAH2 isofor...    380   3e-125   
ref|XP_002275623.3|  PREDICTED: S-type anion channel SLAH2 isofor...    380   4e-125   Vitis vinifera
ref|XP_004234208.1|  PREDICTED: S-type anion channel SLAH2              379   5e-125   
gb|KDP22198.1|  hypothetical protein JCGZ_26029                         379   5e-125   
ref|XP_010035185.1|  PREDICTED: S-type anion channel SLAH2-like i...    379   7e-125   
ref|XP_009771156.1|  PREDICTED: S-type anion channel SLAH3-like i...    375   8e-125   
ref|XP_008792391.1|  PREDICTED: S-type anion channel SLAH3-like         379   9e-125   
ref|XP_006366343.1|  PREDICTED: S-type anion channel SLAH3-like         377   9e-125   
ref|XP_010035183.1|  PREDICTED: S-type anion channel SLAH2-like i...    378   1e-124   
ref|XP_004246840.2|  PREDICTED: S-type anion channel SLAH2-like         377   1e-124   
ref|XP_010035184.1|  PREDICTED: S-type anion channel SLAH2-like i...    378   1e-124   
gb|KHN19952.1|  S-type anion channel SLAH3                              389   2e-124   
ref|XP_008802040.1|  PREDICTED: S-type anion channel SLAH2-like i...    374   2e-124   
ref|XP_009771155.1|  PREDICTED: S-type anion channel SLAH2-like i...    376   3e-124   
ref|XP_007038878.1|  SLAC1, putative isoform 2                          374   4e-124   
ref|XP_009399838.1|  PREDICTED: S-type anion channel SLAH2-like         375   1e-123   
gb|KHG12461.1|  S-type anion channel SLAH3 -like protein                375   1e-123   
ref|XP_008802038.1|  PREDICTED: S-type anion channel SLAH2-like i...    375   2e-123   
ref|XP_009406791.1|  PREDICTED: S-type anion channel SLAH2-like i...    374   2e-123   
ref|XP_006366646.1|  PREDICTED: S-type anion channel SLAH3-like i...    375   2e-123   
gb|KEH15794.1|  C4-dicarboxylate transporter/malic acid transporter     372   3e-123   
ref|XP_010915759.1|  PREDICTED: S-type anion channel SLAH3-like i...    372   3e-123   
ref|XP_007038877.1|  SLAC1, putative isoform 1                          374   3e-123   
ref|XP_008805642.1|  PREDICTED: S-type anion channel SLAH3-like i...    371   3e-123   
ref|XP_009406788.1|  PREDICTED: S-type anion channel SLAH2-like i...    374   3e-123   
ref|XP_008437549.1|  PREDICTED: S-type anion channel SLAH2              375   3e-123   
ref|XP_009396559.1|  PREDICTED: S-type anion channel SLAH2-like         374   4e-123   
gb|KGN49909.1|  hypothetical protein Csa_5G139860                       374   7e-123   
ref|XP_010915757.1|  PREDICTED: S-type anion channel SLAH2-like i...    374   7e-123   
ref|XP_007217945.1|  hypothetical protein PRUPE_ppa005062mg             369   7e-123   
ref|XP_007038879.1|  SLAC1 isoform 3                                    371   8e-123   
ref|XP_010917081.1|  PREDICTED: LOW QUALITY PROTEIN: S-type anion...    374   9e-123   
ref|XP_010915756.1|  PREDICTED: S-type anion channel SLAH2-like i...    374   1e-122   
ref|XP_009409437.1|  PREDICTED: S-type anion channel SLAH2-like         373   1e-122   
ref|XP_008805634.1|  PREDICTED: S-type anion channel SLAH2-like i...    373   1e-122   
gb|AES75465.2|  C4-dicarboxylate transporter/malic acid transporter     372   2e-122   
gb|KDO56844.1|  hypothetical protein CISIN_1g007521mg                   372   3e-122   
ref|XP_006422073.1|  hypothetical protein CICLE_v10006633mg             372   3e-122   
ref|XP_006490606.1|  PREDICTED: S-type anion channel SLAH3-like         372   3e-122   
ref|XP_007218680.1|  hypothetical protein PRUPE_ppa014635mg             366   6e-122   
ref|XP_008234895.1|  PREDICTED: S-type anion channel SLAH2-like         370   1e-121   
ref|XP_008795197.1|  PREDICTED: S-type anion channel SLAH2-like         370   1e-121   
gb|EYU25173.1|  hypothetical protein MIMGU_mgv1a003915mg                368   2e-121   
emb|CEH19766.1|  S-type anion channel                                   368   2e-121   
ref|XP_008234276.1|  PREDICTED: S-type anion channel SLAH3-like         368   5e-121   
ref|XP_007219599.1|  hypothetical protein PRUPE_ppa023038mg             368   5e-121   
ref|XP_003619241.1|  C4-dicarboxylate transporter/malic acid tran...    374   6e-121   
ref|XP_010925809.1|  PREDICTED: S-type anion channel SLAH2-like         368   9e-121   
gb|EYU19607.1|  hypothetical protein MIMGU_mgv1a018786mg                360   1e-120   
ref|XP_011047744.1|  PREDICTED: S-type anion channel SLAH2-like         367   4e-120   
ref|XP_008234809.1|  PREDICTED: S-type anion channel SLAH2-like         365   6e-120   
ref|XP_003548133.1|  PREDICTED: S-type anion channel SLAH3-like         362   6e-119   
ref|XP_011084472.1|  PREDICTED: S-type anion channel SLAH2              362   4e-118   
ref|XP_008380319.1|  PREDICTED: S-type anion channel SLAH2-like         359   6e-118   
ref|XP_010671574.1|  PREDICTED: S-type anion channel SLAH2-like         360   7e-118   
ref|XP_010519469.1|  PREDICTED: S-type anion channel SLAH3              362   8e-118   
ref|XP_008792389.1|  PREDICTED: S-type anion channel SLAH3-like         354   2e-117   
ref|XP_009375560.1|  PREDICTED: S-type anion channel SLAH2-like i...    358   2e-117   
ref|NP_001043099.1|  Os01g0385400                                       359   4e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008380328.1|  PREDICTED: S-type anion channel SLAH2-like         358   7e-117   
ref|XP_008376666.1|  PREDICTED: S-type anion channel SLAH2-like         357   1e-116   
ref|XP_006842896.1|  hypothetical protein AMTR_s00075p00061010          357   6e-116   
ref|XP_003569388.1|  PREDICTED: S-type anion channel SLAH2-like         355   1e-115   
ref|NP_001043615.2|  Os01g0623200                                       352   1e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008362829.1|  PREDICTED: LOW QUALITY PROTEIN: S-type anion...    361   2e-115   
ref|XP_006644384.1|  PREDICTED: S-type anion channel SLAH3-like         355   3e-115   
ref|XP_004960632.1|  PREDICTED: S-type anion channel SLAH3-like         354   3e-115   
ref|XP_009416718.1|  PREDICTED: S-type anion channel SLAH2-like         355   3e-115   
ref|XP_009375559.1|  PREDICTED: S-type anion channel SLAH2-like i...    359   4e-115   
dbj|BAK05767.1|  predicted protein                                      352   5e-115   
ref|XP_003568730.1|  PREDICTED: S-type anion channel SLAH3-like         352   1e-114   
dbj|BAJ99263.1|  predicted protein                                      352   1e-114   
gb|KHN47269.1|  S-type anion channel SLAH3                              346   2e-114   
dbj|BAD81510.1|  unknown protein                                        351   3e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55010.1|  hypothetical protein OsJ_02656                          352   3e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655105.1|  PREDICTED: S-type anion channel SLAH3-like         350   3e-114   
dbj|BAD81509.1|  unknown protein                                        352   3e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EMT08868.1|  Tellurite resistance protein tehA                       351   4e-114   
ref|NP_001042466.1|  Os01g0226600                                       351   4e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EPS60679.1|  hypothetical protein M569_14123                         341   5e-114   
ref|XP_010493534.1|  PREDICTED: S-type anion channel SLAH3 isofor...    349   5e-114   
gb|EEE54151.1|  hypothetical protein OsJ_00957                          353   7e-114   Oryza sativa Japonica Group [Japonica rice]
emb|CDX87147.1|  BnaC09g04620D                                          350   8e-114   
emb|CDX80404.1|  BnaC07g30400D                                          351   8e-114   
ref|XP_010454687.1|  PREDICTED: S-type anion channel SLAH3-like         351   8e-114   
dbj|BAD61172.1|  hypothetical protein                                   352   9e-114   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92320.1|  predicted protein                                      350   9e-114   
ref|XP_010233020.1|  PREDICTED: LOW QUALITY PROTEIN: S-type anion...    350   9e-114   
ref|XP_009150932.1|  PREDICTED: S-type anion channel SLAH3              350   1e-113   
ref|XP_006587259.1|  PREDICTED: S-type anion channel SLAH3-like         347   1e-113   
ref|XP_006287257.1|  hypothetical protein CARUB_v10000447mg             350   1e-113   
ref|XP_003619272.1|  C4-dicarboxylate transporter/malic acid tran...    345   1e-113   
gb|EMT23557.1|  hypothetical protein F775_13413                         347   1e-113   
ref|XP_009141862.1|  PREDICTED: S-type anion channel SLAH3-like         350   1e-113   
emb|CDM82604.1|  unnamed protein product                                349   1e-113   
ref|XP_010421211.1|  PREDICTED: S-type anion channel SLAH3-like         350   2e-113   
ref|XP_010493533.1|  PREDICTED: S-type anion channel SLAH3 isofor...    349   2e-113   
ref|XP_006394661.1|  hypothetical protein EUTSA_v10003801mg             350   3e-113   
gb|EPS70633.1|  c4-dicarboxylate transporter/malic acid transport...    342   3e-113   
gb|EEC70218.1|  hypothetical protein OsI_00977                          352   4e-113   Oryza sativa Indica Group [Indian rice]
gb|EMS54349.1|  S-type anion channel SLAH3                              350   4e-113   
ref|XP_004309170.1|  PREDICTED: uncharacterized protein LOC101302316    362   4e-113   
ref|XP_002874159.1|  C4-dicarboxylate transporter/malic acid tran...    348   1e-112   
ref|XP_008656672.1|  PREDICTED: S-type anion channel SLAH2-like i...    347   3e-112   
gb|EMT25796.1|  Tellurite resistance protein tehA                       346   3e-112   
ref|NP_197791.1|  SLAC1 homologue 3                                     347   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002458185.1|  hypothetical protein SORBIDRAFT_03g028360          347   3e-112   Sorghum bicolor [broomcorn]
ref|XP_006645664.1|  PREDICTED: S-type anion channel SLAH3-like         348   5e-112   
ref|XP_002439460.1|  hypothetical protein SORBIDRAFT_09g007180          345   7e-112   Sorghum bicolor [broomcorn]
ref|XP_008656670.1|  PREDICTED: S-type anion channel SLAH2-like i...    347   8e-112   
ref|XP_008656671.1|  PREDICTED: S-type anion channel SLAH2-like i...    346   9e-112   
ref|XP_004967438.1|  PREDICTED: S-type anion channel SLAH3-like i...    345   1e-111   
gb|AFW83321.1|  hypothetical protein ZEAMMB73_457129                    346   2e-111   
ref|NP_001054944.1|  Os05g0219900                                       344   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967439.1|  PREDICTED: S-type anion channel SLAH3-like i...    344   2e-111   
ref|NP_001147966.1|  LOC100281575                                       344   2e-111   Zea mays [maize]
gb|AAT47062.1|  unknown protein                                         336   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647808.1|  PREDICTED: LOC100281575 isoform X1                 344   2e-111   
gb|EAY97003.1|  hypothetical protein OsI_18925                          344   3e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_009130091.1|  PREDICTED: S-type anion channel SLAH3-like i...    342   3e-111   
emb|CDX88065.1|  BnaA06g26560D                                          347   3e-111   
ref|XP_008656325.1|  PREDICTED: S-type anion channel SLAH3-like         336   3e-111   
ref|XP_008675325.1|  PREDICTED: S-type anion channel SLAH2-like         344   3e-111   
tpg|DAA58508.1|  TPA: hypothetical protein ZEAMMB73_461258              345   4e-111   
ref|NP_001056453.2|  Os05g0584900                                       335   1e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130088.1|  PREDICTED: S-type anion channel SLAH3-like i...    343   1e-110   
gb|EMS57353.1|  S-type anion channel SLAH3                              342   2e-110   
ref|XP_008673492.1|  PREDICTED: S-type anion channel SLAH3-like i...    343   2e-110   
ref|XP_008673491.1|  PREDICTED: S-type anion channel SLAH3-like i...    343   3e-110   
ref|XP_004969208.1|  PREDICTED: S-type anion channel SLAH3-like i...    342   3e-110   
ref|XP_006589515.1|  PREDICTED: S-type anion channel SLAH3-like         339   4e-110   
tpg|DAA52784.1|  TPA: hypothetical protein ZEAMMB73_023139              343   1e-109   
ref|XP_006284985.1|  hypothetical protein CARUB_v10006291mg             335   4e-109   
ref|XP_010438526.1|  PREDICTED: S-type anion channel SLAH2-like i...    333   2e-108   
ref|XP_006655637.1|  PREDICTED: S-type anion channel SLAH3-like         330   2e-108   
ref|XP_010433282.1|  PREDICTED: S-type anion channel SLAH2-like i...    333   2e-108   
ref|XP_010433284.1|  PREDICTED: S-type anion channel SLAH2-like i...    333   2e-108   
gb|EEE64847.1|  hypothetical protein OsJ_19704                          336   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010438525.1|  PREDICTED: S-type anion channel SLAH2-like i...    333   2e-108   
ref|XP_010448054.1|  PREDICTED: S-type anion channel SLAH2              333   2e-108   
gb|EAY99207.1|  hypothetical protein OsI_21165                          336   3e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_002867476.1|  C4-dicarboxylate transporter/malic acid tran...    333   3e-108   
ref|XP_010537128.1|  PREDICTED: S-type anion channel SLAH2              333   4e-108   
gb|EMS66940.1|  S-type anion channel SLAH2                              335   7e-108   
gb|EMS66941.1|  S-type anion channel SLAH2                              333   7e-108   
ref|XP_010438524.1|  PREDICTED: S-type anion channel SLAH2-like i...    332   1e-107   
gb|EMT04852.1|  hypothetical protein F775_18329                         334   1e-107   
emb|CDY29871.1|  BnaA03g48920D                                          330   1e-107   
ref|NP_567792.1|  SLAC1 homologue 2                                     331   1e-107   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84361.1|  BnaC03g51390D                                          326   4e-107   
ref|XP_004961072.1|  PREDICTED: S-type anion channel SLAH3-like         332   9e-107   
ref|XP_004963969.1|  PREDICTED: S-type anion channel SLAH3-like         330   2e-106   
emb|CDX92855.1|  BnaC07g41130D                                          327   2e-106   
gb|EMS50811.1|  S-type anion channel SLAH2                              327   5e-106   
ref|XP_006413008.1|  hypothetical protein EUTSA_v10024941mg             327   5e-106   
ref|XP_009108675.1|  PREDICTED: S-type anion channel SLAH2              326   6e-106   
emb|CDX97408.1|  BnaC08g12730D                                          326   6e-106   
ref|XP_009144107.1|  PREDICTED: S-type anion channel SLAH2-like i...    325   1e-105   
ref|XP_009144103.1|  PREDICTED: S-type anion channel SLAH2-like i...    325   2e-105   
ref|XP_007143498.1|  hypothetical protein PHAVU_007G076700g             327   2e-105   
ref|XP_009109115.1|  PREDICTED: S-type anion channel SLAH2              325   2e-105   
ref|XP_008674366.1|  PREDICTED: S-type anion channel SLAH2-like         327   3e-105   
emb|CDY14262.1|  BnaA08g13930D                                          327   1e-104   
gb|EMT28041.1|  hypothetical protein F775_17066                         327   2e-104   
ref|XP_002445037.1|  hypothetical protein SORBIDRAFT_07g003180          325   4e-104   Sorghum bicolor [broomcorn]
gb|AFW82091.1|  hypothetical protein ZEAMMB73_104906                    315   6e-104   
emb|CDY19015.1|  BnaC01g20530D                                          325   9e-104   
gb|ADN33779.1|  tellurite resistance protein teha                       321   1e-103   
emb|CDX89215.1|  BnaA01g16780D                                          324   1e-103   
ref|XP_004145909.1|  PREDICTED: S-type anion channel SLAH3-like         320   2e-103   
ref|XP_004173203.1|  PREDICTED: S-type anion channel SLAH3-like         320   2e-103   
gb|EMT13582.1|  hypothetical protein F775_13923                         321   3e-103   
gb|EMT31272.1|  Tellurite resistance tehA-like protein                  318   3e-103   
ref|XP_003565860.1|  PREDICTED: S-type anion channel SLAH2-like         321   3e-103   
gb|EMS67976.1|  S-type anion channel SLAH2                              318   4e-103   
gb|EMT04853.1|  Tellurite resistance protein tehA                       323   5e-103   
gb|EMS54125.1|  S-type anion channel SLAH2                              321   6e-103   
ref|XP_008657529.1|  PREDICTED: S-type anion channel SLAH2-like         316   8e-103   
emb|CDJ26599.1|  unnamed protein product                                317   8e-102   
gb|AFW81265.1|  hypothetical protein ZEAMMB73_921276                    317   1e-101   
ref|XP_002441591.1|  hypothetical protein SORBIDRAFT_09g029910          317   6e-101   Sorghum bicolor [broomcorn]
ref|XP_002440338.1|  hypothetical protein SORBIDRAFT_09g029920          317   7e-101   Sorghum bicolor [broomcorn]
gb|EMT02136.1|  hypothetical protein F775_20255                         311   7e-101   
ref|XP_008650076.1|  PREDICTED: S-type anion channel SLAH2-like         316   1e-100   
ref|NP_001059043.1|  Os07g0181100                                       317   1e-100   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02985.1|  hypothetical protein OsI_25126                          316   2e-100   Oryza sativa Indica Group [Indian rice]
emb|CDM80373.1|  unnamed protein product                                312   4e-100   
ref|XP_001757651.1|  predicted protein                                  306   7e-100   
ref|XP_002984606.1|  hypothetical protein SELMODRAFT_43399              303   3e-98    
ref|XP_002440339.1|  hypothetical protein SORBIDRAFT_09g029930          307   7e-98    Sorghum bicolor [broomcorn]
ref|XP_004963556.1|  PREDICTED: S-type anion channel SLAH3-like         306   9e-98    
ref|XP_002978674.1|  hypothetical protein SELMODRAFT_53394              303   1e-97    
emb|CDP09853.1|  unnamed protein product                                306   3e-97    
ref|XP_002457095.1|  hypothetical protein SORBIDRAFT_03g001113          296   2e-96    Sorghum bicolor [broomcorn]
ref|XP_002450796.1|  hypothetical protein SORBIDRAFT_05g018580          301   3e-96    Sorghum bicolor [broomcorn]
ref|XP_001756387.1|  predicted protein                                  296   1e-95    
gb|EMT26636.1|  Tellurite resistance tehA-like protein                  299   2e-95    
ref|XP_010108084.1|  Guard cell S-type anion channel SLAC1              300   7e-95    
ref|XP_004300729.1|  PREDICTED: guard cell S-type anion channel S...    300   7e-95    
emb|CAB36766.1|  putative protein                                       298   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008657530.1|  PREDICTED: S-type anion channel SLAH3-like         298   9e-95    
ref|XP_011071099.1|  PREDICTED: guard cell S-type anion channel S...    298   2e-94    
gb|EYU26087.1|  hypothetical protein MIMGU_mgv1a018578mg                297   1e-93    
gb|EYU40539.1|  hypothetical protein MIMGU_mgv1a003425mg                297   2e-93    
gb|EMS50810.1|  S-type anion channel SLAH2                              295   6e-93    
ref|XP_002439222.1|  hypothetical protein SORBIDRAFT_09g002500          293   6e-93    Sorghum bicolor [broomcorn]
ref|XP_009765224.1|  PREDICTED: guard cell S-type anion channel S...    293   2e-92    
ref|XP_003608781.1|  Tellurite resistance protein tehA-like protein     293   3e-92    
ref|XP_009601617.1|  PREDICTED: guard cell S-type anion channel S...    293   3e-92    
ref|XP_008671135.1|  PREDICTED: uncharacterized protein LOC103648441    303   9e-92    
ref|XP_002985558.1|  hypothetical protein SELMODRAFT_122390             286   1e-91    
ref|XP_002987012.1|  hypothetical protein SELMODRAFT_125321             286   1e-91    
ref|XP_009384523.1|  PREDICTED: guard cell S-type anion channel S...    291   2e-91    
ref|XP_002965651.1|  hypothetical protein SELMODRAFT_31887              285   6e-91    
ref|XP_006477326.1|  PREDICTED: guard cell S-type anion channel S...    289   1e-90    
gb|KDO63692.1|  hypothetical protein CISIN_1g008007mg                   288   4e-90    
ref|XP_006440459.1|  hypothetical protein CICLE_v10019450mg             288   4e-90    
ref|XP_004515754.1|  PREDICTED: LOW QUALITY PROTEIN: guard cell S...    287   5e-90    
ref|XP_004976557.1|  PREDICTED: guard cell S-type anion channel S...    286   2e-89    
ref|XP_006363742.1|  PREDICTED: guard cell S-type anion channel S...    285   2e-89    
tpg|DAA36386.1|  TPA: hypothetical protein ZEAMMB73_956541              286   2e-89    
ref|XP_007209029.1|  hypothetical protein PRUPE_ppa023220mg             285   3e-89    
emb|CDY44267.1|  BnaC02g41500D                                          286   3e-89    
emb|CDY46973.1|  BnaA02g32730D                                          286   3e-89    
ref|XP_004245686.1|  PREDICTED: guard cell S-type anion channel S...    285   3e-89    
ref|XP_010676623.1|  PREDICTED: guard cell S-type anion channel S...    284   6e-89    
gb|EMT02134.1|  hypothetical protein F775_20254                         283   1e-88    
emb|CBI34796.3|  unnamed protein product                                282   1e-88    
ref|XP_010054795.1|  PREDICTED: guard cell S-type anion channel S...    283   2e-88    
ref|XP_002275215.1|  PREDICTED: guard cell S-type anion channel S...    282   3e-88    Vitis vinifera
gb|KDP25567.1|  hypothetical protein JCGZ_20723                         282   4e-88    
ref|XP_008238713.1|  PREDICTED: guard cell S-type anion channel S...    282   4e-88    
ref|XP_004159524.1|  PREDICTED: guard cell S-type anion channel S...    280   1e-87    
gb|KFK43517.1|  hypothetical protein AALP_AA1G135800                    281   1e-87    
ref|XP_007040040.1|  C4-dicarboxylate transporter/malic acid tran...    281   2e-87    
ref|XP_006304711.1|  hypothetical protein CARUB_v10011981mg             280   2e-87    
ref|XP_006417230.1|  hypothetical protein EUTSA_v10007262mg             279   4e-87    
ref|XP_004147985.1|  PREDICTED: guard cell S-type anion channel S...    279   5e-87    
ref|XP_008448932.1|  PREDICTED: guard cell S-type anion channel S...    279   7e-87    
ref|XP_010494221.1|  PREDICTED: guard cell S-type anion channel S...    278   2e-86    
ref|XP_010458675.1|  PREDICTED: guard cell S-type anion channel S...    278   2e-86    
ref|XP_002446969.1|  hypothetical protein SORBIDRAFT_06g026050          280   2e-86    Sorghum bicolor [broomcorn]
ref|NP_563909.1|  guard cell S-type anion channel SLAC1                 278   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476220.1|  PREDICTED: guard cell S-type anion channel S...    277   2e-86    
ref|XP_009373337.1|  PREDICTED: guard cell S-type anion channel S...    277   3e-86    
ref|XP_009148588.1|  PREDICTED: guard cell S-type anion channel S...    276   4e-86    
ref|XP_002892691.1|  C4-dicarboxylate transporter/malic acid tran...    275   2e-85    
ref|XP_006858025.1|  hypothetical protein AMTR_s00069p00198820          274   2e-85    
ref|XP_010919422.1|  PREDICTED: uncharacterized protein LOC105043544    285   3e-85    
emb|CDY30084.1|  BnaC05g09360D                                          275   4e-85    
ref|XP_008373862.1|  PREDICTED: guard cell S-type anion channel S...    274   5e-85    
gb|EAY95241.1|  hypothetical protein OsI_17060                          274   7e-85    Oryza sativa Indica Group [Indian rice]
emb|CDX98059.1|  BnaA06g08100D                                          273   1e-84    
ref|NP_001053620.1|  Os04g0574700                                       273   1e-84    
ref|XP_006653697.1|  PREDICTED: guard cell S-type anion channel S...    272   2e-84    
ref|XP_010277436.1|  PREDICTED: guard cell S-type anion channel S...    271   6e-84    
ref|XP_010553483.1|  PREDICTED: guard cell S-type anion channel S...    271   9e-84    
ref|XP_002973316.1|  hypothetical protein SELMODRAFT_53336              265   4e-83    
ref|XP_009402069.1|  PREDICTED: guard cell S-type anion channel S...    268   8e-83    
ref|XP_002976588.1|  hypothetical protein SELMODRAFT_52164              263   1e-82    
ref|XP_002509647.1|  Tellurite resistance protein tehA, putative        268   2e-82    
ref|XP_006368733.1|  C4-dicarboxylate transporter/malic acid tran...    256   3e-81    
ref|XP_003581553.1|  PREDICTED: LOW QUALITY PROTEIN: guard cell S...    261   6e-80    
ref|XP_011029367.1|  PREDICTED: LOW QUALITY PROTEIN: guard cell S...    249   7e-78    
ref|XP_008780343.1|  PREDICTED: guard cell S-type anion channel S...    252   2e-76    
gb|EAY75014.1|  hypothetical protein OsI_02913                          238   1e-70    
ref|XP_001765635.1|  predicted protein                                  222   5e-67    
gb|EAZ31709.1|  hypothetical protein OsJ_15858                          226   7e-67    
ref|XP_006363759.1|  PREDICTED: S-type anion channel SLAH1-like         193   6e-56    
ref|XP_001776688.1|  predicted protein                                  189   4e-54    
ref|XP_010539035.1|  PREDICTED: S-type anion channel SLAH4-like i...    186   1e-53    
ref|XP_004238614.1|  PREDICTED: S-type anion channel SLAH4-like         187   3e-53    
gb|KCW46982.1|  hypothetical protein EUGRSUZ_K00789                     186   3e-53    
ref|XP_010539034.1|  PREDICTED: S-type anion channel SLAH4-like i...    186   3e-53    
ref|XP_009418856.1|  PREDICTED: S-type anion channel SLAH1-like         186   3e-53    
ref|XP_006343410.1|  PREDICTED: S-type anion channel SLAH1-like         186   4e-53    
ref|XP_010038597.1|  PREDICTED: S-type anion channel SLAH1-like         186   4e-53    
ref|XP_008775461.1|  PREDICTED: S-type anion channel SLAH1-like         186   5e-53    
ref|XP_010672350.1|  PREDICTED: S-type anion channel SLAH1-like i...    184   5e-53    
ref|XP_004234470.1|  PREDICTED: S-type anion channel SLAH1-like         185   1e-52    
ref|XP_009618955.1|  PREDICTED: S-type anion channel SLAH4-like         185   1e-52    
ref|XP_009760444.1|  PREDICTED: S-type anion channel SLAH4-like         184   2e-52    
ref|XP_004243481.1|  PREDICTED: S-type anion channel SLAH1-like         184   3e-52    
gb|EYU27764.1|  hypothetical protein MIMGU_mgv1a008272mg                184   4e-52    
ref|XP_010672346.1|  PREDICTED: S-type anion channel SLAH1-like i...    184   5e-52    
ref|XP_009409964.1|  PREDICTED: S-type anion channel SLAH1-like         183   9e-52    
emb|CDP07447.1|  unnamed protein product                                182   1e-51    
gb|EMT33432.1|  Ankyrin repeat and zinc finger domain-containing ...    189   1e-51    
ref|XP_010927097.1|  PREDICTED: S-type anion channel SLAH1-like         182   2e-51    
ref|XP_007017679.1|  SLAC1                                              182   2e-51    
ref|XP_010252457.1|  PREDICTED: S-type anion channel SLAH1-like         182   2e-51    
ref|XP_009416903.1|  PREDICTED: S-type anion channel SLAH1-like i...    181   3e-51    
ref|XP_003523559.1|  PREDICTED: S-type anion channel SLAH1-like         179   3e-51    
ref|XP_006435092.1|  hypothetical protein CICLE_v10003716mg             180   4e-51    
gb|KDO54707.1|  hypothetical protein CISIN_1g047294mg                   181   4e-51    
gb|KDO84725.1|  hypothetical protein CISIN_1g043127mg                   181   4e-51    
ref|XP_002269615.1|  PREDICTED: S-type anion channel SLAH1              181   5e-51    
emb|CAN65216.1|  hypothetical protein VITISV_024688                     181   6e-51    
ref|XP_006447585.1|  hypothetical protein CICLE_v10017595mg             180   8e-51    
gb|EEE66679.1|  hypothetical protein OsJ_23328                          181   8e-51    
ref|XP_006473900.1|  PREDICTED: S-type anion channel SLAH1-like         181   1e-50    
gb|KHN45897.1|  S-type anion channel SLAH1                              180   1e-50    
ref|XP_006469665.1|  PREDICTED: S-type anion channel SLAH1-like         180   2e-50    
ref|XP_003605961.1|  Inner membrane transport protein                   179   2e-50    
ref|XP_009798459.1|  PREDICTED: S-type anion channel SLAH1-like         178   3e-50    
ref|XP_009619510.1|  PREDICTED: S-type anion channel SLAH1-like         178   4e-50    
gb|KCW75261.1|  hypothetical protein EUGRSUZ_E04013                     178   5e-50    
dbj|BAJ53181.1|  JHL18I08.15                                            178   6e-50    
ref|XP_008792879.1|  PREDICTED: S-type anion channel SLAH1-like         177   8e-50    
ref|XP_010057909.1|  PREDICTED: S-type anion channel SLAH1-like         177   8e-50    
ref|XP_008466511.1|  PREDICTED: S-type anion channel SLAH4-like         177   9e-50    
ref|XP_009416911.1|  PREDICTED: S-type anion channel SLAH1-like i...    176   1e-49    
gb|AAO42083.1|  unknown protein                                         177   1e-49    
ref|XP_002280770.1|  PREDICTED: S-type anion channel SLAH1              176   2e-49    
ref|XP_010089477.1|  S-type anion channel SLAH1                         177   3e-49    
ref|NP_176418.2|  S-type anion channel SLAH1                            176   3e-49    
ref|XP_007132529.1|  hypothetical protein PHAVU_011G102100g             175   5e-49    
ref|XP_002886482.1|  C4-dicarboxylate transporter/malic acid tran...    176   6e-49    
gb|KHN41237.1|  S-type anion channel SLAH1                              175   6e-49    
ref|XP_009405104.1|  PREDICTED: S-type anion channel SLAH1-like         175   8e-49    
gb|EPS70819.1|  hypothetical protein M569_03940                         174   8e-49    
ref|XP_004144593.1|  PREDICTED: S-type anion channel SLAH1-like         174   1e-48    
ref|XP_009586703.1|  PREDICTED: S-type anion channel SLAH4-like         176   1e-48    
ref|XP_006342228.1|  PREDICTED: S-type anion channel SLAH1-like         175   1e-48    
ref|XP_004147871.1|  PREDICTED: S-type anion channel SLAH1-like         174   1e-48    
ref|XP_008455447.1|  PREDICTED: S-type anion channel SLAH1-like         174   1e-48    
ref|XP_010916110.1|  PREDICTED: S-type anion channel SLAH4-like         174   2e-48    
ref|XP_008784481.1|  PREDICTED: S-type anion channel SLAH1-like         173   3e-48    
ref|XP_010430267.1|  PREDICTED: S-type anion channel SLAH4              173   3e-48    
ref|XP_009113094.1|  PREDICTED: S-type anion channel SLAH1-like         173   4e-48    
ref|XP_003526334.1|  PREDICTED: S-type anion channel SLAH1-like         172   5e-48    
ref|XP_002263520.2|  PREDICTED: S-type anion channel SLAH4              173   6e-48    
ref|XP_006391911.1|  hypothetical protein EUTSA_v10023519mg             172   7e-48    
ref|XP_006301559.1|  hypothetical protein CARUB_v10021993mg             172   7e-48    
ref|XP_004506270.1|  PREDICTED: S-type anion channel SLAH1-like         172   1e-47    
emb|CBI19789.3|  unnamed protein product                                175   1e-47    
gb|EYU32876.1|  hypothetical protein MIMGU_mgv1a022357mg                171   1e-47    
emb|CDY08628.1|  BnaC04g19370D                                          172   1e-47    
ref|XP_009773825.1|  PREDICTED: S-type anion channel SLAH1-like         171   1e-47    
ref|XP_010418208.1|  PREDICTED: S-type anion channel SLAH1 isofor...    172   1e-47    
ref|XP_008782205.1|  PREDICTED: S-type anion channel SLAH4-like         172   1e-47    
ref|XP_010057911.1|  PREDICTED: S-type anion channel SLAH1-like         172   2e-47    
gb|KCW75262.1|  hypothetical protein EUGRSUZ_E04014                     171   2e-47    
ref|XP_009123362.1|  PREDICTED: S-type anion channel SLAH1-like         172   2e-47    
ref|XP_011096154.1|  PREDICTED: S-type anion channel SLAH1              171   2e-47    
gb|KEH36225.1|  C4-dicarboxylate transporter/malic acid protein         171   3e-47    
gb|KCW75263.1|  hypothetical protein EUGRSUZ_E04015                     169   4e-47    
ref|XP_010099185.1|  S-type anion channel SLAH1                         171   4e-47    
ref|XP_010473443.1|  PREDICTED: S-type anion channel SLAH1-like         170   5e-47    
ref|XP_010688641.1|  PREDICTED: S-type anion channel SLAH1-like         170   6e-47    
ref|XP_007017680.1|  SLAC1, putative                                    172   6e-47    
ref|XP_010430269.1|  PREDICTED: S-type anion channel SLAH1-like         170   8e-47    
ref|XP_007136050.1|  hypothetical protein PHAVU_009G013800g             170   8e-47    
ref|XP_010059587.1|  PREDICTED: S-type anion channel SLAH1-like         169   9e-47    
ref|XP_006302426.1|  hypothetical protein CARUB_v10020508mg             169   1e-46    
ref|XP_004967317.1|  PREDICTED: S-type anion channel SLAH1-like         168   1e-46    
ref|XP_010057910.1|  PREDICTED: S-type anion channel SLAH1-like         169   1e-46    
gb|KCW75266.1|  hypothetical protein EUGRSUZ_E04018                     169   1e-46    
ref|NP_001077757.1|  SLAC1 homologue 4                                  169   1e-46    
gb|KCW75269.1|  hypothetical protein EUGRSUZ_E04023                     166   3e-46    
ref|XP_010059593.1|  PREDICTED: S-type anion channel SLAH1-like         168   3e-46    
ref|XP_010418202.1|  PREDICTED: S-type anion channel SLAH4              167   4e-46    
ref|XP_010418209.1|  PREDICTED: S-type anion channel SLAH1 isofor...    167   9e-46    
gb|EMT02625.1|  hypothetical protein F775_02357                         167   1e-45    
ref|XP_009113097.1|  PREDICTED: S-type anion channel SLAH4 isofor...    166   1e-45    
ref|XP_006391912.1|  hypothetical protein EUTSA_v10023540mg             166   1e-45    
ref|XP_010244504.1|  PREDICTED: S-type anion channel SLAH1-like         166   2e-45    
gb|KCW75270.1|  hypothetical protein EUGRSUZ_E04023                     164   2e-45    
ref|XP_009113096.1|  PREDICTED: S-type anion channel SLAH4 isofor...    167   4e-45    
ref|XP_009113095.1|  PREDICTED: S-type anion channel SLAH4 isofor...    167   4e-45    
ref|XP_011083896.1|  PREDICTED: S-type anion channel SLAH4-like         166   4e-45    
ref|XP_006645707.1|  PREDICTED: S-type anion channel SLAH1-like         161   2e-44    
emb|CDY39794.1|  BnaA09g10460D                                          163   2e-44    
ref|XP_002454860.1|  hypothetical protein SORBIDRAFT_03g000220          162   4e-44    
emb|CDY03280.1|  BnaC09g10680D                                          162   5e-44    
ref|XP_009112689.1|  PREDICTED: S-type anion channel SLAH1-like         162   7e-44    
dbj|BAB18323.1|  hypothetical protein                                   161   1e-43    
gb|AAD38288.1|AC007789_14  hypothetical protein                         160   1e-43    
emb|CDY12936.1|  BnaA09g13380D                                          161   1e-43    
ref|XP_002886483.1|  hypothetical protein ARALYDRAFT_338156             167   2e-43    
ref|XP_010533799.1|  PREDICTED: LOW QUALITY PROTEIN: S-type anion...    160   3e-43    
ref|XP_011006456.1|  PREDICTED: S-type anion channel SLAH1-like         159   3e-43    
gb|KHN21216.1|  S-type anion channel SLAH1                              159   6e-43    
ref|XP_011007179.1|  PREDICTED: S-type anion channel SLAH1-like         157   1e-42    
emb|CDM82391.1|  unnamed protein product                                159   1e-42    
ref|XP_003565577.1|  PREDICTED: S-type anion channel SLAH1-like         157   6e-42    
ref|NP_001147344.1|  inner membrane transport protein                   157   6e-42    
ref|XP_007026130.1|  SLAC1, putative                                    157   7e-42    
gb|AFK38422.1|  unknown                                                 157   8e-42    
ref|XP_010686811.1|  PREDICTED: S-type anion channel SLAH4-like         157   9e-42    
ref|XP_003610460.1|  hypothetical protein MTR_4g132400                  154   4e-41    
ref|XP_009421492.1|  PREDICTED: S-type anion channel SLAH1-like         152   3e-40    
gb|KHG00717.1|  S-type anion channel SLAH1 -like protein                151   7e-40    
gb|KDP20720.1|  hypothetical protein JCGZ_21191                         150   1e-39    
gb|AAB60772.1|  EST gb|T43829 comes from this gene                      150   2e-39    
gb|EAZ11241.1|  hypothetical protein OsJ_01095                          150   2e-39    
ref|XP_007153976.1|  hypothetical protein PHAVU_003G080700g             149   5e-39    
ref|XP_003549737.1|  PREDICTED: S-type anion channel SLAH1-like         146   5e-38    
ref|XP_006847273.1|  hypothetical protein AMTR_s00015p00133310          145   2e-37    
gb|ACU23745.1|  unknown                                                 143   1e-36    
gb|KHN35723.1|  S-type anion channel SLAH1                              142   1e-36    
ref|XP_003529644.1|  PREDICTED: S-type anion channel SLAH1-like         142   1e-36    
ref|XP_004507674.1|  PREDICTED: S-type anion channel SLAH1-like         140   8e-36    
gb|AAV43961.1|  hypothetical protein                                    140   2e-35    
gb|KDP24858.1|  hypothetical protein JCGZ_24452                         133   2e-34    
ref|XP_008239980.1|  PREDICTED: S-type anion channel SLAH2-like         128   7e-33    
gb|KCW75267.1|  hypothetical protein EUGRSUZ_E04019                     128   2e-31    
gb|KGN60007.1|  hypothetical protein Csa_3G865420                       123   5e-31    
gb|ACN33554.1|  unknown                                                 122   4e-28    
ref|XP_006386776.1|  hypothetical protein POPTR_0002s21380g             110   4e-25    
gb|KDP24856.1|  hypothetical protein JCGZ_24450                         107   7e-25    
emb|CDY00627.1|  BnaC04g22980D                                          102   4e-23    
ref|WP_034378262.1|  C4-dicarboxylate ABC transporter                   104   5e-23    
gb|EQB21998.1|  Tellurite resistance protein tehA                       104   5e-23    
emb|CDY12933.1|  BnaA09g13410D                                          102   9e-23    
emb|CDY19522.1|  BnaC09g13810D                                          100   2e-22    
emb|CDI01885.1|  Tellurite resistance protein-like permease             101   7e-22    
ref|WP_021132787.1|  C4-dicarboxylate transporter/malic acid tran...  96.7    3e-20    
ref|WP_011221292.1|  C4-dicarboxylate ABC transporter                 96.3    5e-20    
gb|KHN01515.1|  S-type anion channel SLAH3                            92.8    1e-19    
ref|WP_012857809.1|  C4-dicarboxylate ABC transporter                 94.4    2e-19    
ref|WP_014041830.1|  C4-dicarboxylate ABC transporter                 94.0    2e-19    
ref|WP_012728545.1|  C4-dicarboxylate ABC transporter                 93.6    3e-19    
ref|WP_007022766.1|  C4-dicarboxylate ABC transporter                 92.8    6e-19    
ref|WP_036521548.1|  C4-dicarboxylate ABC transporter                 92.4    8e-19    
ref|WP_010321870.1|  C4-dicarboxylate ABC transporter                 89.7    7e-18    
ref|WP_012474895.1|  C4-dicarboxylate ABC transporter                 89.0    1e-17    
ref|WP_012120476.1|  C4-dicarboxylate ABC transporter                 88.6    2e-17    
ref|WP_034290480.1|  C4-dicarboxylate ABC transporter                 88.2    3e-17    
ref|WP_022989584.1|  C4-dicarboxylate ABC transporter                 87.8    3e-17    
ref|WP_019022306.1|  hypothetical protein                             87.4    4e-17    
ref|WP_002726526.1|  C4-dicarboxylate ABC transporter                 87.0    6e-17    
ref|WP_019643069.1|  hypothetical protein                             87.0    7e-17    
ref|WP_018936227.1|  hypothetical protein                             86.7    9e-17    
ref|WP_039675530.1|  C4-dicarboxylate ABC transporter                 86.3    1e-16    
ref|WP_018947637.1|  hypothetical protein                             86.3    1e-16    
ref|WP_028491697.1|  C4-dicarboxylate ABC transporter                 86.3    1e-16    
ref|WP_011957010.1|  C4-dicarboxylate ABC transporter                 86.3    1e-16    
ref|WP_035691127.1|  C4-dicarboxylate ABC transporter                 85.9    2e-16    
ref|WP_019589595.1|  MULTISPECIES: hypothetical protein               85.9    2e-16    
ref|WP_027859274.1|  C4-dicarboxylate ABC transporter                 85.5    2e-16    
ref|WP_011629019.1|  C4-dicarboxylate ABC transporter                 85.5    2e-16    
ref|WP_027694151.1|  C4-dicarboxylate ABC transporter                 84.7    3e-16    
ref|WP_022961495.1|  C4-dicarboxylate ABC transporter                 84.7    4e-16    
ref|WP_006803021.1|  C4-dicarboxylate ABC transporter                 85.1    4e-16    
ref|WP_018870513.1|  hypothetical protein                             84.7    4e-16    
ref|WP_019569811.1|  hypothetical protein                             84.7    4e-16    
ref|WP_024329198.1|  C4-dicarboxylate ABC transporter                 84.7    4e-16    
ref|WP_020394002.1|  hypothetical protein                             84.7    4e-16    
gb|EXJ14587.1|  C4-dicarboxylate transporter/malic acid transport...  84.7    5e-16    
ref|WP_014770281.1|  C4-dicarboxylate ABC transporter                 84.3    6e-16    
ref|WP_006561433.1|  C4-dicarboxylate ABC transporter                 84.3    7e-16    
ref|WP_013840857.1|  C4-dicarboxylate transporter/malic acid tran...  84.0    7e-16    
ref|WP_019591652.1|  hypothetical protein                             83.6    9e-16    
ref|WP_024954386.1|  C4-dicarboxylate ABC transporter                 83.6    1e-15    
ref|WP_026758193.1|  C4-dicarboxylate ABC transporter                 83.6    1e-15    
ref|WP_039442184.1|  C4-dicarboxylate ABC transporter                 83.2    1e-15    
ref|WP_015281468.1|  tellurite resistance protein-like permease       82.8    2e-15    
ref|WP_005334603.1|  C4-dicarboxylate ABC transporter                 82.8    2e-15    
ref|WP_007812890.1|  C4-dicarboxylate ABC transporter                 82.4    2e-15    
ref|WP_014235411.1|  C4-dicarboxylate ABC transporter                 82.8    3e-15    
dbj|BAO44179.1|  tellurite resistance/dicarboxylate transporter, ...  82.0    3e-15    
ref|WP_028878856.1|  hypothetical protein                             81.6    4e-15    
ref|WP_027833237.1|  C4-dicarboxylate ABC transporter                 81.6    5e-15    
ref|WP_036232566.1|  C4-dicarboxylate ABC transporter                 81.6    5e-15    
ref|WP_012505811.1|  C4-dicarboxylate ABC transporter                 81.6    5e-15    
ref|WP_038034582.1|  C4-dicarboxylate ABC transporter                 81.6    5e-15    
ref|WP_019622446.1|  hypothetical protein                             81.3    6e-15    
ref|WP_027337097.1|  C4-dicarboxylate ABC transporter                 81.3    7e-15    
ref|WP_038660176.1|  C4-dicarboxylate ABC transporter                 80.5    1e-14    
ref|WP_013653640.1|  C4-dicarboxylate ABC transporter                 80.5    1e-14    
ref|WP_038533789.1|  C4-dicarboxylate ABC transporter                 80.5    1e-14    
ref|WP_028108022.1|  C4-dicarboxylate ABC transporter                 80.5    1e-14    



>ref|XP_009600397.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana tomentosiformis]
 ref|XP_009600398.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana tomentosiformis]
 ref|XP_009600399.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana tomentosiformis]
 ref|XP_009600400.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana tomentosiformis]
Length=627

 Score =   401 bits (1030),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATSPST+FLHISL++NLVLW ISVAL +IVAFIYALK I YFEAVRREYY
Sbjct  254  SSQAIMWKALATSPSTKFLHISLNMNLVLWCISVALMAIVAFIYALKIIFYFEAVRREYY  313

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH+SLWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  314  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHTSLWYILMTPIFCLELKIYGQWMSGGQRR  373

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVA+P NHL++VGNFVGALLGATMGLKEGPIFF+A+GLAHY+VLFVTLYQRLPTNETL
Sbjct  374  LSKVASPVNHLSVVGNFVGALLGATMGLKEGPIFFYAVGLAHYLVLFVTLYQRLPTNETL  433

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+I+YFIALFL
Sbjct  434  PKELHPVFFLFVAAPSVASMAWAAIQGSFDYGSRISYFIALFL  476



>ref|XP_009796326.1| PREDICTED: S-type anion channel SLAH3-like [Nicotiana sylvestris]
Length=627

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATSPST+FLH+SL++NLVLW ISVAL +IVAFIYALK I YFEAVRREYY
Sbjct  254  SSQAIMWKALATSPSTKFLHVSLNMNLVLWCISVALMAIVAFIYALKIIFYFEAVRREYY  313

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG PPSVT+NLH+SLWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  314  HPIRVNFFFAPWIALLFLALGFPPSVTKNLHTSLWYILMTPIFCLELKIYGQWMSGGQRR  373

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVA+P NHL++VGNFVGALLGA+MGLKEGPIFF+A+GLAHY+VLFVTLYQRLPTNETL
Sbjct  374  LSKVASPVNHLSVVGNFVGALLGASMGLKEGPIFFYAVGLAHYLVLFVTLYQRLPTNETL  433

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+I+YFIALFL
Sbjct  434  PKELHPVFFLFVAAPSVASMAWAAIQGSFDYGSRISYFIALFL  476



>ref|XP_007152105.1| hypothetical protein PHAVU_004G102800g [Phaseolus vulgaris]
 gb|ESW24099.1| hypothetical protein PHAVU_004G102800g [Phaseolus vulgaris]
Length=628

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 208/223 (93%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            +SQAILWKALATSPST+FLHISL +NL+LWIIS+AL +I+   Y LK I YFEAVRREYY
Sbjct  266  TSQAILWKALATSPSTQFLHISLKINLILWIISIALVAIIFTTYLLKMIFYFEAVRREYY  325

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT++LH +LWY+ M PIFCL++KIYGQWMSGGQRR
Sbjct  326  HPIRVNFFFAPWIALLFLALGVPPSVTKDLHHALWYILMIPIFCLEIKIYGQWMSGGQRR  385

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL
Sbjct  386  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  445

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD+AS+IAYFIALFL
Sbjct  446  PKELHPVFFLFVAAPSVASMAWANIQGSFDNASRIAYFIALFL  488



>ref|XP_007152106.1| hypothetical protein PHAVU_004G102800g [Phaseolus vulgaris]
 gb|ESW24100.1| hypothetical protein PHAVU_004G102800g [Phaseolus vulgaris]
Length=596

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 208/223 (93%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            +SQAILWKALATSPST+FLHISL +NL+LWIIS+AL +I+   Y LK I YFEAVRREYY
Sbjct  234  TSQAILWKALATSPSTQFLHISLKINLILWIISIALVAIIFTTYLLKMIFYFEAVRREYY  293

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT++LH +LWY+ M PIFCL++KIYGQWMSGGQRR
Sbjct  294  HPIRVNFFFAPWIALLFLALGVPPSVTKDLHHALWYILMIPIFCLEIKIYGQWMSGGQRR  353

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL
Sbjct  354  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  413

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD+AS+IAYFIALFL
Sbjct  414  PKELHPVFFLFVAAPSVASMAWANIQGSFDNASRIAYFIALFL  456



>ref|XP_011076467.1| PREDICTED: S-type anion channel SLAH2-like [Sesamum indicum]
Length=640

 Score =   393 bits (1010),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 205/223 (92%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALA+S ST+FLH+S  +NLVLWIIS+AL  IVA IYALK I YFEAVRREYY
Sbjct  256  SSQAIMWKALASSASTKFLHVSPDINLVLWIISIALVLIVAIIYALKVIFYFEAVRREYY  315

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALGVPPSV++ LH+SLWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  316  HPIRVNFFFAPWIAFLFLALGVPPSVSQTLHASLWYILMTPIFCLELKIYGQWMSGGQRR  375

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGATMGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  376  LSKVANPSNHLSVVGNFVGALLGATMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  435

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I GSFD  S+IAYFIALFL
Sbjct  436  PKELHPVFFLFVAAPSVASMAWARIQGSFDYGSRIAYFIALFL  478



>ref|XP_010251595.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Nelumbo 
nucifera]
Length=625

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATS ST FLHI+L VNLVLW IS+ L +++  IY+LK ILYFEAVRREYY
Sbjct  266  SSQAILWKTLATSTSTSFLHINLSVNLVLWCISIGLTALILLIYSLKFILYFEAVRREYY  325

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALG PPS+ +NLH++LWY+ M+PIFCL+LKIYGQWMSGGQRR
Sbjct  326  HPIRVNFFFAPWIAFLFLALGAPPSLAKNLHAALWYILMSPIFCLELKIYGQWMSGGQRR  385

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFF++GLAHYIVLFVTLYQRLPTNETL
Sbjct  386  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFSVGLAHYIVLFVTLYQRLPTNETL  445

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S++AYFIALFL
Sbjct  446  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRVAYFIALFL  488



>ref|XP_010251593.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Nelumbo 
nucifera]
Length=635

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATS ST FLHI+L VNLVLW IS+ L +++  IY+LK ILYFEAVRREYY
Sbjct  276  SSQAILWKTLATSTSTSFLHINLSVNLVLWCISIGLTALILLIYSLKFILYFEAVRREYY  335

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALG PPS+ +NLH++LWY+ M+PIFCL+LKIYGQWMSGGQRR
Sbjct  336  HPIRVNFFFAPWIAFLFLALGAPPSLAKNLHAALWYILMSPIFCLELKIYGQWMSGGQRR  395

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFF++GLAHYIVLFVTLYQRLPTNETL
Sbjct  396  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFSVGLAHYIVLFVTLYQRLPTNETL  455

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S++AYFIALFL
Sbjct  456  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRVAYFIALFL  498



>ref|XP_010251594.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Nelumbo 
nucifera]
Length=633

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATS ST FLHI+L VNLVLW IS+ L +++  IY+LK ILYFEAVRREYY
Sbjct  274  SSQAILWKTLATSTSTSFLHINLSVNLVLWCISIGLTALILLIYSLKFILYFEAVRREYY  333

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALG PPS+ +NLH++LWY+ M+PIFCL+LKIYGQWMSGGQRR
Sbjct  334  HPIRVNFFFAPWIAFLFLALGAPPSLAKNLHAALWYILMSPIFCLELKIYGQWMSGGQRR  393

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFF++GLAHYIVLFVTLYQRLPTNETL
Sbjct  394  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFSVGLAHYIVLFVTLYQRLPTNETL  453

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S++AYFIALFL
Sbjct  454  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRVAYFIALFL  496



>ref|XP_008792390.1| PREDICTED: S-type anion channel SLAH3-like [Phoenix dactylifera]
Length=445

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPS  FLH+SL VNLVLW IS+AL   V+ IY+LK I YFE VRREYY
Sbjct  101  SSQAILWKTLATSPSVSFLHVSLTVNLVLWCISLALMGAVSLIYSLKIIFYFETVRREYY  160

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI  LFLALGVPPSV  NLH++LWYV MAPIFCL++KIYGQWMSGGQRR
Sbjct  161  HPIRINFFFAPWIACLFLALGVPPSVAANLHAALWYVLMAPIFCLEIKIYGQWMSGGQRR  220

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFA+GLAHYIVLFVTLYQRLPTNE L
Sbjct  221  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAVGLAHYIVLFVTLYQRLPTNEAL  280

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA MA A+I G F+  SK+AYFIALFL
Sbjct  281  PRDLHPVFFLFVAAPSVACMAWAQICGDFNYGSKMAYFIALFL  323



>gb|KEH25755.1| C4-dicarboxylate transporter/malic acid transporter [Medicago 
truncatula]
Length=492

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPSTEFLHIS  +NL+LW IS  L + V  +Y LK +LYFEAVRREYY
Sbjct  249  SSQAILWKTLATSPSTEFLHISPKINLILWYISTILIATVFAVYILKLLLYFEAVRREYY  308

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH SLWY+ M PIF L+LKIYGQWMSGGQRR
Sbjct  309  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHQSLWYILMVPIFFLELKIYGQWMSGGQRR  368

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGL EGPIFFFA+GLAHYIVLFVTLYQRLPTNETL
Sbjct  369  LSKVANPSNHLSIVGNFVGALLGASMGLVEGPIFFFAVGLAHYIVLFVTLYQRLPTNETL  428

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSFD  S+IAYFIALFL
Sbjct  429  PKELHPVFFLFVAAPSVASMAWAKMQGSFDYGSRIAYFIALFL  471



>ref|XP_003549003.1| PREDICTED: S-type anion channel SLAH3-like [Glycine max]
Length=597

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKALATSPST+FLHISL VNL+LW IS+AL + V  IY LK ILYFEAVRREYY
Sbjct  234  SSQAILWKALATSPSTQFLHISLKVNLILWFISIALVTTVFTIYLLKIILYFEAVRREYY  293

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT++L   LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  294  HPIRVNFFFAPWIALLFLALGVPPSVTKDLLHVLWYILMTPILCLELKIYGQWMSGGQRR  353

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHY V+FVTLYQRLPTNETL
Sbjct  354  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYTVMFVTLYQRLPTNETL  413

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+IAYFIALFL
Sbjct  414  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRIAYFIALFL  456



>ref|XP_004515107.1| PREDICTED: S-type anion channel SLAH3-like [Cicer arietinum]
Length=605

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPST FLHIS  +NL+LW IS+ L + V  +Y LK I YFEAVRREYY
Sbjct  241  SSQAILWKTLATSPSTTFLHISPKINLILWCISMVLVATVFTVYLLKIIFYFEAVRREYY  300

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSV ENLH SLWY+ M P+F L+LKIYGQWMSGGQRR
Sbjct  301  HPIRVNFFFAPWIALLFLALGVPPSVIENLHHSLWYILMVPVFFLELKIYGQWMSGGQRR  360

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL
Sbjct  361  LSKVANPSNHLSIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  420

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD+ S+IAYFIA+FL
Sbjct  421  PKELHPVFFLFVAAPSVASMAWAKIQGSFDNGSRIAYFIAIFL  463



>ref|XP_009601842.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana tomentosiformis]
 ref|XP_009601843.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana tomentosiformis]
Length=612

 Score =   384 bits (986),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 185/223 (83%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATS ST+FLHISL VNLVLW ISVAL +IV+F YALK ILYFEAVRREYY
Sbjct  240  SSQAIMWKALATSSSTKFLHISLDVNLVLWYISVALMAIVSFTYALKIILYFEAVRREYY  299

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG+PPSV +NL  +LWYV M P  CL+LKIYGQWMSGGQRR
Sbjct  300  HPIRVNFFFAPWIALLFLALGLPPSVYQNLPEALWYVLMTPFLCLELKIYGQWMSGGQRR  359

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVG+LLGATMGLKEG IFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  360  LSKVANPSNHLSVVGNFVGSLLGATMGLKEGAIFFFAVGLAHYTVLFVTLYQRLPTNETL  419

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA A I GSFD  ++IAYFIALFL
Sbjct  420  PKDLHPVFFLFVAAPSVASMAWANIQGSFDFGARIAYFIALFL  462



>ref|XP_003533133.1| PREDICTED: S-type anion channel SLAH3-like [Glycine max]
 gb|KHN47267.1| S-type anion channel SLAH3 [Glycine soja]
Length=597

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKALATSPST+FLHISL VNL+LW IS+AL   V  IY LK ILYFEAV REYY
Sbjct  234  SSQAILWKALATSPSTQFLHISLKVNLILWFISIALVITVFTIYLLKIILYFEAVHREYY  293

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLA+GVPPSVT++LH + WY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  294  HPIRVNFFFAPWIALLFLAIGVPPSVTKDLHHAPWYILMTPILCLELKIYGQWMSGGQRR  353

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHYIV+FVTLYQRLPTNETL
Sbjct  354  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVMFVTLYQRLPTNETL  413

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+IAYFIALFL
Sbjct  414  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRIAYFIALFL  456



>emb|CDP19331.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATS ST+FLHIS  VNL LW ISVAL  IV+ IY LK I YFEAVRREYY
Sbjct  263  SSQAIMWKALATSTSTKFLHISPDVNLALWCISVALVVIVSSIYFLKVIFYFEAVRREYY  322

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLALGVPPS++E LH++LWY+ M PIFCL+LKIYGQWMSGG+RR
Sbjct  323  HPIRINFFFAPWIALLFLALGVPPSISEKLHAALWYILMFPIFCLELKIYGQWMSGGKRR  382

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFAIGLAHY+VLFVTLYQRLPTNETL
Sbjct  383  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAIGLAHYMVLFVTLYQRLPTNETL  442

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+IAYFIA+FL
Sbjct  443  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRIAYFIAMFL  485



>ref|XP_004240786.1| PREDICTED: S-type anion channel SLAH2-like [Solanum lycopersicum]
 ref|XP_010321980.1| PREDICTED: S-type anion channel SLAH2-like [Solanum lycopersicum]
 ref|XP_010321981.1| PREDICTED: S-type anion channel SLAH2-like [Solanum lycopersicum]
 ref|XP_010321982.1| PREDICTED: S-type anion channel SLAH2-like [Solanum lycopersicum]
Length=617

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATS ST+FLHISL VNLVLW ISVAL ++VAF YALK I YFEAVRREYY
Sbjct  250  SSQAIMWKALATSSSTKFLHISLDVNLVLWCISVALMAVVAFTYALKIIFYFEAVRREYY  309

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLALGVP SVT+ L  +LWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  310  HPIRINFFFAPWISLLFLALGVPQSVTKTLPIALWYILMTPIFCLELKIYGQWMSGGQRR  369

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP NHL++VGNFVGALLGA+MGLKEGPIFF+A+GLAHY+VLFVTLYQRLPTNETL
Sbjct  370  LSKVANPVNHLSVVGNFVGALLGASMGLKEGPIFFYAVGLAHYVVLFVTLYQRLPTNETL  429

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA A I GSFD  ++I+YFIALFL
Sbjct  430  PKDLHPVFFLFVAAPSVASMAWATIQGSFDYGARISYFIALFL  472



>ref|XP_010113219.1| S-type anion channel SLAH3 [Morus notabilis]
 gb|EXC74644.1| S-type anion channel SLAH3 [Morus notabilis]
Length=471

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL+LW I++AL   V  IY LK ILYFEAVRREYY
Sbjct  109  SSQAIMWKTLATSASTKFLHLSLTINLILWYIAIALVVAVFSIYLLKVILYFEAVRREYY  168

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSV + LH +LWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  169  HPIRVNFFFAPWISLLFLALGVPPSVAKTLHPALWYIMMTPIFCLELKIYGQWMSGGQRR  228

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTN+TL
Sbjct  229  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNKTL  288

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSFD+ S+IAYFIALFL
Sbjct  289  PKELHPVFFLFVAAPSVASMAWAKLKGSFDNGSRIAYFIALFL  331



>ref|XP_003619247.1| hypothetical protein MTR_6g045200 [Medicago truncatula]
Length=605

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPSTEFLHIS  +NL+LW IS  L + V  +Y LK +LYFEAVRREYY
Sbjct  240  SSQAILWKTLATSPSTEFLHISPKINLILWYISTILIATVFAVYILKLLLYFEAVRREYY  299

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH SLWY+ M PIF L+LKIYGQWMSGGQRR
Sbjct  300  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHQSLWYILMVPIFFLELKIYGQWMSGGQRR  359

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGL EGPIFFFA+GLAHYIVLFVTLYQRLPTNETL
Sbjct  360  LSKVANPSNHLSIVGNFVGALLGASMGLVEGPIFFFAVGLAHYIVLFVTLYQRLPTNETL  419

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSFD  S+IAYFIALFL
Sbjct  420  PKELHPVFFLFVAAPSVASMAWAKMQGSFDYGSRIAYFIALFL  462



>ref|XP_002513622.1| Tellurite resistance protein tehA, putative [Ricinus communis]
 gb|EEF49025.1| Tellurite resistance protein tehA, putative [Ricinus communis]
Length=616

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK +ATSPST+FLH+S + NLVLW IS+AL  +VA  Y LK ILYFEAVRREYY
Sbjct  250  SSQAIMWKTMATSPSTKFLHVSPNANLVLWCISLALLVLVACTYMLKMILYFEAVRREYY  309

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT NL + LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  310  HPIRVNFFFAPWIALLFLALGVPPSVTNNLPACLWYILMTPFLCLELKIYGQWMSGGQRR  369

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  370  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  429

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  430  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYFIALFL  472



>gb|KEH25754.1| C4-dicarboxylate transporter/malic acid transporter [Medicago 
truncatula]
Length=614

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPSTEFLHIS  +NL+LW IS  L + V  +Y LK +LYFEAVRREYY
Sbjct  249  SSQAILWKTLATSPSTEFLHISPKINLILWYISTILIATVFAVYILKLLLYFEAVRREYY  308

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH SLWY+ M PIF L+LKIYGQWMSGGQRR
Sbjct  309  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHQSLWYILMVPIFFLELKIYGQWMSGGQRR  368

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGL EGPIFFFA+GLAHYIVLFVTLYQRLPTNETL
Sbjct  369  LSKVANPSNHLSIVGNFVGALLGASMGLVEGPIFFFAVGLAHYIVLFVTLYQRLPTNETL  428

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSFD  S+IAYFIALFL
Sbjct  429  PKELHPVFFLFVAAPSVASMAWAKMQGSFDYGSRIAYFIALFL  471



>ref|XP_006360208.1| PREDICTED: S-type anion channel SLAH3-like [Solanum tuberosum]
Length=623

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA++WKALATS ST+FLHISL VNLVLW ISV L ++VAF YALK I YFEAVRREYY
Sbjct  250  SSQAVMWKALATSSSTKFLHISLDVNLVLWCISVVLMAVVAFTYALKIIFYFEAVRREYY  309

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLALGVP SVT+ L + LWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  310  HPIRINFFFAPWISLLFLALGVPQSVTKTLPTVLWYILMTPIFCLELKIYGQWMSGGQRR  369

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP NHL++VGNFVGALLGA+MGLKEGPIFF+A+GLAHY+VLFVTLYQRLPTNETL
Sbjct  370  LSKVANPVNHLSVVGNFVGALLGASMGLKEGPIFFYAVGLAHYVVLFVTLYQRLPTNETL  429

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA A I GSFD  S+I+YFIALFL
Sbjct  430  PKDLHPVFFLFVAAPSVASMAWATIKGSFDYGSRISYFIALFL  472



>ref|XP_010105713.1| S-type anion channel SLAH3 [Morus notabilis]
 gb|EXC05933.1| S-type anion channel SLAH3 [Morus notabilis]
Length=544

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 202/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL+LW I++AL   V  IY LK ILYFEAVRREYY
Sbjct  182  SSQAIMWKTLATSASTKFLHLSLTINLILWYIAIALVVAVFSIYLLKVILYFEAVRREYY  241

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSV + LH +LWY+ M PIFCL+LKIYGQWMSGGQRR
Sbjct  242  HPIRVNFFFAPWISLLFLALGVPPSVAKTLHPALWYIMMTPIFCLELKIYGQWMSGGQRR  301

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTN+TL
Sbjct  302  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNKTL  361

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSFD+ S+IAYFIALFL
Sbjct  362  PKELHPVFFLFVAAPSVASMAWAKLQGSFDNGSRIAYFIALFL  404



>ref|XP_010924777.1| PREDICTED: S-type anion channel SLAH2-like [Elaeis guineensis]
Length=626

 Score =   382 bits (980),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LAT+PS  FLH+SL VN VLW IS+AL S V+ +Y+LK I YFE VRREYY
Sbjct  282  SSQAILWKTLATAPSMSFLHVSLTVNFVLWCISLALMSTVSLMYSLKIIFYFETVRREYY  341

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR+NFFFAPWI  LFL LGVPPSV ENLH +LWY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  342  HPVRINFFFAPWIACLFLVLGVPPSVAENLHPALWYALMAPIFCLELKIYGQWMSGGQRR  401

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHYIVLFVTLYQRLPTNETL
Sbjct  402  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYIVLFVTLYQRLPTNETL  461

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA MA AKI G F+  +K+AYFIALFL
Sbjct  462  PRDLHPVFFLFVAAPSVACMAWAKICGDFNYGAKMAYFIALFL  504



>ref|XP_009805001.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana sylvestris]
 ref|XP_009805002.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana sylvestris]
 ref|XP_009805003.1| PREDICTED: S-type anion channel SLAH2-like [Nicotiana sylvestris]
Length=606

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATS +T+FLHISL VNLVLW ISVAL +IV+F YALK I YFEAVRREYY
Sbjct  240  SSQAIMWKALATSATTKFLHISLDVNLVLWCISVALMAIVSFTYALKIIFYFEAVRREYY  299

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG+PP+V +NL  +LWYV M P  CL+LKIYGQWMSGGQRR
Sbjct  300  HPIRVNFFFAPWIALLFLALGLPPTVYQNLPEALWYVLMTPFLCLELKIYGQWMSGGQRR  359

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVG+LLGATMGLKEG IFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  360  LSKVANPSNHLSVVGNFVGSLLGATMGLKEGAIFFFAVGLAHYTVLFVTLYQRLPTNETL  419

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA A I GSFD  ++IAYFIALFL
Sbjct  420  PKDLHPVFFLFVAAPSVASMAWANIQGSFDFGARIAYFIALFL  462



>ref|XP_010662645.1| PREDICTED: S-type anion channel SLAH2 isoform X3 [Vitis vinifera]
Length=634

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATSPS  FLH+S +VN  LW IS AL +IV+FIY LK I YFEAVRREYY
Sbjct  273  SSQAIMWKTLATSPSMNFLHVSSNVNFSLWCISAALIAIVSFIYLLKVIFYFEAVRREYY  332

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALGVPPSV E+L  +LWY+ M P+FC +LKIYGQWMSGGQRR
Sbjct  333  HPIRVNFFFAPWIAFLFLALGVPPSVAEHLPPALWYILMTPVFCFELKIYGQWMSGGQRR  392

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN TL
Sbjct  393  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNATL  452

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  KI GSFD  S+IAYFIALFL
Sbjct  453  PKELHPVFFLFVAAPSVASMAWTKIQGSFDYGSRIAYFIALFL  495



>ref|XP_010662647.1| PREDICTED: S-type anion channel SLAH2 isoform X5 [Vitis vinifera]
 ref|XP_010662648.1| PREDICTED: S-type anion channel SLAH2 isoform X5 [Vitis vinifera]
 ref|XP_010662649.1| PREDICTED: S-type anion channel SLAH2 isoform X5 [Vitis vinifera]
 emb|CBI22602.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATSPS  FLH+S +VN  LW IS AL +IV+FIY LK I YFEAVRREYY
Sbjct  266  SSQAIMWKTLATSPSMNFLHVSSNVNFSLWCISAALIAIVSFIYLLKVIFYFEAVRREYY  325

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALGVPPSV E+L  +LWY+ M P+FC +LKIYGQWMSGGQRR
Sbjct  326  HPIRVNFFFAPWIAFLFLALGVPPSVAEHLPPALWYILMTPVFCFELKIYGQWMSGGQRR  385

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN TL
Sbjct  386  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNATL  445

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  KI GSFD  S+IAYFIALFL
Sbjct  446  PKELHPVFFLFVAAPSVASMAWTKIQGSFDYGSRIAYFIALFL  488



>ref|XP_010662644.1| PREDICTED: S-type anion channel SLAH2 isoform X2 [Vitis vinifera]
Length=638

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATSPS  FLH+S +VN  LW IS AL +IV+FIY LK I YFEAVRREYY
Sbjct  277  SSQAIMWKTLATSPSMNFLHVSSNVNFSLWCISAALIAIVSFIYLLKVIFYFEAVRREYY  336

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALGVPPSV E+L  +LWY+ M P+FC +LKIYGQWMSGGQRR
Sbjct  337  HPIRVNFFFAPWIAFLFLALGVPPSVAEHLPPALWYILMTPVFCFELKIYGQWMSGGQRR  396

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN TL
Sbjct  397  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNATL  456

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  KI GSFD  S+IAYFIALFL
Sbjct  457  PKELHPVFFLFVAAPSVASMAWTKIQGSFDYGSRIAYFIALFL  499



>ref|XP_010662646.1| PREDICTED: S-type anion channel SLAH2 isoform X4 [Vitis vinifera]
Length=632

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATSPS  FLH+S +VN  LW IS AL +IV+FIY LK I YFEAVRREYY
Sbjct  271  SSQAIMWKTLATSPSMNFLHVSSNVNFSLWCISAALIAIVSFIYLLKVIFYFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALGVPPSV E+L  +LWY+ M P+FC +LKIYGQWMSGGQRR
Sbjct  331  HPIRVNFFFAPWIAFLFLALGVPPSVAEHLPPALWYILMTPVFCFELKIYGQWMSGGQRR  390

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN TL
Sbjct  391  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNATL  450

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  KI GSFD  S+IAYFIALFL
Sbjct  451  PKELHPVFFLFVAAPSVASMAWTKIQGSFDYGSRIAYFIALFL  493



>ref|XP_002275623.3| PREDICTED: S-type anion channel SLAH2 isoform X1 [Vitis vinifera]
Length=648

 Score =   380 bits (976),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATSPS  FLH+S +VN  LW IS AL +IV+FIY LK I YFEAVRREYY
Sbjct  287  SSQAIMWKTLATSPSMNFLHVSSNVNFSLWCISAALIAIVSFIYLLKVIFYFEAVRREYY  346

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLALGVPPSV E+L  +LWY+ M P+FC +LKIYGQWMSGGQRR
Sbjct  347  HPIRVNFFFAPWIAFLFLALGVPPSVAEHLPPALWYILMTPVFCFELKIYGQWMSGGQRR  406

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN TL
Sbjct  407  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNATL  466

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  KI GSFD  S+IAYFIALFL
Sbjct  467  PKELHPVFFLFVAAPSVASMAWTKIQGSFDYGSRIAYFIALFL  509



>ref|XP_004234208.1| PREDICTED: S-type anion channel SLAH2 [Solanum lycopersicum]
 ref|XP_010317498.1| PREDICTED: S-type anion channel SLAH2 [Solanum lycopersicum]
Length=612

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATS ST+FLHIS+ VNLVLW ISV L +IV F YALK I YFEAVRREYY
Sbjct  244  SSQAIMWKALATSASTKFLHISMDVNLVLWWISVVLMAIVTFTYALKIIFYFEAVRREYY  303

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG+PPSV +NL  +LWYV M P  CL+LKIYGQWMSGGQRR
Sbjct  304  HPIRVNFFFAPWIALLFLALGLPPSVYQNLPHALWYVLMTPFLCLELKIYGQWMSGGQRR  363

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVG+LLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  364  LSKVANPSNHLSVVGNFVGSLLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  423

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  ++IAYFIALFL
Sbjct  424  PKELHPVFFLFVAAPSVASMAWANIQGSFDFGARIAYFIALFL  466



>gb|KDP22198.1| hypothetical protein JCGZ_26029 [Jatropha curcas]
Length=603

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LA+S ST+FLHIS H+NLVLW ISVAL  IVA IY LK ILYFEAVRREYY
Sbjct  239  SSQAIMWKTLASSASTKFLHISPHINLVLWCISVALVVIVAAIYLLKVILYFEAVRREYY  298

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVP S+T  L ++LWYV MAPI  L+LKIYGQWMSGGQRR
Sbjct  299  HPIRVNFFFAPWIALLFLALGVPSSITNTLPTALWYVLMAPILVLELKIYGQWMSGGQRR  358

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  359  LSRVANPSNHLSIVGNFVGALLGASMGLKEGPLFFFAVGLAHYTVLFVTLYQRLPTNETL  418

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I GSFD  S+IAYFIALFL
Sbjct  419  PKELHPVFFLFVAAPSVASMAWARIQGSFDYGSRIAYFIALFL  461



>ref|XP_010035185.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Eucalyptus 
grandis]
 gb|KCW46479.1| hypothetical protein EUGRSUZ_K00304 [Eucalyptus grandis]
Length=612

 Score =   379 bits (972),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS S +FLHI   +NLVLW IS+AL  +V  IY LK I YFEAVRREYY
Sbjct  240  SSQAIMWKTLATSESMKFLHIDPRINLVLWCISIALVVVVFSIYLLKLIFYFEAVRREYY  299

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFL  GVPPSV  NLH+SLWYV M PIFCL+LKIYGQWMSGGQRR
Sbjct  300  HPIRVNFFFAPWIALLFLVQGVPPSVATNLHASLWYVLMTPIFCLELKIYGQWMSGGQRR  359

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  360  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPLFFFAVGLAHYTVLFVTLYQRLPTNETL  419

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  420  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYFIALFL  462



>ref|XP_009771156.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Nicotiana 
sylvestris]
Length=528

 Score =   375 bits (964),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST FLH+SL  NL LW IS AL +I++ +YALK I YFEA+RREYY
Sbjct  170  SSQAIMWKNLATSASTNFLHMSLKANLGLWGISAALMAIISVVYALKIIFYFEAIRREYY  229

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVP SVT+NLH+SLWY+ MAPIFCL+LKIYGQWMSGGQRR
Sbjct  230  HPIRVNFFFAPWIALLFLALGVPASVTQNLHTSLWYILMAPIFCLELKIYGQWMSGGQRR  289

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNF G+LLG +MGL EGPIFFFA+GLAHYIV+FVTLYQRLPTNETL
Sbjct  290  LSKVANPSNHLSIVGNFGGSLLGESMGLTEGPIFFFAVGLAHYIVMFVTLYQRLPTNETL  349

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA   I GSFD  S+I+YF+ALFL
Sbjct  350  PKELHPVFFLFVAAPSVASMAWTTIQGSFDHGSRISYFVALFL  392



>ref|XP_008792391.1| PREDICTED: S-type anion channel SLAH3-like [Phoenix dactylifera]
Length=622

 Score =   379 bits (972),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPS  FLH++L VNLVLW IS+A+   V+ IY+LK I YFEAVRREYY
Sbjct  276  SSQAILWKTLATSPSMSFLHVNLTVNLVLWCISLAVIGTVSLIYSLKIIFYFEAVRREYY  335

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR+NFFFAPWI  LFLALGVPPSV  NLH++LWYV MAPIFCL+LKIYGQWMSGGQRR
Sbjct  336  HPVRINFFFAPWIAGLFLALGVPPSVAVNLHAALWYVLMAPIFCLELKIYGQWMSGGQRR  395

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPT ETL
Sbjct  396  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTTETL  455

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P+ELHPVFFLFVAAPSVA +A AKI G FD   +IAYFIA+FL
Sbjct  456  PRELHPVFFLFVAAPSVACVAWAKIRGDFDYGPRIAYFIAMFL  498



>ref|XP_006366343.1| PREDICTED: S-type anion channel SLAH3-like [Solanum tuberosum]
Length=581

 Score =   377 bits (968),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST FLH+SL  NL LW IS AL  I++F+YALK I YFEAVRREYY
Sbjct  226  SSQAIMWKNLATSASTNFLHVSLKANLGLWCISAALMIIISFVYALKFIFYFEAVRREYY  285

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP+I +LFLALGVP S+T++LH+SLWY+ M PIFCL+LK+YGQWMSGGQRR
Sbjct  286  HPIRVNFFFAPFISLLFLALGVPTSITQHLHTSLWYILMFPIFCLELKLYGQWMSGGQRR  345

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHYIV+FVTLYQRLPTN+TL
Sbjct  346  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYIVMFVTLYQRLPTNDTL  405

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA   I GSFD  S+IAYFIALFL
Sbjct  406  PKELHPVFFLFVAAPSVASMAWTTIQGSFDHGSRIAYFIALFL  448



>ref|XP_010035183.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS S +FLHI   +NLVLW IS+AL  +V  IY LK I YFEAVRREYY
Sbjct  255  SSQAIMWKTLATSESMKFLHIDPRINLVLWCISIALVVVVFSIYLLKLIFYFEAVRREYY  314

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFL  GVPPSV  NLH+SLWYV M PIFCL+LKIYGQWMSGGQRR
Sbjct  315  HPIRVNFFFAPWIALLFLVQGVPPSVATNLHASLWYVLMTPIFCLELKIYGQWMSGGQRR  374

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  375  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPLFFFAVGLAHYTVLFVTLYQRLPTNETL  434

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  435  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYFIALFL  477



>ref|XP_004246840.2| PREDICTED: S-type anion channel SLAH2-like [Solanum lycopersicum]
Length=582

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST FLH+SL  NL LW IS AL  I++FIYALK I YFEAVRREYY
Sbjct  226  SSQAIMWKNLATSASTNFLHVSLKANLGLWCISAALMIIISFIYALKFIFYFEAVRREYY  285

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP+I +LFLALG+P S+T++LH+SLWY+ M PIFCL+LK+YGQWMSGGQRR
Sbjct  286  HPIRVNFFFAPFISLLFLALGLPTSITQHLHTSLWYILMLPIFCLELKLYGQWMSGGQRR  345

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHYIV+FVTLYQRLPTN+TL
Sbjct  346  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYIVMFVTLYQRLPTNDTL  405

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA   I GSFD  S+IAYFIALFL
Sbjct  406  PKELHPVFFLFVAAPSVASMAWTAIQGSFDHGSRIAYFIALFL  448



>ref|XP_010035184.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Eucalyptus 
grandis]
Length=620

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS S +FLHI   +NLVLW IS+AL  +V  IY LK I YFEAVRREYY
Sbjct  248  SSQAIMWKTLATSESMKFLHIDPRINLVLWCISIALVVVVFSIYLLKLIFYFEAVRREYY  307

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFL  GVPPSV  NLH+SLWYV M PIFCL+LKIYGQWMSGGQRR
Sbjct  308  HPIRVNFFFAPWIALLFLVQGVPPSVATNLHASLWYVLMTPIFCLELKIYGQWMSGGQRR  367

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  368  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPLFFFAVGLAHYTVLFVTLYQRLPTNETL  427

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  428  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYFIALFL  470



>gb|KHN19952.1| S-type anion channel SLAH3 [Glycine soja]
Length=1057

 Score =   389 bits (999),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKALATSPST+FLHISL VNL+LW IS+AL + V  IY LK ILYFEAVRREYY
Sbjct  234  SSQAILWKALATSPSTQFLHISLKVNLILWFISIALVTTVFTIYLLKIILYFEAVRREYY  293

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT++LH  LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  294  HPIRVNFFFAPWIALLFLALGVPPSVTKDLHQVLWYILMTPILCLELKIYGQWMSGGQRR  353

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIGLAHY V+FVTLYQRLPTNETL
Sbjct  354  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGLAHYTVMFVTLYQRLPTNETL  413

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+IAYFIALFL
Sbjct  414  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRIAYFIALFL  456


 Score =   362 bits (929),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 196/222 (88%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAILWKA+ATSPST+FLHISL +NL+ W ISVAL + V   Y LK ILYFEAVRREYYH
Sbjct  706  SQAILWKAIATSPSTKFLHISLKINLIFWFISVALTATVFTTYLLKIILYFEAVRREYYH  765

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+RVN+FFAPW+ +LFLA GVPPSVT++L ++LWY+ M PI CL+LKIYGQWMSGG RRL
Sbjct  766  PIRVNYFFAPWVSLLFLAHGVPPSVTKDLPNALWYILMTPILCLELKIYGQWMSGGTRRL  825

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            SKVANP+NHL++VGNFVGALLGA+MGLKEGPIFF+AIGLAHYIV+FVTLYQRLPTNETLP
Sbjct  826  SKVANPTNHLSVVGNFVGALLGASMGLKEGPIFFYAIGLAHYIVVFVTLYQRLPTNETLP  885

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            KELHPVFF+FVA P VASMA A I  SFD  S+I+YFI LFL
Sbjct  886  KELHPVFFMFVAPPVVASMAWASIQDSFDYGSRISYFIGLFL  927



>ref|XP_008802040.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Phoenix 
dactylifera]
Length=525

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA SPS  FLH+SL VN +LW IS+AL + ++ IY+LK I YFE VRREY+
Sbjct  179  SSQAILWKTLAISPSMSFLHVSLTVNFILWCISLALMATISLIYSLKIIFYFETVRREYH  238

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PPSV  N+H++LWYV MAPIFCL+LKIYGQWMSGGQRR
Sbjct  239  HPIRVNFFFAPWIACLFLVLGLPPSVAVNIHAALWYVCMAPIFCLELKIYGQWMSGGQRR  298

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  299  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  358

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVA MA AKI+G FD  S+IAYFIA+FL
Sbjct  359  PKDLHPVFFLFVAAPSVACMAWAKINGDFDYGSRIAYFIAMFL  401



>ref|XP_009771155.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Nicotiana 
sylvestris]
Length=588

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST FLH+SL  NL LW IS AL +I++ +YALK I YFEA+RREYY
Sbjct  230  SSQAIMWKNLATSASTNFLHMSLKANLGLWGISAALMAIISVVYALKIIFYFEAIRREYY  289

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVP SVT+NLH+SLWY+ MAPIFCL+LKIYGQWMSGGQRR
Sbjct  290  HPIRVNFFFAPWIALLFLALGVPASVTQNLHTSLWYILMAPIFCLELKIYGQWMSGGQRR  349

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNF G+LLG +MGL EGPIFFFA+GLAHYIV+FVTLYQRLPTNETL
Sbjct  350  LSKVANPSNHLSIVGNFGGSLLGESMGLTEGPIFFFAVGLAHYIVMFVTLYQRLPTNETL  409

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA   I GSFD  S+I+YF+ALFL
Sbjct  410  PKELHPVFFLFVAAPSVASMAWTTIQGSFDHGSRISYFVALFL  452



>ref|XP_007038878.1| SLAC1, putative isoform 2 [Theobroma cacao]
 gb|EOY23379.1| SLAC1, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   374 bits (960),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA++WK LAT+ ST+FLHISL VNL+LW ISVAL  IV+ IY LK ILYFEAVRREYY
Sbjct  239  SSQAVMWKTLATANSTKFLHISLIVNLILWWISVALVVIVSSIYLLKVILYFEAVRREYY  298

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSV  +L  +LWYV M PIFCL+LKIYGQWMSGGQRR
Sbjct  299  HPIRVNFFFAPWITLLFLALGVPPSVASSLPVALWYVLMTPIFCLELKIYGQWMSGGQRR  358

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGA LGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  359  LSKVANPSNHLSIVGNFVGAQLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  418

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G FD  S+IAYFIALFL
Sbjct  419  PKELHPVFFLFVAAPSVASMAWATIQGFFDYGSRIAYFIALFL  461



>ref|XP_009399838.1| PREDICTED: S-type anion channel SLAH2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399840.1| PREDICTED: S-type anion channel SLAH2-like [Musa acuminata subsp. 
malaccensis]
Length=614

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPST FLHIS  VNLVLW IS+AL  IV+ IY LK I YFEA+RREYY
Sbjct  262  SSQAILWKTLATSPSTSFLHISPTVNLVLWCISLALMGIVSAIYVLKIIFYFEAIRREYY  321

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+G+PPSV  NLH++LWYV MAPIF L+LKIYGQWMSGGQRR
Sbjct  322  HPIRVNFFFAPWIACLFLAIGMPPSVAVNLHAALWYVLMAPIFFLELKIYGQWMSGGQRR  381

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFF+A+GLAHY VLFVTLYQRLPTNETL
Sbjct  382  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFYAVGLAHYTVLFVTLYQRLPTNETL  441

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA MA AKI G F   SKIAYFIALFL
Sbjct  442  PRDLHPVFFLFVAAPSVACMAWAKITGDFGYGSKIAYFIALFL  484



>gb|KHG12461.1| S-type anion channel SLAH3 -like protein [Gossypium arboreum]
Length=592

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ ST+FLHISL VNL+LW ISVAL +IVA IY  K ILYFEAVRREYY
Sbjct  231  SSQAIMWKTLATATSTKFLHISLTVNLILWWISVALVAIVASIYLTKVILYFEAVRREYY  290

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLA+GVPPSV  +L  +LWYV M P  CL+LKIYGQWMSGGQRR
Sbjct  291  HPIRVNFFFAPWISLLFLAIGVPPSVASSLPVALWYVLMTPFLCLELKIYGQWMSGGQRR  350

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  351  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPVFFFAVGLAHYTVLFVTLYQRLPTNETL  410

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  S+IAYFIALFL
Sbjct  411  PKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRIAYFIALFL  453



>ref|XP_008802038.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802039.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
Length=625

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA SPS  FLH+SL VN +LW IS+AL + ++ IY+LK I YFE VRREY+
Sbjct  279  SSQAILWKTLAISPSMSFLHVSLTVNFILWCISLALMATISLIYSLKIIFYFETVRREYH  338

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PPSV  N+H++LWYV MAPIFCL+LKIYGQWMSGGQRR
Sbjct  339  HPIRVNFFFAPWIACLFLVLGLPPSVAVNIHAALWYVCMAPIFCLELKIYGQWMSGGQRR  398

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  399  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  458

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVA MA AKI+G FD  S+IAYFIA+FL
Sbjct  459  PKDLHPVFFLFVAAPSVACMAWAKINGDFDYGSRIAYFIAMFL  501



>ref|XP_009406791.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            S+QAILWKALATSPS  FL++SL VNLVLW IS+ L S V+ IYALK I YFEAVRREYY
Sbjct  242  STQAILWKALATSPSVSFLNVSLTVNLVLWCISLVLMSTVSLIYALKVIFYFEAVRREYY  301

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  GVPPSVTE   +++WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  302  HPVRVNFFFAPWIACLFLVQGVPPSVTETPPAAVWYALMAPIFCLELKIYGQWMSGGQRR  361

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGAL+GA++GLKEGPIFFFA+GLAHY VLFVTLYQRLPTN+TL
Sbjct  362  LSKVANPSNHLSIVGNFVGALVGASLGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNKTL  421

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA A+I+G FD  S+IAYF+A FL
Sbjct  422  PKELHPVFFLFVAAPSVACMAWARINGDFDYGSRIAYFVAFFL  464



>ref|XP_006366646.1| PREDICTED: S-type anion channel SLAH3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366647.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WKALATS ST+FLHIS+ VNLVLW ISV L  IV F YALK I YFEAVRREYY
Sbjct  248  SSQAIMWKALATSASTKFLHISMDVNLVLWWISVVLMVIVTFAYALKIIFYFEAVRREYY  307

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG+PPSV +NL  +LWYV M P  CL+LKIYGQWMSGGQRR
Sbjct  308  HPIRVNFFFAPWIALLFLALGLPPSVYQNLPHALWYVLMTPFLCLELKIYGQWMSGGQRR  367

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVG+LLGA+MGLKEGPIFF A+GLAHY VLFVTLYQRLPTNETL
Sbjct  368  LSKVANPSNHLSVVGNFVGSLLGASMGLKEGPIFFLAVGLAHYTVLFVTLYQRLPTNETL  427

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I GSFD  ++IAYFIALFL
Sbjct  428  PKELHPVFFLFVAAPSVASMAWANIQGSFDFGARIAYFIALFL  470



>gb|KEH15794.1| C4-dicarboxylate transporter/malic acid transporter [Medicago 
truncatula]
Length=525

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSP+TEFLHI+  +NL+LW IS  L + +  +Y LK + YFEAVRREYY
Sbjct  177  SSQAILWKTLATSPTTEFLHITPKINLILWYISAVLIATIFAVYILKLLFYFEAVRREYY  236

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH SLWY+ MAPI  L+LKIYGQWMSGGQRR
Sbjct  237  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHQSLWYILMAPILFLELKIYGQWMSGGQRR  296

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGL EGPIFFFA+GLAHY VLFVTLYQRLPTN TL
Sbjct  297  LSKVANPSNHLSVVGNFVGALLGASMGLIEGPIFFFAVGLAHYTVLFVTLYQRLPTNATL  356

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  357  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYFIALFL  399



>ref|XP_010915759.1| PREDICTED: S-type anion channel SLAH3-like isoform X3 [Elaeis 
guineensis]
Length=535

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATS ST FLH+S  +NLVLW IS+AL   VAFIY+LK I YFEAVRREYY
Sbjct  270  SSQAILWKTLATSSSTVFLHVSPIINLVLWCISLALMGTVAFIYSLKIIFYFEAVRREYY  329

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP V  NLH+++WYV MAPI CL+LK+YGQWMSGG+RR
Sbjct  330  HPIRVNFFFAPWITCLFLTLGLPPIVAVNLHAAVWYVLMAPILCLELKLYGQWMSGGKRR  389

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  390  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  449

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G FD +S+IAYFIALFL
Sbjct  450  PKELHPVFFLFVAAPSVASMAWATIAGEFDYSSRIAYFIALFL  492



>ref|XP_007038877.1| SLAC1, putative isoform 1 [Theobroma cacao]
 gb|EOY23378.1| SLAC1, putative isoform 1 [Theobroma cacao]
Length=601

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA++WK LAT+ ST+FLHISL VNL+LW ISVAL  IV+ IY LK ILYFEAVRREYY
Sbjct  239  SSQAVMWKTLATANSTKFLHISLIVNLILWWISVALVVIVSSIYLLKVILYFEAVRREYY  298

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSV  +L  +LWYV M PIFCL+LKIYGQWMSGGQRR
Sbjct  299  HPIRVNFFFAPWITLLFLALGVPPSVASSLPVALWYVLMTPIFCLELKIYGQWMSGGQRR  358

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGA LGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  359  LSKVANPSNHLSIVGNFVGAQLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  418

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G FD  S+IAYFIALFL
Sbjct  419  PKELHPVFFLFVAAPSVASMAWATIQGFFDYGSRIAYFIALFL  461



>ref|XP_008805642.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Phoenix 
dactylifera]
Length=518

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPST FLH+S  +NLVLW +S+AL   VAFIY+LK I YFEAVRREYY
Sbjct  253  SSQAILWKTLATSPSTTFLHVSPIINLVLWCVSLALMGTVAFIYSLKIIFYFEAVRREYY  312

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP V   LHS+LWYV M PI CL+LKIYGQWMSGG+RR
Sbjct  313  HPIRVNFFFAPWITCLFLTLGLPPIVAVKLHSALWYVLMGPILCLELKIYGQWMSGGKRR  372

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  373  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  432

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVAS A A I G FD  S+IAYFIALFL
Sbjct  433  PKELHPVFFLFVAAPSVASTAWATITGEFDYGSRIAYFIALFL  475



>ref|XP_009406788.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406789.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406790.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=598

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            S+QAILWKALATSPS  FL++SL VNLVLW IS+ L S V+ IYALK I YFEAVRREYY
Sbjct  254  STQAILWKALATSPSVSFLNVSLTVNLVLWCISLVLMSTVSLIYALKVIFYFEAVRREYY  313

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  GVPPSVTE   +++WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  314  HPVRVNFFFAPWIACLFLVQGVPPSVTETPPAAVWYALMAPIFCLELKIYGQWMSGGQRR  373

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGAL+GA++GLKEGPIFFFA+GLAHY VLFVTLYQRLPTN+TL
Sbjct  374  LSKVANPSNHLSIVGNFVGALVGASLGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNKTL  433

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA A+I+G FD  S+IAYF+A FL
Sbjct  434  PKELHPVFFLFVAAPSVACMAWARINGDFDYGSRIAYFVAFFL  476



>ref|XP_008437549.1| PREDICTED: S-type anion channel SLAH2 [Cucumis melo]
Length=629

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL LWIIS+AL   VA  Y LK ILYFEAVRREYY
Sbjct  255  SSQAIMWKTLATSVSTKFLHLSLKINLALWIISIALIVTVASTYLLKLILYFEAVRREYY  314

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLA+GVPPSV  NL  ++WYV M P  CL+LKIYGQWMSGGQRR
Sbjct  315  HPIRVNFFFAPWIALLFLAIGVPPSVATNLPPAIWYVLMTPFLCLELKIYGQWMSGGQRR  374

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIG+AHY+VLFVTLYQRLPTNETL
Sbjct  375  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGIAHYLVLFVTLYQRLPTNETL  434

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA  KI GSFD+AS++ YFIA+FL
Sbjct  435  PKELHPVFFLFIAAPSVASMAWGKIQGSFDNASRMMYFIAMFL  477



>ref|XP_009396559.1| PREDICTED: S-type anion channel SLAH2-like [Musa acuminata subsp. 
malaccensis]
Length=616

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPS  FLH+S  VNLVLW IS+AL   V+FIY+ K I YFEAVRREYY
Sbjct  274  SSQAILWKTLATSPSMSFLHVSPTVNLVLWSISLALMGTVSFIYSCKLIFYFEAVRREYY  333

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLALGVPPSV   L + LWYV MAPI  L+LKIYGQWMSGGQRR
Sbjct  334  HPVRVNFFFAPWIACLFLALGVPPSVAVYLRAGLWYVLMAPILFLELKIYGQWMSGGQRR  393

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHYIVLFVTLYQRLPTNETL
Sbjct  394  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYIVLFVTLYQRLPTNETL  453

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA A+I G F+  SKI YFIALFL
Sbjct  454  PKELHPVFFLFVAAPSVACMAWARIRGDFEHGSKIGYFIALFL  496



>gb|KGN49909.1| hypothetical protein Csa_5G139860 [Cucumis sativus]
Length=629

 Score =   374 bits (960),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL LWIIS+AL   VA  Y LK ILYFEAVRREYY
Sbjct  257  SSQAIMWKTLATSVSTKFLHLSLKINLALWIISIALIVTVASTYLLKLILYFEAVRREYY  316

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLA+GVPPSV  NL   +WYV M P+ CL+LKIYGQWMSGGQRR
Sbjct  317  HPIRINFFFAPWIALLFLAIGVPPSVATNLPPVIWYVLMTPVLCLELKIYGQWMSGGQRR  376

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIG+AHY+VLFVTLYQRLPTNETL
Sbjct  377  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGIAHYLVLFVTLYQRLPTNETL  436

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA  KI GSFD+AS++ YFIA+FL
Sbjct  437  PKELHPVFFLFIAAPSVASMAWGKIQGSFDNASRMMYFIAMFL  479



>ref|XP_010915757.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010915758.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Elaeis 
guineensis]
Length=627

 Score =   374 bits (960),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATS ST FLH+S  +NLVLW IS+AL   VAFIY+LK I YFEAVRREYY
Sbjct  253  SSQAILWKTLATSSSTVFLHVSPIINLVLWCISLALMGTVAFIYSLKIIFYFEAVRREYY  312

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP V  NLH+++WYV MAPI CL+LK+YGQWMSGG+RR
Sbjct  313  HPIRVNFFFAPWITCLFLTLGLPPIVAVNLHAAVWYVLMAPILCLELKLYGQWMSGGKRR  372

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  373  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  432

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G FD +S+IAYFIALFL
Sbjct  433  PKELHPVFFLFVAAPSVASMAWATIAGEFDYSSRIAYFIALFL  475



>ref|XP_007217945.1| hypothetical protein PRUPE_ppa005062mg [Prunus persica]
 gb|EMJ19144.1| hypothetical protein PRUPE_ppa005062mg [Prunus persica]
Length=479

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L+TS S +FLH+SL  NLVLW ISVAL +IVAFIY LK  LYFEAVRREYY
Sbjct  119  SSQAILWKTLSTSASMKFLHLSLMTNLVLWCISVALIAIVAFIYLLKVSLYFEAVRREYY  178

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWIV+LFLALGVPPS   NLH ++WY+ M PI  L+LKIYGQWMSGGQRR
Sbjct  179  HPIRMNFFFAPWIVLLFLALGVPPSFANNLHPAIWYILMTPILGLELKIYGQWMSGGQRR  238

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LS VANP NHLAIVGNFVGALLGA+MGLKEGP+FFFA+GLAHYIVLFVTLYQRLPTNET 
Sbjct  239  LSMVANPFNHLAIVGNFVGALLGASMGLKEGPLFFFAVGLAHYIVLFVTLYQRLPTNETV  298

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA AKI GSFD +S+IAYFIALFL
Sbjct  299  IPKDLHPVFFLFVAAPSVASMAWAKIQGSFDYSSRIAYFIALFL  342



>ref|XP_007038879.1| SLAC1 isoform 3 [Theobroma cacao]
 gb|EOY23380.1| SLAC1 isoform 3 [Theobroma cacao]
Length=542

 Score =   371 bits (952),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA++WK LAT+ ST+FLHISL VNL+LW ISVAL  IV+ IY LK ILYFEAVRREYY
Sbjct  239  SSQAVMWKTLATANSTKFLHISLIVNLILWWISVALVVIVSSIYLLKVILYFEAVRREYY  298

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSV  +L  +LWYV M PIFCL+LKIYGQWMSGGQRR
Sbjct  299  HPIRVNFFFAPWITLLFLALGVPPSVASSLPVALWYVLMTPIFCLELKIYGQWMSGGQRR  358

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGA LGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  359  LSKVANPSNHLSIVGNFVGAQLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  418

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G FD  S+IAYFIALFL
Sbjct  419  PKELHPVFFLFVAAPSVASMAWATIQGFFDYGSRIAYFIALFL  461



>ref|XP_010917081.1| PREDICTED: LOW QUALITY PROTEIN: S-type anion channel SLAH2-like 
[Elaeis guineensis]
Length=626

 Score =   374 bits (959),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA SPS  FLH+SL VNLVLW IS+AL + +  IY LK I +FEAVRREY+
Sbjct  280  SSQAILWKTLAISPSMSFLHVSLTVNLVLWCISLALMATIFLIYFLKIIFFFEAVRREYH  339

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PPSVT N+H+++WYV MAPIFCL+LKIYGQWMSGGQRR
Sbjct  340  HPIRVNFFFAPWIACLFLVLGLPPSVTVNVHAAIWYVLMAPIFCLELKIYGQWMSGGQRR  399

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY V FVTLYQRLPTN TL
Sbjct  400  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVXFVTLYQRLPTNATL  459

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA AKIHG FD  S+IAYFIA+FL
Sbjct  460  PKELHPVFFLFVAAPSVACMAWAKIHGDFDYGSRIAYFIAMFL  502



>ref|XP_010915756.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Elaeis 
guineensis]
Length=644

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATS ST FLH+S  +NLVLW IS+AL   VAFIY+LK I YFEAVRREYY
Sbjct  270  SSQAILWKTLATSSSTVFLHVSPIINLVLWCISLALMGTVAFIYSLKIIFYFEAVRREYY  329

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP V  NLH+++WYV MAPI CL+LK+YGQWMSGG+RR
Sbjct  330  HPIRVNFFFAPWITCLFLTLGLPPIVAVNLHAAVWYVLMAPILCLELKLYGQWMSGGKRR  389

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  390  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  449

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G FD +S+IAYFIALFL
Sbjct  450  PKELHPVFFLFVAAPSVASMAWATIAGEFDYSSRIAYFIALFL  492



>ref|XP_009409437.1| PREDICTED: S-type anion channel SLAH2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009409438.1| PREDICTED: S-type anion channel SLAH2-like [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPS  FLH+S  +NL LW IS+AL  +V+ IY LK I YFEAVRREYY
Sbjct  264  SSQAILWKTLATSPSMTFLHVSPTINLTLWCISLALMGLVSAIYMLKIIFYFEAVRREYY  323

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA+G PPSV   LH+ LWYV MAPIFCL+LKIYGQWMSGGQRR
Sbjct  324  HPVRVNFFFAPWITCLFLAIGAPPSVAVKLHAELWYVLMAPIFCLELKIYGQWMSGGQRR  383

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGA++GLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  384  LSRVANPSNHLSIVGNFVGALLGASLGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNETL  443

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA AKI G+F   SKIAYF ALFL
Sbjct  444  PKELHPVFFLFVAAPSVACMAWAKITGNFGYCSKIAYFTALFL  486



>ref|XP_008805634.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805636.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805637.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805638.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805639.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805640.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805641.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Phoenix 
dactylifera]
Length=627

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPST FLH+S  +NLVLW +S+AL   VAFIY+LK I YFEAVRREYY
Sbjct  253  SSQAILWKTLATSPSTTFLHVSPIINLVLWCVSLALMGTVAFIYSLKIIFYFEAVRREYY  312

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP V   LHS+LWYV M PI CL+LKIYGQWMSGG+RR
Sbjct  313  HPIRVNFFFAPWITCLFLTLGLPPIVAVKLHSALWYVLMGPILCLELKIYGQWMSGGKRR  372

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  373  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  432

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVAS A A I G FD  S+IAYFIALFL
Sbjct  433  PKELHPVFFLFVAAPSVASTAWATITGEFDYGSRIAYFIALFL  475



>gb|AES75465.2| C4-dicarboxylate transporter/malic acid transporter [Medicago 
truncatula]
Length=604

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSP+TEFLHI+  +NL+LW IS  L + +  +Y LK + YFEAVRREYY
Sbjct  240  SSQAILWKTLATSPTTEFLHITPKINLILWYISAVLIATIFAVYILKLLFYFEAVRREYY  299

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH SLWY+ MAPI  L+LKIYGQWMSGGQRR
Sbjct  300  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHQSLWYILMAPILFLELKIYGQWMSGGQRR  359

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGL EGPIFFFA+GLAHY VLFVTLYQRLPTN TL
Sbjct  360  LSKVANPSNHLSVVGNFVGALLGASMGLIEGPIFFFAVGLAHYTVLFVTLYQRLPTNATL  419

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSFD  S+IAYFIALFL
Sbjct  420  PKELHPVFFLFVAAPSVASMAWAKMQGSFDYGSRIAYFIALFL  462



>gb|KDO56844.1| hypothetical protein CISIN_1g007521mg [Citrus sinensis]
Length=600

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATSPST+FLHI   +N VLW ISVAL   ++ IY +K +LYFEAVRREYY
Sbjct  224  SSQAILWKTIATSPSTKFLHIRPEINTVLWFISVALVISISLIYLMKVLLYFEAVRREYY  283

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPW+ +LFLALGVPPS+ E L   LWYV M PI CL+LKIYGQWMSGGQRR
Sbjct  284  HPIRVNFFFAPWVALLFLALGVPPSIHEKLPEWLWYVLMTPILCLELKIYGQWMSGGQRR  343

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGATMG+KEGPI FFAIGLAHY VLFVTLYQRLPTNETL
Sbjct  344  LSKVANPSNHLAVVGNFVGALLGATMGIKEGPILFFAIGLAHYTVLFVTLYQRLPTNETL  403

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSF+  S+IAYFIALFL
Sbjct  404  PKELHPVFFLFVAAPSVASMAWAKMQGSFNYGSRIAYFIALFL  446



>ref|XP_006422073.1| hypothetical protein CICLE_v10006633mg [Citrus clementina]
 gb|ESR35313.1| hypothetical protein CICLE_v10006633mg [Citrus clementina]
Length=624

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATSPST+FLHI   +N VLW ISVAL   ++ IY +K +LYFEAVRREYY
Sbjct  248  SSQAILWKTIATSPSTKFLHIRPEINTVLWFISVALVISISLIYLMKVLLYFEAVRREYY  307

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPW+ +LFLALGVPPS+ E L   LWYV M PI CL+LKIYGQWMSGGQRR
Sbjct  308  HPIRVNFFFAPWVALLFLALGVPPSIHEKLPEWLWYVLMTPILCLELKIYGQWMSGGQRR  367

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGATMG+KEGPI FFAIGLAHY VLFVTLYQRLPTNETL
Sbjct  368  LSKVANPSNHLAVVGNFVGALLGATMGIKEGPILFFAIGLAHYTVLFVTLYQRLPTNETL  427

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSF+  S+IAYFIALFL
Sbjct  428  PKELHPVFFLFVAAPSVASMAWAKMQGSFNYGSRIAYFIALFL  470



>ref|XP_006490606.1| PREDICTED: S-type anion channel SLAH3-like [Citrus sinensis]
Length=626

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATSPST+FLHI   +N VLW ISVAL   ++ IY +K +LYFEAVRREYY
Sbjct  250  SSQAILWKTIATSPSTKFLHIRPEINTVLWFISVALVISISLIYLMKVLLYFEAVRREYY  309

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPW+ +LFLALGVPPS+ E L   LWYV M PI CL+LKIYGQWMSGGQRR
Sbjct  310  HPIRVNFFFAPWVALLFLALGVPPSIHEKLPEWLWYVLMTPILCLELKIYGQWMSGGQRR  369

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGATMG+KEGPI FFAIGLAHY VLFVTLYQRLPTNETL
Sbjct  370  LSKVANPSNHLAVVGNFVGALLGATMGIKEGPILFFAIGLAHYTVLFVTLYQRLPTNETL  429

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AK+ GSF+  S+IAYFIALFL
Sbjct  430  PKELHPVFFLFVAAPSVASMAWAKMQGSFNYGSRIAYFIALFL  472



>ref|XP_007218680.1| hypothetical protein PRUPE_ppa014635mg [Prunus persica]
 gb|EMJ19879.1| hypothetical protein PRUPE_ppa014635mg [Prunus persica]
Length=473

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 198/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L TS ST+FLH+SL  NLVLW +SVAL +IVA IY LK ILYFEAVRREYY
Sbjct  119  SSQAILWKTLPTSASTKFLHLSLIPNLVLWCVSVALVAIVACIYLLKVILYFEAVRREYY  178

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFF+PWI +LFLALGVPPS   NLH +LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  179  HPVRVNFFFSPWIALLFLALGVPPSFANNLHPALWYILMTPILCLELKIYGQWMSGGQRR  238

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY++LFVTLYQRLPTNET 
Sbjct  239  LSKVANPVNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYMILFVTLYQRLPTNETV  298

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA  +I GSF+  S+I YFI+LFL
Sbjct  299  IPKDLHPVFFLFVAAPSVASMAWGRIQGSFNYGSRIFYFISLFL  342



>ref|XP_008234895.1| PREDICTED: S-type anion channel SLAH2-like [Prunus mume]
Length=618

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L+TS S +FLH+SL  NLVLW ISVAL +IVAFIY LK  LYFEAVRREYY
Sbjct  258  SSQAILWKTLSTSASMKFLHLSLMTNLVLWCISVALVAIVAFIYLLKVSLYFEAVRREYY  317

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWIV+LFLALGVPPS   NL  ++WY+ M PI  L+LKIYGQWMSGGQRR
Sbjct  318  HPIRMNFFFAPWIVLLFLALGVPPSFANNLQPAIWYILMTPILGLELKIYGQWMSGGQRR  377

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGLKEGP+FFFA+GLAHYIVLFVTLYQRLPTNET 
Sbjct  378  LSKVANPFNHLAIVGNFVGALLGASMGLKEGPLFFFAVGLAHYIVLFVTLYQRLPTNETV  437

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA AKI GSFD +S+IAYFIALFL
Sbjct  438  IPKDLHPVFFLFVAAPSVASMAWAKIQGSFDYSSRIAYFIALFL  481



>ref|XP_008795197.1| PREDICTED: S-type anion channel SLAH2-like [Phoenix dactylifera]
Length=620

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPS  FL +S  +NL+LW I++AL  IVAFIY+LK I YFEAVRREYY
Sbjct  261  SSQAILWKTLATSPSMSFLRVSPVINLMLWCIALALTGIVAFIYSLKIIFYFEAVRREYY  320

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP +  NLH +LWYV MAP+ CL+LKIYGQWMSGGQRR
Sbjct  321  HPIRVNFFFAPWINCLFLTLGLPPKLAVNLHDALWYVLMAPVLCLELKIYGQWMSGGQRR  380

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  381  LSKVANPSNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  440

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A + G F  +S+IAYFIALFL
Sbjct  441  PKELHPVFFLFVAAPSVASMAWANLTGEFGYSSRIAYFIALFL  483



>gb|EYU25173.1| hypothetical protein MIMGU_mgv1a003915mg [Erythranthe guttata]
Length=555

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK L  S ST +L++S ++NLVLW  S+ALF  V+ IY+LK I +FEAVRREYY
Sbjct  190  SSQAIMWKTLTNSGSTNYLNVSPYINLVLWYTSLALFITVSAIYSLKIIFFFEAVRREYY  249

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLA+GVP SV++ LH SLWY+ MAPI CL++KIYGQWMSGGQRR
Sbjct  250  HPIRVNFFFAPWIALLFLAMGVPNSVSQTLHESLWYILMAPICCLEIKIYGQWMSGGQRR  309

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTN+TL
Sbjct  310  LSKVANPSNHLAVVGNFVGALLGASMGLKEGPIFFFAVGLAHYTVLFVTLYQRLPTNKTL  369

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I GSFD  S+IAYFIALFL
Sbjct  370  PKELHPVFFLFVAAPSVASMAWARIQGSFDYGSRIAYFIALFL  412



>emb|CEH19766.1| S-type anion channel [Populus tremula x Populus tremuloides]
Length=566

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLHIS+ VNLVLW I+VAL  I+  IY LK ILYFEAVRREY 
Sbjct  202  SSQAIMWKTLATSASTKFLHISIDVNLVLWCIAVALVVIIGSIYLLKMILYFEAVRREYG  261

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLA+G+PPS+ E+LH++LWYV M P   L+LKIYGQWMSGGQRR
Sbjct  262  HPIRVNFFFAPWIALLFLAIGMPPSLAEDLHAALWYVLMTPFLILELKIYGQWMSGGQRR  321

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTN+T+
Sbjct  322  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPLFFFAVGLAHYTVLFVTLYQRLPTNQTI  381

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+I YF ALFL
Sbjct  382  PKELHPVFFLFVAAPSVASMAWAKIQGSFDHGSRIPYFTALFL  424



>ref|XP_008234276.1| PREDICTED: S-type anion channel SLAH3-like [Prunus mume]
Length=583

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 198/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L TS ST+FLH+SL  NLVLW ISVAL +IVA IY LK ILYFEAVRREYY
Sbjct  231  SSQAILWKTLPTSASTKFLHLSLIPNLVLWCISVALVAIVACIYLLKVILYFEAVRREYY  290

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFF+PWI +LFLALGVPPS   NLH +LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  291  HPVRVNFFFSPWIALLFLALGVPPSFANNLHPALWYILMTPILCLELKIYGQWMSGGQRR  350

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY+VLFVTLYQRLPTNET 
Sbjct  351  LSKVANPVNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYMVLFVTLYQRLPTNETV  410

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA  +I GSF+  S+I YFI+LFL
Sbjct  411  IPKDLHPVFFLFVAAPSVASMAWGRIQGSFNYGSRIFYFISLFL  454



>ref|XP_007219599.1| hypothetical protein PRUPE_ppa023038mg [Prunus persica]
 gb|EMJ20798.1| hypothetical protein PRUPE_ppa023038mg [Prunus persica]
Length=594

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 198/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L TS ST+FLH+SL  NLVLW ISVAL +IVA IY LK ILYFEAVRREYY
Sbjct  246  SSQAILWKTLPTSASTKFLHLSLIPNLVLWCISVALVAIVACIYLLKVILYFEAVRREYY  305

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFF+PWI +LFLALGVPPS   NLH +LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  306  HPVRVNFFFSPWIALLFLALGVPPSFANNLHPALWYILMTPILCLELKIYGQWMSGGQRR  365

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY+VLFVTLYQRLPTNET 
Sbjct  366  LSKVANPVNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYMVLFVTLYQRLPTNETV  425

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA  +I GSF+  S+I YFI+LFL
Sbjct  426  IPKDLHPVFFLFVAAPSVASMAWGRIQGSFNYGSRIFYFISLFL  469



>ref|XP_003619241.1| C4-dicarboxylate transporter/malic acid transport protein [Medicago 
truncatula]
Length=800

 Score =   374 bits (959),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSP+TEFLHI+  +NL+LW IS  L + +  +Y LK + YFEAVRREYY
Sbjct  452  SSQAILWKTLATSPTTEFLHITPKINLILWYISAVLIATIFAVYILKLLFYFEAVRREYY  511

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPSVT+NLH SLWY+ MAPI  L+LKIYGQWMSGGQRR
Sbjct  512  HPIRVNFFFAPWIALLFLALGVPPSVTKNLHQSLWYILMAPILFLELKIYGQWMSGGQRR  571

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGL EGPIFFFA+GLAHY VLFVTLYQRLPTN TL
Sbjct  572  LSKVANPSNHLSVVGNFVGALLGASMGLIEGPIFFFAVGLAHYTVLFVTLYQRLPTNATL  631

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  632  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYFIALFL  674



>ref|XP_010925809.1| PREDICTED: S-type anion channel SLAH2-like [Elaeis guineensis]
Length=613

 Score =   368 bits (944),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA SPS  FLH+S  +NLVLW IS+AL  IVAFIY+LK I YFEAVRREYY
Sbjct  261  SSQAILWKTLARSPSMSFLHVSPVINLVLWCISLALTGIVAFIYSLKIIFYFEAVRREYY  320

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL LG+PP V  NLH +LWYV MAPI  L+LKIYGQWMSGGQRR
Sbjct  321  HPIRVNFFFAPWINCLFLTLGLPPVVAVNLHGALWYVLMAPILFLELKIYGQWMSGGQRR  380

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  381  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPIFFFAVGLAHYSVLFVTLYQRLPTNETL  440

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A I G F   S+IAYFIALFL
Sbjct  441  PKELHPVFFLFVAAPSVASMAWANISGEFGYGSRIAYFIALFL  483



>gb|EYU19607.1| hypothetical protein MIMGU_mgv1a018786mg [Erythranthe guttata]
Length=398

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT  S +FLH+   ++ +LW  S+AL  +VA +YALK I YFEAVRREYY
Sbjct  32   SSQAIMWKTLATVKSVKFLHVDPTISSILWFASIALTVVVAIVYALKLIFYFEAVRREYY  91

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG PP V+   H S+WY+ M PIF L+LKIYGQWMSGGQRR
Sbjct  92   HPIRVNFFFAPWIALLFLALGAPPEVSRTFHVSMWYILMTPIFVLELKIYGQWMSGGQRR  151

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFFA+G+AHY VLFVTLYQRLPTNETL
Sbjct  152  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFAVGMAHYTVLFVTLYQRLPTNETL  211

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I GSFD  S++AYFIA+FL
Sbjct  212  PKELHPVFFLFVAAPSVASMAWARIQGSFDYGSRVAYFIAMFL  254



>ref|XP_011047744.1| PREDICTED: S-type anion channel SLAH2-like [Populus euphratica]
Length=625

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/222 (79%), Positives = 196/222 (88%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAI+WK LATS ST+FLHIS+ VNLVLW I+VAL  I+  IY LK ILYFEAVR EYYH
Sbjct  262  SQAIMWKTLATSASTKFLHISIDVNLVLWCIAVALVVIIGSIYLLKMILYFEAVRCEYYH  321

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+RVNFFFAPWI +LFLA+G+PPS+ ++LH+ LWYV M P   L++KIYGQWMSGGQRRL
Sbjct  322  PIRVNFFFAPWIALLFLAIGMPPSLVKDLHAGLWYVLMTPFLILEIKIYGQWMSGGQRRL  381

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            SKVANP+NHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETLP
Sbjct  382  SKVANPTNHLSIVGNFVGALLGASMGLKEGPLFFFAVGLAHYTVLFVTLYQRLPTNETLP  441

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            KELHPVFFLFVAAPSVASMA A I GSFD  S+I YFIALFL
Sbjct  442  KELHPVFFLFVAAPSVASMAWANIQGSFDHGSRIPYFIALFL  483



>ref|XP_008234809.1| PREDICTED: S-type anion channel SLAH2-like [Prunus mume]
Length=594

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 198/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L TS ST+FLH+SL  NLVLW ISVAL +IVA IY LK ILYFEAVRREYY
Sbjct  222  SSQAILWKTLPTSASTKFLHLSLIPNLVLWCISVALVAIVACIYLLKMILYFEAVRREYY  281

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFF+PWI +LFLALGVPPS   NL+ +LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  282  HPVRVNFFFSPWIALLFLALGVPPSFANNLYPALWYILMTPILCLELKIYGQWMSGGQRR  341

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGLKEGP+FFFA+GLAHY+VLFVTLYQRLPTNET 
Sbjct  342  LSKVANPVNHLAIVGNFVGALLGASMGLKEGPVFFFAVGLAHYMVLFVTLYQRLPTNETV  401

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA  +I GSF+  S+I YFI+LFL
Sbjct  402  IPKDLHPVFFLFVAAPSVASMAWGRIQGSFNYGSRIFYFISLFL  445



>ref|XP_003548133.1| PREDICTED: S-type anion channel SLAH3-like [Glycine max]
Length=584

 Score =   362 bits (930),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 196/222 (88%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAILWKA+ATSPST+FLHISL +NL+ W ISVAL + V   Y LK ILYFEAVRREYYH
Sbjct  233  SQAILWKAIATSPSTKFLHISLKINLIFWFISVALTATVFTTYLLKIILYFEAVRREYYH  292

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+RVN+FFAPW+ +LFLA GVPPSVT++L ++LWY+ M PI CL+LKIYGQWMSGG RRL
Sbjct  293  PIRVNYFFAPWVSLLFLAHGVPPSVTKDLPNALWYILMTPILCLELKIYGQWMSGGTRRL  352

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            SKVANP+NHL++VGNFVGALLGA+MGLKEGPIFF+AIGLAHYIV+FVTLYQRLPTNETLP
Sbjct  353  SKVANPTNHLSVVGNFVGALLGASMGLKEGPIFFYAIGLAHYIVVFVTLYQRLPTNETLP  412

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            KELHPVFF+FVA P VASMA A I  SFD  S+I+YFI LFL
Sbjct  413  KELHPVFFMFVAPPVVASMAWASIQDSFDYGSRISYFIGLFL  454



>ref|XP_011084472.1| PREDICTED: S-type anion channel SLAH2 [Sesamum indicum]
 ref|XP_011084473.1| PREDICTED: S-type anion channel SLAH2 [Sesamum indicum]
 ref|XP_011084474.1| PREDICTED: S-type anion channel SLAH2 [Sesamum indicum]
Length=626

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LA+S ST+FLH+S  +NLVLW ISVAL  IVA +YALK I YFEAVRREYY
Sbjct  257  SSQAIMWKTLASSESTKFLHVSPDINLVLWFISVALVVIVAAVYALKVIFYFEAVRREYY  316

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALG+PPS +  LH+SLWY+ M PIF L+LKIYGQWMSGGQRR
Sbjct  317  HPIRVNFFFAPWIALLFLALGIPPSFSNTLHASLWYILMTPIFFLELKIYGQWMSGGQRR  376

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA+MGLKEGP+FFFA+GLAHY VLFVTLYQRLPTNETL
Sbjct  377  LSKVANPSNHLSIVGNFVGALLGASMGLKEGPVFFFAVGLAHYTVLFVTLYQRLPTNETL  436

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G+FD  S+IAYFIALFL
Sbjct  437  PKELHPVFFLFVAAPSVASMAWARIQGTFDYGSRIAYFIALFL  479



>ref|XP_008380319.1| PREDICTED: S-type anion channel SLAH2-like [Malus domestica]
Length=568

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 196/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKAL TS S +FLH+SL +N+VLW ISV L +IV+ IY +K  LYFEAVRREY+
Sbjct  210  SSQAILWKALPTSASMKFLHMSLTINIVLWCISVVLLAIVSCIYLVKVALYFEAVRREYH  269

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLALGVPPS   NLH SLWY+ M P+ CL+LKIYGQWM GGQRR
Sbjct  270  HPIRINFFFAPWIALLFLALGVPPSFANNLHPSLWYILMTPLLCLELKIYGQWMFGGQRR  329

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGL+EGPIFFFAIG  HYIVLFVTLYQRLPTN+T 
Sbjct  330  LSKVANPFNHLAIVGNFVGALLGASMGLQEGPIFFFAIGFVHYIVLFVTLYQRLPTNDTV  389

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PKELHPVFFLFVAAPS+AS+A AKI GSFD  S+IAYFI+LFL
Sbjct  390  IPKELHPVFFLFVAAPSIASVAWAKIQGSFDHGSRIAYFISLFL  433



>ref|XP_010671574.1| PREDICTED: S-type anion channel SLAH2-like [Beta vulgaris subsp. 
vulgaris]
Length=604

 Score =   360 bits (924),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPST FL++SL VNLVLW ISVAL  ++  IY LK I +FEAVRREYY
Sbjct  243  SSQAILWKTLATSPSTSFLNVSLIVNLVLWTISVALVVVIGIIYGLKMIFFFEAVRREYY  302

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG P  VT+ LH +LWYV M P  CL+LKIYGQWMSGGQRR
Sbjct  303  HPIRVNFFFAPLIALLFLALGCPQHVTKELHQALWYVLMFPFLCLELKIYGQWMSGGQRR  362

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVA P NHL++VGNFVGALLGA+MGL EGPIFFFA+G+AHY VLFVTLYQRLPTN+TL
Sbjct  363  LSKVATPVNHLSVVGNFVGALLGASMGLTEGPIFFFAVGMAHYTVLFVTLYQRLPTNKTL  422

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  ++IAYFIALFL
Sbjct  423  PKELHPVFFLFVAAPSVASMAWAKIQGSFDYGARIAYFIALFL  465



>ref|XP_010519469.1| PREDICTED: S-type anion channel SLAH3 [Tarenaya hassleriana]
Length=661

 Score =   362 bits (928),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISV L  ++A IY+LK +LYFEAVRREYY
Sbjct  288  SSQAIMWKTLATAEPTKFLHVPLWINQALWFISVGLILVIACIYSLKVLLYFEAVRREYY  347

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP+I +LFLALGVPPSV ++L  +LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  348  HPIRVNFFFAPFISLLFLALGVPPSVIKDLPQTLWYILMFPFLCLELKIYGQWMSGGQRR  407

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL+IVGNFVGALLGA+MGLKEGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  408  LSRVANPTNHLSIVGNFVGALLGASMGLKEGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  467

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI GSFD  SKI YFIALFL
Sbjct  468  PKELHPVFFLFVAAPSVASMAWAKISGSFDSGSKICYFIALFL  510



>ref|XP_008792389.1| PREDICTED: S-type anion channel SLAH3-like [Phoenix dactylifera]
Length=445

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LATSPS  FLH+SL VNLVLW IS+AL   V+ IY+LK I YFE VRREYY
Sbjct  101  SSQAILWKTLATSPSMSFLHVSLTVNLVLWCISLALMGAVSLIYSLKIIFYFETVRREYY  160

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR+NFFFAPWI  + LALGVPPS+  +LH++LWYV MAPI CL+LKIYG+WMSGG RR
Sbjct  161  HPVRINFFFAPWIAGIVLALGVPPSIAVHLHAALWYVLMAPILCLELKIYGEWMSGGPRR  220

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS VANPSNHLAI+GNFVGALLGATMGLKEGP+FFFA+GLAHY+VLFVTLYQRLP+N  L
Sbjct  221  LSMVANPSNHLAILGNFVGALLGATMGLKEGPLFFFAVGLAHYVVLFVTLYQRLPSNAAL  280

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAP+VA +A  KI G F+  +K+AYFIALFL
Sbjct  281  PRDLHPVFFLFVAAPTVACLAWEKICGEFNYGAKMAYFIALFL  323



>ref|XP_009375560.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Pyrus 
x bretschneideri]
Length=575

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 195/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKAL TS S +FLH+SL +N+VLW ISV L +IV+ IY +K  LYFEAVRREY+
Sbjct  217  SSQAILWKALPTSASMKFLHLSLTINIVLWCISVVLLAIVSCIYLVKVALYFEAVRREYH  276

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLALGVPPS   NLH SLWY+ M P+ CL+LKIYGQWM GGQRR
Sbjct  277  HPIRINFFFAPWIALLFLALGVPPSFANNLHPSLWYILMTPLLCLELKIYGQWMFGGQRR  336

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAI GNFVGALLGA+MGL+EGPIFFFAIG  HYIVLFVTLYQRLPTN+T 
Sbjct  337  LSKVANPFNHLAIAGNFVGALLGASMGLQEGPIFFFAIGFVHYIVLFVTLYQRLPTNDTV  396

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PKELHPVFFLFVAAPS+AS+A AKI GSFD  S+IAYFI+LFL
Sbjct  397  IPKELHPVFFLFVAAPSIASVAWAKIQGSFDHGSRIAYFISLFL  440



>ref|NP_001043099.1| Os01g0385400 [Oryza sativa Japonica Group]
 dbj|BAC03353.1| C4-dicarboxylate transporter-like protein [Oryza sativa Japonica 
Group]
 dbj|BAC06289.1| C4-dicarboxylate transporter-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF05013.1| Os01g0385400 [Oryza sativa Japonica Group]
 gb|EAY74166.1| hypothetical protein OsI_02047 [Oryza sativa Indica Group]
 gb|EAZ12004.1| hypothetical protein OsJ_01883 [Oryza sativa Japonica Group]
Length=625

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATS  T FLH++  VNLVLW +S+AL  ++A IYA K + +FEAVRREYY
Sbjct  277  SSQAILWKTVATSTPTRFLHVTTKVNLVLWCVSLALMCVIAAIYACKVVFFFEAVRREYY  336

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVPPSV   L   LWY  M PI C++LKIYGQWMSGGQRR
Sbjct  337  HPIRVNFFFAPWIACLFLAIGVPPSVATELPRWLWYALMTPILCMELKIYGQWMSGGQRR  396

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGP+FFF++GLAHY VLFVTLYQRLPTNETL
Sbjct  397  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPVFFFSVGLAHYTVLFVTLYQRLPTNETL  456

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA AKI G F   S++AYFIA+FL
Sbjct  457  PKELHPVFFLFVAAPSVACMAWAKITGEFGLGSRVAYFIAMFL  499



>ref|XP_008380328.1| PREDICTED: S-type anion channel SLAH2-like [Malus domestica]
Length=606

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK + TS ST++LH++L  NLVLW ISVAL  +VA IY LK  LYFEAVRREYY
Sbjct  252  SSQAILWKTIPTSASTKYLHLNLIPNLVLWCISVALLVVVACIYLLKVTLYFEAVRREYY  311

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPS    LH +LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  312  HPIRVNFFFAPWIALLFLALGVPPSFANKLHPALWYILMTPILCLELKIYGQWMSGGQRR  371

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NH++IVGNFVGALLGA+MGLKEGPIFFF +G+AHY+VLFVTLYQRLPTNET 
Sbjct  372  LSKVANPVNHISIVGNFVGALLGASMGLKEGPIFFFGVGMAHYLVLFVTLYQRLPTNETV  431

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA A+I GSF   S+I YFIALFL
Sbjct  432  IPKDLHPVFFLFVAAPSVASMAWARIQGSFGYGSRILYFIALFL  475



>ref|XP_008376666.1| PREDICTED: S-type anion channel SLAH2-like [Malus domestica]
Length=602

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L TS ST+FLH+SL  NLVLW ISVAL ++VA IY LK I YFEAVRREY+
Sbjct  248  SSQAILWKVLPTSSSTKFLHLSLTPNLVLWCISVALVAMVACIYLLKVIFYFEAVRREYF  307

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFF+PWI +LFL LG+PPS    L+ ++WY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  308  HPIRVNFFFSPWIALLFLTLGIPPSFANKLNPAIWYILMTPILCLELKIYGQWMSGGQRR  367

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGLKEGPIFFFA+GLAHY VLFVTLYQRLPTNET 
Sbjct  368  LSKVANPVNHLAIVGNFVGALLGASMGLKEGPIFFFAVGLAHYAVLFVTLYQRLPTNETV  427

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVF LFVAAPSVASMA A+IHGSF   S+I YFIALFL
Sbjct  428  IPKDLHPVFLLFVAAPSVASMAWARIHGSFGYGSRILYFIALFL  471



>ref|XP_006842896.1| hypothetical protein AMTR_s00075p00061010 [Amborella trichopoda]
 gb|ERN04571.1| hypothetical protein AMTR_s00075p00061010 [Amborella trichopoda]
Length=659

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L+ +PS  FLHI+L VNLVLW IS+A+ +++  +Y LK + Y EAVRREYY
Sbjct  302  SSQAILWKTLSVTPSMSFLHINLTVNLVLWCISLAVTTVIFSVYILKLLFYIEAVRREYY  361

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI ++FLAL +PP+++  LH S+WYV MAPIF L+LKIYGQWMSG QRR
Sbjct  362  HPIRVNFFFAPWIALMFLALSMPPALSRKLHGSIWYVLMAPIFILELKIYGQWMSGSQRR  421

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA++GLKEGP FFFA+GLAHYIVLFVTLYQRLPTNETL
Sbjct  422  LSKVANPSNHLSIVGNFVGALLGASLGLKEGPTFFFAVGLAHYIVLFVTLYQRLPTNETL  481

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI G FD  SKI YFIALFL
Sbjct  482  PKDLHPVFFLFVAAPSVASMAWAKIQGDFDYFSKIIYFIALFL  524



>ref|XP_003569388.1| PREDICTED: S-type anion channel SLAH2-like [Brachypodium distachyon]
 ref|XP_010232042.1| PREDICTED: S-type anion channel SLAH2-like [Brachypodium distachyon]
Length=634

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 192/223 (86%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P T FLH+S  V  VLW IS+AL  +V+FIY LK + YFEAVRRE+Y
Sbjct  271  SSQAILWKTLASAPPTAFLHVSPVVTHVLWYISLALMGLVSFIYLLKVVFYFEAVRREFY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  G P  V E +H  +WYV MAPIFCL+LKIYGQWMSGGQRR
Sbjct  331  HPIRANFFFAPWIACLFLVQGAPMPVAE-VHHGVWYVLMAPIFCLELKIYGQWMSGGQRR  389

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGP+FFFA+GLAHYIVLFVTLYQRLPTN TL
Sbjct  390  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPVFFFAVGLAHYIVLFVTLYQRLPTNVTL  449

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  450  PKELHPVFFLFVAAPSVASMAWAKINGRFDNGARIAYFIALFL  492



>ref|NP_001043615.2| Os01g0623200 [Oryza sativa Japonica Group]
 dbj|BAF05529.2| Os01g0623200 [Oryza sativa Japonica Group]
Length=526

 Score =   352 bits (903),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA++P T FLH+S  VN VLW IS+AL   V+FIY LK + YFEAVRRE+Y
Sbjct  291  SSQAMLWKTLASAPPTSFLHVSPVVNHVLWWISLALMGFVSFIYLLKVVFYFEAVRREFY  350

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  GVP  VTE +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  351  HPIRANFFFAPWIACLFLVQGVPRPVTE-VHHGVWYALMAPIFCLELKIYGQWMSGGQRR  409

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGPIF+FA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  410  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPIFYFAVGLAHYMVLFVTLYQRLPTNVTL  469

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI G FD  ++IAYFIALFL
Sbjct  470  PKELHPVFFLFVAAPSVASMAWAKILGEFDYGARIAYFIALFL  512



>ref|XP_008362829.1| PREDICTED: LOW QUALITY PROTEIN: S-type anion channel SLAH3-like 
[Malus domestica]
Length=871

 Score =   361 bits (927),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 196/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKAL TS S +FLH+SL +N+VLW ISV L +IV+ IY +K  LYFEAVRREY+
Sbjct  210  SSQAILWKALPTSASMKFLHMSLTINIVLWCISVVLLAIVSCIYLVKVALYFEAVRREYH  269

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLALGVPPS   NLH SLWY+ M P+ CL+LKIYGQWM GGQRR
Sbjct  270  HPIRINFFFAPWIALLFLALGVPPSFANNLHPSLWYILMTPLLCLELKIYGQWMFGGQRR  329

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHLAIVGNFVGALLGA+MGL+EGPIFFFAIG  HYIVLFVTLYQRLPTN+T 
Sbjct  330  LSKVANPFNHLAIVGNFVGALLGASMGLQEGPIFFFAIGFVHYIVLFVTLYQRLPTNDTV  389

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PKELHPVFFLFVAAPS+AS+A AKI GSFD  S+IAYFI+LFL
Sbjct  390  IPKELHPVFFLFVAAPSIASVAWAKIQGSFDHGSRIAYFISLFL  433



>ref|XP_006644384.1| PREDICTED: S-type anion channel SLAH3-like [Oryza brachyantha]
Length=644

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 192/223 (86%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P T FLH+S  VN VLW +++AL ++V  IY LK + YFEAVRRE+Y
Sbjct  277  SSQAILWKTLASAPPTAFLHVSPVVNHVLWYVALALMALVTSIYLLKIVFYFEAVRREFY  336

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  GVP  VTE +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  337  HPIRANFFFAPWIACLFLVQGVPRPVTE-VHHGVWYALMAPIFCLELKIYGQWMSGGQRR  395

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGPIFFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  396  LSKVANPSNHLSIVGNFVGALLGARMGLREGPIFFFAVGLAHYMVLFVTLYQRLPTNITL  455

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKIHG FD  ++IAYFIALFL
Sbjct  456  PKELHPVFFLFVAAPSVASMAWAKIHGEFDYGARIAYFIALFL  498



>ref|XP_004960632.1| PREDICTED: S-type anion channel SLAH3-like [Setaria italica]
Length=633

 Score =   354 bits (909),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATS  T FLH+   VNLVLW ISVAL    A +YALK   +FEAVRREYY
Sbjct  292  SSQAILWKTIATSAPTMFLHVGTKVNLVLWCISVALMCATAAVYALKIAFFFEAVRREYY  351

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVPPSV   L   LWY  MAP+  L+LKIYGQWMSGGQRR
Sbjct  352  HPIRVNFFFAPWIACLFLAIGVPPSVATELPRWLWYALMAPVLILELKIYGQWMSGGQRR  411

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGPIFFF++GLAHY VLFVTLYQRLPTNETL
Sbjct  412  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPIFFFSVGLAHYSVLFVTLYQRLPTNETL  471

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVA MA AKI G F   S++AYFIA+FL
Sbjct  472  PKELHPVFFLFVAAPSVACMAWAKITGEFGYGSRVAYFIAMFL  514



>ref|XP_009416718.1| PREDICTED: S-type anion channel SLAH2-like [Musa acuminata subsp. 
malaccensis]
Length=677

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SQAILWK LATSPS  FLH+SL VNL LW +S+ L S V+ IYA K I YFEAVRREY 
Sbjct  340  GSQAILWKTLATSPSVGFLHVSLTVNLALWCMSLVLMSTVSLIYACKIIFYFEAVRREYD  399

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFL  GVPPSV E   ++LWY  MAPIFCL+LK+YGQWMSGGQRR
Sbjct  400  HPVRGNFFFAPWIACLFLVQGVPPSVAEKPPAALWYALMAPIFCLELKVYGQWMSGGQRR  459

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGAL GA++GL+EGPIFFFA+GLAHY VLFVTLYQRLPTN TL
Sbjct  460  LSKVANPSNHLSIVGNFVGALAGASVGLREGPIFFFAVGLAHYTVLFVTLYQRLPTNVTL  519

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P+ELHPVFFLFVAAPSVA MA A I+G FD  S+IAY++ALFL
Sbjct  520  PRELHPVFFLFVAAPSVACMAWATINGDFDYGSRIAYYVALFL  562



>ref|XP_009375559.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score =   359 bits (922),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK + TS ST++LH++L  NLVLW ISVAL  +VA IY LK  LYFEAVRREYY
Sbjct  473  SSQAILWKTIPTSASTKYLHLNLIPNLVLWCISVALLVVVACIYLLKVTLYFEAVRREYY  532

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLALGVPPS    LH +LWY+ M PI CL+LKIYGQWMSGGQRR
Sbjct  533  HPIRVNFFFAPWIALLFLALGVPPSFANKLHPALWYILMTPILCLELKIYGQWMSGGQRR  592

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NH++IVGNFVGALLGA+MGLKEGPIFFF +G+AHY+VLFVTLYQRLPTNET 
Sbjct  593  LSKVANPVNHISIVGNFVGALLGASMGLKEGPIFFFGVGMAHYLVLFVTLYQRLPTNETV  652

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PK+LHPVFFLFVAAPSVASMA A+I GSF   S+I YFIALFL
Sbjct  653  IPKDLHPVFFLFVAAPSVASMAWARIQGSFGCGSRILYFIALFL  696



>dbj|BAK05767.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06343.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=596

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI+L  NLVLW +SVAL  +V+ +YA K I YFEAVRREYY
Sbjct  252  SSQAILWKNIAISASTRFLHITLRTNLVLWCVSVALMCLVSALYACKVIFYFEAVRREYY  311

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V E+L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  312  HPIRVNFFFAPWIACLFLAIGVPELVMESLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  371

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGA MGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  372  LSRVANPSNHLSIVGNFVGALLGAIMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  431

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S+IAYFIA+FL
Sbjct  432  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRIAYFIAMFL  474



>ref|XP_003568730.1| PREDICTED: S-type anion channel SLAH3-like [Brachypodium distachyon]
 ref|XP_010231591.1| PREDICTED: S-type anion channel SLAH3-like [Brachypodium distachyon]
Length=609

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAIL+K ++TS  T FLH+S  VNLVLW ISVAL   +  IY  K + +FEAVRREYY
Sbjct  264  SSQAILYKTISTSEPTSFLHVSPKVNLVLWCISVALMCAITAIYLCKVVFFFEAVRREYY  323

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL +G+PPS+   L   LWY  MAP+ CL+LKIYGQWMSGGQRR
Sbjct  324  HPIRVNFFFAPWIACLFLVIGMPPSIAAELPPWLWYALMAPVLCLELKIYGQWMSGGQRR  383

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA+MGLKEGP+FFFA+G+AHY VLFVTLYQRLPTNETL
Sbjct  384  LSKVANPSNHLSVVGNFVGALLGASMGLKEGPVFFFAVGMAHYSVLFVTLYQRLPTNETL  443

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI G F   S+IAYFIA+FL
Sbjct  444  PKELHPVFFLFVAAPSVASMAWAKITGEFGLGSRIAYFIAMFL  486



>dbj|BAJ99263.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=602

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAIL+K +AT+  TEFLH+S  VNLVLW ISV L SI+  +YA K I +FEAVRREYY
Sbjct  251  SSQAILYKTIATAAPTEFLHVSPKVNLVLWYISVVLMSIITAVYAFKIIFFFEAVRREYY  310

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVPPSVT  L + LWY  M+P+ CL+LKIYGQWMSGGQRR
Sbjct  311  HPIRVNFFFAPWIACLFLAMGVPPSVTTQLPAWLWYALMSPVLCLELKIYGQWMSGGQRR  370

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGAL+GA+MGLKEGPIFFF +G+AHY VLFVTLYQRLPTN TL
Sbjct  371  LSKVANPSNHLSVVGNFVGALMGASMGLKEGPIFFFGVGMAHYTVLFVTLYQRLPTNATL  430

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI   F   +K+AYFIA+FL
Sbjct  431  PKDLHPVFFLFVAAPSVASMAWAKIVDEFGVGAKLAYFIAMFL  473



>gb|KHN47269.1| S-type anion channel SLAH3 [Glycine soja]
Length=435

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQ ILWKA+ATSPST+FL+ISL +NL+ W IS+AL   V   Y LK ILYFEA  REYYH
Sbjct  87   SQTILWKAIATSPSTKFLNISLKINLIFWFISIALIIAVFTTYLLKIILYFEATLREYYH  146

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+RVN+FFAPWI +LFLA GVPPSV ++L ++LWY+ M PI CL+LKIYGQWMSGG RRL
Sbjct  147  PIRVNYFFAPWIALLFLAQGVPPSVIKDLPNALWYILMTPILCLELKIYGQWMSGGSRRL  206

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            SKVANP+N+L++VGNFV ALLGA+MGLKEGPIFFFAIGLAHY+V+F+TLYQRLPTNETLP
Sbjct  207  SKVANPTNYLSVVGNFVRALLGASMGLKEGPIFFFAIGLAHYVVVFITLYQRLPTNETLP  266

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            K+LHPVFF+FVA P VASMA A I GSFD  S+IAYFI LFL
Sbjct  267  KDLHPVFFMFVAPPIVASMAWATIQGSFDYGSRIAYFIGLFL  308



>dbj|BAD81510.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAH00500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=618

 Score =   351 bits (901),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW +SVAL   V+ +YA K   YFEAVRREYY
Sbjct  236  SSQAILWKNIAISTSTRFLHITVKINLVLWCVSVALMCAVSALYACKVAFYFEAVRREYY  295

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA+GVPP V  +L   LWY+ MAPI CL+LKIYGQW+SGGQRR
Sbjct  296  HPVRVNFFFAPWIACLFLAIGVPPMVAASLPHWLWYLLMAPIVCLELKIYGQWISGGQRR  355

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGATMGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  356  LSRVANPSNHLSIVGNFVGALLGATMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  415

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  416  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  458



>gb|EEE55010.1| hypothetical protein OsJ_02656 [Oryza sativa Japonica Group]
Length=658

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA++P T FLH+S  VN VLW IS+AL   V+FIY LK + YFEAVRRE+Y
Sbjct  291  SSQAMLWKTLASAPPTSFLHVSPVVNHVLWWISLALMGFVSFIYLLKVVFYFEAVRREFY  350

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  GVP  VTE +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  351  HPIRANFFFAPWIACLFLVQGVPRPVTE-VHHGVWYALMAPIFCLELKIYGQWMSGGQRR  409

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGPIF+FA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  410  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPIFYFAVGLAHYMVLFVTLYQRLPTNVTL  469

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI G FD  ++IAYFIALFL
Sbjct  470  PKELHPVFFLFVAAPSVASMAWAKILGEFDYGARIAYFIALFL  512



>ref|XP_006655105.1| PREDICTED: S-type anion channel SLAH3-like [Oryza brachyantha]
Length=561

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 189/224 (84%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATS  T FLH++  VNLVLW +SVAL   ++ IY  K   +FEAVRREYY
Sbjct  218  SSQAILWKTIATSAPTTFLHVTTKVNLVLWCVSVALMCAISAIYGAKVAFFFEAVRREYY  277

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV-TENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWI  LFLA+GVPPSV    L   LWY  MAP+ CL+LKIYGQWMSGGQR
Sbjct  278  HPIRVNFFFAPWIACLFLAIGVPPSVVATTLPQWLWYALMAPVLCLELKIYGQWMSGGQR  337

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA+MGL+EGP+FFFA+GLAHY VLFVTLYQRLPTNET
Sbjct  338  RLSKVANPSNHLSVVGNFVGALLGASMGLREGPVFFFAVGLAHYGVLFVTLYQRLPTNET  397

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMA A+I G F   S++AYF+A+FL
Sbjct  398  LPKELHPVFFLFVAAPSVASMAWARITGEFGLGSRLAYFVAVFL  441



>dbj|BAD81509.1| unknown protein [Oryza sativa Japonica Group]
Length=656

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW +SVAL   V+ +YA K   YFEAVRREYY
Sbjct  277  SSQAILWKNIAISTSTRFLHITVKINLVLWCVSVALMCAVSALYACKVAFYFEAVRREYY  336

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA+GVPP V  +L   LWY+ MAPI CL+LKIYGQW+SGGQRR
Sbjct  337  HPVRVNFFFAPWIACLFLAIGVPPMVAASLPHWLWYLLMAPIVCLELKIYGQWISGGQRR  396

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGATMGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  397  LSRVANPSNHLSIVGNFVGALLGATMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  456

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  457  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  499



>gb|EMT08868.1| Tellurite resistance protein tehA [Aegilops tauschii]
Length=619

 Score =   351 bits (900),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 190/223 (85%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LAT+P T FLH+SL V   LW IS+AL  +V+ IY LK + YFEAVRRE++
Sbjct  257  SSQAILWKTLATAPPTAFLHVSLAVAHALWYISLALMGLVSCIYLLKIVFYFEAVRREFH  316

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  G P  + + +H  +WY+ MAPIFCL+LKIYGQWMSGGQRR
Sbjct  317  HPIRANFFFAPWIACLFLVQGAPRELAQ-VHHGVWYMLMAPIFCLELKIYGQWMSGGQRR  375

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MG+ EGPIFFFAIGLAHYIVLFVTLYQRLPTN TL
Sbjct  376  LSKVANPSNHLSIVGNFVGALLGAKMGISEGPIFFFAIGLAHYIVLFVTLYQRLPTNVTL  435

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  436  PKELHPVFFLFVAAPSVASMAWAKINGEFDNGARIAYFIALFL  478



>ref|NP_001042466.1| Os01g0226600 [Oryza sativa Japonica Group]
 dbj|BAF04380.1| Os01g0226600, partial [Oryza sativa Japonica Group]
Length=628

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW +SVAL   V+ +YA K   YFEAVRREYY
Sbjct  246  SSQAILWKNIAISTSTRFLHITVKINLVLWCVSVALMCAVSALYACKVAFYFEAVRREYY  305

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA+GVPP V  +L   LWY+ MAPI CL+LKIYGQW+SGGQRR
Sbjct  306  HPVRVNFFFAPWIACLFLAIGVPPMVAASLPHWLWYLLMAPIVCLELKIYGQWISGGQRR  365

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGATMGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  366  LSRVANPSNHLSIVGNFVGALLGATMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  425

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  426  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  468



>gb|EPS60679.1| hypothetical protein M569_14123, partial [Genlisea aurea]
Length=327

 Score =   341 bits (874),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK+L+ S ST FLHI+  +NLV+W IS+AL   V+  Y LK ILYFEAVRREYY
Sbjct  94   SSQAIMWKSLSNSDSTRFLHITPQINLVIWFISIALVLFVSSTYILKVILYFEAVRREYY  153

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPW+ ++FL++G+PPSV   L + +WY+ M P+FCLDLKIYGQWMSGG+RR
Sbjct  154  HPVRVNFFFAPWVALMFLSIGLPPSVATTLPTYVWYILMTPVFCLDLKIYGQWMSGGERR  213

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+ GNFVGALLGA+M L+EGPIFFFA+G AHY+VLFVTLYQRLPT+E L
Sbjct  214  LSKVANPSNHLAVAGNFVGALLGASMELREGPIFFFAVGFAHYMVLFVTLYQRLPTSEVL  273

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVA PSVAS+A A+I GSF   S+I +FI+LFL
Sbjct  274  PKELHPVFFLFVATPSVASVAWARITGSFGYGSQILFFISLFL  316



>ref|XP_010493534.1| PREDICTED: S-type anion channel SLAH3 isoform X2 [Camelina sativa]
Length=567

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLHI L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  202  SSQAIMWKTLATAEPTKFLHIPLWINQGLWFISVALILTIATIYLLKIILYFEAVRREYY  261

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  262  HPIRINFFFAPFISLLFLALGVPPSIITDLPHYLWYLLMFPFICLELKIYGQWMSGGQRR  321

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  322  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  381

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  382  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  424



>gb|EEE54151.1| hypothetical protein OsJ_00957 [Oryza sativa Japonica Group]
Length=705

 Score =   353 bits (905),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW +SVAL   V+ +YA K   YFEAVRREYY
Sbjct  335  SSQAILWKNIAISTSTRFLHITVKINLVLWCVSVALMCAVSALYACKVAFYFEAVRREYY  394

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA+GVPP V  +L   LWY+ MAPI CL+LKIYGQW+SGGQRR
Sbjct  395  HPVRVNFFFAPWIACLFLAIGVPPMVAASLPHWLWYLLMAPIVCLELKIYGQWISGGQRR  454

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGATMGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  455  LSRVANPSNHLSIVGNFVGALLGATMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  514

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  515  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  557



>emb|CDX87147.1| BnaC09g04620D [Brassica napus]
Length=623

 Score =   350 bits (899),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLHI L +N VLW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  258  SSQAIMWKTLATAEPTKFLHIPLWINEVLWFISVALILTIATIYLLKIILYFEAVRREYY  317

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+   L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  318  HPIRINFFFAPFISLLFLALGVPPSIATELPQFLWYLLMFPFICLELKIYGQWMSGGQRR  377

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL+IVGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  378  LSRVANPTNHLSIVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  437

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI  SFD  SK+ YFIA+FL
Sbjct  438  PKDLHPVFFLFVAAPSVASMAWAKITDSFDYGSKVCYFIAIFL  480



>emb|CDX80404.1| BnaC07g30400D [Brassica napus]
Length=636

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  271  SSQAIMWKTLATAEPTKFLHVPLWINQALWFISVALVFTIAIIYLLKIILYFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPSV   L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  331  HPIRINFFFAPFISLLFLALGVPPSVMTELPQFLWYLLMFPFICLELKIYGQWMSGGQRR  390

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL+IVGNFVGALLGA+MGL+EGP+FF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  391  LSRVANPTNHLSIVGNFVGALLGASMGLREGPMFFYAVGMAHYLVLFVTLYQRLPTNETL  450

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  451  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  493



>ref|XP_010454687.1| PREDICTED: S-type anion channel SLAH3-like [Camelina sativa]
Length=636

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLHI L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  271  SSQAIMWKTLATAEPTKFLHIPLWINQGLWFISVALILTIATIYLLKIILYFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  331  HPIRINFFFAPFISLLFLALGVPPSIITDLPHYLWYILMFPFICLELKIYGQWMSGGQRR  390

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  391  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  450

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  451  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  493



>dbj|BAD61172.1| hypothetical protein [Oryza sativa Japonica Group]
Length=686

 Score =   352 bits (903),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA++P T FLH+S  VN VLW IS+AL   V+FIY LK + YFEAVRRE+Y
Sbjct  319  SSQAMLWKTLASAPPTSFLHVSPVVNHVLWWISLALMGFVSFIYLLKVVFYFEAVRREFY  378

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  GVP  VTE +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  379  HPIRANFFFAPWIACLFLVQGVPRPVTE-VHHGVWYALMAPIFCLELKIYGQWMSGGQRR  437

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGPIF+FA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  438  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPIFYFAVGLAHYMVLFVTLYQRLPTNVTL  497

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI G FD  ++IAYFIALFL
Sbjct  498  PKELHPVFFLFVAAPSVASMAWAKILGEFDYGARIAYFIALFL  540



>dbj|BAJ92320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 190/223 (85%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P T FLH+SL V   LW IS+AL  +V+ IY LK + YFEAVRRE+Y
Sbjct  264  SSQAILWKTLASAPPTAFLHVSLVVAHALWYISLALMGLVSSIYLLKIVFYFEAVRREFY  323

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  G P  + E +H  +WY+ MAPIFCL+LKIYGQWMSGGQRR
Sbjct  324  HPIRANFFFAPWIACLFLVQGAPRELAE-VHHGVWYMLMAPIFCLELKIYGQWMSGGQRR  382

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MG++EGPIFFFAIGLAHY VLFVTLYQRLPTN TL
Sbjct  383  LSKVANPSNHLSIVGNFVGALLGAKMGIREGPIFFFAIGLAHYTVLFVTLYQRLPTNVTL  442

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  443  PKELHPVFFLFVAAPSVASMAWAKINGEFDNGARIAYFIALFL  485



>ref|XP_010233020.1| PREDICTED: LOW QUALITY PROTEIN: S-type anion channel SLAH2-like 
[Brachypodium distachyon]
Length=606

 Score =   350 bits (897),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI+L  NLVLW +SVAL   V+ +YA K   YFEAVRREYY
Sbjct  256  SSQAILWKNIAXSASTRFLHITLRTNLVLWCVSVALMCFVSALYACKVAFYFEAVRREYY  315

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V E+L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  316  HPIRVNFFFAPWIACLFLAIGVPELVVESLPHWLWYVLMAPIACLELKIYGQWISGGQRR  375

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL++VGNFVGALLGA MGL+EGPIFFFA+GLAHY VLFVTLYQRLPT+ETL
Sbjct  376  LSRVANPSNHLSVVGNFVGALLGAIMGLREGPIFFFAVGLAHYTVLFVTLYQRLPTSETL  435

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S+IAYFIA+FL
Sbjct  436  PRDLHPVFFLFVAAPSVACLAWARITGQFGYGSRIAYFIAMFL  478



>ref|XP_009150932.1| PREDICTED: S-type anion channel SLAH3 [Brassica rapa]
Length=636

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  271  SSQAIMWKTLATAEPTKFLHVPLWINQALWFISVALVFTIAIIYLLKIILYFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPSV   L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  331  HPIRINFFFAPFISLLFLALGVPPSVMTELPQFLWYLLMFPFICLELKIYGQWMSGGQRR  390

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL+IVGNFVGALLGA+MGL+EGP+FF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  391  LSRVANPTNHLSIVGNFVGALLGASMGLREGPMFFYAVGMAHYLVLFVTLYQRLPTNETL  450

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  451  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  493



>ref|XP_006587259.1| PREDICTED: S-type anion channel SLAH3-like [Glycine max]
Length=514

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQ ILWKA+ATSPST+FL+ISL +NL+ W IS+AL   V   Y LK ILYFEA  REYYH
Sbjct  166  SQTILWKAIATSPSTKFLNISLKINLIFWFISIALIIAVFTTYLLKIILYFEATLREYYH  225

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+RVN+FFAPWI +LFLA GVPPSV ++L ++LWY+ M PI CL+LKIYGQWMSGG RRL
Sbjct  226  PIRVNYFFAPWIALLFLAQGVPPSVIKDLPNALWYILMTPILCLELKIYGQWMSGGSRRL  285

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            SKVANP+N+L++VGNFV ALLGA+MGLKEGPIFFFAIGLAHY+V+F+TLYQRLPTNETLP
Sbjct  286  SKVANPTNYLSVVGNFVRALLGASMGLKEGPIFFFAIGLAHYVVVFITLYQRLPTNETLP  345

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            K+LHPVFF+FVA P VASMA A I GSFD  S+IAYFI LFL
Sbjct  346  KDLHPVFFMFVAPPIVASMAWATIQGSFDYGSRIAYFIGLFL  387



>ref|XP_006287257.1| hypothetical protein CARUB_v10000447mg [Capsella rubella]
 gb|EOA20155.1| hypothetical protein CARUB_v10000447mg [Capsella rubella]
Length=637

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  272  SSQAIMWKTLATAAPTKFLHVPLWINQGLWFISVALILTIATIYLLKIILYFEAVRREYY  331

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  332  HPIRINFFFAPFISLLFLALGVPPSIITDLPHYLWYILMFPFICLELKIYGQWMSGGQRR  391

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  392  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  451

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  452  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  494



>ref|XP_003619272.1| C4-dicarboxylate transporter/malic acid transport protein [Medicago 
truncatula]
Length=451

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = -2

Query  627  STEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYHPVRVNFFFAPWIV  448
            S EFLHI+  +NL+LW IS  L + +  +Y LK + YFEAVRREYYHP+RVNFFFAPWI 
Sbjct  21   SLEFLHITPKINLILWYISAVLIATIFAVYILKLLFYFEAVRREYYHPIRVNFFFAPWIA  80

Query  447  VLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRLSKVANPSNHLAIV  268
            +LFLALGVPPSVT+NLH SLWY+ MAPI  L+LKIYGQWMSGGQRRLSKVANPSNHL++V
Sbjct  81   LLFLALGVPPSVTKNLHQSLWYILMAPILFLELKIYGQWMSGGQRRLSKVANPSNHLSVV  140

Query  267  GNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLPKELHPVFFLFVAA  88
            GNFVGALLGA+MGL EGPIFFFA+GLAHY VLFVTLYQRLPTN TLPKELHPVFFLFVAA
Sbjct  141  GNFVGALLGASMGLIEGPIFFFAVGLAHYTVLFVTLYQRLPTNATLPKELHPVFFLFVAA  200

Query  87   PSVASMALAKIHGSFDDASKIAYFIALFL  1
            PSVASMA AKI GSFD  S+IAYFIALFL
Sbjct  201  PSVASMAWAKIQGSFDYGSRIAYFIALFL  229



>gb|EMT23557.1| hypothetical protein F775_13413 [Aegilops tauschii]
Length=524

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI+L  NLVLW +SVAL   V+ +YA K I YFEAVRREYY
Sbjct  179  SSQAILWKNIAISASTRFLHITLRTNLVLWCVSVALMCFVSALYACKVIFYFEAVRREYY  238

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V  +L   LWYV MAPI CL++KIYGQW+SGGQRR
Sbjct  239  HPIRVNFFFAPWIACLFLAIGVPEMVVASLPHWLWYVLMAPIVCLEIKIYGQWISGGQRR  298

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS VANPSNHL+IVGNFVGALLGA MGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  299  LSGVANPSNHLSIVGNFVGALLGAIMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  358

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S+IAYFIA+FL
Sbjct  359  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRIAYFIAMFL  401



>ref|XP_009141862.1| PREDICTED: S-type anion channel SLAH3-like [Brassica rapa]
Length=624

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLHI L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  259  SSQAIMWKTLATAEPTKFLHIPLWINEALWFISVALILTIATIYLLKIILYFEAVRREYY  318

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+ + L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  319  HPIRINFFFAPFISLLFLALGVPPSIAKELPQFLWYLLMFPFICLELKIYGQWMSGGQRR  378

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL+IVGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  379  LSRVANPTNHLSIVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  438

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI  SFD  SK+ YFIA+FL
Sbjct  439  PKDLHPVFFLFVAAPSVASMAWAKITDSFDYGSKVCYFIAIFL  481



>emb|CDM82604.1| unnamed protein product [Triticum aestivum]
Length=602

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI+L  NLVLW +SVAL   V+ +YA K I YFEAVRREYY
Sbjct  258  SSQAILWKNIAISASTRFLHITLRTNLVLWCVSVALMCFVSALYACKVIFYFEAVRREYY  317

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V  +L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  318  HPIRVNFFFAPWIACLFLAIGVPEMVVGSLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  377

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGA MGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  378  LSRVANPSNHLSIVGNFVGALLGAIMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  437

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S+IAYFIA+FL
Sbjct  438  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRIAYFIAMFL  480



>ref|XP_010421211.1| PREDICTED: S-type anion channel SLAH3-like [Camelina sativa]
Length=636

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLHI L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  271  SSQAIMWKTLATAEPTKFLHIPLWINQGLWFISVALILTIATIYLLKIILYFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  331  HPIRINFFFAPFISLLFLALGVPPSIITDLPHYLWYLLMFPFICLELKIYGQWMSGGQRR  390

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  391  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  450

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  451  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  493



>ref|XP_010493533.1| PREDICTED: S-type anion channel SLAH3 isoform X1 [Camelina sativa]
 ref|XP_010493535.1| PREDICTED: S-type anion channel SLAH3 isoform X3 [Camelina sativa]
Length=636

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLHI L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  271  SSQAIMWKTLATAEPTKFLHIPLWINQGLWFISVALILTIATIYLLKIILYFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  331  HPIRINFFFAPFISLLFLALGVPPSIITDLPHYLWYLLMFPFICLELKIYGQWMSGGQRR  390

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  391  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  450

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  451  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  493



>ref|XP_006394661.1| hypothetical protein EUTSA_v10003801mg [Eutrema salsugineum]
 gb|ESQ31947.1| hypothetical protein EUTSA_v10003801mg [Eutrema salsugineum]
Length=646

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  281  SSQAIMWKTLATAEPTKFLHVPLWINQGLWFISVALILAIASIYLLKIILYFEAVRREYY  340

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  341  HPIRVNFFFAPFISLLFLALGVPPSIVTDLPQFLWYLLMFPFICLELKIYGQWMSGGQRR  400

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGLKEGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  401  LSRVANPTNHLSVVGNFVGALLGASMGLKEGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  460

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AK+ GSFD  SK+ YF+A+FL
Sbjct  461  PKDLHPVFFLFVAAPSVASMAWAKVTGSFDYGSKVCYFVAIFL  503



>gb|EPS70633.1| c4-dicarboxylate transporter/malic acid transport family protein, 
partial [Genlisea aurea]
Length=410

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 192/224 (86%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHI-SLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREY  493
             SQAILWK LATS ST FLHI  + +NLV+W  ++ L   V+  Y LK ILY EAVRREY
Sbjct  90   GSQAILWKHLATSDSTRFLHIVGMELNLVIWFSAIVLVFFVSSAYVLKIILYSEAVRREY  149

Query  492  YHPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            +HPVRVNFFFAPWIV+LFL+LG+PPSV+ +L +  WY  MAPIFCL+LKIYGQWMSGG+R
Sbjct  150  FHPVRVNFFFAPWIVLLFLSLGLPPSVSASLPAYAWYFLMAPIFCLELKIYGQWMSGGER  209

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHLAIVGNFVGALLGA+MGL+EGP+FFFA+G AHY VLFVTLYQRLPT+E 
Sbjct  210  RLSKVANPSNHLAIVGNFVGALLGASMGLREGPVFFFAVGFAHYTVLFVTLYQRLPTSEV  269

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVAS+A A+I GSF   SKIAYF+ALFL
Sbjct  270  LPKELHPVFFLFVAAPSVASLACAEITGSFGYGSKIAYFVALFL  313



>gb|EEC70218.1| hypothetical protein OsI_00977 [Oryza sativa Indica Group]
Length=724

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW +SVAL   V+ +YA K   YFEAVRREYY
Sbjct  345  SSQAILWKNIAISTSTRFLHITVKINLVLWCVSVALMCAVSALYACKVAFYFEAVRREYY  404

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA+GVPP V  +L   LWY+ MAPI CL+LKIYGQW+SGGQRR
Sbjct  405  HPVRVNFFFAPWIACLFLAIGVPPMVAASLPHWLWYLLMAPIVCLELKIYGQWISGGQRR  464

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGATMGL+EGPIFFFA+GLAHYIVLFVTLYQRLPT+ETL
Sbjct  465  LSRVANPSNHLSIVGNFVGALLGATMGLREGPIFFFAVGLAHYIVLFVTLYQRLPTSETL  524

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  525  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  567



>gb|EMS54349.1| S-type anion channel SLAH3 [Triticum urartu]
Length=689

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LAT+P T FLH+SL V   LW IS+AL  +V+ IY LK + YFEAVRRE++
Sbjct  327  SSQAILWKTLATAPPTVFLHVSLAVAHALWYISLALMGLVSCIYLLKIVFYFEAVRREFH  386

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL  G P  + + +H  +WY+ MAPIFCL+LKIYGQWMSGGQRR
Sbjct  387  HPIRANFFFAPWIACLFLVQGAPRELAQ-VHHGVWYMLMAPIFCLELKIYGQWMSGGQRR  445

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MG++EGPIFFFA+GLAHYIVLFVTLYQRLPTN TL
Sbjct  446  LSKVANPSNHLSIVGNFVGALLGAKMGIREGPIFFFAVGLAHYIVLFVTLYQRLPTNVTL  505

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  506  PKELHPVFFLFVAAPSVASMAWAKINGEFDNGARIAYFIALFL  548



>ref|XP_004309170.1| PREDICTED: uncharacterized protein LOC101302316 [Fragaria vesca 
subsp. vesca]
Length=1207

 Score =   362 bits (928),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK L TS ST+FLH+SL  NLVLW IS+AL  IVA IY LK I YFEAVRREYY
Sbjct  233  SSQAILWKILPTSASTKFLHLSLMPNLVLWFISLALLVIVASIYILKIIFYFEAVRREYY  292

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFF+P+I +LF+ALGVPPS+ +NL+ +LWY+ MAPI CL+LKIYGQWMSGGQRR
Sbjct  293  HPIRINFFFSPFITLLFIALGVPPSICKNLNPALWYILMAPILCLELKIYGQWMSGGQRR  352

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
            LSKVANP NHL+IVGNFVGALLGA+MGLKEGPIFFFA+G+AHY+VLFVTLYQRLPTNE+ 
Sbjct  353  LSKVANPVNHLSIVGNFVGALLGASMGLKEGPIFFFAVGVAHYMVLFVTLYQRLPTNESV  412

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            +PKELHPVFFLFVAAPSVASMA A+I GSFD  S+I YFIA+FL
Sbjct  413  IPKELHPVFFLFVAAPSVASMAWARIQGSFDYGSRIGYFIAMFL  456


 Score =   351 bits (901),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 196/224 (88%), Gaps = 1/224 (0%)
 Frame = -2

Query  669   SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SSQAILWK L T+ ST+FLH+SL +NLVLW I+VA    V  IY LK I YFEAVRREY+
Sbjct  844   SSQAILWKTLPTTASTQFLHLSLTINLVLWCIAVATLVGVTCIYLLKIIFYFEAVRREYF  903

Query  489   HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
             HP+R+NFFF+P+I +LFLA+GVPPS++ NLH +LWY+ MAP+ CL+LKIYGQWMSGGQRR
Sbjct  904   HPIRINFFFSPFIALLFLAIGVPPSISSNLHPALWYILMAPLLCLELKIYGQWMSGGQRR  963

Query  309   LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET-  133
             LSKVANP NHL+IVGNFVGALLGA+MGL+EGPIFFFA+G+AHY+VLFVTLYQRL TNET 
Sbjct  964   LSKVANPVNHLSIVGNFVGALLGASMGLREGPIFFFAVGMAHYMVLFVTLYQRLTTNETV  1023

Query  132   LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
             +PKELHPVFFLFVAAPSVAS + A+I GSFD  S+I YFI++FL
Sbjct  1024  IPKELHPVFFLFVAAPSVASTSWARIQGSFDVGSRIGYFISMFL  1067



>ref|XP_002874159.1| C4-dicarboxylate transporter/malic acid transport family protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH50418.1| C4-dicarboxylate transporter/malic acid transport family protein 
[Arabidopsis lyrata subsp. lyrata]
Length=633

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  268  SSQAIMWKTLATAEPTKFLHVPLWINQGLWFISVALVLTIATIYLLKIILYFEAVRREYY  327

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  328  HPIRINFFFAPFISLLFLALGVPPSIITDLPHFLWYLLMFPFICLELKIYGQWMSGGQRR  387

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  388  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  447

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AK+ GSFD  SK+ YFIA+FL
Sbjct  448  PKDLHPVFFLFVAAPSVASMAWAKVTGSFDYGSKVCYFIAIFL  490



>ref|XP_008656672.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Zea mays]
 ref|XP_008656673.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Zea mays]
 ref|XP_008656675.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Zea mays]
 ref|XP_008656676.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Zea mays]
Length=634

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P+T FL +S  V+  LW +++AL ++V+  Y LK + Y EAVRRE+Y
Sbjct  270  SSQAILWKTLASAPATAFLRVSPAVSHALWYVALALTALVSSTYLLKVVFYLEAVRREFY  329

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFLALG P  V   +H  +WY  MAPI CL+LKIYGQWMSGGQRR
Sbjct  330  HPVRANFFFAPWIACLFLALGAPRLVVAEMHRGVWYALMAPILCLELKIYGQWMSGGQRR  389

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA MGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  390  LSKVANPSNHLSVVGNFVGALLGARMGLREGPVFFFAVGLAHYLVLFVTLYQRLPTNVTL  449

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  450  PKELHPVFFLFVAAPSVASMAWAKINGQFDNGARIAYFIALFL  492



>gb|EMT25796.1| Tellurite resistance protein tehA [Aegilops tauschii]
Length=618

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAIL+K +AT+  TEFLH++  VNLVLW ISV L SI+   YA K I +FEAVRREYY
Sbjct  269  SSQAILYKTIATAAPTEFLHVNPKVNLVLWFISVGLMSIITAAYAFKIIFFFEAVRREYY  328

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVPPSV   L   LWY  M+P  CL+LKIYGQWMSGGQRR
Sbjct  329  HPIRVNFFFAPWIACLFLAMGVPPSVATQLPPWLWYALMSPFLCLELKIYGQWMSGGQRR  388

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGAL+GA+MGLKEGPIFFF +G+AHY VLFVTLYQRLPTN TL
Sbjct  389  LSKVANPSNHLSVVGNFVGALMGASMGLKEGPIFFFGVGVAHYTVLFVTLYQRLPTNATL  448

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI   F   +K+AYFIA+FL
Sbjct  449  PKDLHPVFFLFVAAPSVASMAWAKIVDEFGVGAKLAYFIAMFL  491



>ref|NP_197791.1| SLAC1 homologue 3 [Arabidopsis thaliana]
 sp|Q9FLV9.1|SLAH3_ARATH RecName: Full=S-type anion channel SLAH3; AltName: Full=SLAC1-homolog 
protein 3 [Arabidopsis thaliana]
 dbj|BAB08726.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05487.1| At5g24030 [Arabidopsis thaliana]
 gb|AAU45219.1| At5g24030 [Arabidopsis thaliana]
 gb|AED93247.1| SLAC1 homologue 3 [Arabidopsis thaliana]
Length=635

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK IL+FEAVRREYY
Sbjct  270  SSQAIMWKTLATAEPTKFLHVPLWINQGLWFISVALILTIATIYLLKIILFFEAVRREYY  329

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPS+  +L   LWY+ M P  CL+LKIYGQWMSGGQRR
Sbjct  330  HPIRINFFFAPFISLLFLALGVPPSIITDLPHFLWYLLMFPFICLELKIYGQWMSGGQRR  389

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL++VGNFVGALLGA+MGL+EGPIFF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  390  LSRVANPTNHLSVVGNFVGALLGASMGLREGPIFFYAVGMAHYLVLFVTLYQRLPTNETL  449

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AK+ GSFD  SK+ YFIA+FL
Sbjct  450  PKDLHPVFFLFVAAPSVASMAWAKVTGSFDYGSKVCYFIAIFL  492



>ref|XP_002458185.1| hypothetical protein SORBIDRAFT_03g028360 [Sorghum bicolor]
 gb|EES03305.1| hypothetical protein SORBIDRAFT_03g028360 [Sorghum bicolor]
Length=661

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 190/223 (85%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P T FLH+S  V+  LW +++AL  +V+ IY LK + YFEAVRRE+Y
Sbjct  296  SSQAILWKTLASAPPTAFLHVSPVVSHALWYVALALMLLVSVIYLLKVVFYFEAVRREFY  355

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFL LG P  V E +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  356  HPIRANFFFAPWIACLFLVLGAPRLVAE-MHHGVWYAVMAPIFCLELKIYGQWMSGGQRR  414

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGPIFFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  415  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPIFFFAVGLAHYMVLFVTLYQRLPTNVTL  474

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD  ++IAYFIALFL
Sbjct  475  PKELHPVFFLFVAAPSVASMAWAKINGQFDAGARIAYFIALFL  517



>ref|XP_006645664.1| PREDICTED: S-type anion channel SLAH3-like [Oryza brachyantha]
Length=707

 Score =   348 bits (893),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW +SVAL  +V+ +YA K + YFEAVRREYY
Sbjct  358  SSQAILWKRIAISASTRFLHITVKINLVLWCVSVALMCVVSALYACKVVFYFEAVRREYY  417

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFLA G PP V  NL   LWY+ MAP+ CL+LKIYGQW+SGGQRR
Sbjct  418  HPVRVNFFFAPWIACLFLAAGGPPVVAANLPHWLWYLLMAPLVCLELKIYGQWISGGQRR  477

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLGA MGL+EGPIFFFA+GLAHY VLFVTLYQRLPT+ETL
Sbjct  478  LSRVANPSNHLSIVGNFVGALLGAIMGLREGPIFFFAVGLAHYTVLFVTLYQRLPTSETL  537

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S+IAYFIA+FL
Sbjct  538  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRIAYFIAMFL  580



>ref|XP_002439460.1| hypothetical protein SORBIDRAFT_09g007180 [Sorghum bicolor]
 gb|EES17890.1| hypothetical protein SORBIDRAFT_09g007180 [Sorghum bicolor]
Length=628

 Score =   345 bits (886),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A+S  T FLH++  VNLVLW ISV L   +  +YALK   +FEAVRREYY
Sbjct  280  SSQAILWKTIASSSPTMFLHVTHKVNLVLWCISVVLMCAITAVYALKVAFFFEAVRREYY  339

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWI  LFL +GVPPSV  E L   LWY  MAP+  L+LKIYGQWMSGGQR
Sbjct  340  HPIRVNFFFAPWIACLFLVIGVPPSVAREPLPQWLWYALMAPVLTLELKIYGQWMSGGQR  399

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA+MGLKEGP+FFF++GLAHY VLFVTLYQRLPTNET
Sbjct  400  RLSKVANPSNHLSVVGNFVGALLGASMGLKEGPVFFFSVGLAHYTVLFVTLYQRLPTNET  459

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMALAK+ G F    ++AYFIA+FL
Sbjct  460  LPKELHPVFFLFVAAPSVASMALAKLTGEFGFGPRVAYFIAMFL  503



>ref|XP_008656670.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Zea mays]
Length=668

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P+T FL +S  V+  LW +++AL ++V+  Y LK + Y EAVRRE+Y
Sbjct  304  SSQAILWKTLASAPATAFLRVSPAVSHALWYVALALTALVSSTYLLKVVFYLEAVRREFY  363

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFLALG P  V   +H  +WY  MAPI CL+LKIYGQWMSGGQRR
Sbjct  364  HPVRANFFFAPWIACLFLALGAPRLVVAEMHRGVWYALMAPILCLELKIYGQWMSGGQRR  423

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA MGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  424  LSKVANPSNHLSVVGNFVGALLGARMGLREGPVFFFAVGLAHYLVLFVTLYQRLPTNVTL  483

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  484  PKELHPVFFLFVAAPSVASMAWAKINGQFDNGARIAYFIALFL  526



>ref|XP_008656671.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Zea mays]
Length=666

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P+T FL +S  V+  LW +++AL ++V+  Y LK + Y EAVRRE+Y
Sbjct  302  SSQAILWKTLASAPATAFLRVSPAVSHALWYVALALTALVSSTYLLKVVFYLEAVRREFY  361

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFLALG P  V   +H  +WY  MAPI CL+LKIYGQWMSGGQRR
Sbjct  362  HPVRANFFFAPWIACLFLALGAPRLVVAEMHRGVWYALMAPILCLELKIYGQWMSGGQRR  421

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA MGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  422  LSKVANPSNHLSVVGNFVGALLGARMGLREGPVFFFAVGLAHYLVLFVTLYQRLPTNVTL  481

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  482  PKELHPVFFLFVAAPSVASMAWAKINGQFDNGARIAYFIALFL  524



>ref|XP_004967438.1| PREDICTED: S-type anion channel SLAH3-like isoform X1 [Setaria 
italica]
Length=625

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI+  VNLVLW +SVAL + V  +YA K + YFEAVRREYY
Sbjct  272  SSQAILWKRIAISASTRFLHITAKVNLVLWCVSVALMAAVWALYACKVVFYFEAVRREYY  331

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP +V  +L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  332  HPIRVNFFFAPWIACLFLAIGVPDAVAASLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  391

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLG  MGLKEGP+FFFA+GLAHY VLFVTLYQRLPT+ETL
Sbjct  392  LSRVANPSNHLSIVGNFVGALLGGIMGLKEGPMFFFAVGLAHYTVLFVTLYQRLPTSETL  451

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  452  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  494



>gb|AFW83321.1| hypothetical protein ZEAMMB73_457129 [Zea mays]
Length=678

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++P+T FL +S  V+  LW +++AL ++V+  Y LK + Y EAVRRE+Y
Sbjct  314  SSQAILWKTLASAPATAFLRVSPAVSHALWYVALALTALVSSTYLLKVVFYLEAVRREFY  373

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFLALG P  V   +H  +WY  MAPI CL+LKIYGQWMSGGQRR
Sbjct  374  HPVRANFFFAPWIACLFLALGAPRLVVAEMHRGVWYALMAPILCLELKIYGQWMSGGQRR  433

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGALLGA MGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  434  LSKVANPSNHLSVVGNFVGALLGARMGLREGPVFFFAVGLAHYLVLFVTLYQRLPTNVTL  493

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD+ ++IAYFIALFL
Sbjct  494  PKELHPVFFLFVAAPSVASMAWAKINGQFDNGARIAYFIALFL  536



>ref|NP_001054944.1| Os05g0219900 [Oryza sativa Japonica Group]
 gb|AAT07553.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16858.1| Os05g0219900 [Oryza sativa Japonica Group]
 gb|EEE62777.1| hypothetical protein OsJ_17580 [Oryza sativa Japonica Group]
Length=622

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 187/224 (83%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATS  T FLH++  VNLVLW +SVAL   ++  Y  K + +FEAVRREYY
Sbjct  271  SSQAILWKTIATSGPTAFLHVTTKVNLVLWCVSVALMCAISATYGAKVVFFFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSS-LWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWI  LFL +GVP SV   L    LWY  MAP+ CL+LKIYGQWMSGGQR
Sbjct  331  HPIRVNFFFAPWIACLFLTIGVPDSVAPTLLPHWLWYALMAPVLCLELKIYGQWMSGGQR  390

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA+MGL+EGP+FFFA+G+AHY VLFVTLYQRLPTNET
Sbjct  391  RLSKVANPSNHLSVVGNFVGALLGASMGLREGPVFFFAVGMAHYSVLFVTLYQRLPTNET  450

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMA A+I G F   S++AYFIA+FL
Sbjct  451  LPKELHPVFFLFVAAPSVASMAWARITGEFGLGSRVAYFIAMFL  494



>ref|XP_004967439.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Setaria 
italica]
 ref|XP_004967440.1| PREDICTED: S-type anion channel SLAH3-like isoform X3 [Setaria 
italica]
Length=612

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI+  VNLVLW +SVAL + V  +YA K + YFEAVRREYY
Sbjct  259  SSQAILWKRIAISASTRFLHITAKVNLVLWCVSVALMAAVWALYACKVVFYFEAVRREYY  318

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP +V  +L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  319  HPIRVNFFFAPWIACLFLAIGVPDAVAASLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  378

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLG  MGLKEGP+FFFA+GLAHY VLFVTLYQRLPT+ETL
Sbjct  379  LSRVANPSNHLSIVGNFVGALLGGIMGLKEGPMFFFAVGLAHYTVLFVTLYQRLPTSETL  438

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  439  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  481



>ref|NP_001147966.1| LOC100281575 [Zea mays]
 gb|ACG29271.1| C4-dicarboxylate transporter/malic acid transport protein [Zea 
mays]
Length=634

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A+S  T FLH+S  VNLVLW ISV L   +  +YALK   +FEAVRREYY
Sbjct  290  SSQAILWKTIASSSPTTFLHVSHKVNLVLWCISVLLMCAITAVYALKLAFFFEAVRREYY  349

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV-TENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+R+NFFFAPWI  LFLA+GVPPSV TE L   LWY  MAP+  ++LKIYGQWMSGGQR
Sbjct  350  HPIRINFFFAPWIACLFLAIGVPPSVATEPLPQWLWYALMAPVLFMELKIYGQWMSGGQR  409

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA MGL+EGP+FFF++GLAHY VLFVTLYQRLPTNET
Sbjct  410  RLSKVANPSNHLSVVGNFVGALLGANMGLREGPVFFFSVGLAHYSVLFVTLYQRLPTNET  469

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMA AKI G F    ++AYFIA+FL
Sbjct  470  LPKELHPVFFLFVAAPSVASMAWAKITGEFGYGPRVAYFIAMFL  513



>gb|AAT47062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG97189.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA+ PST FLHISL VN VLW +SVAL ++V+ IY LK + YFEAVRRE++
Sbjct  6    SSQAMLWKTLASEPSTAFLHISLDVNHVLWWVSVALMALVSAIYLLKVVFYFEAVRREFH  65

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +W++ MAPI  LDLKIYGQWMSGG+RR
Sbjct  66   HPIRVNFFFAPWIACLFLVKGLPRQVW-TIHHVVWFLLMAPILLLDLKIYGQWMSGGERR  124

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA MGL+EGPIFF A+GL HYIVLFVTLYQRLPTN  L
Sbjct  125  LSKVANPSNHLAIVGNFVGALLGARMGLREGPIFFLAVGLVHYIVLFVTLYQRLPTNVQL  184

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA A++ G FD  ++IAYF+ALFL
Sbjct  185  PKELHPVFFLFIAAPSVASMAWARLTGEFDFGARIAYFVALFL  227



>ref|XP_008647808.1| PREDICTED: LOC100281575 isoform X1 [Zea mays]
 ref|XP_008647809.1| PREDICTED: LOC100281575 isoform X1 [Zea mays]
 ref|XP_008647810.1| PREDICTED: LOC100281575 isoform X1 [Zea mays]
 ref|XP_008647811.1| PREDICTED: LOC100281575 isoform X1 [Zea mays]
 gb|AFW77536.1| C4-dicarboxylate transporter/malic acid transport protein isoform 
1 [Zea mays]
 gb|AFW77537.1| C4-dicarboxylate transporter/malic acid transport protein isoform 
2 [Zea mays]
Length=636

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A+S  T FLH+S  VNLVLW ISV L   +  +YALK   +FEAVRREYY
Sbjct  292  SSQAILWKTIASSSPTTFLHVSHKVNLVLWCISVLLMCAITAVYALKLAFFFEAVRREYY  351

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV-TENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWI  LFLA+GVPPSV TE L   LWY  MAP+  ++LKIYGQWMSGGQR
Sbjct  352  HPIRVNFFFAPWIACLFLAIGVPPSVATEPLPRWLWYALMAPVLFMELKIYGQWMSGGQR  411

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA MGL+EGP+FFF++GLAHY VLFVTLYQRLPTNET
Sbjct  412  RLSKVANPSNHLSVVGNFVGALLGANMGLREGPVFFFSVGLAHYSVLFVTLYQRLPTNET  471

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMA AKI G F    ++AYFIA+FL
Sbjct  472  LPKELHPVFFLFVAAPSVASMAWAKITGEFGYGPRVAYFIAMFL  515



>gb|EAY97003.1| hypothetical protein OsI_18925 [Oryza sativa Indica Group]
Length=622

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 187/224 (83%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +ATS  T FLH++  VNLVLW +S+AL   V+  Y  K + +FEAVRREYY
Sbjct  271  SSQAILWKTIATSGPTAFLHVTTKVNLVLWCVSMALMCAVSATYGAKVVFFFEAVRREYY  330

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWI  LFL +GVP SV    L   LWY  MAP+ CL+LKIYGQWMSGGQR
Sbjct  331  HPIRVNFFFAPWIACLFLTIGVPDSVAPTPLPHWLWYALMAPVLCLELKIYGQWMSGGQR  390

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA+MGL+EGP+FFFA+G+AHY VLFVTLYQRLPTNET
Sbjct  391  RLSKVANPSNHLSVVGNFVGALLGASMGLREGPVFFFAVGMAHYSVLFVTLYQRLPTNET  450

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMA A+I G F   S++AYFIA+FL
Sbjct  451  LPKELHPVFFLFVAAPSVASMAWARITGEFGLGSRVAYFIAMFL  494



>ref|XP_009130091.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Brassica 
rapa]
Length=569

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAI+WK LAT+  T+FLH+SL ++  LW ISVAL  I+A IY LK ILYFEAVRREYYH
Sbjct  207  SQAIMWKTLATAKPTKFLHVSLWIHRSLWFISVALVLIIATIYLLKIILYFEAVRREYYH  266

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+R+NFFFAP+I +LFLAL VPP +  +L   LWYV M P  CL+LKIYGQWMSGGQRRL
Sbjct  267  PIRINFFFAPFISLLFLALAVPPFIVTDLPQFLWYVLMFPFICLELKIYGQWMSGGQRRL  326

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            S+VANP+NHLAIVGNFVGALLGA MGL+EGPIFFF +G+AHY+VLFVTLYQRLPTNETLP
Sbjct  327  SRVANPTNHLAIVGNFVGALLGARMGLREGPIFFFTVGMAHYLVLFVTLYQRLPTNETLP  386

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            K+LHPVFFLFVAAPSVASMA A I GSF+  SK+ YFIA+FL
Sbjct  387  KDLHPVFFLFVAAPSVASMAWATITGSFNYGSKVCYFIAMFL  428



>emb|CDX88065.1| BnaA06g26560D [Brassica napus]
Length=745

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+  T+FLH+ L +N  LW ISVAL   +A IY LK ILYFEAVRREYY
Sbjct  380  SSQAIMWKTLATAEPTKFLHVPLWINQALWFISVALVFTIAIIYLLKIILYFEAVRREYY  439

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAP+I +LFLALGVPPSV   L   LW + M P  CL+LKIYGQWMSGGQRR
Sbjct  440  HPIRINFFFAPFISLLFLALGVPPSVMTELPQFLWCLLMFPFICLELKIYGQWMSGGQRR  499

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP+NHL+IVGNFVGALLGA+MGL+EGP+FF+A+G+AHY+VLFVTLYQRLPTNETL
Sbjct  500  LSRVANPTNHLSIVGNFVGALLGASMGLREGPMFFYAVGMAHYLVLFVTLYQRLPTNETL  559

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI GSFD  SK+ YFIA+FL
Sbjct  560  PKDLHPVFFLFVAAPSVASMAWAKITGSFDYGSKVCYFIAIFL  602



>ref|XP_008656325.1| PREDICTED: S-type anion channel SLAH3-like [Zea mays]
Length=384

 Score =   336 bits (861),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 187/224 (83%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A+S  T FLH++  VNLVLW IS  L   +  +YALK  ++FEAVRREYY
Sbjct  42   SSQAILWKTIASSSPTMFLHVTHKVNLVLWCISAVLMCGITAVYALKIAIFFEAVRREYY  101

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPWI  LFLA+GVPPSV  E L   LWY  MAP+  L+LKIYGQWMSGGQR
Sbjct  102  HPVRVNFFFAPWITCLFLAIGVPPSVAKEPLPHWLWYALMAPMLILELKIYGQWMSGGQR  161

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++VGNFVGALLGA+MGL +GP+FFF++GLAHY VLFVTLYQRLPTNET
Sbjct  162  RLSKVANPSNHLSVVGNFVGALLGASMGLSDGPVFFFSVGLAHYSVLFVTLYQRLPTNET  221

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPVFFLFVAAPSVASMA A+I G F    ++AYFIA+FL
Sbjct  222  LPKELHPVFFLFVAAPSVASMAWARITGEFGYGPRVAYFIAMFL  265



>ref|XP_008675325.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 ref|XP_008675326.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 ref|XP_008675327.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 ref|XP_008675328.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 ref|XP_008675329.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 ref|XP_008675330.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 ref|XP_008675331.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
Length=630

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 189/223 (85%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++  T FLH+S  V+  LW  ++AL  +V+ IY LK + YFEAVRRE+Y
Sbjct  269  SSQAILWKTLASAAPTAFLHVSPAVSHALWYAALALTVLVSGIYLLKVVFYFEAVRREFY  328

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFLALG P  V E +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  329  HPIRANFFFAPWIACLFLALGAPRLVAE-MHHGVWYALMAPIFCLELKIYGQWMSGGQRR  387

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  388  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPVFFFAVGLAHYMVLFVTLYQRLPTNMTL  447

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD  ++IAYFIALFL
Sbjct  448  PKELHPVFFLFVAAPSVASMAWAKINGQFDAGARIAYFIALFL  490



>tpg|DAA58508.1| TPA: hypothetical protein ZEAMMB73_461258 [Zea mays]
Length=667

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 189/223 (85%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK LA++  T FLH+S  V+  LW  ++AL  +V+ IY LK + YFEAVRRE+Y
Sbjct  306  SSQAILWKTLASAAPTAFLHVSPAVSHALWYAALALTVLVSGIYLLKVVFYFEAVRREFY  365

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPWI  LFLALG P  V E +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  366  HPIRANFFFAPWIACLFLALGAPRLVAE-MHHGVWYALMAPIFCLELKIYGQWMSGGQRR  424

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  425  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPVFFFAVGLAHYMVLFVTLYQRLPTNMTL  484

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA AKI+G FD  ++IAYFIALFL
Sbjct  485  PKELHPVFFLFVAAPSVASMAWAKINGQFDAGARIAYFIALFL  527



>ref|NP_001056453.2| Os05g0584900 [Oryza sativa Japonica Group]
 dbj|BAF18367.2| Os05g0584900, partial [Oryza sativa Japonica Group]
Length=410

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA+ PST FLHISL VN VLW +SVAL ++V+ IY LK + YFEAVRRE++
Sbjct  39   SSQAMLWKTLASEPSTAFLHISLDVNHVLWWVSVALMALVSAIYLLKVVFYFEAVRREFH  98

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +W++ MAPI  LDLKIYGQWMSGG+RR
Sbjct  99   HPIRVNFFFAPWIACLFLVKGLPRQVW-TIHHVVWFLLMAPILLLDLKIYGQWMSGGERR  157

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA MGL+EGPIFF A+GL HYIVLFVTLYQRLPTN  L
Sbjct  158  LSKVANPSNHLAIVGNFVGALLGARMGLREGPIFFLAVGLVHYIVLFVTLYQRLPTNVQL  217

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA A++ G FD  ++IAYF+ALFL
Sbjct  218  PKELHPVFFLFIAAPSVASMAWARLTGEFDFGARIAYFVALFL  260



>ref|XP_009130088.1| PREDICTED: S-type anion channel SLAH3-like isoform X1 [Brassica 
rapa]
 ref|XP_009130090.1| PREDICTED: S-type anion channel SLAH3-like isoform X1 [Brassica 
rapa]
Length=640

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAI+WK LAT+  T+FLH+SL ++  LW ISVAL  I+A IY LK ILYFEAVRREYYH
Sbjct  278  SQAIMWKTLATAKPTKFLHVSLWIHRSLWFISVALVLIIATIYLLKIILYFEAVRREYYH  337

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+R+NFFFAP+I +LFLAL VPP +  +L   LWYV M P  CL+LKIYGQWMSGGQRRL
Sbjct  338  PIRINFFFAPFISLLFLALAVPPFIVTDLPQFLWYVLMFPFICLELKIYGQWMSGGQRRL  397

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            S+VANP+NHLAIVGNFVGALLGA MGL+EGPIFFF +G+AHY+VLFVTLYQRLPTNETLP
Sbjct  398  SRVANPTNHLAIVGNFVGALLGARMGLREGPIFFFTVGMAHYLVLFVTLYQRLPTNETLP  457

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            K+LHPVFFLFVAAPSVASMA A I GSF+  SK+ YFIA+FL
Sbjct  458  KDLHPVFFLFVAAPSVASMAWATITGSFNYGSKVCYFIAMFL  499



>gb|EMS57353.1| S-type anion channel SLAH3 [Triticum urartu]
Length=634

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAIL+K +AT+  TEFLH++  VNLVLW ISV L SI+   YA K + +FEAVRREYY
Sbjct  284  SSQAILYKTIATAAPTEFLHVNPKVNLVLWFISVGLMSIITAAYAFKIVFFFEAVRREYY  343

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVPP V   L + LWY  M+P  CL+LKIYGQWMSGGQRR
Sbjct  344  HPIRVNFFFAPWIACLFLAMGVPPFVATQLPTWLWYALMSPFLCLELKIYGQWMSGGQRR  403

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL++VGNFVGAL+GA+MGLKEGPIFFF +G+AHY VLFVTLYQRLPTN TL
Sbjct  404  LSKVANPSNHLSVVGNFVGALMGASMGLKEGPIFFFGVGVAHYTVLFVTLYQRLPTNATL  463

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVAAPSVASMA AKI   F   +K+AYFIA+FL
Sbjct  464  PKDLHPVFFLFVAAPSVASMAWAKIVDEFGVGAKLAYFIAMFL  506



>ref|XP_008673492.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Zea mays]
Length=666

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW  SVAL + V+ +Y  K +LYFEAVRREYY
Sbjct  306  SSQAILWKRIAISASTRFLHITVKINLVLWCASVALMAAVSALYGCKLVLYFEAVRREYY  365

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V   L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  366  HPIRVNFFFAPWIACLFLAIGVPDVVAATLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  425

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLG  MGLKEGP+FFF++GLAHY+VLFVTLYQRLPT+ETL
Sbjct  426  LSRVANPSNHLSIVGNFVGALLGGIMGLKEGPMFFFSVGLAHYMVLFVTLYQRLPTSETL  485

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  486  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  528



>ref|XP_008673491.1| PREDICTED: S-type anion channel SLAH3-like isoform X1 [Zea mays]
Length=679

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW  SVAL + V+ +Y  K +LYFEAVRREYY
Sbjct  319  SSQAILWKRIAISASTRFLHITVKINLVLWCASVALMAAVSALYGCKLVLYFEAVRREYY  378

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V   L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  379  HPIRVNFFFAPWIACLFLAIGVPDVVAATLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  438

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLG  MGLKEGP+FFF++GLAHY+VLFVTLYQRLPT+ETL
Sbjct  439  LSRVANPSNHLSIVGNFVGALLGGIMGLKEGPMFFFSVGLAHYMVLFVTLYQRLPTSETL  498

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  499  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  541



>ref|XP_004969208.1| PREDICTED: S-type anion channel SLAH3-like isoform X1 [Setaria 
italica]
 ref|XP_004969209.1| PREDICTED: S-type anion channel SLAH3-like isoform X2 [Setaria 
italica]
 ref|XP_004969210.1| PREDICTED: S-type anion channel SLAH3-like isoform X3 [Setaria 
italica]
Length=640

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQ+ILWK LA++P T FLH+S  VN VLW +++AL  +++ IY LK + YFEAVRRE+Y
Sbjct  279  SSQSILWKTLASAPPTAFLHVSPVVNHVLWYVALALMVLISAIYLLKVVFYFEAVRREFY  338

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R NFFFAPW+  LFL LG P  V E +H  +WY  MAPIFCL+LKIYGQWMSGGQRR
Sbjct  339  HPIRANFFFAPWVACLFLVLGAPRLVAE-MHHGVWYGLMAPIFCLELKIYGQWMSGGQRR  397

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHL+IVGNFVGALLGA MGL+EGP FFFA+GLAHY+VLFVTLYQRLPTN TL
Sbjct  398  LSKVANPSNHLSIVGNFVGALLGAKMGLREGPTFFFAVGLAHYMVLFVTLYQRLPTNVTL  457

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVA PSVASMA AKI+G FD  ++I +FIALFL
Sbjct  458  PKELHPVFFLFVAPPSVASMAWAKINGQFDAGARIGFFIALFL  500



>ref|XP_006589515.1| PREDICTED: S-type anion channel SLAH3-like [Glycine max]
 gb|KHN21802.1| S-type anion channel SLAH3 [Glycine soja]
Length=561

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKALATSPST FLHI+  +N +LW IS+A+ + +   Y  K IL+FEAVRREY 
Sbjct  233  SSQAILWKALATSPSTAFLHITPKINFILWFISIAIVATIFTTYLFKIILHFEAVRREYQ  292

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI +LFLALGVPPSVT++LH ++WY+ M P+FCL LKIYGQWM GG+R 
Sbjct  293  HPVRVNFFFAPWIALLFLALGVPPSVTKDLHQAVWYILMIPLFCLKLKIYGQWMFGGKRL  352

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+N LAIVGNFVGALLGA+MGLKEGP+FFFA+GLAHY+VLFVTL Q LPTN+T+
Sbjct  353  LSKVANPTNLLAIVGNFVGALLGASMGLKEGPLFFFALGLAHYMVLFVTLSQMLPTNKTI  412

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHPVFFLFVA PSVA+MA AKI GSF   S+I YF A+FL
Sbjct  413  PKDLHPVFFLFVAPPSVAAMAWAKIQGSFHYESRIFYFTAMFL  455



>tpg|DAA52784.1| TPA: hypothetical protein ZEAMMB73_023139 [Zea mays]
Length=740

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S ST FLHI++ +NLVLW  SVAL + V+ +Y  K +LYFEAVRREYY
Sbjct  380  SSQAILWKRIAISASTRFLHITVKINLVLWCASVALMAAVSALYGCKLVLYFEAVRREYY  439

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA+GVP  V   L   LWYV MAPI CL+LKIYGQW+SGGQRR
Sbjct  440  HPIRVNFFFAPWIACLFLAIGVPDVVAATLPHWLWYVLMAPIVCLELKIYGQWISGGQRR  499

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANPSNHL+IVGNFVGALLG  MGLKEGP+FFF++GLAHY+VLFVTLYQRLPT+ETL
Sbjct  500  LSRVANPSNHLSIVGNFVGALLGGIMGLKEGPMFFFSVGLAHYMVLFVTLYQRLPTSETL  559

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVAAPSVA +A A+I G F   S++AYFIA+FL
Sbjct  560  PRDLHPVFFLFVAAPSVACLAWARITGEFGYGSRVAYFIAMFL  602



>ref|XP_006284985.1| hypothetical protein CARUB_v10006291mg [Capsella rubella]
 gb|EOA17883.1| hypothetical protein CARUB_v10006291mg [Capsella rubella]
Length=518

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  153  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLVLLLAVSITYLLKTILYFEAVRREFR  212

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  213  HPIRVNFFFAPLISVLFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  272

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  273  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  332

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  333  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  375



>ref|XP_010438526.1| PREDICTED: S-type anion channel SLAH2-like isoform X3 [Camelina 
sativa]
Length=520

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  154  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  376



>ref|XP_006655637.1| PREDICTED: S-type anion channel SLAH3-like [Oryza brachyantha]
Length=410

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 185/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            +SQA+LWK LAT PST FL +S  VN  LW +SVAL  +V+ IY LK + YFEAVRRE++
Sbjct  39   TSQAMLWKTLATEPSTAFLGVSPDVNHALWWLSVALMVLVSAIYLLKVVFYFEAVRREFH  98

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G P  V   +H  +W++ MAPIF LDLKIYGQWMSGG+RR
Sbjct  99   HPIRVNFFFAPWIACLFLVKGSPRPV-WTIHHVVWFLLMAPIFLLDLKIYGQWMSGGERR  157

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA MGL+EGPIFFFA+GL HYIVLFVTLYQRLPTN  L
Sbjct  158  LSKVANPSNHLAIVGNFVGALLGARMGLREGPIFFFAVGLVHYIVLFVTLYQRLPTNVQL  217

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA A++ G FD  +++AYF+ALFL
Sbjct  218  PKELHPVFFLFIAAPSVASMAWARLRGEFDMGARVAYFVALFL  260



>ref|XP_010433282.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Camelina 
sativa]
 ref|XP_010433283.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Camelina 
sativa]
Length=517

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  154  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  376



>ref|XP_010433284.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Camelina 
sativa]
Length=516

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  153  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  212

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  213  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  272

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  273  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  332

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  333  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  375



>gb|EEE64847.1| hypothetical protein OsJ_19704 [Oryza sativa Japonica Group]
Length=602

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA+ PST FLHISL VN VLW +SVAL ++V+ IY LK + YFEAVRRE++
Sbjct  231  SSQAMLWKTLASEPSTAFLHISLDVNHVLWWVSVALMALVSAIYLLKVVFYFEAVRREFH  290

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +W++ MAPI  LDLKIYGQWMSGG+RR
Sbjct  291  HPIRVNFFFAPWIACLFLVKGLPRQVW-TIHHVVWFLLMAPILLLDLKIYGQWMSGGERR  349

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA MGL+EGPIFF A+GL HYIVLFVTLYQRLPTN  L
Sbjct  350  LSKVANPSNHLAIVGNFVGALLGARMGLREGPIFFLAVGLVHYIVLFVTLYQRLPTNVQL  409

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA A++ G FD  ++IAYF+ALFL
Sbjct  410  PKELHPVFFLFIAAPSVASMAWARLTGEFDFGARIAYFVALFL  452



>ref|XP_010438525.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Camelina 
sativa]
Length=522

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  154  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  376



>ref|XP_010448054.1| PREDICTED: S-type anion channel SLAH2 [Camelina sativa]
Length=517

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  154  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  376



>gb|EAY99207.1| hypothetical protein OsI_21165 [Oryza sativa Indica Group]
Length=619

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 188/223 (84%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK LA+ PST FLHISL VN VLW +SVAL ++V+ IY LK + YFEAVRRE++
Sbjct  231  SSQAMLWKTLASEPSTAFLHISLDVNHVLWWVSVALMALVSAIYLLKVVFYFEAVRREFH  290

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +W++ MAPI  LDLKIYGQWMSGG+RR
Sbjct  291  HPIRVNFFFAPWIACLFLVKGLPRQVW-TIHHVVWFLLMAPILLLDLKIYGQWMSGGERR  349

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA MGL+EGPIFF A+GL HYIVLFVTLYQRLPTN  L
Sbjct  350  LSKVANPSNHLAIVGNFVGALLGARMGLREGPIFFLAVGLVHYIVLFVTLYQRLPTNVQL  409

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVASMA A++ G FD  ++IAYF+ALFL
Sbjct  410  PKELHPVFFLFIAAPSVASMAWARLTGEFDFGARIAYFVALFL  452



>ref|XP_002867476.1| C4-dicarboxylate transporter/malic acid transport family protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH43735.1| C4-dicarboxylate transporter/malic acid transport family protein 
[Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  152  SSQAIMWKTLATTNAEKFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  211

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  212  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  271

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA+MGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  272  LSKVANPTNHLSIVGNFAGALLGASMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  331

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  332  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  374



>ref|XP_010537128.1| PREDICTED: S-type anion channel SLAH2 [Tarenaya hassleriana]
Length=533

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 186/223 (83%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FL+++   N  LW IS+ L    +  Y LK  LYFEAVRRE+ 
Sbjct  170  SSQAIMWKTLATTEAEKFLNVTQMTNHALWWISLFLLLAFSSAYILKAFLYFEAVRREFQ  229

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I  LFLALG+P S+  +L   LWY+ MAPI CL+LKIYGQWMSGGQRR
Sbjct  230  HPIRVNFFFAPLISTLFLALGIPHSIVSDLPKILWYILMAPILCLELKIYGQWMSGGQRR  289

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIG++HY+VLFVTLYQRLPTNETL
Sbjct  290  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGMSHYLVLFVTLYQRLPTNETL  349

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI GSFD  S+ AYFI+LFL
Sbjct  350  PKELHPVFFLFVAAPAVASMAWTKISGSFDLGSRFAYFISLFL  392



>gb|EMS66940.1| S-type anion channel SLAH2 [Triticum urartu]
Length=640

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 185/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST+FLH+    N VLW ISVAL  +V+  Y LK + YFEAVRRE++
Sbjct  264  SSQAMLWKTLESEPSTKFLHVHPATNHVLWWISVALMVVVSITYLLKVVFYFEAVRREFH  323

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  GVP  V E +H ++WY+ MAPI CLDLKIYGQWMS G+RR
Sbjct  324  HPVRVNFFFAPWIACLFLVKGVPHPVWE-IHHAVWYLLMAPILCLDLKIYGQWMSSGERR  382

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLAIVGNFVGALLGA MGL+E PIFFFA+GLAHY+VLFVTLYQRLPTN  L
Sbjct  383  LSKVANPSNHLAIVGNFVGALLGARMGLRELPIFFFAVGLAHYVVLFVTLYQRLPTNAQL  442

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  +I G F+D SK+ YF++LFL
Sbjct  443  PKELHPVFFLFVAAPSVASMAWTRICGEFNDGSKLLYFVSLFL  485



>gb|EMS66941.1| S-type anion channel SLAH2 [Triticum urartu]
Length=564

 Score =   333 bits (854),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L T PST+FLH+   VN VLW +SVAL  +V+  Y LK + YFEAVRRE++
Sbjct  188  SSQAMLWKTLQTEPSTKFLHVHPVVNHVLWWVSVALMGVVSITYLLKIVFYFEAVRREFH  247

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  G+P  V E +H ++WYV MAPI CLDLKIYGQWMS G+RR
Sbjct  248  HPVRVNFFFAPWIACLFLVKGLPHPVWE-IHHAVWYVLMAPILCLDLKIYGQWMSSGERR  306

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY+VLFVTLYQRLPTN  L
Sbjct  307  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYVVLFVTLYQRLPTNVQL  366

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  +I G F++ +K+ YF++LFL
Sbjct  367  PKELHPVFFLFVAAPSVASMAWTRISGEFNNGAKLLYFVSLFL  409



>ref|XP_010438524.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Camelina 
sativa]
Length=549

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  +N VLW IS+ L   V+  Y LKTILYFEAVRRE+ 
Sbjct  154  SSQAIMWKTLATTNAERFLHVTQVINHVLWWISLLLLLAVSITYLLKTILYFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGATMGLKEGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LSKVANPTNHLSIVGNFAGALLGATMGLKEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  376



>gb|EMT04852.1| hypothetical protein F775_18329 [Aegilops tauschii]
Length=604

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST+FLH+    N VLW ISVAL  +V+  Y LK + YFEAVRRE++
Sbjct  228  SSQAMLWKTLESEPSTKFLHVHPATNHVLWWISVALMVVVSITYLLKVVFYFEAVRREFH  287

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  GVP  V E +H ++WYV MAPI CLDLKIYGQWMS G+RR
Sbjct  288  HPVRVNFFFAPWIACLFLVKGVPHPVWE-IHHAVWYVLMAPILCLDLKIYGQWMSSGERR  346

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY VLFVTLYQRLPTN  L
Sbjct  347  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYAVLFVTLYQRLPTNVQL  406

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  +I G F+D +K+ YFI+LFL
Sbjct  407  PKELHPVFFLFVAAPSVASMAWTRISGEFNDGAKLLYFISLFL  449



>emb|CDY29871.1| BnaA03g48920D [Brassica napus]
Length=497

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SS AI+WK LAT+ + +FLH++  VN VLW IS+ L   V+  Y  KTI +FEAVRRE+ 
Sbjct  154  SSHAIMWKTLATTDAEKFLHVTQVVNHVLWWISLVLLIAVSITYLFKTIFFFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T +L + LWY FMAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLITVLFLALGIPHSITSSLPTILWYFFMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGP+FFF+IGLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPMFFFSIGLAYYMVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYF +LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISDSFDLGSRLAYFASLFL  376



>ref|NP_567792.1| SLAC1 homologue 2 [Arabidopsis thaliana]
 sp|Q9ASQ7.1|SLAH2_ARATH RecName: Full=S-type anion channel SLAH2; AltName: Full=SLAC1-homolog 
protein 2 [Arabidopsis thaliana]
 gb|AAK32924.1|AF367337_1 AT4g27970/T13J8_80 [Arabidopsis thaliana]
 gb|AAN72249.1| At4g27970/T13J8_80 [Arabidopsis thaliana]
 gb|AEE85415.1| SLAC1 homologue 2 [Arabidopsis thaliana]
Length=519

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  +N VLW IS+ L   V+  Y  KTIL+FEAVRRE+ 
Sbjct  155  SSQAIMWKTLATTEAEKFLHVTQVINHVLWWISLLLLLAVSITYLFKTILFFEAVRREFR  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA+MGLKEGPIFFFAIGLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLSIVGNFAGALLGASMGLKEGPIFFFAIGLAYYLVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  377



>emb|CDX84361.1| BnaC03g51390D [Brassica napus]
Length=390

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  VN VLW IS+ L    +  Y  KTI +FEAVRRE+ 
Sbjct  30   SSQAIMWKTLATTKAEKFLHLTQVVNHVLWWISLVLLLSFSITYLFKTIFFFEAVRREFK  89

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T NL S LWY  MAP+  L++KIYGQWMSGGQRR
Sbjct  90   HPIRVNFFFAPLISVLFLALGIPHSITSNLPSMLWYFLMAPVLFLEMKIYGQWMSGGQRR  149

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA++GLKEGP+FFF++GLA+Y+VLFVTLYQRLPTNETL
Sbjct  150  LSKVANPTNHLSIVGNFAGALLGASLGLKEGPMFFFSVGLAYYLVLFVTLYQRLPTNETL  209

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA   I  SFD  S+IAYFI+LFL
Sbjct  210  PKELHPVFFLFVAAPAVASMAWTTISASFDIGSRIAYFISLFL  252



>ref|XP_004961072.1| PREDICTED: S-type anion channel SLAH3-like [Setaria italica]
Length=612

 Score =   332 bits (851),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 185/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + P+T FL +S  VN  LW++SVAL  +V+ IY LK + YFEAVRRE+Y
Sbjct  250  SSQAMLWKTLQSEPATAFLRVSPDVNHALWLVSVALMGVVSAIYLLKVVFYFEAVRREFY  309

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +WYV MAPIFCLDLKIYGQWMSGG RR
Sbjct  310  HPIRVNFFFAPWIACLFLVKGLPRPVW-TIHHVVWYVLMAPIFCLDLKIYGQWMSGGDRR  368

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP++HLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY+VLFVTLYQRLPTN  L
Sbjct  369  LSKVANPTSHLAVVGNFVGALLGARMGLREAPIFFFAVGLAHYMVLFVTLYQRLPTNVQL  428

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PK+LHP FFLFVAAPSVASMA A++ G F+  +KIAYFI+LFL
Sbjct  429  PKDLHPAFFLFVAAPSVASMAWARLCGEFNYGAKIAYFISLFL  471



>ref|XP_004963969.1| PREDICTED: S-type anion channel SLAH3-like [Setaria italica]
Length=588

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S  T FLH++   NLVLW +S AL   V   YA K+ LYFEAVRREYY
Sbjct  248  SSQAILWKVIALSVPTTFLHVTSKANLVLWCVSAALMLAVTATYACKSALYFEAVRREYY  307

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT--ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQ  316
            HP+RVNFFFAPWI  L+LA+GVP  +T    L   LWYV MAP+ CL LKIYGQWMSGGQ
Sbjct  308  HPIRVNFFFAPWITCLYLAIGVPHHLTWAARLPHWLWYVLMAPLLCLGLKIYGQWMSGGQ  367

Query  315  RRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNE  136
            RRLSKVANPSNHL+++GNFVGA LGATMGL+EGPIFFFA+GLAHY+VLFVTLYQRLPTNE
Sbjct  368  RRLSKVANPSNHLSLLGNFVGAQLGATMGLREGPIFFFAVGLAHYVVLFVTLYQRLPTNE  427

Query  135  TLPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            TLPKELHPVFFLFVAAPSV+S+A ++I G F   S++A+F+ +FL
Sbjct  428  TLPKELHPVFFLFVAAPSVSSVAWSRITGEFGYVSRVAFFVGMFL  472



>emb|CDX92855.1| BnaC07g41130D [Brassica napus]
Length=498

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SS AI+WK LAT+ + +FLH++  VN VLW IS+ L   V+  Y  KTI +FEAVRRE+ 
Sbjct  155  SSHAIMWKTLATTDAEKFLHVTQVVNHVLWWISLVLLIAVSITYLFKTIFFFEAVRREFM  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T +L S LWY  MAP+  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISVLFLALGIPHSITSSLPSILWYFLMAPVLFLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGP+FFF+IGLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPMFFFSIGLAYYMVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYF +LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFASLFL  377



>gb|EMS50811.1| S-type anion channel SLAH2 [Triticum urartu]
Length=511

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 183/223 (82%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST+FLH+   VN VLW ISVAL  +V+  Y LK + YFEAVRRE++
Sbjct  127  SSQAMLWKTLESEPSTKFLHVHPVVNHVLWWISVALMVVVSITYLLKIVFYFEAVRREFH  186

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFL  GVP  V E +H ++WYV MAPI CLDLKIYGQWMS  +RR
Sbjct  187  HPVRANFFFAPWIACLFLVKGVPHPVWE-IHHAVWYVLMAPILCLDLKIYGQWMSSDERR  245

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY+VLFVTLYQRLPTN  L
Sbjct  246  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYVVLFVTLYQRLPTNVQL  305

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  +I   F+D +K+ YF++LFL
Sbjct  306  PKELHPVFFLFVAAPSVASMAWTRISREFNDGAKLLYFVSLFL  348



>ref|XP_006413008.1| hypothetical protein EUTSA_v10024941mg [Eutrema salsugineum]
 gb|ESQ54461.1| hypothetical protein EUTSA_v10024941mg [Eutrema salsugineum]
Length=515

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  VN VLW IS+ L   V+  Y  KTI +FEAVRRE+ 
Sbjct  155  SSQAIMWKTLATTDAEKFLHMTQVVNHVLWWISLVLLVTVSITYLFKTIFFFEAVRREFR  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +L LALGVP S+T  L S LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISILLLALGVPHSITTTLPSILWYFLMAPILVLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA+MGL+EGP+FF+A+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLSIVGNFAGALLGASMGLEEGPMFFYAVGLAYYLVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA   I GSF+  S++AYFI+LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTNISGSFNIGSRLAYFISLFL  377



>ref|XP_009108675.1| PREDICTED: S-type anion channel SLAH2 [Brassica rapa]
Length=497

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SS AI+WK LAT+ + +FLH++  VN VLW IS+ L   V+  Y  KTI +FEAVRRE+ 
Sbjct  154  SSHAIMWKTLATTDAEKFLHVTQVVNHVLWWISLVLLIAVSITYLFKTIFFFEAVRREFR  213

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T +L S LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  214  HPIRVNFFFAPLISVLFLALGIPHSITSSLPSILWYFLMAPILFLEMKIYGQWMSGGQRR  273

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            L KVANP+NHL+IVGNFVGALLGA+MGLKEGP+FFF+IGLA+Y+VLFVTLYQRLPTNETL
Sbjct  274  LPKVANPTNHLSIVGNFVGALLGASMGLKEGPMFFFSIGLAYYMVLFVTLYQRLPTNETL  333

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYF +LFL
Sbjct  334  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFASLFL  376



>emb|CDX97408.1| BnaC08g12730D [Brassica napus]
Length=502

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  VN VLW IS+ L    +  Y  KTI +FEAVRRE+ 
Sbjct  142  SSQAIMWKTLATTKAEKFLHLTQVVNHVLWWISLVLLVSFSITYLFKTIFFFEAVRREFK  201

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T +L S LWY F+API  L++KIYGQWMSGGQRR
Sbjct  202  HPIRVNFFFAPLISVLFLALGIPHSITSSLPSILWYFFIAPILLLEMKIYGQWMSGGQRR  261

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA++GLKEGP+FFF++GLA+Y+VLFVTLYQRLPTNETL
Sbjct  262  LSKVANPTNHLSIVGNFAGALLGASLGLKEGPMFFFSVGLAYYLVLFVTLYQRLPTNETL  321

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA   I  SFD  S+IAYFI+LFL
Sbjct  322  PKELHPVFFLFVAAPAVASMAWTTISASFDIGSRIAYFISLFL  364



>ref|XP_009144107.1| PREDICTED: S-type anion channel SLAH2-like isoform X2 [Brassica 
rapa]
Length=483

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  VN VLW IS+ L   V+  Y  KTI +F+AVRRE+ 
Sbjct  130  SSQAIMWKTLATTNAERFLHLTQVVNHVLWWISLVLLLAVSITYLFKTIFFFQAVRREFK  189

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLF+ALG+P S+T NL S LWY  MAP+  L++KIYGQWMSGGQRR
Sbjct  190  HPIRVNFFFAPLISVLFIALGIPHSITSNLPSMLWYFLMAPVLFLEMKIYGQWMSGGQRR  249

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLAI+GNF GALLGA+MGL+EGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  250  LSKVANPTNHLAIIGNFAGALLGASMGLEEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  309

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  ++ GSFD  S+  YFI+LFL
Sbjct  310  PKELHPVFFLFVAAPAVASMAWTQLCGSFDLGSRFYYFISLFL  352



>ref|XP_009144103.1| PREDICTED: S-type anion channel SLAH2-like isoform X1 [Brassica 
rapa]
Length=508

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  VN VLW IS+ L   V+  Y  KTI +F+AVRRE+ 
Sbjct  155  SSQAIMWKTLATTNAERFLHLTQVVNHVLWWISLVLLLAVSITYLFKTIFFFQAVRREFK  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLF+ALG+P S+T NL S LWY  MAP+  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISVLFIALGIPHSITSNLPSMLWYFLMAPVLFLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLAI+GNF GALLGA+MGL+EGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLAIIGNFAGALLGASMGLEEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  ++ GSFD  S+  YFI+LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTQLCGSFDLGSRFYYFISLFL  377



>ref|XP_007143498.1| hypothetical protein PHAVU_007G076700g [Phaseolus vulgaris]
 gb|ESW15492.1| hypothetical protein PHAVU_007G076700g [Phaseolus vulgaris]
Length=578

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKALA SPSTEFLHI+  +N +LW+IS+A+ + +  IY  K +LYFEAVRREY+
Sbjct  234  SSQAILWKALAASPSTEFLHITPKINFILWLISIAVVATIFAIYLFKIVLYFEAVRREYH  293

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            H VRVNFFFAPWI +LFLALGVP SV + LH ++WY+ M P+F L LKIYGQWM GG+R 
Sbjct  294  HAVRVNFFFAPWISLLFLALGVPSSVAKELHHAVWYILMTPLFFLMLKIYGQWMFGGKRM  353

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+N L+IVGNFVGALLGA+MGLKEGPIFFF IGLAHY+V+FVTL Q LPTN+T+
Sbjct  354  LSKVANPTNMLSIVGNFVGALLGASMGLKEGPIFFFTIGLAHYMVIFVTLSQMLPTNKTI  413

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFL VA PSVA+MALAKI GSF   S+I YF ++FL
Sbjct  414  PRDLHPVFFLLVAPPSVAAMALAKIQGSFHFESRIFYFTSMFL  456



>ref|XP_009109115.1| PREDICTED: S-type anion channel SLAH2 [Brassica rapa]
Length=515

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  VN VLW IS+ L    +  Y  KTI +FEAVRRE+ 
Sbjct  155  SSQAIMWKTLATTKAEKFLHLTQVVNHVLWWISLVLLLSFSITYLFKTIFFFEAVRREFK  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T +L S LWY FMAPI  L++KIYGQWMSGG RR
Sbjct  215  HPIRVNFFFAPLISVLFLALGIPHSITSSLPSILWYFFMAPILLLEMKIYGQWMSGGPRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA++GLKEGP+FFF++GLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLSIVGNFAGALLGASLGLKEGPMFFFSVGLAYYLVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA   I  SFD  S+IAYFI+LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTAISASFDIGSRIAYFISLFL  377



>ref|XP_008674366.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 tpg|DAA55296.1| TPA: hypothetical protein ZEAMMB73_922186 [Zea mays]
Length=600

 Score =   327 bits (839),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 185/227 (81%), Gaps = 4/227 (2%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWK +A S  T FLH++   NL LW ISVAL   V  +YA K  L+FEAVRREYY
Sbjct  259  SSQAILWKVMALSVPTTFLHVTAKANLALWCISVALTCAVTAVYACKAALFFEAVRREYY  318

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV---TENLHSSLWYVFMAPIFCLDLKIYGQWMSGG  319
            HP+RVNFFFAPWI  L LA+G P +V   T  L   LWY+ MAP+ CL LKIYGQWMSGG
Sbjct  319  HPIRVNFFFAPWITCLCLAIGAPRAVAPSTAALPRWLWYLLMAPLLCLGLKIYGQWMSGG  378

Query  318  QRRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN  139
            QRRLSKVANPSNHL+++GNFVGA LGATMGL+EGP+FFFA+GLAHY+VLFVTLYQRLPTN
Sbjct  379  QRRLSKVANPSNHLSVLGNFVGAQLGATMGLREGPVFFFAVGLAHYVVLFVTLYQRLPTN  438

Query  138  ETLPKELHPVFFLFVAAPSVASMALAKIH-GSFDDASKIAYFIALFL  1
            ETLPKELHPVFFLFVAAPSV+S+A A+I  G F   S++A+F+A+FL
Sbjct  439  ETLPKELHPVFFLFVAAPSVSSVAWAEISGGEFGHVSRVAFFVAMFL  485



>emb|CDY14262.1| BnaA08g13930D [Brassica napus]
Length=648

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  VN VLW IS+ L    +  Y  KTI +FEAVRRE+ 
Sbjct  142  SSQAIMWKTLATTKAEKFLHLTQVVNHVLWWISLVLLLSFSITYLFKTIFFFEAVRREFK  201

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLFLALG+P S+T +L S LWY FMAPI  L++KIYGQWMSGGQRR
Sbjct  202  HPIRVNFFFAPLISVLFLALGIPHSITSSLPSILWYFFMAPILLLEMKIYGQWMSGGQRR  261

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA++GLKEGP+FFF++GLA+Y+VLFVTLYQRLPTNETL
Sbjct  262  LSKVANPTNHLSIVGNFAGALLGASLGLKEGPMFFFSVGLAYYLVLFVTLYQRLPTNETL  321

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA   I  SFD  S+IAYFI+LFL
Sbjct  322  PKELHPVFFLFVAAPAVASMAWTTISASFDIGSRIAYFISLFL  364



>gb|EMT28041.1| hypothetical protein F775_17066 [Aegilops tauschii]
Length=666

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L T PST+FLH+   VN VLW +SVAL  +V+  Y LK + YFEAVRRE++
Sbjct  241  SSQAMLWKTLQTEPSTKFLHVHPVVNHVLWWVSVALMVVVSITYLLKIVFYFEAVRREFH  300

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  G+P  V E +H ++WYV MAPI CLDLKIYGQWMS G+RR
Sbjct  301  HPVRVNFFFAPWIACLFLVKGLPHPVWE-IHHAVWYVLMAPILCLDLKIYGQWMSSGERR  359

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY VLFVTLYQRLP N  L
Sbjct  360  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYGVLFVTLYQRLPPNVQL  419

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  +I G F++ +K+ YF++LFL
Sbjct  420  PKELHPVFFLFVAAPSVASMAWTRISGEFNNGAKLLYFVSLFL  462



>ref|XP_002445037.1| hypothetical protein SORBIDRAFT_07g003180 [Sorghum bicolor]
 gb|EES14532.1| hypothetical protein SORBIDRAFT_07g003180 [Sorghum bicolor]
Length=607

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILWKA+  S  T FLH++  VNLVLW +S AL +  +  YA K  LYFEAVRREYY
Sbjct  263  SSQAILWKAITLSVPTTFLHVTSKVNLVLWCVSAALMAAASATYACKVALYFEAVRREYY  322

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT--ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQ  316
            HP+RVNFFFAPWI+ L+LA+GVP SVT    L   LWYV MAP+ CL LKIYGQWMSGGQ
Sbjct  323  HPIRVNFFFAPWIICLYLAIGVPHSVTWAARLPHWLWYVLMAPLLCLGLKIYGQWMSGGQ  382

Query  315  RRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNE  136
            RRLSKVANPSNHL+++GNFVGA LGATMGL+EGP+FFF +G+AHY+VLFVTLYQRLPTNE
Sbjct  383  RRLSKVANPSNHLSLLGNFVGAQLGATMGLREGPLFFFGVGVAHYVVLFVTLYQRLPTNE  442

Query  135  TLPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            TLPKELHPVFFLFVAAPSV+S+A +KI G F   SK+A+F+ +FL
Sbjct  443  TLPKELHPVFFLFVAAPSVSSVAWSKITGEFGVFSKLAFFVGMFL  487



>gb|AFW82091.1| hypothetical protein ZEAMMB73_104906 [Zea mays]
Length=327

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = -2

Query  618  FLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYHPVRVNFFFAPWIVVLF  439
            FLH++  VNLVLW IS  L   +  +YALK  ++FEAVRREYYHPVRVNFFFAPWI  LF
Sbjct  2    FLHVTHKVNLVLWCISAVLMCGITAVYALKIAIFFEAVRREYYHPVRVNFFFAPWITCLF  61

Query  438  LALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRLSKVANPSNHLAIVGN  262
            LA+GVPPSV  E L   LWY  MAP+  L+LKIYGQWMSGGQRRLSKVANPSNHL++VGN
Sbjct  62   LAIGVPPSVAKEPLPHWLWYALMAPMLILELKIYGQWMSGGQRRLSKVANPSNHLSVVGN  121

Query  261  FVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLPKELHPVFFLFVAAPS  82
            FVGALLGA+MGL +GP+FFF++GLAHY VLFVTLYQRLPTNETLPKELHPVFFLFVAAPS
Sbjct  122  FVGALLGASMGLSDGPVFFFSVGLAHYSVLFVTLYQRLPTNETLPKELHPVFFLFVAAPS  181

Query  81   VASMALAKIHGSFDDASKIAYFIALFL  1
            VASMA A+I G F    ++AYFIA+FL
Sbjct  182  VASMAWARITGEFGYGPRVAYFIAMFL  208



>emb|CDY19015.1| BnaC01g20530D [Brassica napus]
Length=637

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  VN VLW IS+ L   V+  Y  KTI +F+AVRRE+ 
Sbjct  155  SSQAIMWKTLATTNAERFLHLTQVVNHVLWWISLVLLLAVSITYLFKTIFFFQAVRREFK  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLF+ALG+P S+T NL S LWY  MAP+  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISVLFMALGIPHSITSNLPSMLWYFLMAPVLFLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLAI+GNF GALLGA+MGL+EGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLAIIGNFAGALLGASMGLEEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  ++ GSFD  S+  YFI+LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTQLCGSFDLGSRFYYFISLFL  377



>gb|ADN33779.1| tellurite resistance protein teha [Cucumis melo subsp. melo]
Length=501

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL LWIIS+AL   VA  Y LK ILYFEAVRREYY
Sbjct  168  SSQAIMWKTLATSVSTKFLHLSLKINLALWIISIALIVTVASTYLLKLILYFEAVRREYY  227

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI +LFLA+GVPPSV  NL  ++WYV M P  CL+LKIYGQWMSGGQRR
Sbjct  228  HPIRVNFFFAPWIALLFLAIGVPPSVATNLPPAIWYVLMTPFLCLELKIYGQWMSGGQRR  287

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIG+AHY+VLFVTLYQRLPTNETL
Sbjct  288  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGIAHYLVLFVTLYQRLPTNETL  347

Query  129  PKELHPV  109
            PKELHPV
Sbjct  348  PKELHPV  354



>emb|CDX89215.1| BnaA01g16780D [Brassica napus]
Length=637

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ +  FLH++  VN VLW IS+ L   V+  Y  KTI +F+AVRRE+ 
Sbjct  155  SSQAIMWKTLATTNAERFLHLTQVVNHVLWWISLVLLLAVSITYLFKTIFFFQAVRREFK  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I VLF+ALG+P S+T NL S LWY  MAP+  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISVLFIALGIPHSITSNLPSMLWYFLMAPVLFLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLAI+GNF GALLGA+MGL+EGP+FFFA+GLA+Y+VLFVTLYQRLPTNETL
Sbjct  275  LSKVANPTNHLAIIGNFAGALLGASMGLEEGPMFFFAVGLAYYLVLFVTLYQRLPTNETL  334

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  ++ GSFD  S+  YFI+LFL
Sbjct  335  PKELHPVFFLFVAAPAVASMAWTQLCGSFDLGSRFYYFISLFL  377



>ref|XP_004145909.1| PREDICTED: S-type anion channel SLAH3-like [Cucumis sativus]
Length=501

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL LWIIS+AL   VA  Y LK ILYFEAVRREYY
Sbjct  170  SSQAIMWKTLATSVSTKFLHLSLKINLALWIISIALIVTVASTYLLKLILYFEAVRREYY  229

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLA+GVPPSV  NL   +WYV M P+ CL+LKIYGQWMSGGQRR
Sbjct  230  HPIRINFFFAPWIALLFLAIGVPPSVATNLPPVIWYVLMTPVLCLELKIYGQWMSGGQRR  289

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIG+AHY+VLFVTLYQRLPTNETL
Sbjct  290  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGIAHYLVLFVTLYQRLPTNETL  349

Query  129  PKELHPV  109
            PKELHPV
Sbjct  350  PKELHPV  356



>ref|XP_004173203.1| PREDICTED: S-type anion channel SLAH3-like [Cucumis sativus]
Length=501

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LATS ST+FLH+SL +NL LWIIS+AL   VA  Y LK ILYFEAVRREYY
Sbjct  170  SSQAIMWKTLATSVSTKFLHLSLKINLALWIISIALIVTVASTYLLKLILYFEAVRREYY  229

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+R+NFFFAPWI +LFLA+GVPPSV  NL   +WYV M P+ CL+LKIYGQWMSGGQRR
Sbjct  230  HPIRINFFFAPWIALLFLAIGVPPSVATNLPPVIWYVLMTPVLCLELKIYGQWMSGGQRR  289

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNFVGALLGA+MGLKEGPIFFFAIG+AHY+VLFVTLYQRLPTNETL
Sbjct  290  LSKVANPTNHLSIVGNFVGALLGASMGLKEGPIFFFAIGIAHYLVLFVTLYQRLPTNETL  349

Query  129  PKELHPV  109
            PKELHPV
Sbjct  350  PKELHPV  356



>gb|EMT13582.1| hypothetical protein F775_13923 [Aegilops tauschii]
Length=545

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 180/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PS  FL +    N VLW ISVAL ++V+ +Y LK + YFEAVRRE++
Sbjct  188  SSQAMLWKTLESEPSMAFLRVCPAANHVLWWISVALTAVVSIVYLLKVVFYFEAVRREFH  247

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPW+  LFL  GVP    E +H   WY  M PI CLDLKIYGQWMS G+RR
Sbjct  248  HPVRVNFFFAPWVACLFLVKGVPRPEWE-IHHLFWYFLMVPILCLDLKIYGQWMSSGERR  306

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY VLFVTLYQRLPTN+ L
Sbjct  307  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYAVLFVTLYQRLPTNKQL  366

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F++ +K+ YF++LFL
Sbjct  367  PKELHPVFFLFVAAPSVASMAWARISGEFNNGAKLLYFVSLFL  409



>gb|EMT31272.1| Tellurite resistance tehA-like protein [Aegilops tauschii]
Length=458

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 181/223 (81%), Gaps = 2/223 (1%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L   PST+FLH+   VN VLW ISVAL  +V+  Y LK + YFEAVRRE+ 
Sbjct  84   SSQAMLWKTLQWEPSTKFLHVHPVVNHVLWWISVALMVVVSITYLLKIVFYFEAVRREFN  143

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFF APWI  LFL  GVP  V E +H ++W V MAPI CLDLKIYGQWM+  +RR
Sbjct  144  HPVRVNFF-APWIACLFLVKGVPHPVWE-IHHAVWCVLMAPILCLDLKIYGQWMTSDERR  201

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY+VLFVTLYQRLPTN  L
Sbjct  202  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYVVLFVTLYQRLPTNVQL  261

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA  +I G F+D +K+ YFI+LFL
Sbjct  262  PKELHPVFFLFVAAPSVASMAWTRISGEFNDGAKLLYFISLFL  304



>ref|XP_003565860.1| PREDICTED: S-type anion channel SLAH2-like [Brachypodium distachyon]
Length=551

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 183/223 (82%), Gaps = 3/223 (1%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PS EFLH+   +N +LW  SV+L + V+ +Y LK + YFEAVRRE++
Sbjct  198  SSQAMLWKTLHSEPSMEFLHVPPIINHLLWWASVSLMAAVSLVYLLKAVFYFEAVRREFH  257

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  LFLA GVP   T+ +  ++WY+ M PIF LDLK+YGQWMS G++R
Sbjct  258  HPVRANFFFAPWIACLFLAKGVP---TDEIDHAVWYILMTPIFILDLKVYGQWMSSGEKR  314

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLA+VGNFVGALLGA MGL+E P+FFFA+GLAHY+VLFVTLYQRLPTN  L
Sbjct  315  LSKVANPTNHLAVVGNFVGALLGARMGLREPPMFFFAVGLAHYLVLFVTLYQRLPTNVQL  374

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F   SK+AYF++LFL
Sbjct  375  PKELHPVFFLFVAAPSVASMAWARITGEFSHGSKLAYFVSLFL  417



>gb|EMS67976.1| S-type anion channel SLAH2 [Triticum urartu]
Length=483

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PS  FL +    N VLW +SVAL ++++ +Y LK + YFEAVRRE++
Sbjct  147  SSQAMLWKTLESEPSMAFLRVRPAANHVLWWVSVALTAVISIVYLLKVVFYFEAVRREFH  206

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPW+  LFL  GVP    E +H   WY+ MAPI CLDLKIYGQWMS G+RR
Sbjct  207  HPVRVNFFFAPWVACLFLVKGVPLPEWE-IHHVFWYLLMAPILCLDLKIYGQWMSSGERR  265

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA GLAHY VLFVTLYQRLPTN  L
Sbjct  266  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAAGLAHYAVLFVTLYQRLPTNMQL  325

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F++++K+ YFI+LFL
Sbjct  326  PKELHPVFFLFVAAPSVASMAWARISGEFNNSAKLLYFISLFL  368



>gb|EMT04853.1| Tellurite resistance protein tehA [Aegilops tauschii]
Length=648

 Score =   323 bits (828),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 180/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST+FLH+    N VLW ISV L  +V+  Y LK + YFEAVRRE++
Sbjct  234  SSQAMLWKTLESEPSTKFLHVHPAANHVLWWISVTLMVVVSITYLLKVVFYFEAVRREFH  293

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAP I  LFL  GVP  V E +H  +WY+ M PI CLDLKIYGQWMS G+RR
Sbjct  294  HPVRVNFFFAPSIACLFLVKGVPHPVWE-IHHVVWYLLMLPILCLDLKIYGQWMSSGERR  352

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFF +GLAHY VLFVTLYQRLPTN  L
Sbjct  353  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFGVGLAHYAVLFVTLYQRLPTNVQL  412

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F+D +K+ YFI+LFL
Sbjct  413  PKELHPVFFLFVAAPSVASMAWARISGEFNDGAKLLYFISLFL  455



>gb|EMS54125.1| S-type anion channel SLAH2 [Triticum urartu]
Length=585

 Score =   321 bits (823),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST+FLH+    N VLW ISV L  +V+  Y LK + YFEAVRRE++
Sbjct  209  SSQAMLWKTLESEPSTKFLHVHPAANHVLWWISVTLMVVVSITYLLKVVFYFEAVRREFH  268

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAP I  LFL  G+P  V E +H  +WY+ M PI CLDLKIYGQWMS G+RR
Sbjct  269  HPVRVNFFFAPSIACLFLVKGLPHPVWE-IHHVVWYLLMLPILCLDLKIYGQWMSSGERR  327

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFF++GLAHY VLFVTLYQRLPTN  L
Sbjct  328  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFSVGLAHYAVLFVTLYQRLPTNVQL  387

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F+D +K+ YFI+LFL
Sbjct  388  PKELHPVFFLFVAAPSVASMAWARISGEFNDGAKLLYFISLFL  430



>ref|XP_008657529.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
Length=431

 Score =   316 bits (810),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST FLH+S  VN VLW +S +L ++V+FIY  K + YFEAVRRE++
Sbjct  204  SSQAMLWKTLQSEPSTAFLHVSPAVNHVLWWVSASLMALVSFIYLFKVVFYFEAVRREFH  263

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +WY+ MAPIF LDLKIYGQWMSGG RR
Sbjct  264  HPIRVNFFFAPWIACLFLVKGLPHPVW-TIHHVVWYILMAPIFLLDLKIYGQWMSGGARR  322

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLA+VGNFVGALLGA MGL+E PIFFFA+G+ HY+VLFVTLYQRLP+N  L
Sbjct  323  LSKVANPTNHLAVVGNFVGALLGAKMGLREVPIFFFAVGVVHYLVLFVTLYQRLPSNAQL  382

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P+ELHPVFFLF+AAPSVAS+  A++ G F+ A+KI YF +LFL
Sbjct  383  PRELHPVFFLFIAAPSVASVGWARLCGDFNYAAKILYFTSLFL  425



>emb|CDJ26599.1| unnamed protein product [Triticum aestivum]
Length=529

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 180/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PS  FL +    N VLW +SVAL ++V+ +Y LK + YFEAVRRE++
Sbjct  193  SSQAMLWKTLESEPSMAFLRVRPAANHVLWWVSVALTAVVSIVYLLKVVFYFEAVRREFH  252

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPW+  LFL  GVP    E +H   WY+ MAPI CLDLKI+GQWMS G+RR
Sbjct  253  HPVRVNFFFAPWVACLFLVKGVPLPEWE-IHHVFWYLLMAPILCLDLKIHGQWMSSGERR  311

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY VLFVTLYQRLPTN  L
Sbjct  312  LSKVANPSNHLAVVGNFVGALLGARMGLRELPIFFFAVGLAHYAVLFVTLYQRLPTNMQL  371

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFL VA PSVASMA A+I G F++++K+ YFI+LFL
Sbjct  372  PKELHPVFFLLVATPSVASMAWARISGEFNNSAKLLYFISLFL  414



>gb|AFW81265.1| hypothetical protein ZEAMMB73_921276 [Zea mays]
Length=565

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST FLH+S  VN VLW +S +L ++V+FIY  K + YFEAVRRE++
Sbjct  204  SSQAMLWKTLQSEPSTAFLHVSPAVNHVLWWVSASLMALVSFIYLFKVVFYFEAVRREFH  263

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +WY+ MAPIF LDLKIYGQWMSGG RR
Sbjct  264  HPIRVNFFFAPWIACLFLVKGLPHPVW-TIHHVVWYILMAPIFLLDLKIYGQWMSGGARR  322

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLA+VGNFVGALLGA MGL+E PIFFFA+G+ HY+VLFVTLYQRLP+N  L
Sbjct  323  LSKVANPTNHLAVVGNFVGALLGAKMGLREVPIFFFAVGVVHYLVLFVTLYQRLPSNAQL  382

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P+ELHPVFFLF+AAPSVAS+  A++ G F+ A+KI YF +LFL
Sbjct  383  PRELHPVFFLFIAAPSVASVGWARLCGDFNYAAKILYFTSLFL  425



>ref|XP_002441591.1| hypothetical protein SORBIDRAFT_09g029910 [Sorghum bicolor]
 gb|EES20021.1| hypothetical protein SORBIDRAFT_09g029910 [Sorghum bicolor]
Length=622

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST FLH+S  VN  LW +SVAL  +V+  Y LK + YFEAVRRE++
Sbjct  253  SSQAMLWKTLQSEPSTAFLHVSPAVNHALWWVSVALMFLVSVTYLLKVVFYFEAVRREFH  312

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V + +H  +WY+ MAPI  LDLKIYGQWMSGG RR
Sbjct  313  HPIRVNFFFAPWIACLFLVKGLPQPVAD-VHHVVWYILMAPILFLDLKIYGQWMSGGDRR  371

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHLA+VGNFVGALLGA MGL+E PIFFFA+G+ HY+VLFVTLYQRLPTN  L
Sbjct  372  LSKVANPTNHLAVVGNFVGALLGAKMGLREVPIFFFAVGVVHYLVLFVTLYQRLPTNAQL  431

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVAS+  A++ G F+ A+KI YF +LFL
Sbjct  432  PKELHPVFFLFIAAPSVASVGWARLCGDFNYAAKILYFTSLFL  474



>ref|XP_002440338.1| hypothetical protein SORBIDRAFT_09g029920 [Sorghum bicolor]
 gb|EES18768.1| hypothetical protein SORBIDRAFT_09g029920 [Sorghum bicolor]
Length=619

 Score =   317 bits (812),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST FLH+S  VN  LW IS +L ++V+F Y LK + YFEAVRRE++
Sbjct  253  SSQAMLWKTLQSEPSTAFLHVSPAVNSALWWISASLMALVSFTYLLKIVFYFEAVRREFH  312

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V  ++H  +WY+ MAPI  LDLKIYGQWMSGG RR
Sbjct  313  HPIRVNFFFAPWIACLFLVKGLPQPVA-DVHHVVWYILMAPILFLDLKIYGQWMSGGDRR  371

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVA P+NHLA+VGNFVGALLGA MGL+E PIFFFA+G+ HY+VLFVTLYQRLPTN  L
Sbjct  372  LSKVATPTNHLAVVGNFVGALLGAKMGLREVPIFFFAVGVVHYLVLFVTLYQRLPTNAKL  431

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPSVAS+  A++ G F+ A+KI YF +LFL
Sbjct  432  PKELHPVFFLFIAAPSVASVGWARLCGEFNYAAKIFYFTSLFL  474



>gb|EMT02136.1| hypothetical protein F775_20255 [Aegilops tauschii]
Length=431

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 177/223 (79%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            +SQA+LWK L + PS  FLH+    N V W +SVAL  IV+  Y LK I YFEAVRRE++
Sbjct  40   NSQAMLWKTLESEPSMAFLHVHPTANYVFWWVSVALTIIVSVTYLLKVIFYFEAVRREFH  99

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  LFL  G P  V E +H  ++ + M PI CL LKIYGQWMS G+RR
Sbjct  100  HPVRVNFFFAPWIACLFLVKGEPHPVWE-IHHVVYNLLMLPILCLGLKIYGQWMSSGERR  158

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY VLFVTLYQRLPTN  L
Sbjct  159  LSKVANPSNHLAVVGNFVGALLGAKMGLRELPIFFFAVGLAHYGVLFVTLYQRLPTNVQL  218

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F+D +K+ YFI+LFL
Sbjct  219  PKELHPVFFLFVAAPSVASMAWARISGEFNDGAKLLYFISLFL  261



>ref|XP_008650076.1| PREDICTED: S-type anion channel SLAH2-like [Zea mays]
 gb|AFW79352.1| hypothetical protein ZEAMMB73_403368 [Zea mays]
Length=602

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 182/223 (82%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PST FLH+S  VN  LW +S AL ++V+FIY LK + YFEAVRRE++
Sbjct  235  SSQAMLWKTLQSEPSTAFLHVSPAVNHALWWVSAALMALVSFIYLLKIVFYFEAVRREFH  294

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H ++WY+ M PIF LDLKIYGQWMSGG RR
Sbjct  295  HPIRVNFFFAPWIACLFLVKGLPHPVW-TIHHAVWYILMVPIFLLDLKIYGQWMSGGDRR  353

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVA P+NHLA+VGNFVGALLGA MGL+E PIFFFA+G+ HY+VLFVTLYQRLPTN  L
Sbjct  354  LSKVATPTNHLAVVGNFVGALLGANMGLREVPIFFFAVGVVHYLVLFVTLYQRLPTNAQL  413

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P+ELHPVFFLF+AAPSVAS+  A++ G F+ A+KI YF +LFL
Sbjct  414  PRELHPVFFLFIAAPSVASVGWARLCGDFNYAAKIFYFTSLFL  456



>ref|NP_001059043.1| Os07g0181100 [Oryza sativa Japonica Group]
 dbj|BAC83049.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20957.1| Os07g0181100 [Oryza sativa Japonica Group]
 dbj|BAG98931.1| unnamed protein product [Oryza sativa Japonica Group]
Length=624

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 185/226 (82%), Gaps = 4/226 (2%)
 Frame = -2

Query  666  SQAILWKALATSP-STEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SQAILWK +A SP +T +LH++  VNLVLW +SVAL   V+ +YA K + +FEAVRREY 
Sbjct  263  SQAILWKRIAESPPTTRYLHVAADVNLVLWWLSVALTCAVSAVYACKVVFFFEAVRREYL  322

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV---TENLHSSLWYVFMAPIFCLDLKIYGQWMSGG  319
            HPVRVNFFFAP I  LFLA+GVP SV   T  L + LWY  MAP+ CL+LKIYGQWMS G
Sbjct  323  HPVRVNFFFAPLIACLFLAIGVPRSVAPSTAALPAWLWYALMAPMLCLELKIYGQWMSSG  382

Query  318  QRRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN  139
            QRRLS VANPSNHL++VGNFVGALLGA+MG++EG +FFFA+G+AHY+VLFVTLYQRLPTN
Sbjct  383  QRRLSMVANPSNHLSVVGNFVGALLGASMGIREGAVFFFAVGVAHYVVLFVTLYQRLPTN  442

Query  138  ETLPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            E LP+ELHPVFFLFVA PSVAS+A A I G F   +++AYF+A+FL
Sbjct  443  EALPRELHPVFFLFVATPSVASVAWAAIAGEFALGARLAYFVAMFL  488



>gb|EAZ02985.1| hypothetical protein OsI_25126 [Oryza sativa Indica Group]
Length=622

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 185/226 (82%), Gaps = 4/226 (2%)
 Frame = -2

Query  666  SQAILWKALATSP-STEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SQAILWK +A SP +T +LH++  VNLVLW +SVAL   V+ +YA K + +FEAVRREY 
Sbjct  262  SQAILWKRIAESPPTTRYLHVAADVNLVLWWLSVALTCAVSAVYACKVVFFFEAVRREYL  321

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV---TENLHSSLWYVFMAPIFCLDLKIYGQWMSGG  319
            HPVRVNFFFAP I  LFLA+GVP SV   T  L + LWY  MAP+ CL+LKIYGQWMS G
Sbjct  322  HPVRVNFFFAPLIACLFLAIGVPRSVAASTAALPAWLWYALMAPMLCLELKIYGQWMSSG  381

Query  318  QRRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTN  139
            QRRLS VANPSNHL++VGNFVGALLGA+MG++EG +FFFA+G+AHY+VLFVTLYQRLPTN
Sbjct  382  QRRLSMVANPSNHLSVVGNFVGALLGASMGIREGALFFFAVGVAHYVVLFVTLYQRLPTN  441

Query  138  ETLPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            E LP+ELHPVFFLFVA PSVAS+A A I G F   +++AYF+A+FL
Sbjct  442  EALPRELHPVFFLFVATPSVASVAWAAIAGEFALGARLAYFVAMFL  487



>emb|CDM80373.1| unnamed protein product [Triticum aestivum]
Length=523

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 177/223 (79%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L + PS  FL +    N  LW +SVAL +IV+ +Y LK + YFEAVRRE++
Sbjct  195  SSQAMLWKTLESEPSMAFLRVRPAANHALWWVSVALTAIVSIVYLLKIVFYFEAVRREFH  254

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPW+  LFL  GVP    E +H   WY+ M PI CLDLKIYGQWM  G+RR
Sbjct  255  HPVRVNFFFAPWVACLFLVKGVPLPEWE-IHHVFWYLLMTPILCLDLKIYGQWMFSGERR  313

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E  IFFFA+GLAHY VLFVTLYQRLPTN  L
Sbjct  314  LSKVANPSNHLAVVGNFVGALLGARMGLRELSIFFFAVGLAHYAVLFVTLYQRLPTNVQL  373

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAPSVASMA A+I G F++ +K+ YF++LFL
Sbjct  374  PKELHPVFFLFVAAPSVASMAWARISGEFNNGAKLLYFVSLFL  416



>ref|XP_001757651.1| predicted protein [Physcomitrella patens]
 gb|EDQ77708.1| predicted protein, partial [Physcomitrella patens]
Length=363

 Score =   306 bits (784),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 173/223 (78%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SQ +LWK LA  P   FL I   +NLVLW ++V    ++   Y LK   YFEAVRREY+
Sbjct  50   GSQTMLWKNLALVPQMTFLQIPTWINLVLWCVAVLALVVILICYFLKIQFYFEAVRREYH  109

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVRVNFFFAPWI  +FLA GVPP +   +H ++W VFM P+FCL+LKIYGQW+SGGQRR
Sbjct  110  HPVRVNFFFAPWIACMFLATGVPPQIATTIHPAVWCVFMFPVFCLELKIYGQWLSGGQRR  169

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPS HL++VGNFVG+ L A +G KE  IFF+A+GLAHYIVLFVTLYQRLPTNETL
Sbjct  170  LSKVANPSTHLSVVGNFVGSNLAAIVGWKEPAIFFWAVGLAHYIVLFVTLYQRLPTNETL  229

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P +LHPVFFLFVAAPS +S+A  +I G FD  S+I +FIALFL
Sbjct  230  PTDLHPVFFLFVAAPSASSLAWMRISGEFDYVSRIVFFIALFL  272



>ref|XP_002984606.1| hypothetical protein SELMODRAFT_43399, partial [Selaginella moellendorffii]
 gb|EFJ14251.1| hypothetical protein SELMODRAFT_43399, partial [Selaginella moellendorffii]
Length=375

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 171/223 (77%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SQ+ILWK L+T P+  FLH    +N VLW ++    + +   Y  K I Y EAVRREYY
Sbjct  57   GSQSILWKNLSTVPAMRFLHAPEIINTVLWFLAAIALAGIFTTYLFKAIFYLEAVRREYY  116

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  +FLALG+PPS    LH  +W   MAPI  L+LKIYGQW+SGGQRR
Sbjct  117  HPVRANFFFAPWIAAMFLALGIPPSAGVTLHPWIWCCLMAPILALELKIYGQWLSGGQRR  176

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP  HL++VGNFVGALLGAT+G  +G IFF+AIGLAHY+VLFVTLYQRLPTNE L
Sbjct  177  LSKVANPCTHLSVVGNFVGALLGATVGWIDGGIFFWAIGLAHYLVLFVTLYQRLPTNEAL  236

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPS AS+A  KI G F   S+IA+FIALFL
Sbjct  237  PKELHPVFFLFIAAPSAASLAWEKITGDFGIVSRIAFFIALFL  279



>ref|XP_002440339.1| hypothetical protein SORBIDRAFT_09g029930 [Sorghum bicolor]
 gb|EES18769.1| hypothetical protein SORBIDRAFT_09g029930 [Sorghum bicolor]
Length=552

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L   PST FL +S  VN VLW +S AL ++V+FIY LK + YFEAVRRE++
Sbjct  186  SSQAMLWKTLEQEPSTAFLGVSPSVNDVLWCVSAALMALVSFIYLLKAVFYFEAVRREFH  245

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA G+P  VT  LH ++WY  MAPI  LDLK+YGQWMSGG+ R
Sbjct  246  HPIRVNFFFAPWIACLFLAKGLPELVT-TLHHAVWYQLMAPILILDLKMYGQWMSGGEWR  304

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VA+P++HLA+VGNFVGALLGA MGL+E  +FFFA+G  HY+VLFVTLYQRLPTN  L
Sbjct  305  LSRVASPTSHLAVVGNFVGALLGARMGLREPALFFFAVGSVHYVVLFVTLYQRLPTNVPL  364

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P++LHPVFFLFVA PSVAS+A A+I G F   +++AY+++LFL
Sbjct  365  PRDLHPVFFLFVATPSVASVAWARISGEFGLGARLAYYVSLFL  407



>ref|XP_004963556.1| PREDICTED: S-type anion channel SLAH3-like [Setaria italica]
Length=542

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 176/223 (79%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L   PST FLH++  VN   W  SVAL ++V+  Y LK + YFEAVRRE+Y
Sbjct  180  SSQAMLWKTLELEPSTAFLHVNPDVNDAFWWFSVALMALVSATYLLKVVFYFEAVRREFY  239

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFL  G+P  V   +H  +WY  MAP+  LDLK+YGQWMSGG+ R
Sbjct  240  HPIRVNFFFAPWIACLFLVKGLPEPV-RTIHHVVWYALMAPLLALDLKVYGQWMSGGEWR  298

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VANP++HLA+VGNFVGALLGA MGL+E  IFFFA+GL HY+VLFVTLYQRLPTN  L
Sbjct  299  LSRVANPTSHLAVVGNFVGALLGARMGLREAAIFFFAVGLVHYLVLFVTLYQRLPTNVPL  358

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+A PSVAS+A A+I G F   +K+AY+I+LFL
Sbjct  359  PKELHPVFFLFIATPSVASVAWARICGEFGHGAKVAYYISLFL  401



>ref|XP_002978674.1| hypothetical protein SELMODRAFT_53394, partial [Selaginella moellendorffii]
 gb|EFJ20121.1| hypothetical protein SELMODRAFT_53394, partial [Selaginella moellendorffii]
Length=427

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 171/223 (77%), Gaps = 0/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SQ+ILWK L+T P+  FLH    +N VLW ++    + +   Y  K I Y EAVRREYY
Sbjct  109  GSQSILWKNLSTVPAMRFLHAPEIINTVLWFLAAIALAGIFTTYLFKAIFYLEAVRREYY  168

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR NFFFAPWI  +FLALG+PPS    LH  +W   MAPI  L+LKIYGQW+SGGQRR
Sbjct  169  HPVRANFFFAPWIAAMFLALGIPPSAGVTLHPWIWCCLMAPILALELKIYGQWLSGGQRR  228

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP  HL++VGNFVGALLGAT+G  +G IFF+AIGLAHY+VLFVTLYQRLPTNE L
Sbjct  229  LSKVANPCTHLSVVGNFVGALLGATVGWIDGGIFFWAIGLAHYLVLFVTLYQRLPTNEAL  288

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLF+AAPS AS+A  KI G F   S+IA+FIALFL
Sbjct  289  PKELHPVFFLFIAAPSAASLAWEKITGDFGIVSRIAFFIALFL  331



>emb|CDP09853.1| unnamed protein product [Coffea canephora]
Length=568

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 182/224 (81%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW+AL++SPST+FLH++  +N VLW+++V +   ++  YALK  LYFEAV+REY+
Sbjct  211  SSQAILWRALSSSPSTKFLHVTPFINFVLWLLAVGVLVAISVTYALKCALYFEAVKREYF  270

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPW+V +FLA+G PP +  E LH ++W VFMAPI  LDLKIYGQW+SGG+R
Sbjct  271  HPVRVNFFFAPWVVCMFLAIGAPPRIAPETLHPAIWCVFMAPILFLDLKIYGQWLSGGKR  330

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G KE   F ++IG AHY+V+FVTLYQRLPT+E 
Sbjct  331  RLCKVANPSSHLSVVGNFVGAILAAKVGWKEAGKFLWSIGFAHYLVVFVTLYQRLPTSEA  390

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   ++G FD  ++  YFIALFL
Sbjct  391  LPKELHPVYSMFIATPAAASLAWGAVYGEFDGLARTCYFIALFL  434



>ref|XP_002457095.1| hypothetical protein SORBIDRAFT_03g001113 [Sorghum bicolor]
 gb|EES02215.1| hypothetical protein SORBIDRAFT_03g001113 [Sorghum bicolor]
Length=327

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  552  VAFIYALKTILYFEAVRREYYHPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFM  373
            V+ +YA K + YFEAVRREYYHP+RVNFFFAPWI  LFLA+GVP  V   L   LWYV M
Sbjct  4    VSALYASKVVFYFEAVRREYYHPIRVNFFFAPWIACLFLAIGVPDLVAATLPHWLWYVLM  63

Query  372  APIFCLDLKIYGQWMSGGQRRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIG  193
            API CL+LKIYGQW+SGGQRRLS+VANPSNHL+IVGNFVGALLG  MGLKEGP+FFF++G
Sbjct  64   APIVCLELKIYGQWISGGQRRLSRVANPSNHLSIVGNFVGALLGGIMGLKEGPMFFFSVG  123

Query  192  LAHYIVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFI  13
            LAHYIVLFVTLYQRLPT+ETLP++LHPVFFLFVAAPSVA +A A+I G+F   S++AYFI
Sbjct  124  LAHYIVLFVTLYQRLPTSETLPRDLHPVFFLFVAAPSVACLAWARITGAFGYGSRVAYFI  183

Query  12   ALFL  1
            A+FL
Sbjct  184  AMFL  187



>ref|XP_002450796.1| hypothetical protein SORBIDRAFT_05g018580 [Sorghum bicolor]
 gb|EES09784.1| hypothetical protein SORBIDRAFT_05g018580 [Sorghum bicolor]
Length=496

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 181/229 (79%), Gaps = 6/229 (3%)
 Frame = -2

Query  669  SSQAILWKALATSPSTE--FLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRRE  496
            + QAILWK +A+S  T   FLH++  VNLVLW ISV L   +  +YALK   +F+AVRRE
Sbjct  107  ARQAILWKTMASSSPTPTMFLHMTHKVNLVLWCISVVLMCAITAVYALKAAFFFDAVRRE  166

Query  495  YYHPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGG  319
            YYHP+RVNFFFAPWI  L L +GVP SV  + L   LWY  MAP+  L+LKIYGQWMSGG
Sbjct  167  YYHPIRVNFFFAPWIACLLLVIGVPQSVARDPLPQWLWYALMAPVLVLELKIYGQWMSGG  226

Query  318  QRRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLP-T  142
            QR LSKVANPSNHLA+VGNFVGALLGA MGL+EGP+FFFA+GLAHY VLFVTLYQRLP T
Sbjct  227  QRPLSKVANPSNHLAVVGNFVGALLGANMGLREGPVFFFAVGLAHYTVLFVTLYQRLPTT  286

Query  141  NETLPK-ELHPVFFLFVAAPSVASMALAKIHG-SFDDASKIAYFIALFL  1
            +ET+PK EL+P  FLFVAAPSVASMALA+I    F   +++AYF+A+FL
Sbjct  287  SETMPKAELYPALFLFVAAPSVASMALARITAPEFGFGARMAYFVAMFL  335



>ref|XP_001756387.1| predicted protein [Physcomitrella patens]
 gb|EDQ78783.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 176/222 (79%), Gaps = 0/222 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAILWK L  SP  EFLHI   +N+ LW I++    +++  Y LK + YFEAVRREY+H
Sbjct  68   SQAILWKNLHLSPELEFLHIPKEINIFLWSIALLALLVISMTYLLKVLFYFEAVRREYFH  127

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            PVRVNFFFAPWI  +FLA+GVPPS+ +++H +++  FM PIF L+LK+YGQW+SGG+RRL
Sbjct  128  PVRVNFFFAPWIAGMFLAIGVPPSIAQSVHPAVFCCFMTPIFILELKLYGQWLSGGKRRL  187

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
            SKVANPS HL+IVGNFVG+LL A +   E  IFF+++GLAHYIVLFVTLYQRLPTNE LP
Sbjct  188  SKVANPSTHLSIVGNFVGSLLAAIVKWNEPAIFFWSVGLAHYIVLFVTLYQRLPTNEKLP  247

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            K+LHPVFFLFVAAPS AS+A   I G FD  S+I + IALFL
Sbjct  248  KDLHPVFFLFVAAPSTASVAWLYITGDFDYISRIVFSIALFL  289



>gb|EMT26636.1| Tellurite resistance tehA-like protein [Aegilops tauschii]
Length=479

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 173/223 (78%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK L++  ST FL +   VN VLW  SVA+  IV+  Y LK + YFEAVRRE++
Sbjct  147  SSQAMLWKTLSSEHSTGFLGVHPAVNRVLWWASVAITVIVSITYLLKVVFYFEAVRREFH  206

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            +PVRVNFFFAPWI  LFL  G+P    E  H  +WY+ M PI CLDLKIYGQWMS G+RR
Sbjct  207  YPVRVNFFFAPWIACLFLVKGLPRPEREIRHI-VWYLLMTPILCLDLKIYGQWMSSGERR  265

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANPSNHLA+VGNFVGALLGA MGL+E PIFFFA+GLAHY+VLFVTLYQRLPT+  L
Sbjct  266  LSKVANPSNHLAVVGNFVGALLGAKMGLRELPIFFFAVGLAHYLVLFVTLYQRLPTSMQL  325

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
             KELHP+FF FV  PSVASMA A+I G F    K+ YF++LFL
Sbjct  326  AKELHPIFFFFVTVPSVASMAWARISGEFGHGPKLLYFVSLFL  368



>ref|XP_010108084.1| Guard cell S-type anion channel SLAC1 [Morus notabilis]
 gb|EXC17816.1| Guard cell S-type anion channel SLAC1 [Morus notabilis]
Length=558

 Score =   300 bits (767),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 178/224 (79%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW+ALATSP+ EFLHIS  +NL LW+ ++A+   V F Y LK I YFEAV+REY+
Sbjct  206  SSQAVLWRALATSPAVEFLHISPFINLALWLFALAVLVSVTFTYILKCIFYFEAVKREYF  265

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPW+V +FL++ VPP +    LH ++W  FM P F L+LKIYGQW+SGG+R
Sbjct  266  HPVRVNFFFAPWVVCMFLSISVPPMLAPATLHPAIWCAFMGPYFFLELKIYGQWLSGGKR  325

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L + +G +E   F +A+G AHY+VLFVTLYQRLPT+E 
Sbjct  326  RLCKVANPSSHLSVVGNFVGAILASKVGWQEPAKFLWAVGFAHYLVLFVTLYQRLPTSEA  385

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+AAPS AS+A   I+G FD  S+  YFIALFL
Sbjct  386  LPKELHPVYSMFIAAPSAASLAWRTIYGEFDGCSRTCYFIALFL  429



>ref|XP_004300729.1| PREDICTED: guard cell S-type anion channel SLAC1-like [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   300 bits (767),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW+ALATS +TEFLHI L +NL LW+++VA+   V+  Y LK I Y EAV+REY+
Sbjct  209  SSQAVLWRALATSSATEFLHIPLFINLALWLLAVAVLFCVSLTYMLKIIFYCEAVKREYF  268

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPW+V +FLALG PP++  N L  ++W  FM P F L+LKIYGQW+SGG+R
Sbjct  269  HPVRVNFFFAPWVVCMFLALGAPPTLFPNKLQPAIWCTFMLPYFLLELKIYGQWLSGGKR  328

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G KE   F +A+G AHY V+FVTLYQRLPT+E 
Sbjct  329  RLCKVANPSSHLSVVGNFVGAILAAKVGWKEPAKFLWAVGFAHYYVVFVTLYQRLPTSEA  388

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LP+ELHPV+ +F+AAPS ASMA   I+G FD  S+  YFIA FL
Sbjct  389  LPRELHPVYSMFIAAPSAASMAWQNIYGEFDGVSRTCYFIAFFL  432



>emb|CAB36766.1| putative protein [Arabidopsis thaliana]
 emb|CAB79599.1| putative protein [Arabidopsis thaliana]
Length=505

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 176/223 (79%), Gaps = 14/223 (6%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAI+WK LAT+ + +FLH++  +N VLW IS+ L   V+  Y  KTIL+FEAVRRE+ 
Sbjct  155  SSQAIMWKTLATTEAEKFLHVTQVINHVLWWISLLLLLAVSITYLFKTILFFEAVRREFR  214

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAP I +LFLALG+P S+  +L S+LWY  MAPI  L++KIYGQWMSGGQRR
Sbjct  215  HPIRVNFFFAPLISILFLALGIPHSIISHLPSTLWYFLMAPILFLEMKIYGQWMSGGQRR  274

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+NHL+IVGNF GALLGA+MGLKEGPIFFFAIG              LPTNETL
Sbjct  275  LSKVANPTNHLSIVGNFAGALLGASMGLKEGPIFFFAIG--------------LPTNETL  320

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPVFFLFVAAP+VASMA  KI  SFD  S++AYFI+LFL
Sbjct  321  PKELHPVFFLFVAAPAVASMAWTKISASFDLGSRLAYFISLFL  363



>ref|XP_008657530.1| PREDICTED: S-type anion channel SLAH3-like [Zea mays]
 gb|AFW81266.1| hypothetical protein ZEAMMB73_120265 [Zea mays]
Length=519

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 176/223 (79%), Gaps = 1/223 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA++WK L   PST FL +S  VN  LW +SVAL  +V+  Y LK + Y EAVRRE++
Sbjct  151  SSQAMMWKTLEQEPSTAFLRVSPGVNDALWWLSVALMVVVSATYVLKAVFYLEAVRREFH  210

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HP+RVNFFFAPWI  LFLA G+P  VT  +H  +WY  MAPI  LD+KIYGQWMSGG+ R
Sbjct  211  HPIRVNFFFAPWIACLFLAKGLPEPVTA-VHHVVWYALMAPILFLDIKIYGQWMSGGEWR  269

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LS+VA+P++HLA+VGNFVGALLGA MGL+E  +FFFA+G  HY+VLFVTLYQRLPTN  L
Sbjct  270  LSRVASPTSHLAVVGNFVGALLGARMGLREPALFFFAVGAVHYVVLFVTLYQRLPTNVPL  329

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            P+ELHPVFFLFVA PSVAS+A A+I G F   +++AY+++LFL
Sbjct  330  PRELHPVFFLFVATPSVASVAWARISGEFGLGARVAYYVSLFL  372



>ref|XP_011071099.1| PREDICTED: guard cell S-type anion channel SLAC1 [Sesamum indicum]
Length=558

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 178/224 (79%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW+ALATSP+T+FLHI+  +NL +W++++ +   V   YALK   YFEAV+REY+
Sbjct  201  SSQAILWRALATSPATKFLHITPLINLAIWLLALGVLVAVFITYALKCAFYFEAVKREYF  260

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPW+V +FLA+GVP S+  N LH ++W  FMAPI  LDLKIYGQW+SGG+R
Sbjct  261  HPVRVNFFFAPWVVCMFLAIGVPSSIAPNTLHPAVWCTFMAPIVFLDLKIYGQWLSGGKR  320

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G  E   F +AIG AHY+V+FVTLYQRLPT+E 
Sbjct  321  RLCKVANPSSHLSVVGNFVGAILAAKVGWSEAGKFLWAIGFAHYLVVFVTLYQRLPTSEA  380

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   I+  FD  S+  YFIALFL
Sbjct  381  LPKELHPVYSMFIATPAAASIAWGAIYDEFDGLSRTCYFIALFL  424



>gb|EYU26087.1| hypothetical protein MIMGU_mgv1a018578mg [Erythranthe guttata]
Length=588

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW+AL+TS +T+FLH++  VNL +W++++ +F  V   YALK   YFEAV+REY+
Sbjct  229  SSQAILWRALSTSRATKFLHVTPIVNLAIWLLALGVFVAVFITYALKCAFYFEAVKREYF  288

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWIV +FLA+GVPP + ++ LH +LW  F  PI  LDLKIYGQW+SGG+R
Sbjct  289  HPIRVNFFFAPWIVCMFLAIGVPPCIAQDRLHPALWCAFAGPIIFLDLKIYGQWLSGGKR  348

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPS+HL++VGNFVGA+L A +G  E   F +A+G AHY+V+FVTLYQRLPT+E 
Sbjct  349  RLSKVANPSSHLSVVGNFVGAILAAQVGWLEAGKFMWAVGFAHYMVVFVTLYQRLPTSEA  408

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   I+G FD  S+  YFIALFL
Sbjct  409  LPKELHPVYCMFIATPAAASIAWGAIYGEFDGLSRTCYFIALFL  452



>gb|EYU40539.1| hypothetical protein MIMGU_mgv1a003425mg [Erythranthe guttata]
Length=586

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW+AL+TS +T+FLH++  VNL +W++++ +F  V   YALK   YFEAV+REY+
Sbjct  227  SSQAILWRALSTSRATKFLHVTPIVNLAIWLLALGVFVAVFTTYALKCAFYFEAVKREYF  286

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HP+RVNFFFAPWIV +FLA+GVPP + ++ LH +LW  F  PI  LDLKIYGQW+SGG+R
Sbjct  287  HPIRVNFFFAPWIVCMFLAIGVPPCIAQDRLHPALWCAFAGPIIFLDLKIYGQWLSGGKR  346

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPS+HL++VGNFVGA+L A +G  E   F +A+G AHY+V+FVTLYQRLPT+E 
Sbjct  347  RLSKVANPSSHLSVVGNFVGAILAAQVGWLEAGKFMWAVGFAHYMVVFVTLYQRLPTSEA  406

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   I+G FD  S+  YFIALFL
Sbjct  407  LPKELHPVYCMFIATPAAASIAWGAIYGEFDGLSRTCYFIALFL  450



>gb|EMS50810.1| S-type anion channel SLAH2 [Triticum urartu]
Length=561

 Score =   295 bits (754),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  618  FLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYHPVRVNFFFAPWIVVLF  439
            FL +   V+ VLW IS+AL  IV+  Y LK + YFEAVRRE++HPVRVNFFFAPWI  LF
Sbjct  218  FLRVHPAVSHVLWWISLALTVIVSITYLLKVVFYFEAVRREFHHPVRVNFFFAPWITCLF  277

Query  438  LALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRLSKVANPSNHLAIVGNF  259
            L  GVP  V E +H  +WY+ MAPIF LD+KIYGQWMS G+RRLSKVANPSNHLAIVGNF
Sbjct  278  LVKGVPHPVWE-IHHVVWYLLMAPIFWLDIKIYGQWMSSGERRLSKVANPSNHLAIVGNF  336

Query  258  VGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSV  79
            VGALLGA MGL+E PIFFFA+G AHY+VLFVTLYQRLPTN  LPK+LHPVFFLFVAAPSV
Sbjct  337  VGALLGARMGLRELPIFFFAVGFAHYVVLFVTLYQRLPTNMQLPKDLHPVFFLFVAAPSV  396

Query  78   ASMALAKIHGSFDDASKIAYFIALFL  1
            ASMA  +I G F D +K+ Y+++LFL
Sbjct  397  ASMAWTRISGEFSDGAKLLYYVSLFL  422



>ref|XP_002439222.1| hypothetical protein SORBIDRAFT_09g002500 [Sorghum bicolor]
 gb|EES17652.1| hypothetical protein SORBIDRAFT_09g002500 [Sorghum bicolor]
Length=526

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 176/226 (78%), Gaps = 4/226 (2%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LWK+L T PS  FLH+S  VN  LW +SVAL   V+ +Y LK + YFEAVRRE+ 
Sbjct  192  SSQAMLWKSLETEPSMAFLHVSPAVNQALWWVSVALTGFVSAVYLLKAVFYFEAVRREFC  251

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSS--LWYVFMAPIFCLDLKIYGQWMSGGQ  316
            +P+RVNFFFAPW+  LFL  G P  V   +H S  +WYV M PI  LDLKIYGQW+SGG 
Sbjct  252  NPIRVNFFFAPWVACLFLVKGHPRPVAA-IHDSHVVWYVLMTPILLLDLKIYGQWLSGGG  310

Query  315  RRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNE  136
            RRLSKVANP++HLAIVGNFVGA+LGA +GL E P+FFFA+GLAHY VLFVTLYQ L TN+
Sbjct  311  RRLSKVANPTSHLAIVGNFVGAVLGALVGLHEAPLFFFAVGLAHYAVLFVTLYQWLDTND  370

Query  135  T-LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
              LPKELHPVFFLFVA PSVASMA A++ G F  A+KI YFI+LFL
Sbjct  371  VRLPKELHPVFFLFVAVPSVASMAWARLSGEFGFAAKIPYFISLFL  416



>ref|XP_009765224.1| PREDICTED: guard cell S-type anion channel SLAC1 [Nicotiana sylvestris]
Length=557

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW++LA SP+T+FLH+ L +N V+W++ V +   V   Y  K  LYFEA+RREY 
Sbjct  203  SSQAILWRSLALSPATKFLHVPLFINFVIWLLGVGILVAVFTTYMFKCALYFEAIRREYS  262

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPWIV +FLA+G PP +  + LH ++W VF+APIF L+LKIYGQW+SGG+R
Sbjct  263  HPVRVNFFFAPWIVCMFLAIGTPPKIARDTLHPAIWCVFIAPIFFLNLKIYGQWLSGGKR  322

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPS+HL+++GNFVGA+L A +G KE   F +AIG AHY+V+FVTLYQRLPT+E 
Sbjct  323  RLSKVANPSSHLSVIGNFVGAILAAKVGWKEPGKFLWAIGFAHYLVVFVTLYQRLPTSEA  382

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   I+  FD  ++  YFI+LFL
Sbjct  383  LPKELHPVYSMFIATPAAASIAWGAIYDEFDGLARTCYFISLFL  426



>ref|XP_003608781.1| Tellurite resistance protein tehA-like protein [Medicago truncatula]
 gb|AES90978.1| C4-dicarboxylate transporter/malic acid protein [Medicago truncatula]
Length=561

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 177/225 (79%), Gaps = 2/225 (1%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW  LATSP+T FLHIS  ++ ++W++S+A+   V+  Y LK I YFEAVRREY+
Sbjct  198  SSQAVLWLNLATSPATRFLHISPDISFLIWLLSLAVLIAVSITYILKCIFYFEAVRREYF  257

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV--TENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQ  316
            HPVR+NFFFAPW+V +FLA+ VP  +   + LH ++W  F+ P F L+LKIYGQW+SGG+
Sbjct  258  HPVRINFFFAPWVVCMFLAISVPSRIVPQQTLHPAIWVTFIVPYFLLELKIYGQWLSGGK  317

Query  315  RRLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNE  136
            RRLSKVANPSNHL++ GNFVGA+L + +G KE   FF+A+G AHY+V+FVTLYQRLPT+E
Sbjct  318  RRLSKVANPSNHLSVSGNFVGAILASKVGWKEPAKFFWAVGFAHYLVVFVTLYQRLPTSE  377

Query  135  TLPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
             LPKELHPV+ +F+AAPS A +A   I+G FD  S+  YFIALFL
Sbjct  378  ALPKELHPVYSMFIAAPSAACIAWQSIYGEFDGISRNCYFIALFL  422



>ref|XP_009601617.1| PREDICTED: guard cell S-type anion channel SLAC1 [Nicotiana tomentosiformis]
Length=557

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 176/224 (79%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW++LA SP+T+FLH+ L +N V+W++ V +   V   Y  K  LYFEA++REY 
Sbjct  203  SSQAILWRSLALSPATKFLHVPLFINFVIWLLGVGILVAVFITYMFKCALYFEAIKREYS  262

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPWIV +FLA+G PP    E LH ++W VF+APIF L+LKIYGQW+SGG+R
Sbjct  263  HPVRVNFFFAPWIVCMFLAIGTPPKTAPETLHPAIWCVFIAPIFFLNLKIYGQWLSGGKR  322

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPS+HL+++GNFVGA+L A +G KE   F +AIG AHY+V+FVTLYQRLPT+E 
Sbjct  323  RLSKVANPSSHLSVIGNFVGAILAAKVGWKEPGKFLWAIGFAHYLVVFVTLYQRLPTSEA  382

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   I+  FD  ++  YFI+LFL
Sbjct  383  LPKELHPVYSMFIATPAAASIAWGAIYDEFDGLARTCYFISLFL  426



>ref|XP_008671135.1| PREDICTED: uncharacterized protein LOC103648441 [Zea mays]
Length=1263

 Score =   303 bits (777),  Expect = 9e-92, Method: Composition-based stats.
 Identities = 133/223 (60%), Positives = 174/223 (78%), Gaps = 1/223 (0%)
 Frame = -2

Query  666   SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
             SQAILW ALA SP+  FLH++  +N+ LW+++VA+    +  YALK I YFEA+RREY+H
Sbjct  899   SQAILWGALAASPAMRFLHVTPMINVALWLLAVAVLVATSVTYALKCIFYFEAIRREYFH  958

Query  486   PVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
             PVRVNFFFAPWI  +F+ +G+P S   E  H ++W  F+ P+F L+LKIYGQW+SGG+RR
Sbjct  959   PVRVNFFFAPWIAAMFVTIGLPRSYAPERPHPAVWCAFVLPLFALELKIYGQWLSGGKRR  1018

Query  309   LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
             L KVANPS+HL++VGNFVGA+L A +G  E     +AIG+AHYIV+FVTLYQRLPTNE L
Sbjct  1019  LCKVANPSSHLSVVGNFVGAILAARVGWTEAGKLLWAIGVAHYIVVFVTLYQRLPTNEAL  1078

Query  129   PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
             PKELHPV+ +F+A PS AS+A A I+GSFD  ++  +F+A+FL
Sbjct  1079  PKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMAIFL  1121



>ref|XP_002985558.1| hypothetical protein SELMODRAFT_122390 [Selaginella moellendorffii]
 gb|EFJ13432.1| hypothetical protein SELMODRAFT_122390 [Selaginella moellendorffii]
Length=391

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPS-TEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREY  493
             SQ ILWK+L+++P+  EF+HI   VNLVLW  ++  F  ++  Y LK  LYFEAVRRE+
Sbjct  65   GSQGILWKSLSSTPAMEEFVHIPKQVNLVLWCATLLAFVAISLTYLLKCFLYFEAVRREF  124

Query  492  YHPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            +HPVR+N+FFAP I  +FLA+G+P +V  +LH S+W + MAP+F L+LKIYGQW+SGG R
Sbjct  125  FHPVRINYFFAPCIGGMFLAIGLPDAVGLSLHPSVWCLLMAPLFLLELKIYGQWLSGGDR  184

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPS HL+IVGNFVGA+LGA +G KE  +FF+A+GLAHY+VLFVTLYQRLPTN+ 
Sbjct  185  RLSKVANPSTHLSIVGNFVGAVLGARVGWKEPAMFFWAVGLAHYMVLFVTLYQRLPTNKR  244

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAY  19
            LPK+LHPVFFLFVAAPS AS+A   I GSF   S+I Y
Sbjct  245  LPKDLHPVFFLFVAAPSTASVAWEDITGSFGYVSRIVY  282



>ref|XP_002987012.1| hypothetical protein SELMODRAFT_125321 [Selaginella moellendorffii]
 gb|EFJ11855.1| hypothetical protein SELMODRAFT_125321 [Selaginella moellendorffii]
Length=391

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPS-TEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREY  493
             SQ ILWK+L+++P+  EF+HI   VNLVLW  ++  F  ++  Y LK  LYFEAVRRE+
Sbjct  65   GSQGILWKSLSSTPAMEEFVHIPKQVNLVLWCATLLAFVAISLTYLLKCFLYFEAVRREF  124

Query  492  YHPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            +HPVR+N+FFAP I  +FLA+G+P +V  +LH S+W + MAP+F L+LKIYGQW+SGG R
Sbjct  125  FHPVRINYFFAPCIGGMFLAIGLPDAVGLSLHPSVWCLLMAPLFLLELKIYGQWLSGGDR  184

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPS HL+IVGNFVGA+LGA +G KE  +FF+A+GLAHY+VLFVTLYQRLPTN+ 
Sbjct  185  RLSKVANPSTHLSIVGNFVGAVLGARVGWKEPAMFFWAVGLAHYMVLFVTLYQRLPTNKR  244

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAY  19
            LPK+LHPVFFLFVAAPS AS+A   I GSF   S+I Y
Sbjct  245  LPKDLHPVFFLFVAAPSTASVAWEDITGSFGYVSRIVY  282



>ref|XP_009384523.1| PREDICTED: guard cell S-type anion channel SLAC1-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 175/224 (78%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SQAILW ALA+SP+  FL +S ++N+ LW++++ +   V+  Y LK I YFEA+RREY+
Sbjct  221  GSQAILWGALASSPAMAFLRVSPYINIALWLLALVILVSVSVTYTLKCIFYFEAIRREYF  280

Query  489  HPVRVNFFFAPWIVVLFLALGVPPS-VTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPWI  +FLA+G PP  V ++LH ++W  F+AP+F L++KIYGQW+SGG+R
Sbjct  281  HPVRVNFFFAPWIACMFLAIGTPPRWVPKHLHPAIWCAFIAPVFVLEVKIYGQWLSGGKR  340

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G  E   F +A+GLAHY+ +FVTLYQRLPTNE 
Sbjct  341  RLCKVANPSSHLSVVGNFVGAILAAKVGWGEAGKFLWAVGLAHYVCVFVTLYQRLPTNEA  400

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A PS AS+A   I+G FD  S   YFIALFL
Sbjct  401  LPKELHPVYSMFIATPSAASIAWTTIYGKFDAVSTTFYFIALFL  444



>ref|XP_002965651.1| hypothetical protein SELMODRAFT_31887, partial [Selaginella moellendorffii]
 ref|XP_002989264.1| hypothetical protein SELMODRAFT_21556, partial [Selaginella moellendorffii]
 gb|EFJ09702.1| hypothetical protein SELMODRAFT_21556, partial [Selaginella moellendorffii]
 gb|EFJ33071.1| hypothetical protein SELMODRAFT_31887, partial [Selaginella moellendorffii]
Length=397

 Score =   285 bits (728),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 168/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
             SQ ILWK L+  PS  FLHI LH+N VLW +++  +++++  Y  K I YFEAVRRE+Y
Sbjct  78   GSQTILWKKLSLMPSMRFLHIPLHINFVLWCVALCAYTLISLTYVCKCIFYFEAVRREFY  137

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            HPVR+NFFFAPW+  +FL LGVPP++  ++H + W VFM+P+  L+LKIYGQW+SGG+RR
Sbjct  138  HPVRINFFFAPWVCGMFLTLGVPPTIAASIHPAAWLVFMSPLVVLELKIYGQWLSGGERR  197

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            LSKVANP+ H++IVGNFVG+LLGAT+  KE   FF+A+G+AHY+V+FVTLYQRLPTNE L
Sbjct  198  LSKVANPATHVSIVGNFVGSLLGATVEWKELATFFWAVGIAHYVVVFVTLYQRLPTNELL  257

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASK  28
             +++HPV+FLF+A PS AS+A  KI   F   SK
Sbjct  258  TRDMHPVYFLFLAVPSTASVAWEKITSDFGYVSK  291



>ref|XP_006477326.1| PREDICTED: guard cell S-type anion channel SLAC1-like [Citrus 
sinensis]
Length=571

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 182/224 (81%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW+AL+TSP+T+FLH+   +NL LW+++VA+   V+F Y LK I YFEAVRREY+
Sbjct  218  SSQAVLWRALSTSPATKFLHVPPFINLGLWLLAVAVLISVSFTYILKCIFYFEAVRREYF  277

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSV-TENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVR+NFFFAPW+V +FLA+GVPP V +E LH ++W  FM P F L+LKIYGQW+SGG+R
Sbjct  278  HPVRINFFFAPWVVCMFLAIGVPPVVASETLHPAIWCAFMGPYFFLELKIYGQWLSGGKR  337

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G KE   F +A+G AHY+VLFVTLYQRLPT+E 
Sbjct  338  RLCKVANPSSHLSVVGNFVGAILAAKVGWKEVGKFLWAVGFAHYLVLFVTLYQRLPTSEA  397

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+AAPS AS+A   I+G  D  S+  YFIALFL
Sbjct  398  LPKELHPVYSMFIAAPSAASIAWQAIYGDLDGLSRTCYFIALFL  441



>gb|KDO63692.1| hypothetical protein CISIN_1g008007mg [Citrus sinensis]
Length=581

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 181/224 (81%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW+AL+TSP+T+FLH+   +NL LW+++VA+   V+F Y LK I YFEAVRREY+
Sbjct  228  SSQAVLWRALSTSPATKFLHVPPFINLGLWLLAVAVLISVSFTYILKCIFYFEAVRREYF  287

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVR+NFFFAPW+V +FLA+GVPP V  E LH ++W  FM P F L+LKIYGQW+SGG+R
Sbjct  288  HPVRINFFFAPWVVCMFLAIGVPPVVAPETLHPAIWCAFMGPYFFLELKIYGQWLSGGKR  347

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G KE   F +A+G AHY+VLFVTLYQRLPT+E 
Sbjct  348  RLCKVANPSSHLSVVGNFVGAILAAKVGWKEVGKFLWAVGFAHYLVLFVTLYQRLPTSEA  407

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+AAPS AS+A   I+G  D  S+  YFIALFL
Sbjct  408  LPKELHPVYSMFIAAPSAASIAWQAIYGDLDGLSRTCYFIALFL  451



>ref|XP_006440459.1| hypothetical protein CICLE_v10019450mg [Citrus clementina]
 gb|ESR53699.1| hypothetical protein CICLE_v10019450mg [Citrus clementina]
Length=581

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 181/224 (81%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW+AL+TSP+T+FLH+   +NL LW+++VA+   V+F Y LK I YFEAVRREY+
Sbjct  228  SSQAVLWRALSTSPATKFLHVPPFINLGLWLLAVAVLISVSFTYILKCIFYFEAVRREYF  287

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVR+NFFFAPW+V +FLA+GVPP V  E LH ++W  FM P F L+LKIYGQW+SGG+R
Sbjct  288  HPVRINFFFAPWVVCMFLAIGVPPVVAPETLHPAIWCAFMGPYFFLELKIYGQWLSGGKR  347

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G KE   F +A+G AHY+VLFVTLYQRLPT+E 
Sbjct  348  RLCKVANPSSHLSVVGNFVGAILAAKVGWKEVGKFLWAVGFAHYLVLFVTLYQRLPTSEA  407

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+AAPS AS+A   I+G  D  S+  YFIALFL
Sbjct  408  LPKELHPVYSMFIAAPSAASIAWQAIYGDLDGLSRTCYFIALFL  451



>ref|XP_004515754.1| PREDICTED: LOW QUALITY PROTEIN: guard cell S-type anion channel 
SLAC1-like [Cicer arietinum]
Length=553

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQA+LW+ +ATSP+T FLHI   V+  +W++++A+   V+  Y LK I YFEAVRREY+H
Sbjct  191  SQAVLWRTMATSPATSFLHIRPAVSFAIWLLALAVLIAVSITYILKCIFYFEAVRREYFH  250

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVT--ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            PVR+NFFFAPWIV +FLA+ VP  +     L  ++W  F+ P F L+LKIYGQW+SGG+R
Sbjct  251  PVRINFFFAPWIVCMFLAISVPSQLAPHTTLQPAIWCTFIVPYFLLELKIYGQWLSGGKR  310

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RLSKVANPSNHL++ GNFVGA+L + +G  E   FF+A+G AHY+V+FVTLYQRLPT+E 
Sbjct  311  RLSKVANPSNHLSVTGNFVGAILASKVGWNEPAKFFWAVGFAHYLVVFVTLYQRLPTSEA  370

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+AAPS AS+A   I+G FD   +  YFIALFL
Sbjct  371  LPKELHPVYTMFIAAPSAASLAWESIYGEFDGLCRTCYFIALFL  414



>ref|XP_004976557.1| PREDICTED: guard cell S-type anion channel SLAC1-like [Setaria 
italica]
Length=573

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 173/223 (78%), Gaps = 1/223 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQ ILW ALA SP+  FLH+S  +N+ LW+++VA+    +  YALK I YFEA+RREY+H
Sbjct  208  SQTILWGALAASPAMRFLHVSPMINVALWLLAVAVLVATSVTYALKCIFYFEAIRREYFH  267

Query  486  PVRVNFFFAPWIVVLFLALGVPPS-VTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            PVRVNFFFAPWI  +F+ LG+P +   E  H  +W  F+ P+F L+LKIYGQW+SGG+RR
Sbjct  268  PVRVNFFFAPWIAAMFVTLGLPRAYAPERPHPGVWCAFVLPLFALELKIYGQWLSGGKRR  327

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            L KVANPS+HL++VGNFVGA+L A +G  E   F +AIG+AHYIV+FVTLYQRLPTNE L
Sbjct  328  LCKVANPSSHLSVVGNFVGAILAARVGWTEAGKFLWAIGVAHYIVVFVTLYQRLPTNEAL  387

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPV+ +F+A PS AS+A A I+GSFD  ++  +F+A+FL
Sbjct  388  PKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMAIFL  430



>ref|XP_006363742.1| PREDICTED: guard cell S-type anion channel SLAC1-like [Solanum 
tuberosum]
Length=560

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 173/224 (77%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQAILW++LA SP T+FLH+ L +N  +W+++V +   V   Y  K  LYFEA++REY+
Sbjct  206  SSQAILWRSLALSPVTKFLHVPLFINFAVWLLAVGVLVAVFITYMFKCALYFEAIKREYF  265

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVTEN-LHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFF APWIV +FLA+G PP      LH ++W VFMAPIF L+LKIYGQW+SGG+R
Sbjct  266  HPVRVNFFCAPWIVCMFLAIGAPPKTAPGTLHPAIWCVFMAPIFFLNLKIYGQWLSGGKR  325

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL+++GNFVGA+L A +G KE   F ++IG AHY+V+FVTLYQRLPT+E 
Sbjct  326  RLCKVANPSSHLSVIGNFVGAILAAKVGWKEPGKFLWSIGFAHYLVVFVTLYQRLPTSEA  385

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+A P+ AS+A   I+  FD  ++  YFI+LFL
Sbjct  386  LPKELHPVYSMFIATPAAASLAWGAIYDEFDGLARTCYFISLFL  429



>tpg|DAA36386.1| TPA: hypothetical protein ZEAMMB73_956541 [Zea mays]
Length=574

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 174/223 (78%), Gaps = 1/223 (0%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAILW ALA SP+  FLH++  +N+ LW+++VA+    +  YALK I YFEA+RREY+H
Sbjct  210  SQAILWGALAASPAMRFLHVTPMINVALWLLAVAVLVATSVTYALKCIFYFEAIRREYFH  269

Query  486  PVRVNFFFAPWIVVLFLALGVPPS-VTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRR  310
            PVRVNFFFAPWI  +F+ +G+P S   E  H ++W  F+ P+F L+LKIYGQW+SGG+RR
Sbjct  270  PVRVNFFFAPWIAAMFVTIGLPRSYAPERPHPAVWCAFVLPLFALELKIYGQWLSGGKRR  329

Query  309  LSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETL  130
            L KVANPS+HL++VGNFVGA+L A +G  E     +AIG+AHYIV+FVTLYQRLPTNE L
Sbjct  330  LCKVANPSSHLSVVGNFVGAILAARVGWTEAGKLLWAIGVAHYIVVFVTLYQRLPTNEAL  389

Query  129  PKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            PKELHPV+ +F+A PS AS+A A I+GSFD  ++  +F+A+FL
Sbjct  390  PKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMAIFL  432



>ref|XP_007209029.1| hypothetical protein PRUPE_ppa023220mg [Prunus persica]
 gb|EMJ10228.1| hypothetical protein PRUPE_ppa023220mg [Prunus persica]
Length=562

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -2

Query  669  SSQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYY  490
            SSQA+LW ALATSP+T+FL+IS  +N+ LW+++V +   V+F Y LK I YFEAV+REY+
Sbjct  209  SSQAVLWHALATSPATKFLNISPVINVALWLLAVPVLLCVSFTYILKCIFYFEAVKREYF  268

Query  489  HPVRVNFFFAPWIVVLFLALGVPPSVT-ENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQR  313
            HPVRVNFFFAPW+V +FL LGVPP++  E L   +W  FMAP F L+LKIYGQW+SGG+R
Sbjct  269  HPVRVNFFFAPWVVCMFLTLGVPPAIALEKLQPFIWCTFMAPYFLLELKIYGQWLSGGKR  328

Query  312  RLSKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNET  133
            RL KVANPS+HL++VGNFVGA+L A +G  E   F +A+G AHY+VLFVTLYQRLPT+E 
Sbjct  329  RLCKVANPSSHLSVVGNFVGAILAAKVGWDEAAKFLWAVGFAHYLVLFVTLYQRLPTSEA  388

Query  132  LPKELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            LPKELHPV+ +F+AAPS AS+A   I+G FD  S+  YFIALFL
Sbjct  389  LPKELHPVYSMFIAAPSAASIAWETIYGEFDGVSRTCYFIALFL  432



>emb|CDY44267.1| BnaC02g41500D [Brassica napus]
Length=614

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 168/222 (76%), Gaps = 22/222 (10%)
 Frame = -2

Query  666  SQAILWKALATSPSTEFLHISLHVNLVLWIISVALFSIVAFIYALKTILYFEAVRREYYH  487
            SQAI+WK LAT+  T+FLH+SL ++  LW ISVAL  I+A IY LK ILYFEAVRREYYH
Sbjct  273  SQAIMWKTLATAKPTKFLHVSLWIHRSLWFISVALVLIIATIYLLKIILYFEAVRREYYH  332

Query  486  PVRVNFFFAPWIVVLFLALGVPPSVTENLHSSLWYVFMAPIFCLDLKIYGQWMSGGQRRL  307
            P+R+NFFFAP+I +LFLAL VPP +  +L   LWYV M P  CL+LKIYGQWMSG     
Sbjct  333  PIRINFFFAPFISLLFLALAVPPFIVTDLPQFLWYVLMFPFICLELKIYGQWMSG-----  387

Query  306  SKVANPSNHLAIVGNFVGALLGATMGLKEGPIFFFAIGLAHYIVLFVTLYQRLPTNETLP  127
                             GALLGA MGL+EGPIFFF +G+AHY+VLFVTLYQRLPTNETLP
Sbjct  388  -----------------GALLGARMGLREGPIFFFTVGMAHYLVLFVTLYQRLPTNETLP  430

Query  126  KELHPVFFLFVAAPSVASMALAKIHGSFDDASKIAYFIALFL  1
            K+LHPVFFLFVAAPSVASMA A I GSF+  SK+ YFIA+FL
Sbjct  431  KDLHPVFFLFVAAPSVASMAWATITGSFNYGSKVCYFIAMFL  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 997384586720