BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78168_g1_i1 len=1253 path=[1231:0-1252]

Length=1253
                                                                      Score     E

ref|XP_004250132.1|  PREDICTED: UPF0483 protein AGAP003155              328   2e-107   
ref|XP_009791392.1|  PREDICTED: UPF0483 protein CG5412-like             327   4e-107   
ref|XP_009791393.1|  PREDICTED: UPF0483 protein AGAP003155-like         327   5e-107   
ref|XP_009628842.1|  PREDICTED: UPF0483 protein AGAP003155              322   6e-105   
ref|XP_006353190.1|  PREDICTED: UPF0483 protein GA18864-like            319   1e-103   
ref|XP_003613094.1|  Ovarian cancer-associated gene 2 protein-lik...    313   2e-101   
ref|XP_010646332.1|  PREDICTED: UPF0483 protein AGAP003155              311   1e-100   
ref|XP_004250133.1|  PREDICTED: UPF0483 protein AGAP003155-like         309   7e-100   
gb|KHN00405.1|  UPF0483 protein AGAP003155-like protein                 305   2e-98    
ref|XP_007158387.1|  hypothetical protein PHAVU_002G149000g             305   2e-98    
gb|KHG07773.1|  Uncharacterized protein F383_35028                      303   2e-97    
ref|XP_007047826.1|  Folic acid and derivative biosynthetic proce...    302   3e-97    
emb|CDP01537.1|  unnamed protein product                                291   9e-93    
ref|XP_010025395.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    289   5e-92    
ref|XP_010025404.1|  PREDICTED: UPF0483 protein AGAP003155-like         288   6e-92    
ref|XP_010106313.1|  hypothetical protein L484_019828                   290   4e-91    
gb|KCW62055.1|  hypothetical protein EUGRSUZ_H04730                     284   3e-90    
ref|XP_010025403.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    284   4e-90    
gb|KCW62052.1|  hypothetical protein EUGRSUZ_H04729                     283   6e-90    
ref|XP_010025405.1|  PREDICTED: UPF0483 protein C25G4.2-like            283   1e-89    
ref|XP_006426300.1|  hypothetical protein CICLE_v10026008mg             284   1e-88    
ref|XP_010266516.1|  PREDICTED: ovarian cancer-associated gene 2 ...    280   2e-88    
ref|XP_010025402.1|  PREDICTED: ovarian cancer-associated gene 2 ...    279   8e-88    
ref|XP_007227573.1|  hypothetical protein PRUPE_ppa010983mg             277   2e-87    
ref|XP_011016882.1|  PREDICTED: UPF0483 protein CG5412                  275   8e-87    
ref|XP_008219377.1|  PREDICTED: dihydrofolate reductase                 275   1e-86    
ref|XP_002301079.1|  hypothetical protein POPTR_0002s10290g             274   2e-86    Populus trichocarpa [western balsam poplar]
gb|KDP29743.1|  hypothetical protein JCGZ_18678                         274   2e-86    
ref|XP_009373649.1|  PREDICTED: dihydrofolate reductase                 277   2e-86    
ref|XP_004490394.1|  PREDICTED: rhodanese-like domain-containing ...    273   6e-86    
ref|XP_007227572.1|  hypothetical protein PRUPE_ppa010983mg             273   6e-86    
ref|XP_004490411.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0483 prot...    273   9e-86    
ref|XP_002285711.1|  PREDICTED: UPF0483 protein AGAP003155              271   2e-85    Vitis vinifera
ref|XP_008352708.1|  PREDICTED: dihydrofolate reductase-like            271   3e-85    
ref|XP_006280974.1|  hypothetical protein CARUB_v10026973mg             272   4e-85    
ref|XP_002534315.1|  conserved hypothetical protein                     273   6e-85    Ricinus communis
ref|XP_010060078.1|  PREDICTED: dihydrofolate reductase                 270   7e-85    
gb|KFK28241.1|  hypothetical protein AALP_AA8G490600                    271   8e-85    
ref|XP_008444882.1|  PREDICTED: dihydrofolate reductase-like            271   9e-85    
ref|XP_006472521.1|  PREDICTED: dihydrofolate reductase-like            270   9e-85    
ref|XP_010530073.1|  PREDICTED: UPF0483 protein AGAP003155-like         270   1e-84    
gb|KCW62057.1|  hypothetical protein EUGRSUZ_H04730                     268   2e-84    
ref|XP_006433884.1|  hypothetical protein CICLE_v10002399mg             268   4e-84    
ref|XP_010025399.1|  PREDICTED: UPF0483 protein AGAP003155-like         268   6e-84    
ref|XP_003519835.1|  PREDICTED: UPF0483 protein AGAP003155-like         268   8e-84    
ref|XP_003615240.1|  Hydrolase, putative                                267   1e-83    
ref|XP_004152614.1|  PREDICTED: dihydrofolate reductase-like            268   1e-83    
ref|XP_010675437.1|  PREDICTED: ovarian cancer-associated gene 2 ...    267   3e-83    
ref|XP_010272959.1|  PREDICTED: UPF0483 protein AGAP003155-like         266   3e-83    
ref|XP_009626524.1|  PREDICTED: dihydrofolate reductase-like isof...    266   4e-83    
ref|XP_010530103.1|  PREDICTED: ovarian cancer-associated gene 2 ...    267   5e-83    
ref|XP_010463129.1|  PREDICTED: UPF0483 protein C25G4.2-like            266   1e-82    
gb|KDP41448.1|  hypothetical protein JCGZ_15855                         264   3e-82    
ref|XP_010530093.1|  PREDICTED: ovarian cancer-associated gene 2 ...    267   3e-82    
ref|XP_010530084.1|  PREDICTED: ovarian cancer-associated gene 2 ...    267   4e-82    
ref|XP_007141237.1|  hypothetical protein PHAVU_008G178800g             263   5e-82    
ref|XP_004299697.1|  PREDICTED: UPF0483 protein AAEL000016-like         263   5e-82    
ref|XP_002514003.1|  conserved hypothetical protein                     263   7e-82    Ricinus communis
ref|XP_007047825.1|  Alpha/beta-Hydrolases superfamily protein, p...    263   8e-82    
ref|XP_009130510.1|  PREDICTED: ovarian cancer-associated gene 2 ...    262   6e-81    
ref|XP_010484371.1|  PREDICTED: ovarian cancer-associated gene 2 ...    261   8e-81    
gb|KCW62054.1|  hypothetical protein EUGRSUZ_H04730                     259   2e-80    
ref|NP_567701.1|  uncharacterized protein                               259   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KHG12242.1|  Ovarian cancer-associated protein 2                     259   2e-80    
ref|XP_011096050.1|  PREDICTED: UPF0483 protein AGAP003155              258   3e-80    
ref|XP_006841248.1|  hypothetical protein AMTR_s00135p00087760          258   4e-80    
emb|CDY33961.1|  BnaC02g43760D                                          259   4e-80    
gb|AAM63786.1|  unknown                                                 258   9e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CAH67099.1|  H0818E04.16                                            258   1e-79    Oryza sativa [red rice]
emb|CDY37826.1|  BnaAnng04870D                                          258   1e-79    
ref|XP_010098668.1|  hypothetical protein L484_026043                   257   1e-79    
gb|EPS65400.1|  hypothetical protein M569_09376                         256   1e-79    
ref|XP_011097505.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    256   2e-79    
gb|KHN35465.1|  UPF0483 protein AGAP003155-like protein                 255   4e-79    
ref|XP_006652342.1|  PREDICTED: dihydrofolate reductase-like            256   4e-79    
dbj|BAB11562.1|  unnamed protein product                                256   4e-79    Arabidopsis thaliana [mouse-ear cress]
gb|EAY94329.1|  hypothetical protein OsI_16097                          256   5e-79    Oryza sativa Indica Group [Indian rice]
ref|NP_201343.2|  alpha/beta-Hydrolases superfamily protein             256   5e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009626527.1|  PREDICTED: UPF0483 protein CG5412-like isofo...    254   1e-78    
ref|XP_007018157.1|  Folic acid and derivative biosynthetic process     257   1e-78    
ref|NP_001052936.1|  Os04g0450100                                       255   1e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EYU22769.1|  hypothetical protein MIMGU_mgv1a011590mg                256   2e-78    
ref|XP_002864954.1|  hypothetical protein ARALYDRAFT_332756             254   2e-78    
ref|XP_003519190.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    253   2e-78    
ref|XP_007018147.1|  Folic acid and derivative biosynthetic process     254   3e-78    
ref|XP_006413439.1|  hypothetical protein EUTSA_v10026143mg             253   5e-78    
gb|KCW62048.1|  hypothetical protein EUGRSUZ_H04726                     253   5e-78    
emb|CDP11467.1|  unnamed protein product                                251   4e-77    
ref|NP_001145537.1|  uncharacterized protein LOC100278972               249   2e-76    Zea mays [maize]
ref|XP_004975781.1|  PREDICTED: dihydrofolate reductase-like            249   2e-76    
ref|XP_009770612.1|  PREDICTED: rhodanese-like domain-containing ...    248   2e-76    
ref|XP_010942650.1|  PREDICTED: UPF0483 protein CG5412-like             249   2e-76    
ref|NP_001237691.1|  uncharacterized protein LOC100500670               247   8e-76    
tpg|DAA37561.1|  TPA: hypothetical protein ZEAMMB73_807797              250   8e-76    
ref|XP_010320195.1|  PREDICTED: UPF0483 protein CG5412 isoform X2       246   2e-75    
ref|XP_006338096.1|  PREDICTED: ovarian cancer-associated gene 2 ...    247   3e-75    
ref|XP_004237969.1|  PREDICTED: UPF0483 protein CG5412 isoform X3       244   6e-75    
ref|XP_008776557.1|  PREDICTED: UPF0483 protein AGAP003155-like         245   7e-75    
gb|KHG17753.1|  Uncharacterized protein F383_22151                      243   3e-74    
ref|XP_010439048.1|  PREDICTED: ovarian cancer-associated gene 2 ...    243   8e-74    
ref|XP_010106315.1|  hypothetical protein L484_019830                   241   1e-73    
gb|ADE77504.1|  unknown                                                 242   2e-73    
ref|XP_004237967.1|  PREDICTED: ovarian cancer-associated gene 2 ...    242   2e-73    
ref|XP_009409294.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    241   3e-73    
ref|XP_003581295.1|  PREDICTED: UPF0483 protein AGAP003155              239   1e-72    
ref|XP_006338095.1|  PREDICTED: rhodanese-like domain-containing ...    238   2e-72    
ref|XP_008444881.1|  PREDICTED: ovarian cancer-associated gene 2 ...    238   2e-72    
ref|XP_009138021.1|  PREDICTED: UPF0483 protein CG5412                  237   6e-72    
emb|CDY34285.1|  BnaA01g13880D                                          236   2e-71    
ref|XP_010433772.1|  PREDICTED: UPF0483 protein AGAP003155-like         236   2e-71    
ref|XP_010448573.1|  PREDICTED: ovarian cancer-associated gene 2 ...    236   3e-71    
ref|XP_009380891.1|  PREDICTED: dihydrofolate reductase-like            235   4e-71    
emb|CDY03451.1|  BnaC01g16310D                                          235   5e-71    
ref|XP_010439046.1|  PREDICTED: UPF0483 protein CG5412-like             235   5e-71    
ref|XP_010025396.1|  PREDICTED: rhodanese-like domain-containing ...    232   1e-70    
emb|CAB45073.1|  putative protein                                       233   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433775.1|  PREDICTED: ovarian cancer-associated gene 2 ...    233   4e-70    
ref|XP_006285371.1|  hypothetical protein CARUB_v10006762mg             232   2e-69    
ref|XP_010448568.1|  PREDICTED: UPF0483 protein AGAP003155-like         230   3e-69    
ref|XP_009109248.1|  PREDICTED: UPF0483 protein AGAP003155-like         228   4e-68    
emb|CDY08935.1|  BnaC08g11650D                                          227   6e-68    
ref|XP_002446578.1|  hypothetical protein SORBIDRAFT_06g018330          226   3e-67    Sorghum bicolor [broomcorn]
emb|CAN80597.1|  hypothetical protein VITISV_002641                     238   6e-67    Vitis vinifera
ref|XP_009409293.1|  PREDICTED: dihydrofolate reductase-like isof...    224   9e-67    
ref|XP_004164784.1|  PREDICTED: dihydrofolate reductase-like            222   3e-66    
ref|XP_004152616.1|  PREDICTED: dihydrofolate reductase-like            222   3e-66    
ref|XP_004975783.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    225   5e-66    
ref|XP_004975784.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    224   5e-66    
gb|KCW62058.1|  hypothetical protein EUGRSUZ_H04730                     220   6e-66    
ref|XP_006394038.1|  hypothetical protein EUTSA_v10005471mg             221   3e-65    
ref|XP_009391336.1|  PREDICTED: UPF0483 protein AGAP003155-like         220   3e-65    
ref|XP_004240026.1|  PREDICTED: ovarian cancer-associated gene 2 ...    219   3e-65    
ref|XP_006280973.1|  hypothetical protein CARUB_v10026973mg             219   4e-65    
ref|XP_004975782.1|  PREDICTED: UPF0483 protein AGAP003155-like i...    220   5e-64    
ref|XP_009626526.1|  PREDICTED: dihydrofolate reductase-like isof...    214   2e-63    
ref|XP_004152615.1|  PREDICTED: dihydrofolate reductase-like            214   5e-63    
gb|ACN39839.1|  unknown                                                 214   8e-63    Picea sitchensis
gb|KCW62053.1|  hypothetical protein EUGRSUZ_H04730                     211   2e-62    
ref|XP_009626528.1|  PREDICTED: uncharacterized protein LOC104117...    209   1e-61    
ref|XP_011097506.1|  PREDICTED: UPF0483 protein GA18864-like isof...    208   2e-61    
gb|KEH28114.1|  dihydrofolate reductase-like protein                    207   5e-61    
ref|XP_008669333.1|  PREDICTED: ovarian cancer-associated gene 2 ...    211   8e-61    
gb|AFK42671.1|  unknown                                                 206   7e-60    
ref|XP_006360404.1|  PREDICTED: UPF0483 protein GA18864-like            203   1e-59    
dbj|BAJ86131.1|  predicted protein                                      203   1e-58    
dbj|BAJ98930.1|  predicted protein                                      202   4e-58    
gb|EMT12142.1|  Calmodulin-related protein                              207   4e-58    
ref|XP_004164783.1|  PREDICTED: dihydrofolate reductase-like            201   5e-58    
dbj|BAC10351.1|  unknown protein                                        199   3e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002964600.1|  hypothetical protein SELMODRAFT_82287              198   3e-57    
ref|XP_002988794.1|  hypothetical protein SELMODRAFT_128834             198   5e-57    
ref|NP_001031707.1|  uncharacterized protein                            196   5e-57    Arabidopsis thaliana [mouse-ear cress]
gb|EMS55430.1|  Calmodulin-related protein                              204   1e-56    
gb|EEC82715.1|  hypothetical protein OsI_27396                          198   1e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_003624798.1|  Dihydrofolate reductase                            195   1e-55    
ref|NP_001060690.2|  Os07g0687100                                       194   5e-55    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37560.1|  TPA: hypothetical protein ZEAMMB73_807797              194   2e-54    
tpg|DAA41804.1|  TPA: hypothetical protein ZEAMMB73_848431              191   4e-54    
ref|NP_001144323.1|  uncharacterized protein LOC100277218               191   5e-54    Zea mays [maize]
ref|XP_004958754.1|  PREDICTED: UPF0483 protein AGAP003155-like         195   6e-54    
ref|XP_006658157.1|  PREDICTED: UPF0483 protein AGAP003155-like         194   3e-53    
ref|XP_009586875.1|  PREDICTED: rhodanese-like domain-containing ...    187   3e-53    
ref|XP_002461247.1|  hypothetical protein SORBIDRAFT_02g043510          194   3e-53    Sorghum bicolor [broomcorn]
ref|XP_010055417.1|  PREDICTED: dihydrofolate reductase-like            189   3e-53    
ref|XP_004493280.1|  PREDICTED: family of serine hydrolases 3-like      193   5e-53    
tpg|DAA64212.1|  TPA: calmodulin                                        192   7e-53    
gb|KCW62056.1|  hypothetical protein EUGRSUZ_H04730                     183   1e-52    
ref|XP_010111313.1|  hypothetical protein L484_027968                   187   1e-52    
ref|XP_007161838.1|  hypothetical protein PHAVU_001G102300g             187   2e-52    
ref|XP_003554076.1|  PREDICTED: dihydrofolate reductase-like            187   2e-52    
gb|KHN34600.1|  Dihydrofolate reductase                                 187   2e-52    
gb|EYU20847.1|  hypothetical protein MIMGU_mgv1a012528mg                187   2e-52    
gb|AFK38495.1|  unknown                                                 187   3e-52    
ref|XP_009419840.1|  PREDICTED: dihydrofolate reductase-like            187   3e-52    
ref|XP_010439049.1|  PREDICTED: dihydrofolate reductase-like isof...    183   7e-52    
ref|XP_010909407.1|  PREDICTED: dihydrofolate reductase-like            186   9e-52    
ref|XP_006466282.1|  PREDICTED: ovarian cancer-associated gene 2 ...    181   1e-51    
ref|XP_010233722.1|  PREDICTED: dihydrofolate reductase-like            183   2e-51    
ref|XP_010673347.1|  PREDICTED: dihydrofolate reductase-like            184   2e-51    
ref|XP_010439051.1|  PREDICTED: dihydrofolate reductase-like isof...    181   2e-51    
ref|XP_006832894.1|  hypothetical protein AMTR_s00095p00115990          184   3e-51    
ref|XP_011079224.1|  PREDICTED: UPF0483 protein C25G4.2-like            184   6e-51    
ref|XP_007202241.1|  hypothetical protein PRUPE_ppa008733mg             185   6e-51    
ref|XP_004136600.1|  PREDICTED: UPF0483 protein AGAP003155-like         182   2e-50    
gb|KCW89972.1|  hypothetical protein EUGRSUZ_A02175                     180   2e-50    
ref|XP_002307937.2|  hypothetical protein POPTR_0006s02780g             182   2e-50    Populus trichocarpa [western balsam poplar]
emb|CBI18718.3|  unnamed protein product                                177   8e-50    
ref|XP_010433777.1|  PREDICTED: ovarian cancer-associated gene 2 ...    177   1e-49    
ref|XP_004287203.1|  PREDICTED: dihydrofolate reductase-like            180   2e-49    
ref|XP_006430437.1|  hypothetical protein CICLE_v10012464mg             180   2e-49    
ref|XP_006481982.1|  PREDICTED: dihydrofolate reductase-like            179   2e-49    
ref|XP_008443142.1|  PREDICTED: UPF0483 protein C25G4.2-like            178   5e-49    
gb|ABK94803.1|  unknown                                                 178   6e-49    Populus trichocarpa [western balsam poplar]
ref|XP_011040680.1|  PREDICTED: dihydrofolate reductase-like            178   7e-49    
ref|XP_010251742.1|  PREDICTED: UPF0483 protein CBG03338-like           176   5e-48    
ref|XP_006366754.1|  PREDICTED: dihydrofolate reductase-like            176   6e-48    
ref|XP_007018156.1|  Uncharacterized protein TCM_034460                 174   8e-48    
ref|XP_004242010.1|  PREDICTED: dihydrofolate reductase-like            174   1e-47    
ref|XP_009345365.1|  PREDICTED: dihydrofolate reductase-like            174   2e-47    
ref|XP_002283808.1|  PREDICTED: dihydrofolate reductase                 172   2e-46    Vitis vinifera
gb|KGN62728.1|  hypothetical protein Csa_2G369790                       169   2e-46    
ref|XP_007028389.1|  Folic acid and derivative biosynthetic proce...    172   2e-46    
gb|EMT15239.1|  hypothetical protein F775_04967                         175   3e-46    
gb|KHN42155.1|  Dihydrofolate reductase                                 166   2e-44    
gb|KCW89971.1|  hypothetical protein EUGRSUZ_A02175                     165   3e-44    
ref|XP_002990786.1|  hypothetical protein SELMODRAFT_272162             162   1e-43    
ref|XP_002974512.1|  hypothetical protein SELMODRAFT_271081             162   1e-43    
ref|XP_006360392.1|  PREDICTED: ovarian cancer-associated gene 2 ...    160   1e-43    
tpg|DAA37559.1|  TPA: hypothetical protein ZEAMMB73_807797              160   2e-43    
gb|KHG11174.1|  Dihydrofolate reductase                                 164   3e-43    
ref|XP_006495447.1|  PREDICTED: rhodanese-like domain-containing ...    160   5e-43    
ref|XP_001758505.1|  predicted protein                                  156   4e-41    
gb|KCW62059.1|  hypothetical protein EUGRSUZ_H04730                     150   5e-40    
ref|XP_009630893.1|  PREDICTED: uncharacterized protein LOC104120762    149   9e-40    
ref|XP_009802159.1|  PREDICTED: uncharacterized protein LOC104247763    146   2e-38    
ref|NP_001242178.1|  uncharacterized protein LOC100812874               144   1e-36    
gb|AFK41646.1|  unknown                                                 140   2e-36    
gb|KDO57359.1|  hypothetical protein CISIN_1g025495mg                   144   3e-36    
ref|XP_001779260.1|  predicted protein                                  140   3e-35    
ref|XP_002983136.1|  hypothetical protein SELMODRAFT_271605             140   6e-35    
ref|XP_008776461.1|  PREDICTED: uncharacterized protein LOC103696567    144   7e-35    
ref|XP_002965892.1|  hypothetical protein SELMODRAFT_227576             137   5e-34    
gb|EPS74177.1|  hypothetical protein M569_00573                         139   1e-33    
tpg|DAA64211.1|  TPA: calmodulin                                        130   1e-30    
gb|KGN62727.1|  hypothetical protein Csa_2G369780                       123   2e-30    
ref|XP_006481467.1|  PREDICTED: dihydrofolate reductase-like isof...    112   5e-26    
ref|XP_006481466.1|  PREDICTED: dihydrofolate reductase-like isof...    114   6e-26    
emb|CBI18719.3|  unnamed protein product                                103   1e-23    
ref|XP_007028390.1|  Folic acid and derivative biosynthetic proce...    103   7e-23    
gb|KEH25891.1|  serine hydrolase                                      97.1    5e-21    
ref|XP_002957066.1|  hypothetical protein VOLCADRAFT_121595           99.4    4e-20    
ref|XP_004988593.1|  hypothetical protein PTSG_10254                    101   6e-20    
ref|XP_009823046.1|  hypothetical protein H257_01496                  95.5    3e-19    
ref|XP_002501981.1|  predicted protein                                95.5    5e-19    Micromonas commoda
ref|XP_003057558.1|  predicted protein                                95.5    7e-19    
ref|XP_005525847.1|  PREDICTED: ovarian cancer-associated gene 2 ...  94.4    9e-19    
gb|KDD75386.1|  FSH1 serine hydrolase                                 92.4    4e-18    
ref|XP_005844648.1|  hypothetical protein CHLNCDRAFT_138988           92.4    5e-18    
dbj|BAJ95682.1|  predicted protein                                    86.7    2e-17    
ref|XP_009514215.1|  hypothetical protein PHYSODRAFT_308487           90.1    2e-17    
ref|XP_002909515.1|  serine hydrolase (FSH1), putative                89.7    3e-17    
gb|AFA26163.1|  hypothetical protein                                  86.7    4e-17    
ref|XP_001758707.1|  predicted protein                                86.7    4e-17    
ref|XP_008870246.1|  hypothetical protein H310_06832                  88.2    1e-16    
ref|XP_008903312.1|  hypothetical protein PPTG_10388                  87.0    2e-16    
gb|KDP44791.1|  hypothetical protein JCGZ_01291                       84.3    3e-16    
ref|XP_009495806.1|  hypothetical protein H696_03658                  88.2    3e-16    
ref|XP_009823045.1|  hypothetical protein H257_01495                  87.0    3e-16    
ref|XP_008880138.1|  hypothetical protein H310_14123                  86.7    4e-16    
gb|ETK90603.1|  hypothetical protein L915_05667                       85.9    7e-16    
ref|XP_001698787.1|  hypothetical protein CHLREDRAFT_177330           85.9    8e-16    Chlamydomonas reinhardtii
emb|CDH61426.1|  ovarian cancer-associated gene 2 proteinhomolog      86.3    1e-15    
ref|XP_001014187.1|  hypothetical protein TTHERM_00224570             85.1    1e-15    Tetrahymena thermophila
ref|XP_001630175.1|  predicted protein                                84.7    2e-15    Nematostella vectensis
emb|CDS04144.1|  hypothetical protein LRAMOSA07098                    84.3    3e-15    
gb|ETI50640.1|  hypothetical protein F443_05798                       83.6    4e-15    
ref|XP_008862562.1|  hypothetical protein H310_01275                  84.0    4e-15    
ref|XP_003082531.1|  Phospholipase/carboxyhydrolase (ISS)             83.6    6e-15    
emb|CDH57355.1|  ovarian cancer-associated gene 2 proteinhomolog      82.8    1e-14    
ref|XP_009514216.1|  hypothetical protein PHYSODRAFT_471918           82.4    1e-14    
gb|ETP48414.1|  hypothetical protein F442_05844                       82.4    1e-14    
gb|ETO79463.1|  hypothetical protein F444_05846                       81.3    3e-14    
emb|CBK21948.2|  unnamed protein product                              81.3    3e-14    
gb|ETK90602.1|  hypothetical protein L915_05666                       81.3    3e-14    
gb|ETM50319.1|  hypothetical protein L914_05608                       81.3    3e-14    
ref|XP_007922782.1|  hypothetical protein MYCFIDRAFT_77436            80.5    5e-14    
ref|XP_008870245.1|  hypothetical protein H310_06831                  80.5    5e-14    
ref|XP_008903311.1|  hypothetical protein PPTG_10387                  80.5    6e-14    
ref|XP_009821555.1|  hypothetical protein H257_00524                  80.5    6e-14    
ref|XP_001016512.1|  hypothetical protein TTHERM_00188360             80.1    8e-14    Tetrahymena thermophila
ref|XP_007485824.1|  PREDICTED: ovarian cancer-associated gene 2 ...  79.7    1e-13    
ref|XP_003971122.1|  PREDICTED: ovarian cancer-associated gene 2 ...  79.7    1e-13    
ref|XP_003748281.1|  PREDICTED: ovarian cancer-associated gene 2 ...  79.0    2e-13    
gb|AEE61492.1|  unknown                                               79.3    2e-13    
gb|ENN72434.1|  hypothetical protein YQE_10925                        80.1    2e-13    
ref|XP_007554429.1|  PREDICTED: ovarian cancer-associated gene 2 ...  78.6    3e-13    
gb|KFM26280.1|  hypothetical protein F751_4773                        78.6    3e-13    
ref|XP_009823044.1|  hypothetical protein H257_01494                  78.6    3e-13    
ref|XP_008425596.1|  PREDICTED: ovarian cancer-associated gene 2 ...  78.6    3e-13    
ref|XP_005462393.1|  PREDICTED: ovarian cancer-associated gene 2 ...  78.2    3e-13    
gb|KEQ96342.1|  hypothetical protein AUEXF2481DRAFT_87762             78.2    4e-13    
gb|EJT48843.1|  hypothetical protein A1Q1_02178                       77.8    4e-13    
ref|XP_008425594.1|  PREDICTED: ovarian cancer-associated gene 2 ...  77.8    5e-13    
gb|EFA02968.1|  hypothetical protein TcasGA2_TC030670                 78.2    5e-13    
ref|XP_002494630.1|  ZYRO0A05984p                                     77.8    5e-13    
ref|XP_005752404.1|  PREDICTED: ovarian cancer-associated gene 2 ...  77.8    6e-13    
ref|XP_005812428.1|  PREDICTED: ovarian cancer-associated gene 2 ...  77.0    9e-13    
ref|XP_005946863.1|  PREDICTED: ovarian cancer-associated gene 2 ...  77.0    1e-12    
ref|XP_004550213.1|  PREDICTED: ovarian cancer-associated gene 2 ...  77.0    1e-12    
ref|XP_004363006.1|  DUF341 family protein                            77.4    1e-12    
ref|XP_001701928.1|  predicted protein                                77.4    1e-12    
ref|XP_008552111.1|  PREDICTED: ovarian cancer-associated gene 2 ...  76.6    1e-12    
gb|EJY82698.1|  FSH1 domain containing protein                        77.0    1e-12    
gb|EFO26377.2|  hypothetical protein LOAG_02110                       75.5    3e-12    
ref|XP_006808730.1|  PREDICTED: ovarian cancer-associated gene 2 ...  75.5    3e-12    
ref|NP_588353.1|  dihydrofolate reductase Dfr1                        77.8    3e-12    
gb|AAA57051.1|  dihydropteridine reductase                            77.4    5e-12    
gb|KDO29103.1|  hypothetical protein SPRG_20123                       74.7    6e-12    
ref|XP_009046102.1|  hypothetical protein LOTGIDRAFT_224587           74.7    6e-12    
ref|XP_312845.5|  AGAP003155-PA                                       75.1    6e-12    
ref|XP_007904384.1|  PREDICTED: ovarian cancer-associated gene 2 ...  74.3    6e-12    
ref|XP_008191920.1|  PREDICTED: UPF0483 protein AGAP003155            75.5    7e-12    
emb|CAG08883.1|  unnamed protein product                              74.3    9e-12    
ref|XP_003395115.1|  PREDICTED: ovarian cancer-associated gene 2 ...  73.6    1e-11    
ref|XP_010571933.1|  PREDICTED: ovarian cancer-associated gene 2 ...  73.6    1e-11    
gb|EPY52139.1|  dihydrofolate reductase Dfr1                          75.9    1e-11    
ref|XP_002590157.1|  hypothetical protein BRAFLDRAFT_126058           73.2    1e-11    
emb|CCO37155.1|  hypothetical protein BN14_11307                      73.9    2e-11    
emb|CDQ95312.1|  unnamed protein product                              73.2    2e-11    
gb|EPB81823.1|  hypothetical protein HMPREF1544_11444                 73.2    2e-11    
dbj|BAO37932.1|  family of serine hydrolases 3                        73.2    2e-11    
dbj|BAP69487.1|  family of serine hydrolases 3                        73.2    2e-11    
gb|KHG19325.1|  putative Xaa-Pro aminopeptidase 3                     75.9    3e-11    
ref|XP_003137696.1|  hypothetical protein LOAG_02110                  72.8    3e-11    
gb|EFA79316.1|  Prostaglandin-E                                       75.9    3e-11    
gb|EUC56453.1|  serine hydrolase                                      72.8    4e-11    
ref|XP_002172452.1|  dihydrofolate reductase Dfr1                     74.3    4e-11    
ref|XP_002973061.1|  hypothetical protein SELMODRAFT_413493           74.7    5e-11    
ref|XP_006007488.1|  PREDICTED: ovarian cancer-associated gene 2 ...  72.0    5e-11    
gb|ERL90498.1|  hypothetical protein D910_07846                       71.2    5e-11    
gb|EJK68911.1|  hypothetical protein THAOC_09875                      71.6    6e-11    
ref|WP_034088813.1|  hypothetical protein                             71.2    6e-11    
ref|XP_006007485.1|  PREDICTED: ovarian cancer-associated gene 2 ...  72.0    6e-11    
ref|XP_006007487.1|  PREDICTED: ovarian cancer-associated gene 2 ...  72.0    6e-11    
ref|XP_009821556.1|  hypothetical protein, variant                    70.9    6e-11    
ref|XP_003491252.1|  PREDICTED: ovarian cancer-associated gene 2 ...  71.6    7e-11    
ref|XP_006007486.1|  PREDICTED: ovarian cancer-associated gene 2 ...  72.0    7e-11    
gb|EPS29681.1|  hypothetical protein PDE_04631                        72.0    7e-11    
gb|KEP48528.1|  serine hydrolase                                      72.0    7e-11    
ref|XP_001270251.1|  hypothetical protein ACLA_097660                 71.2    7e-11    
ref|XP_001644423.1|  hypothetical protein Kpol_1064p47                71.2    7e-11    
emb|CDH10057.1|  related to Family of serine hydrolases 3             72.0    8e-11    
ref|XP_002994256.1|  hypothetical protein SELMODRAFT_270132           73.6    9e-11    
ref|XP_006624137.1|  PREDICTED: UPF0483 protein CG5412-like           70.9    9e-11    
emb|CCO35532.1|  hypothetical protein BN14_09650                      72.0    1e-10    
gb|EIE83092.1|  hypothetical protein RO3G_07797                       70.1    1e-10    
ref|XP_008331124.1|  PREDICTED: ovarian cancer-associated gene 2 ...  70.5    1e-10    
gb|EMF12538.1|  hypothetical protein SEPMUDRAFT_44535                 72.0    1e-10    
ref|XP_003708427.1|  PREDICTED: UPF0483 protein AGAP003155-like       70.5    1e-10    
gb|ELT98892.1|  hypothetical protein CAPTEDRAFT_223070                71.2    2e-10    
ref|XP_008613318.1|  hypothetical protein SDRG_09179                  70.5    2e-10    
gb|EPX70878.1|  dihydrofolate reductase Dfr1                          72.8    2e-10    
ref|NP_001134280.1|  ovarian cancer-associated gene 2 protein hom...  70.1    2e-10    
emb|CDW71752.1|  UNKNOWN                                              70.9    2e-10    
ref|XP_004076235.1|  PREDICTED: ovarian cancer-associated gene 2 ...  70.1    2e-10    
ref|XP_011056368.1|  PREDICTED: ovarian cancer-associated gene 2 ...  70.1    2e-10    
gb|EGI64280.1|  Ovarian cancer-associated gene 2 protein-like pro...  70.1    2e-10    
gb|ETO33372.1|  hypothetical protein RFI_03736                        70.5    2e-10    
ref|XP_008292446.1|  PREDICTED: ovarian cancer-associated gene 2 ...  70.1    2e-10    
ref|XP_005314046.1|  PREDICTED: ovarian cancer-associated gene 2 ...  69.7    2e-10    
emb|CDO93037.1|  unnamed protein product                              69.7    3e-10    
ref|XP_007514627.1|  predicted protein                                70.5    3e-10    
gb|EKC39156.1|  hypothetical protein CGI_10006633                     70.5    3e-10    
ref|XP_002947375.1|  hypothetical protein VOLCADRAFT_116421           69.7    3e-10    
ref|XP_002096432.1|  GE25670                                          70.1    4e-10    
ref|XP_005179656.1|  PREDICTED: UPF0483 protein GA18864-like          69.7    4e-10    
ref|XP_007879459.1|  hypothetical protein PFL1_03749                  69.7    4e-10    
ref|XP_003651200.1|  hypothetical protein THITE_37820                 70.1    4e-10    
ref|XP_007927892.1|  hypothetical protein MYCFIDRAFT_23150            68.9    4e-10    
ref|XP_006977442.1|  PREDICTED: ovarian cancer-associated gene 2 ...  68.9    4e-10    
ref|XP_002043470.1|  GM23119                                          69.7    5e-10    
dbj|GAM18510.1|  hypothetical protein SAMD00019534_016850             69.7    5e-10    
emb|CEG62843.1|  hypothetical protein RMATCC62417_00103               68.9    5e-10    
emb|CEG66606.1|  hypothetical protein RMATCC62417_03153               68.6    5e-10    
ref|XP_005702918.1|  methyltransferase                                71.2    6e-10    
ref|NP_001107711.1|  ovarian cancer-associated gene 2 protein hom...  68.9    6e-10    
gb|KDO27688.1|  hypothetical protein SPRG_07317                       68.9    6e-10    
gb|EFX88631.1|  hypothetical protein DAPPUDRAFT_220828                68.6    6e-10    
gb|KDE09783.1|  hypothetical protein MVLG_00182                       69.7    6e-10    
ref|XP_004177076.1|  PREDICTED: LOW QUALITY PROTEIN: ovarian canc...  70.1    7e-10    
gb|KDO60629.1|  hypothetical protein CISIN_1g040514mg                 65.1    7e-10    
emb|CEG82616.1|  hypothetical protein RMATCC62417_16665               68.2    8e-10    
ref|XP_002984427.1|  hypothetical protein SELMODRAFT_423653           70.9    8e-10    
gb|EPB85554.1|  hypothetical protein HMPREF1544_07643                 68.6    8e-10    
ref|XP_002984531.1|  hypothetical protein SELMODRAFT_234558           70.9    9e-10    
sp|A4II73.2|OVCA2_XENTR  RecName: Full=Ovarian cancer-associated ...  68.2    9e-10    
gb|AAI35891.1|  ovca2 protein                                         68.2    9e-10    
ref|XP_003770180.1|  PREDICTED: diphthamide biosynthesis protein 1    70.9    9e-10    
ref|XP_002892497.1|  hypothetical protein ARALYDRAFT_471018           70.5    9e-10    
ref|XP_001209861.1|  predicted protein                                68.2    9e-10    
ref|NP_650895.1|  CG5412                                              68.9    1e-09    
emb|CCA17541.1|  serine hydrolase (FSH1) putative                     68.9    1e-09    
ref|XP_007515056.1|  predicted protein                                68.2    1e-09    
ref|XP_002903762.1|  serine hydrolase (FSH1)-like protein, putative   67.8    1e-09    
gb|EJY87701.1|  FSH1 domain containing protein                        68.2    1e-09    
ref|XP_002102713.1|  GD19358                                          68.6    1e-09    
ref|XP_004347772.1|  dihydrofolate reductase                          67.8    1e-09    
emb|CDQ01138.1|  Protein Bm2374, isoform b                            67.8    1e-09    
ref|XP_002563113.1|  Pc20g05840                                       68.2    1e-09    
ref|XP_001902405.1|  GH07367p                                         67.4    1e-09    
ref|XP_007229836.1|  PREDICTED: ovarian cancer-associated gene 2 ...  67.4    2e-09    
ref|XP_010475756.1|  PREDICTED: rhodanese-like domain-containing ...  70.1    2e-09    
ref|XP_002108258.1|  hypothetical protein TRIADDRAFT_52561            67.4    2e-09    
ref|NP_985212.1|  AER356Cp                                            67.8    2e-09    
ref|XP_010475757.1|  PREDICTED: rhodanese-like domain-containing ...  69.7    2e-09    
emb|CCK72291.1|  hypothetical protein KNAG_0J02100                    67.4    2e-09    
ref|XP_001444434.1|  hypothetical protein                             67.4    2e-09    
gb|AAC24078.1|  Contains similarity to dihydrofolate reductase (d...  69.3    2e-09    
gb|EXK86101.1|  hypothetical protein FOQG_10148                       67.0    2e-09    
ref|XP_009162334.1|  hypothetical protein T265_00325                  67.0    2e-09    
gb|EIE79041.1|  hypothetical protein RO3G_03746                       67.0    2e-09    
ref|XP_010903728.1|  PREDICTED: ovarian cancer-associated gene 2 ...  67.0    2e-09    
ref|XP_009032698.1|  hypothetical protein AURANDRAFT_18387            67.0    2e-09    
ref|NP_563840.1|  uncharacterized protein                             69.3    2e-09    
emb|CCX31176.1|  Similar to Dihydrofolate reductase; acc. no. P36591  67.0    2e-09    
gb|EXA41554.1|  hypothetical protein FOVG_10027                       66.6    2e-09    
ref|XP_003694286.1|  PREDICTED: LOW QUALITY PROTEIN: ovarian canc...  66.6    3e-09    
emb|CDF87263.1|  BN860_02454g1_1                                      67.4    3e-09    
ref|NP_001102506.1|  ovarian cancer-associated gene 2 protein         66.6    3e-09    
ref|XP_010458210.1|  PREDICTED: rhodanese-like domain-containing ...  68.9    3e-09    
ref|XP_001420904.1|  predicted protein                                67.0    3e-09    
ref|XP_005349617.1|  PREDICTED: ovarian cancer-associated gene 2 ...  66.6    3e-09    
ref|XP_010458209.1|  PREDICTED: rhodanese-like domain-containing ...  68.9    3e-09    
ref|XP_010776454.1|  PREDICTED: ovarian cancer-associated gene 2 ...  66.6    3e-09    
ref|NP_081412.1|  ovarian cancer-associated gene 2 protein homolog    66.6    3e-09    
emb|CDF87262.1|  BN860_02432g1_1                                      66.2    3e-09    
ref|XP_452511.1|  hypothetical protein                                67.0    3e-09    
ref|XP_006813983.1|  PREDICTED: ovarian cancer-associated gene 2 ...  67.0    3e-09    
ref|XP_001954565.1|  GF16680                                          67.4    4e-09    
ref|XP_005088422.1|  PREDICTED: ovarian cancer-associated gene 2 ...  66.2    4e-09    
ref|XP_002494631.1|  ZYRO0A06006p                                     67.0    4e-09    
ref|XP_001823250.1|  EF-hand calcium-binding domain protein           67.0    4e-09    
ref|XP_001979418.1|  GG23967                                          67.0    4e-09    
ref|XP_002378609.1|  EF-hand calcium-binding domain protein, puta...  66.6    4e-09    
ref|XP_005643498.1|  hypothetical protein COCSUDRAFT_59879            65.1    4e-09    
ref|XP_004347604.1|  dihydrofolate reductase                          67.0    4e-09    
ref|XP_006472227.1|  PREDICTED: rhodanese-like domain-containing ...  68.6    4e-09    
ref|XP_009148180.1|  PREDICTED: rhodanese-like domain-containing ...  68.6    5e-09    
ref|XP_009148179.1|  PREDICTED: rhodanese-like domain-containing ...  68.6    5e-09    
emb|CDX93513.1|  BnaA06g05350D                                        68.6    5e-09    
gb|EJW78372.1|  hypothetical protein WUBG_10720                       65.9    5e-09    
ref|XP_008897195.1|  hypothetical protein PPTG_05404                  66.2    6e-09    
ref|XP_001448782.1|  hypothetical protein                             65.9    6e-09    
gb|EYU38409.1|  hypothetical protein MIMGU_mgv1a003014mg              68.2    6e-09    
ref|XP_004925264.1|  PREDICTED: UPF0483 protein AGAP003155-like       66.2    6e-09    
gb|ELU39112.1|  FSH1 domain-containing protein                        67.0    7e-09    
ref|XP_003675452.1|  hypothetical protein NCAS_0C00950                65.5    7e-09    
ref|XP_006306499.1|  hypothetical protein CARUB_v10012485mg           67.8    7e-09    
emb|CEI94237.1|  hypothetical protein RMCBS344292_08451               65.1    7e-09    
ref|XP_003851329.1|  hypothetical protein MYCGRDRAFT_93616            65.1    8e-09    
ref|XP_002072194.1|  GK22454                                          66.2    8e-09    
ref|XP_008246127.1|  PREDICTED: rhodanese-like domain-containing ...  67.8    8e-09    
ref|XP_390721.1|  hypothetical protein FG10545.1                      65.5    9e-09    
emb|CEG76814.1|  hypothetical protein RMATCC62417_11662               65.1    9e-09    
emb|CEF69267.1|  UPF0483 protein CG5412                               65.1    9e-09    
gb|KFB47060.1|  AGAP003155-PA-like protein                            65.5    9e-09    
gb|KGO64092.1|  Serine hydrolase FSH                                  65.9    9e-09    
gb|KDO81641.1|  hypothetical protein CISIN_1g007311mg                 67.4    9e-09    
ref|XP_002553265.1|  KLTH0D12738p                                     65.5    9e-09    
gb|KDP23370.1|  hypothetical protein JCGZ_23203                       67.4    1e-08    
gb|ETI34099.1|  hypothetical protein F443_19307                       65.5    1e-08    
ref|XP_002536682.1|  conserved hypothetical protein                   62.4    1e-08    
ref|XP_006185060.1|  PREDICTED: ovarian cancer-associated gene 2 ...  65.1    1e-08    
ref|XP_008608169.1|  hypothetical protein SDRG_04281                  65.1    1e-08    
gb|EWY87745.1|  hypothetical protein FOYG_09139                       64.7    1e-08    
gb|ESW96434.1|  hypothetical protein HPODL_03058                      65.1    1e-08    
ref|XP_006891161.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.7    1e-08    
ref|XP_001270322.1|  DUF341 domain protein                            64.7    1e-08    
gb|EKC99276.1|  hypothetical protein A1Q2_06476                       65.9    1e-08    
gb|EJT48357.1|  hypothetical protein A1Q1_02640                       65.9    1e-08    
gb|KEQ86630.1|  hypothetical protein M438DRAFT_373172                 65.1    1e-08    
gb|AGO14152.1|  AaceriAER356Cp                                        65.1    1e-08    
emb|CCI44819.1|  unnamed protein product                              64.7    1e-08    
ref|XP_762428.1|  hypothetical protein UM06281.1                      66.6    1e-08    
ref|XP_007646031.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.7    1e-08    
emb|CDX94987.1|  BnaC05g06840D                                        67.0    1e-08    
ref|XP_005833415.1|  hypothetical protein GUITHDRAFT_70571            64.3    1e-08    
gb|KFK43225.1|  hypothetical protein AALP_AA1G096600                  67.0    1e-08    
gb|KFP01837.1|  Ovarian cancer-associated 2                           64.3    2e-08    
ref|XP_006214511.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.3    2e-08    
ref|XP_005096416.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.7    2e-08    
ref|XP_008008000.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.3    2e-08    
gb|EXK33527.1|  hypothetical protein FOMG_10798                       64.3    2e-08    
ref|XP_011092171.1|  PREDICTED: rhodanese-like domain-containing ...  66.6    2e-08    
ref|XP_004178702.1|  hypothetical protein TBLA_0B03420                65.1    2e-08    
gb|KEQ59238.1|  hypothetical protein M437DRAFT_69269                  65.1    2e-08    
gb|KEZ45626.1|  hypothetical protein SAPIO_CDS1983                    63.9    2e-08    
gb|EWZ40777.1|  hypothetical protein FOZG_09406                       63.9    2e-08    
ref|XP_007454263.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.7    2e-08    
emb|CDO93038.1|  unnamed protein product                              64.7    2e-08    
ref|XP_003386523.1|  PREDICTED: ovarian cancer-associated gene 2 ...  63.9    2e-08    
ref|XP_003670141.1|  hypothetical protein NDAI_0E00820                65.1    2e-08    
gb|ETO71479.1|  hypothetical protein F444_12209                       64.3    2e-08    
ref|XP_006433556.1|  hypothetical protein CICLE_v10000632mg           66.2    2e-08    
ref|XP_001357799.1|  GA18864                                          64.7    2e-08    
ref|XP_006433555.1|  hypothetical protein CICLE_v10000632mg           66.2    3e-08    
ref|XP_009393162.1|  PREDICTED: rhodanese-like domain-containing ...  65.9    3e-08    
ref|XP_008493350.1|  PREDICTED: ovarian cancer-associated gene 2 ...  63.9    3e-08    
gb|KDN45605.1|  FSH1-domain-containing protein                        65.1    3e-08    
gb|EKV04261.1|  hypothetical protein PDIG_90180                       64.3    3e-08    
ref|XP_009393161.1|  PREDICTED: rhodanese-like domain-containing ...  65.9    3e-08    
ref|XP_001994449.1|  GH17157                                          64.7    3e-08    
ref|XP_008908377.1|  hypothetical protein PPTG_13745                  63.5    3e-08    
ref|XP_003289325.1|  hypothetical protein DICPUDRAFT_98320            64.7    3e-08    
ref|XP_002001068.1|  GI10581                                          64.7    3e-08    
gb|ETK82888.1|  hypothetical protein L915_11818                       63.5    3e-08    
ref|XP_009393159.1|  PREDICTED: rhodanese-like domain-containing ...  65.9    3e-08    
ref|NP_001018391.1|  ovarian cancer-associated gene 2 protein hom...  63.5    3e-08    
ref|XP_001257469.1|  hypothetical protein NFIA_049100                 63.2    3e-08    
ref|XP_010956493.1|  PREDICTED: ovarian cancer-associated gene 2 ...  64.3    3e-08    



>ref|XP_004250132.1| PREDICTED: UPF0483 protein AGAP003155 [Solanum lycopersicum]
Length=225

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            + KKLR++CLHGFR S EILKKL+ RWPESV+ +LDL FLDAPFPAQGKS +EG FDPPY
Sbjct  1    MEKKLRILCLHGFRGSGEILKKLIFRWPESVIGKLDLVFLDAPFPAQGKSPLEGFFDPPY  60

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQA+K+F E+Y FEECLEYIED+M+KNGPFDGVLGFSQGAVL AA+PGMQR+G AL+
Sbjct  61   YEWFQANKDFTEFYNFEECLEYIEDFMLKNGPFDGVLGFSQGAVLGAAIPGMQRDGVALT  120

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKFVIIISGAKFGGP +G+PKL ANAFS  ++CPSLHFLGE DFQ+++G++LLECF
Sbjct  121  KVPKIKFVIIISGAKFGGPTYGIPKLVANAFSSTINCPSLHFLGEADFQRKDGEILLECF  180

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            VD  +IHHPKGHT+PRLD+ +V  MLGFI+KI
Sbjct  181  VDTQVIHHPKGHTIPRLDDSNVEIMLGFIEKI  212



>ref|XP_009791392.1| PREDICTED: UPF0483 protein CG5412-like [Nicotiana sylvestris]
Length=220

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK R++CLHGFR SAEILKKLVLRWPESV+D+LDL FLDAPFPAQGKS +EG FDPPYFE
Sbjct  8    KKPRILCLHGFRGSAEILKKLVLRWPESVVDKLDLVFLDAPFPAQGKSALEGFFDPPYFE  67

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ++K+F E+Y FEEC+EYIED+M K+GPFDG+LGFSQGAVL AA+PGMQRE  AL+K 
Sbjct  68   WFQSNKDFTEFYNFEECVEYIEDFMSKHGPFDGILGFSQGAVLGAAIPGMQRERVALTKV  127

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             +IKFVIIISGAK GGP +GVP+LAANAFS P++CPSLHFLGETDFQK++G++LLE FVD
Sbjct  128  PEIKFVIIISGAKLGGPTYGVPQLAANAFSSPVNCPSLHFLGETDFQKKDGEILLESFVD  187

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            P +IHH KGHT+PRLD+ S+  MLGFI+KI+K+
Sbjct  188  PQVIHHSKGHTIPRLDDSSLEIMLGFIEKIQKL  220



>ref|XP_009791393.1| PREDICTED: UPF0483 protein AGAP003155-like [Nicotiana sylvestris]
Length=220

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK R++CLHGFR SAEILKKLVLRW ESV+D+LDL FL+APFPAQGKS +EG FDPPYFE
Sbjct  8    KKPRILCLHGFRGSAEILKKLVLRWSESVVDKLDLVFLNAPFPAQGKSALEGFFDPPYFE  67

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ++K+F EYY FEECLEYIED+M K+GP DGVLGFSQGAVL AA+PGMQRE  AL+K 
Sbjct  68   WFQSNKDFTEYYNFEECLEYIEDFMSKHGPIDGVLGFSQGAVLGAAIPGMQRERVALTKV  127

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKFVIIISGAKFGGP FGVP+LAANAFS P++CPSLHFLGE DFQK++G++LLE FVD
Sbjct  128  QKIKFVIIISGAKFGGPSFGVPQLAANAFSSPINCPSLHFLGEADFQKKDGEILLESFVD  187

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            P +IHH KGHT+PRLDE S+  MLGFI+KI+K+
Sbjct  188  PQVIHHSKGHTIPRLDESSLEIMLGFIEKIQKL  220



>ref|XP_009628842.1| PREDICTED: UPF0483 protein AGAP003155 [Nicotiana tomentosiformis]
Length=220

 Score =   322 bits (824),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK R++CLHGFR SA+ILKKLV RWPESVL++LDL FLDAPFPAQGKS +EG FDPPYFE
Sbjct  8    KKPRILCLHGFRGSADILKKLVFRWPESVLEKLDLVFLDAPFPAQGKSALEGFFDPPYFE  67

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ++K+F E+Y F+ECLEYIED+M K+GPFDG+LGFSQGAVL AA+PGMQ+E  AL+K 
Sbjct  68   WFQSNKDFTEFYNFKECLEYIEDFMSKHGPFDGILGFSQGAVLGAAIPGMQKERVALAKI  127

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             +IKF+IIISGAKFGGP FGVP+LAAN FS P++CPSLHFLGETDFQK++G++LLE FVD
Sbjct  128  PEIKFLIIISGAKFGGPSFGVPQLAANVFSSPINCPSLHFLGETDFQKKDGEILLESFVD  187

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            P +IHH KGHT+P+LD+ S+  MLGFI+KI+K+
Sbjct  188  PQVIHHSKGHTIPKLDDSSLEIMLGFIEKIQKL  220



>ref|XP_006353190.1| PREDICTED: UPF0483 protein GA18864-like [Solanum tuberosum]
Length=230

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = +1

Query  157  QIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDP  336
            +I  KKLR++CLHGFR SA+ILKKL+ RWPESV  +LDL FLD PFPAQGKS +EG FDP
Sbjct  4    EIEKKKLRILCLHGFRGSADILKKLIFRWPESVTGKLDLVFLDGPFPAQGKSPLEGFFDP  63

Query  337  PYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAA  516
            PYFEWFQ++K+F E+Y FEECL+YIED+M+KNGPFDGVLGFSQGAVL AA+PGMQR+G A
Sbjct  64   PYFEWFQSNKDFTEFYNFEECLKYIEDFMLKNGPFDGVLGFSQGAVLGAAIPGMQRDGVA  123

Query  517  LSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLE  696
            L+K  K+KFVIIISGAKFGG  +G+PKLA NAFS P++ PSLHFLGE DFQ+++G++LLE
Sbjct  124  LTKVPKVKFVIIISGAKFGGSTYGIPKLATNAFSSPINSPSLHFLGEADFQRKDGEILLE  183

Query  697  CFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDK  795
            CFVDP +IHH KGHT+P+LD+ +V  MLGFI+K
Sbjct  184  CFVDPQVIHHSKGHTIPKLDDSNVEIMLGFIEK  216



>ref|XP_003613094.1| Ovarian cancer-associated gene 2 protein-like protein [Medicago 
truncatula]
 gb|AES96052.1| dihydrofolate reductase-like protein [Medicago truncatula]
Length=227

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             KK +++CLHGFRTS EILKKLVLRWPE+V+ +LDL FLD PFPAQGKS VEGIFDPPY+
Sbjct  6    QKKPKILCLHGFRTSGEILKKLVLRWPETVIQKLDLVFLDGPFPAQGKSDVEGIFDPPYY  65

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ+++ F EY  FEECL YIEDYM+KNGPFDGVLGFSQGA LAAA+PGMQ +GAAL K
Sbjct  66   EWFQSNEGFTEYRNFEECLAYIEDYMLKNGPFDGVLGFSQGAFLAAALPGMQAQGAALQK  125

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
             +KIKF+I+ISGAKFGG  +G PKLA+NAFS P+ CPSLH +G+ DF K E  +L E FV
Sbjct  126  ISKIKFLILISGAKFGGMNYGTPKLASNAFSKPIDCPSLHIIGDMDFLKPESIILREGFV  185

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            DP +IHHPKGHT+PRLDE+S+ TMLGFI+ I+ M
Sbjct  186  DPVVIHHPKGHTIPRLDEKSLPTMLGFINTIQGM  219



>ref|XP_010646332.1| PREDICTED: UPF0483 protein AGAP003155 [Vitis vinifera]
Length=229

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 184/218 (84%), Gaps = 2/218 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   +  K R++CLHGFRT AEILKKLV +WPE+VL  LDL FLDAPFPAQGKS VEG
Sbjct  1    MENQ--LQNKPRILCLHGFRTRAEILKKLVGKWPETVLGNLDLVFLDAPFPAQGKSDVEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            +FDPPY+EWFQ++++F EY  FEECL YIEDYM+K+GPF G+LGFSQGA+LAAA+PGMQ 
Sbjct  59   LFDPPYYEWFQSNQDFTEYINFEECLAYIEDYMLKHGPFHGLLGFSQGAILAAALPGMQA  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL+K  KIKF+IIISGAKFGG KFG PKLAANAFS P+ CPSLHF+GETDF K+EG 
Sbjct  119  QGVALTKVPKIKFLIIISGAKFGGSKFGSPKLAANAFSPPIPCPSLHFIGETDFMKQEGT  178

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             LLE FVDP +IHHP+GHTVPRLDE++  T+L FI KI
Sbjct  179  ALLESFVDPVVIHHPRGHTVPRLDEKAQETVLQFIQKI  216



>ref|XP_004250133.1| PREDICTED: UPF0483 protein AGAP003155-like [Solanum lycopersicum]
Length=235

 Score =   309 bits (792),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            +KK R++CLHG+R SA+ILKKL+ RWPESV  +LDL FLDAPFPA+GKS +EG FDPPYF
Sbjct  6    NKKPRILCLHGYRESAKILKKLIFRWPESVTGKLDLIFLDAPFPAKGKSRLEGYFDPPYF  65

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ +K+F E+Y FEECLEYIE++M K+GPFDG+LGFS  AVL AA+PGMQREG AL+K
Sbjct  66   EWFQFNKDFTEFYNFEECLEYIEEFMSKHGPFDGILGFSMAAVLCAAIPGMQREGVALTK  125

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKFVI+ISGAKFGGP FGVPKLA NAFS+P+ CPSLHFLGE D+QK++G++LLECFV
Sbjct  126  VPKIKFVILISGAKFGGPSFGVPKLAVNAFSYPISCPSLHFLGEKDYQKKDGEVLLECFV  185

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDK  795
            DP +IHHPKGH +P LD+ S   +LGFI+K
Sbjct  186  DPQVIHHPKGHAIPELDDSSAEIILGFIEK  215



>gb|KHN00405.1| UPF0483 protein AGAP003155-like protein [Glycine soja]
Length=221

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             +K+R++CLHGFRTS EILK+LVLRWPE VL +LDL FLD PFPAQG+S VEGIFDPPYF
Sbjct  7    QRKVRILCLHGFRTSGEILKQLVLRWPEPVLQKLDLVFLDGPFPAQGRSDVEGIFDPPYF  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQA++EF EY  FEECL YIEDYM+KNGPFDG L FSQGA+LAAA+PGMQ +G AL K
Sbjct  67   EWFQANEEFTEYTNFEECLAYIEDYMLKNGPFDGFLSFSQGAILAAALPGMQAQGVALGK  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+I ISGAKFG  +FG+PKLA+NAFS P+ CPSLHF+GE DF K E   LLE F 
Sbjct  127  VDKIKFLIEISGAKFGENRFGMPKLASNAFSKPIDCPSLHFIGEKDFMKAESIALLEAFQ  186

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            DP +IHHP+GHTVP+LD+ S+  M+ FID I++M
Sbjct  187  DPVVIHHPRGHTVPKLDDYSLEIMVNFIDTIQRM  220



>ref|XP_007158387.1| hypothetical protein PHAVU_002G149000g [Phaseolus vulgaris]
 ref|XP_007158388.1| hypothetical protein PHAVU_002G149000g [Phaseolus vulgaris]
 gb|ESW30381.1| hypothetical protein PHAVU_002G149000g [Phaseolus vulgaris]
 gb|ESW30382.1| hypothetical protein PHAVU_002G149000g [Phaseolus vulgaris]
Length=221

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME +Q   +K R++CLHGFRTS EILK+LVLRWPE V+ +LDL FLD  FPAQG+S VEG
Sbjct  1    MEEDQT-QRKPRILCLHGFRTSGEILKQLVLRWPEPVIQKLDLVFLDGQFPAQGRSDVEG  59

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQA+++F EY  FE CL YIEDYM+KNGPFDGVLGFSQGA+LAAA+PGMQ 
Sbjct  60   IFDPPYYEWFQANEDFSEYRNFEACLAYIEDYMLKNGPFDGVLGFSQGAILAAALPGMQA  119

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL K  KIKF+I+ISGAKFGG KFG+PKLA+NAFS P+ C SLH +GE DF KEE  
Sbjct  120  QGVALGKVDKIKFLIVISGAKFGGNKFGMPKLASNAFSKPIDCLSLHIIGEKDFMKEESV  179

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             LL  F +P +IHHP+GHTVP+LD+ S+ TM+ F D I++M
Sbjct  180  ALLGAFQNPVVIHHPRGHTVPKLDDNSLETMVNFTDNIQRM  220



>gb|KHG07773.1| Uncharacterized protein F383_35028 [Gossypium arboreum]
Length=233

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 184/227 (81%), Gaps = 3/227 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   I +K R++CLHGFRTSAEILK+ VLRWP +VLD+LDL FLDAP+PAQGKS VE 
Sbjct  1    MENQ--IQRKPRILCLHGFRTSAEILKRQVLRWPAAVLDKLDLVFLDAPYPAQGKSGVER  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
             FDPPY+EWFQA ++F EY  FEECL +IED M+K+GPFDG LGFSQGA+L+AA+PGMQR
Sbjct  59   FFDPPYYEWFQATEDFTEYTNFEECLAFIEDNMIKSGPFDGFLGFSQGALLSAALPGMQR  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL++  +IKF+IIISGAKFGGPKF   KL +NA+S PL CPSLH  GETDF K+E  
Sbjct  119  DGLALTRVPRIKFLIIISGAKFGGPKFAHHKLTSNAYSSPLECPSLHITGETDFMKQEST  178

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK-MAVQEE  822
             L E FVDP +I+HPKGHT+P LDE+S   MLGFI++I+K MA  +E
Sbjct  179  SLPEYFVDPFVINHPKGHTIPELDEKSTEVMLGFIERIQKTMATADE  225



>ref|XP_007047826.1| Folic acid and derivative biosynthetic process, putative [Theobroma 
cacao]
 gb|EOX91983.1| Folic acid and derivative biosynthetic process, putative [Theobroma 
cacao]
Length=227

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 181/223 (81%), Gaps = 3/223 (1%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            + +K R++CLHGFRTSAEILKKLVLRWP +VL++LDL FLD P+PAQGKS VEG FDPPY
Sbjct  5    VQRKPRILCLHGFRTSAEILKKLVLRWPATVLEKLDLVFLDGPYPAQGKSAVEGFFDPPY  64

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQA++++ EY  FEECL +IEDYM+KNGPFDG++GFSQGAVL+AA+PGMQR+G AL+
Sbjct  65   YEWFQANQDYTEYTNFEECLAFIEDYMIKNGPFDGLMGFSQGAVLSAALPGMQRDGVALT  124

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDF--QKEEGKLLLE  696
            K  KIKF+I+ISGAKFGG KFG  KL   AFS PL CPSLH +GE D    K E   LLE
Sbjct  125  KVPKIKFLILISGAKFGGSKFGHHKLTTTAFSSPLECPSLHIIGEMDTTNTKPESTALLE  184

Query  697  CFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK-MAVQEE  822
             FVDP +I+HPKGHTVP+LDE+S   ML FI++I+K M   EE
Sbjct  185  SFVDPFVINHPKGHTVPKLDEKSTEVMLRFIERIQKTMPTDEE  227



>emb|CDP01537.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 189/223 (85%), Gaps = 2/223 (1%)
 Frame = +1

Query  142  KMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            +++N+QI  +K R++CLHGFRTSA ILKKL+LRWPE+VLD+LDL FLDAP+PAQ KS VE
Sbjct  11   EVKNDQI-QRKPRILCLHGFRTSAAILKKLILRWPENVLDKLDLDFLDAPYPAQDKSAVE  69

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GIFDPP+FEWFQ+DK + E Y FEECLEY+EDYM+K+GPFDGVLGFSQG VLAAA PG+Q
Sbjct  70   GIFDPPFFEWFQSDKSYTECYNFEECLEYLEDYMIKHGPFDGVLGFSQGGVLAAAFPGIQ  129

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKF-GVPKLAANAFSHPLHCPSLHFLGETDFQKEE  678
            R+G AL+K  KIKFVII+SGAKFGG    G+PKLA NAFS PL CPSLHF+GETDF KEE
Sbjct  130  RDGVALTKVPKIKFVIILSGAKFGGGILIGIPKLAENAFSIPLECPSLHFIGETDFLKEE  189

Query  679  GKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            G  LL  FVDP +I++P+GHTVP+L +E   TML FIDKI+++
Sbjct  190  GIALLSSFVDPMVIYYPEGHTVPKLGKEGEETMLSFIDKIQEL  232



>ref|XP_010025395.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW62049.1| hypothetical protein EUGRSUZ_H04727 [Eucalyptus grandis]
Length=223

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            H+K R++CLHGFRTSA+IL+  + +WP+S+L++LDL +LDAP+P+ G+S+VEGIFDPPYF
Sbjct  7    HEKPRILCLHGFRTSAKILETQIHKWPDSILEKLDLVYLDAPYPSMGQSSVEGIFDPPYF  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQA+++F EY  FEEC+ +IED+MVKNGPFDG+LGFSQGA LAAA+PGMQ EG  L+K
Sbjct  67   EWFQANQDFTEYENFEECITFIEDFMVKNGPFDGLLGFSQGATLAAALPGMQAEGLVLTK  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+I+ SGAKFGG KFG P LAANAFS P+ CPSLH +GE DF K E   LL+ FV
Sbjct  127  VPKIKFLILTSGAKFGGSKFGAPPLAANAFSCPVKCPSLHVIGENDFLKPESIALLDSFV  186

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            DP++IHHP GHT+P LD++++  +  FI+KI  +A 
Sbjct  187  DPNVIHHPNGHTIPSLDDQNLEIVNNFIEKIRNLAA  222



>ref|XP_010025404.1| PREDICTED: UPF0483 protein AGAP003155-like [Eucalyptus grandis]
 gb|KCW62051.1| hypothetical protein EUGRSUZ_H04729 [Eucalyptus grandis]
Length=223

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 179/223 (80%), Gaps = 1/223 (0%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M  NQ  H+K R++CLHGFRTSA+IL+  + +WPESVL++LDL +LDAP+P+ G+S VEG
Sbjct  1    MTENQT-HEKPRILCLHGFRTSAKILETQIHKWPESVLEKLDLVYLDAPYPSTGQSGVEG  59

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPYFEWFQA+++F EY  FEEC+  IED+MVKNGPFDG+LGFSQGA+LAA +PGMQ 
Sbjct  60   IFDPPYFEWFQANQDFTEYENFEECIALIEDFMVKNGPFDGLLGFSQGAMLAATLPGMQA  119

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            EG  L+K  KIKF+I+I+GAK GG  +G P LAANAFS P+ CPSLH +GE DF K E  
Sbjct  120  EGLVLTKVPKIKFLILIAGAKLGGSTYGAPPLAANAFSSPVKCPSLHVIGENDFLKPESI  179

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
              L+ FVDP ++HHPKGHT+PRLD++S+G +  FI+KI+ +A 
Sbjct  180  AQLDLFVDPIVLHHPKGHTIPRLDDQSLGIVNNFIEKIQSLAT  222



>ref|XP_010106313.1| hypothetical protein L484_019828 [Morus notabilis]
 gb|EXC09730.1| hypothetical protein L484_019828 [Morus notabilis]
Length=326

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 178/225 (79%), Gaps = 3/225 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN     KK RV+C+HGFRTS+EILK+++  RWPE+VL +LDL FLDAPFPA GKS VE
Sbjct  1    MENQN--QKKPRVLCIHGFRTSSEILKRMLQKRWPETVLQKLDLVFLDAPFPAHGKSDVE  58

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GIFDPPY+EWFQ +++F EY  FEECL+YIEDYMVKNGPFDG LGFSQGA+L AA+PGMQ
Sbjct  59   GIFDPPYYEWFQGNQDFTEYKNFEECLKYIEDYMVKNGPFDGFLGFSQGAILIAALPGMQ  118

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
             EG AL+K  KIKF+IIISG KFGG KF  P+LAANAFS P+ CPSLHF+GE DF K  G
Sbjct  119  NEGVALTKVPKIKFLIIISGDKFGGAKFTAPRLAANAFSSPIECPSLHFIGELDFLKPGG  178

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQ  816
             +L+E F+DP +IHHPKGH +PRLD +    ++  I +  ++ ++
Sbjct  179  TVLVESFLDPVVIHHPKGHVIPRLDGKKKAKLVKQIHEKAQLNIE  223



>gb|KCW62055.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=225

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 171/216 (79%), Gaps = 2/216 (1%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  9    KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  68

Query  352  FQ--ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            FQ    ++  EY  +EEC+ YIED+MV+NGPFDG+LGFSQGA L A +PGMQ EG AL+K
Sbjct  69   FQFQVHQDHTEYQNYEECIAYIEDFMVQNGPFDGLLGFSQGASLCATLPGMQEEGVALTK  128

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKFVIIISGAK GG K+  PKLAANAF+ P+ CPSLHF+GE DFQK EG  L++ FV
Sbjct  129  VPKIKFVIIISGAKAGGAKYTAPKLAANAFAAPIKCPSLHFIGEQDFQKTEGLALIDSFV  188

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            DP +IHHPK HTVPRLD++SV     F++KI  +A 
Sbjct  189  DPLVIHHPKAHTVPRLDDQSVKIAQNFVEKILNLAT  224



>ref|XP_010025403.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW62050.1| hypothetical protein EUGRSUZ_H04728 [Eucalyptus grandis]
Length=240

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            H+K R++CLHGFR SA+IL+  + +WPESVL++LDL +L+AP+P+ GKS VEGIFDPPYF
Sbjct  7    HEKPRILCLHGFRMSAKILETQIHKWPESVLEKLDLVYLNAPYPSMGKSGVEGIFDPPYF  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQA+++F EY  FEEC+++IED+MVKNGPFDG+LGFSQGAVLAAA+PGMQ EG  L+K
Sbjct  67   EWFQANQDFTEYENFEECIDFIEDFMVKNGPFDGLLGFSQGAVLAAALPGMQAEGLVLTK  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+I+ISGAK GG K+G P LAANAFS P+ CPSLH +GE DFQK +   LL+ FV
Sbjct  127  VPKIKFLILISGAKLGGSKYGAPPLAANAFSPPVKCPSLHLIGENDFQKPDSIALLDSFV  186

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            DP ++HH +GHT+P LD++S+  +  FI+KI   A 
Sbjct  187  DPIVVHHLRGHTIPMLDDQSLEVVNNFIEKIRNHAT  222



>gb|KCW62052.1| hypothetical protein EUGRSUZ_H04729 [Eucalyptus grandis]
Length=229

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 179/229 (78%), Gaps = 7/229 (3%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M  NQ  H+K R++CLHGFRTSA+IL+  + +WPESVL++LDL +LDAP+P+ G+S VEG
Sbjct  1    MTENQT-HEKPRILCLHGFRTSAKILETQIHKWPESVLEKLDLVYLDAPYPSTGQSGVEG  59

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPYFEWFQA+++F EY  FEEC+  IED+MVKNGPFDG+LGFSQGA+LAA +PGMQ 
Sbjct  60   IFDPPYFEWFQANQDFTEYENFEECIALIEDFMVKNGPFDGLLGFSQGAMLAATLPGMQA  119

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLH------FLGETDF  666
            EG  L+K  KIKF+I+I+GAK GG  +G P LAANAFS P+ CPSLH       LGE DF
Sbjct  120  EGLVLTKVPKIKFLILIAGAKLGGSTYGAPPLAANAFSSPVKCPSLHVIVTVVLLGENDF  179

Query  667  QKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
             K E    L+ FVDP ++HHPKGHT+PRLD++S+G +  FI+KI+ +A 
Sbjct  180  LKPESIAQLDLFVDPIVLHHPKGHTIPRLDDQSLGIVNNFIEKIQSLAT  228



>ref|XP_010025405.1| PREDICTED: UPF0483 protein C25G4.2-like [Eucalyptus grandis]
Length=241

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 171/216 (79%), Gaps = 2/216 (1%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  25   KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  84

Query  352  FQ--ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            FQ    ++  EY  +EEC+ YIED+MV+NGPFDG+LGFSQGA L A +PGMQ EG AL+K
Sbjct  85   FQFQVHQDHTEYQNYEECIAYIEDFMVQNGPFDGLLGFSQGASLCATLPGMQEEGVALTK  144

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKFVIIISGAK GG K+  PKLAANAF+ P+ CPSLHF+GE DFQK EG  L++ FV
Sbjct  145  VPKIKFVIIISGAKAGGAKYTAPKLAANAFAAPIKCPSLHFIGEQDFQKTEGLALIDSFV  204

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            DP +IHHPK HTVPRLD++SV     F++KI  +A 
Sbjct  205  DPLVIHHPKAHTVPRLDDQSVKIAQNFVEKILNLAT  240



>ref|XP_006426300.1| hypothetical protein CICLE_v10026008mg [Citrus clementina]
 gb|ESR39540.1| hypothetical protein CICLE_v10026008mg [Citrus clementina]
Length=339

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   I KK R++CLHGFRTS EILKK + RWPES+L +LDL FLDAPFPA GKS VE 
Sbjct  121  MENG--IPKKPRILCLHGFRTSGEILKKQIGRWPESILRKLDLDFLDAPFPALGKSDVEA  178

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
             FDPPY+EW+Q +++  +Y  FE+ + YIEDYMV +GPFDG+LGFSQGA +AAA PGMQ 
Sbjct  179  FFDPPYYEWYQRNEDCTQYINFEQSIAYIEDYMVTHGPFDGLLGFSQGAFIAAASPGMQA  238

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            EG A +K  KIKFVI+I+GAKF G KFG PKLA NAFS P+ CPSLH +GE DF KE+G 
Sbjct  239  EGVAFTKVPKIKFVILIAGAKFLGFKFGQPKLAVNAFSSPVQCPSLHIIGENDFLKEQGM  298

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
             LLE FVDP +I+H KGHT+PR+DE    TML FI K +
Sbjct  299  ALLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQ  337



>ref|XP_010266516.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Nelumbo 
nucifera]
Length=244

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             KK R +CLHGFRTSA+IL+K V +WPESVL+++DL F+DAPFPA+GKS VEGIFDPPY 
Sbjct  5    EKKPRFLCLHGFRTSAKILRKQVGKWPESVLEKMDLVFVDAPFPAEGKSDVEGIFDPPYL  64

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DKEF +Y   +ECL+YIEDYM+K+GPFDG+LGFSQGA+L+A +PG+Q +G AL+K
Sbjct  65   EWFQFDKEFVQYRNLQECLQYIEDYMIKHGPFDGLLGFSQGAILSAGLPGLQAKGLALTK  124

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+III GAKF       P +A NA+S P+ CPSLHFLGETDF +  G  LLE FV
Sbjct  125  VPKIKFLIIIGGAKFQS-----PTVAENAYSLPIECPSLHFLGETDFLRPHGTKLLESFV  179

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            +P ++HHPKGHTVPRLDE+S+  ML F++KI+K
Sbjct  180  NPFIVHHPKGHTVPRLDEKSLNIMLDFLEKIQK  212



>ref|XP_010025402.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X1 [Eucalyptus grandis]
Length=246

 Score =   279 bits (713),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 176/222 (79%), Gaps = 6/222 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            H+K R++CLHGFR SA+IL+  + +WPESVL++LDL +L+AP+P+ GKS VEGIFDPPYF
Sbjct  7    HEKPRILCLHGFRMSAKILETQIHKWPESVLEKLDLVYLNAPYPSMGKSGVEGIFDPPYF  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQA+++F EY  FEEC+++IED+MVKNGPFDG+LGFSQGAVLAAA+PGMQ EG  L+K
Sbjct  67   EWFQANQDFTEYENFEECIDFIEDFMVKNGPFDGLLGFSQGAVLAAALPGMQAEGLVLTK  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLH------FLGETDFQKEEGKL  687
              KIKF+I+ISGAK GG K+G P LAANAFS P+ CPSLH       LGE DFQK +   
Sbjct  127  VPKIKFLILISGAKLGGSKYGAPPLAANAFSPPVKCPSLHLIVFIVLLGENDFQKPDSIA  186

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            LL+ FVDP ++HH +GHT+P LD++S+  +  FI+KI   A 
Sbjct  187  LLDSFVDPIVVHHLRGHTIPMLDDQSLEVVNNFIEKIRNHAT  228



>ref|XP_007227573.1| hypothetical protein PRUPE_ppa010983mg [Prunus persica]
 gb|EMJ28772.1| hypothetical protein PRUPE_ppa010983mg [Prunus persica]
Length=228

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 176/225 (78%), Gaps = 5/225 (2%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E   ++ KK R +CLHGFRTS EI+KK V +WPESVL +LDL +LD PFPA GKS VEGI
Sbjct  7    EEGGLLLKKPRFLCLHGFRTSGEIMKKQVGKWPESVLQKLDLVYLDGPFPALGKSDVEGI  66

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  F++CLEYIEDY++K GPFDG++GFSQGA+L+AA+PG+Q +
Sbjct  67   FDPPYYEWFQFNKEFSEYTNFDKCLEYIEDYIIKQGPFDGLVGFSQGAILSAALPGLQTK  126

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+K  KIKF+III GAKF       P +A +A++ P+ CPSLHFLGETDF K  G  
Sbjct  127  GVALTKVPKIKFLIIIGGAKFKS-----PAVADDAYASPIQCPSLHFLGETDFLKPYGLE  181

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            LLE  V+P +IHHPKGHTVPRLDE+ + TM+ FIDKI+K   +++
Sbjct  182  LLEHCVEPTIIHHPKGHTVPRLDEKGLETMMSFIDKIQKALTEKD  226



>ref|XP_011016882.1| PREDICTED: UPF0483 protein CG5412 [Populus euphratica]
Length=220

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 172/225 (76%), Gaps = 5/225 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   + KK R +CLHGFRTS EILKK V +WPESVL  LDL +LDAPFP+QGKS VEG
Sbjct  1    MGSEAEVPKKPRFLCLHGFRTSGEILKKQVHKWPESVLQMLDLVYLDAPFPSQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  F+ECL YIED+M+KNGPFDG+LGFSQGA+L+A +PG+Q 
Sbjct  61   IFDPPYYEWFQFNKEFNEYTNFDECLAYIEDFMIKNGPFDGLLGFSQGAILSAGLPGLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKF+III GA F       P LA  A++ P+ CPSLHFLGETDF K+ G 
Sbjct  121  TGVALTKVPKIKFLIIIGGAMFKS-----PSLAEKAYASPIECPSLHFLGETDFLKQYGM  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
             LL+C  D  +IHHPKGHT+PRLDE+ + TML FID+I+ M + +
Sbjct  176  ELLKCCADHVVIHHPKGHTIPRLDEKGLETMLSFIDRIQNMLLDK  220



>ref|XP_008219377.1| PREDICTED: dihydrofolate reductase [Prunus mume]
Length=228

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 175/225 (78%), Gaps = 5/225 (2%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E    + KK R +CLHGFRTS EI+KK V +WPESVL +LDL +LD PFPA GKS VEGI
Sbjct  7    EEGGWLLKKPRFLCLHGFRTSGEIMKKQVGKWPESVLQKLDLVYLDGPFPALGKSDVEGI  66

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  F++CLEYIEDY++K GPFDG++GFSQGA+L+AA+PG+Q +
Sbjct  67   FDPPYYEWFQFNKEFSEYTNFDKCLEYIEDYIIKQGPFDGLVGFSQGAILSAALPGLQAK  126

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+K  KIKF+III GAKF       P +A +A++ P+ CPSLHFLGETDF K  G  
Sbjct  127  GVALTKVPKIKFLIIIGGAKFKS-----PAVADDAYASPIQCPSLHFLGETDFLKPYGLE  181

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            LLE  V+P +IHHPKGHTVPRLDE+ + TM+ FIDKI+K   +++
Sbjct  182  LLEHCVEPTIIHHPKGHTVPRLDEKGLETMMSFIDKIQKALTEKD  226



>ref|XP_002301079.1| hypothetical protein POPTR_0002s10290g [Populus trichocarpa]
 gb|ABK94545.1| unknown [Populus trichocarpa]
 gb|EEE80352.1| hypothetical protein POPTR_0002s10290g [Populus trichocarpa]
Length=220

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 170/225 (76%), Gaps = 5/225 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K R +CLHGFRTS EILK  V +WPESVL  LDL FLDAPFP+QGKS VEG
Sbjct  1    MGSEAEIPRKPRFLCLHGFRTSGEILKTQVHKWPESVLQMLDLVFLDAPFPSQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  F+ECL YIED+M+KNGPFDG+LGFSQGA+L++ +PG+Q 
Sbjct  61   IFDPPYYEWFQFNKEFSEYTNFDECLAYIEDFMIKNGPFDGLLGFSQGAILSSGLPGLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKF+III GA F       P +A  A+  P+ CPSLH LGETDF K+ G 
Sbjct  121  TGVALTKVPKIKFLIIIGGAMFKS-----PSVAEKAYDSPIECPSLHLLGETDFLKQYGM  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
             LL+C VDP +IHHPKGHT+PRLDE+   TML FID+I+ M + +
Sbjct  176  ELLKCCVDPVVIHHPKGHTIPRLDEKGSETMLSFIDRIQNMLLDK  220



>gb|KDP29743.1| hypothetical protein JCGZ_18678 [Jatropha curcas]
Length=224

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = +1

Query  202  RTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkey  381
            RTS  IL+KL+ RWP++VL++LDLHFLD  FPA+GKS VEG FDPPYFEW+Q+ ++FKEY
Sbjct  18   RTSGSILQKLIGRWPQTVLEKLDLHFLDGLFPARGKSDVEGFFDPPYFEWYQSSQDFKEY  77

Query  382  ykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISG  561
              FEEC+ YIEDYM+ +GPFDG+LGFSQGA+L+AA+PGMQ +G A ++  KIKF+IIISG
Sbjct  78   RNFEECVAYIEDYMINHGPFDGLLGFSQGAMLSAAVPGMQLQGMAFTRVPKIKFLIIISG  137

Query  562  AKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHT  741
            AKF G KFG PKLAANAFS P+ CPSLH +GE DF K  G  LLE FVDP +IHHPKGH 
Sbjct  138  AKFLGYKFGQPKLAANAFSSPVECPSLHIIGEMDFLKPGGIDLLESFVDPVVIHHPKGHI  197

Query  742  VPRLDEESVGTMLGFIDKIEKMAVQEE  822
            +PRLD+ ++  ML FI+KI+KM   E+
Sbjct  198  IPRLDDNNIKIMLSFIEKIQKMPSDEQ  224



>ref|XP_009373649.1| PREDICTED: dihydrofolate reductase [Pyrus x bretschneideri]
Length=310

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 181/257 (70%), Gaps = 10/257 (4%)
 Frame = +1

Query  52   SLKIHCNYVASNYFLGNKELREYLSSFLHLKMENNQIIHKKLRVVCLHGFRTSAEILKKL  231
            SL     Y +S Y+L     R+   +             +K R +CLHGFRTS EI++K 
Sbjct  62   SLVDRSEYSSSPYYL-----RKTAENMGSQGSGEGGGCSRKPRFLCLHGFRTSGEIMRKQ  116

Query  232  VLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYI  411
            V +WPESVL++LD+ +LD PFPAQGKS V+GIFDPPY+EWFQ ++EF  Y  F++CLEYI
Sbjct  117  VGKWPESVLEKLDMVYLDGPFPAQGKSDVDGIFDPPYYEWFQFNQEFSAYTNFDKCLEYI  176

Query  412  EDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGV  591
            EDYM+K GPFDG++GFSQGA+L+A +PG+Q +G AL+K  KIKF+III GAKF       
Sbjct  177  EDYMIKQGPFDGLVGFSQGAILSAGLPGLQAKGVALTKVPKIKFLIIIGGAKFNS-----  231

Query  592  PKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVG  771
            P +A +A+S P+ CPSLHFLGE DF K  G  LLE  VD  +IHHPKGHTVPRLDE+ + 
Sbjct  232  PAVAEDAYSSPIQCPSLHFLGEMDFLKPYGLQLLEHCVDASVIHHPKGHTVPRLDEKGLD  291

Query  772  TMLGFIDKIEKMAVQEE  822
            TM+ FIDKI  +  +++
Sbjct  292  TMMNFIDKIRNILAEKD  308



>ref|XP_004490394.1| PREDICTED: rhodanese-like domain-containing protein 6-like [Cicer 
arietinum]
Length=223

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 178/221 (81%), Gaps = 6/221 (3%)
 Frame = +1

Query  145  MEN-NQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN +  + +K R +CLHGFRTSAEI+KK + +WP+ VLD+LDL ++DAPFP  GKS VE
Sbjct  1    MENEDNNMARKPRFLCLHGFRTSAEIMKKQIEKWPQDVLDKLDLVYVDAPFPCTGKSDVE  60

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GIFDPPY+EWFQ +KEF EY  F+ECL+YIEDY+VK+GPFDG+LGFSQGA+L+A++PG+Q
Sbjct  61   GIFDPPYYEWFQFNKEFTEYINFDECLQYIEDYIVKHGPFDGLLGFSQGAILSASIPGLQ  120

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
             +G AL+K  K+KFVIII+GAKF       P +A  A+S  + CPSLHF+GE D+ K+ G
Sbjct  121  EKGVALTKVPKVKFVIIIAGAKFRS-----PSVAEKAYSSMITCPSLHFIGENDYLKQYG  175

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            K L+E FV+P +IHHPKGHTVPRLD++++ T+  FI++I+K
Sbjct  176  KELMESFVEPVVIHHPKGHTVPRLDDKTLNTVTSFIERIQK  216



>ref|XP_007227572.1| hypothetical protein PRUPE_ppa010983mg [Prunus persica]
 gb|EMJ28771.1| hypothetical protein PRUPE_ppa010983mg [Prunus persica]
Length=224

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 169/225 (75%), Gaps = 9/225 (4%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E   ++ KK R +CLHGFRTS EI+KK V +WPESVL +LDL +LD PFPA GKS VEGI
Sbjct  7    EEGGLLLKKPRFLCLHGFRTSGEIMKKQVGKWPESVLQKLDLVYLDGPFPALGKSDVEGI  66

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +K          CLEYIEDY++K GPFDG++GFSQGA+L+AA+PG+Q +
Sbjct  67   FDPPYYEWFQFNKYTNFDK----CLEYIEDYIIKQGPFDGLVGFSQGAILSAALPGLQTK  122

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+K  KIKF+III GAKF  P      +A +A++ P+ CPSLHFLGETDF K  G  
Sbjct  123  GVALTKVPKIKFLIIIGGAKFKSPA-----VADDAYASPIQCPSLHFLGETDFLKPYGLE  177

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            LLE  V+P +IHHPKGHTVPRLDE+ + TM+ FIDKI+K   +++
Sbjct  178  LLEHCVEPTIIHHPKGHTVPRLDEKGLETMMSFIDKIQKALTEKD  222



>ref|XP_004490411.1| PREDICTED: LOW QUALITY PROTEIN: UPF0483 protein CG5412-like [Cicer 
arietinum]
Length=242

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 178/225 (79%), Gaps = 6/225 (3%)
 Frame = +1

Query  133  LHLKMEN-NQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGK  309
            L L MEN N+ + +K R +CLHGFRTSAEI+K  + +WP+SVLD+LDL FLDAPFP +GK
Sbjct  2    LSLDMENENKNMERKPRFLCLHGFRTSAEIMKTQMHKWPQSVLDKLDLVFLDAPFPCKGK  61

Query  310  STVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAM  489
            S VEGIFDPPY+EWFQ ++E  EYY F+ECL+YIED+M+K+GPFDG+LGFSQG+VLAAA+
Sbjct  62   SLVEGIFDPPYYEWFQFNEETTEYYNFDECLQYIEDFMIKHGPFDGLLGFSQGSVLAAAL  121

Query  490  PGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQ  669
            PG+Q +G AL+K  K+KFVIII+G K        P LA  A+  P+ CPSLHFLGE DF 
Sbjct  122  PGLQEKGIALTKVPKVKFVIIIAGIKSRS-----PLLAEKAYFPPISCPSLHFLGEKDFL  176

Query  670  KEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            K  GK LLE FV+P  I+H KGHTVPRLD++S+ T++ FI+KI+K
Sbjct  177  KHFGKQLLEYFVEPVAIYHSKGHTVPRLDDKSLNTVMNFIEKIQK  221



>ref|XP_002285711.1| PREDICTED: UPF0483 protein AGAP003155 [Vitis vinifera]
 emb|CBI19228.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 174/221 (79%), Gaps = 5/221 (2%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            +  +K R +CLHGFRTSA+IL+K V +WPESVL ++DL F DAPFP+ GKS VEGIFDPP
Sbjct  7    VAMRKPRFLCLHGFRTSADILQKQVGKWPESVLGQVDLVFADAPFPSNGKSDVEGIFDPP  66

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            Y+EWFQ +KEF EY  F+ECL YIEDYM+K+GPFDG+LGFSQGA+L+AA+PG+Q +G AL
Sbjct  67   YYEWFQFNKEFTEYTNFDECLAYIEDYMIKHGPFDGLLGFSQGAILSAALPGLQAKGLAL  126

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
            +K  KI F+III GAK        P LA  A+S  + C S+HFLGETDF ++ G  LLE 
Sbjct  127  TKVPKINFLIIIGGAKLKS-----PSLAEKAYSSTIQCQSIHFLGETDFLRQYGIELLES  181

Query  700  FVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            FVDP +IHHPKGHTVPRLDE+S+  MLGF+++I+KM  ++E
Sbjct  182  FVDPLVIHHPKGHTVPRLDEKSLQIMLGFLERIQKMLPEKE  222



>ref|XP_008352708.1| PREDICTED: dihydrofolate reductase-like [Malus domestica]
Length=228

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 171/218 (78%), Gaps = 5/218 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EI++K V +WPESVL++LD+ +LD PFPA+GKS V+GIFDPPY+E
Sbjct  14   RKPRFLCLHGFRTSGEIMRKQVGKWPESVLEKLDMVYLDGPFPAEGKSDVDGIFDPPYYE  73

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ ++EF  Y  F+ECLEYIEDYM+K GPFDG++GFSQGA+L+A +PG+Q +G AL+K 
Sbjct  74   WFQFNQEFSAYTNFDECLEYIEDYMIKQGPFDGLVGFSQGAILSAGLPGLQAKGVALTKV  133

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKF+III GAKF       P +A +A+S P+ CPSLHFLGE DF K  G  LLE  VD
Sbjct  134  PKIKFLIIIGGAKFKS-----PAVAEDAYSSPIQCPSLHFLGEMDFLKPYGLELLEHCVD  188

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
              +IHHPKGHTVPRLDE+ + TM+ FIDKI+ +  +++
Sbjct  189  ASVIHHPKGHTVPRLDEKGLDTMMNFIDKIQNILAEKD  226



>ref|XP_006280974.1| hypothetical protein CARUB_v10026973mg [Capsella rubella]
 gb|EOA13872.1| hypothetical protein CARUB_v10026973mg [Capsella rubella]
Length=261

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 180/251 (72%), Gaps = 1/251 (0%)
 Frame = +1

Query  79   ASNYFLGNKELREYLSSFLHLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESV  255
            +S+ F    E R  L   +    + +    K  R++CLHGFRTS  IL+ ++L +WPE+V
Sbjct  5    SSSCFQTAGEFRAGLRFKITAMAQGSHRKSKNPRILCLHGFRTSGRILRAIILNKWPETV  64

Query  256  LDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNG  435
            L  LDL FLDAPFPA GKS VE  FDPPY+EW+QA+KE KEY  FEECL Y+EDYM+KNG
Sbjct  65   LRNLDLDFLDAPFPATGKSDVERFFDPPYYEWYQANKELKEYKNFEECLAYVEDYMIKNG  124

Query  436  PFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAF  615
            PFDG+LGFSQGA L AA+PGMQ +G AL+K  K+KF++IISGAK  G  FG PK A NAF
Sbjct  125  PFDGLLGFSQGAFLTAAIPGMQEQGTALTKVPKVKFLVIISGAKLPGLIFGEPKAAVNAF  184

Query  616  SHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDK  795
            S P+ CPSLHF+GE DF K EG+ L++ FV+P +I H   HT+P+LD  +  T+L F +K
Sbjct  185  SSPVRCPSLHFIGERDFLKTEGEALVKSFVEPVVIRHTSAHTIPKLDTIAGETVLSFFEK  244

Query  796  IEKMAVQEEGN  828
            I++M  +E G+
Sbjct  245  IKQMLPEETGH  255



>ref|XP_002534315.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28071.1| conserved hypothetical protein [Ricinus communis]
Length=287

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 173/223 (78%), Gaps = 1/223 (0%)
 Frame = +1

Query  133  LHLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKS  312
            + + MEN +    K R++C+H FRTSA I +K++ RWP +VL++L LHFLD PF A+GKS
Sbjct  61   MMMTMEN-KTFRNKPRILCIHSFRTSAAIFQKMIERWPVTVLEKLQLHFLDGPFLARGKS  119

Query  313  TVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMP  492
             VE +FDPPY+EW+Q+ ++FK Y  FEEC+ YIE+YM+K GPFDG+LGFSQGA + AA+P
Sbjct  120  DVELLFDPPYYEWYQSSEDFKVYEDFEECVAYIEEYMLKYGPFDGLLGFSQGAFITAAVP  179

Query  493  GMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQK  672
            GMQ +G A +K  KI+F+I+ISGAKFGG KFG PKLA +A+S P+ CPSLH +GE DF K
Sbjct  180  GMQAQGVAFTKVPKIRFLIVISGAKFGGYKFGQPKLAGSAYSSPIDCPSLHIIGEKDFMK  239

Query  673  EEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
              G  LL  FVDP +IHHPKGH +PRLD+ S+ TML FI+K+E
Sbjct  240  PGGIDLLGSFVDPVVIHHPKGHIIPRLDDISLKTMLSFIEKME  282



>ref|XP_010060078.1| PREDICTED: dihydrofolate reductase [Eucalyptus grandis]
 gb|KCW66607.1| hypothetical protein EUGRSUZ_F00401 [Eucalyptus grandis]
Length=228

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 169/219 (77%), Gaps = 5/219 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             ++ R++CLHGFRTS EILKK VL+WP+SVL R+DL F D PFPA+GKS VEGIFDPPYF
Sbjct  13   QRRPRILCLHGFRTSGEILKKQVLKWPDSVLRRVDLVFPDGPFPAEGKSDVEGIFDPPYF  72

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ +KEF EY  F+ECL YIED M+K GPFDG+LGFSQGA+L+AA+PG+Q +G AL+K
Sbjct  73   EWFQFNKEFTEYTNFDECLSYIEDVMIKQGPFDGLLGFSQGAILSAALPGLQAKGVALTK  132

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+III GAKF       P +A NA++ P+ CPSLHFLGETDF K  G  LLE   
Sbjct  133  VPKIKFLIIIGGAKFKS-----PSVADNAYASPIQCPSLHFLGETDFLKPYGLELLESCA  187

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            DP ++HHPKGHT+PRLDE+ + T   F+D+I  +  ++E
Sbjct  188  DPIIVHHPKGHTIPRLDEKGLETAERFLDRIRDVLAEDE  226



>gb|KFK28241.1| hypothetical protein AALP_AA8G490600 [Arabis alpina]
Length=239

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K  RV+CLHGFRTS  IL+ L+ +WPE++L  LDL FLD PFPA GKS VE  FDPPY+E
Sbjct  15   KNPRVLCLHGFRTSGRILQALISKWPETILRNLDLEFLDGPFPATGKSDVERFFDPPYYE  74

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            W+QA K F EY  FEECL Y+EDYM+KNGPFDG+LGFSQGA L+AA+PGMQ EG AL+K 
Sbjct  75   WYQASKGFTEYRNFEECLAYVEDYMIKNGPFDGLLGFSQGAFLSAAIPGMQEEGTALTKV  134

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKF++IISGAK  G  FG PK A  AFS P+ CPSLH +GE DF K E ++L E FVD
Sbjct  135  PKIKFLVIISGAKIPGLVFGQPKAALGAFSSPVRCPSLHIIGERDFLKTESEILAESFVD  194

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            P +IHH  GH +P+L+ ++  T+L F  KI +M   E G+
Sbjct  195  PVVIHHSGGHIIPKLETKAEETVLSFFQKIRQMLSDESGS  234



>ref|XP_008444882.1| PREDICTED: dihydrofolate reductase-like [Cucumis melo]
Length=249

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 171/226 (76%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M ++Q I  K R +CLHGFRTSA ILKK V +WP SVLD+LDLHFLDAPFPA+GKS VEG
Sbjct  28   MGSDQKIFTKPRFLCLHGFRTSAAILKKQVGKWPPSVLDQLDLHFLDAPFPAEGKSDVEG  87

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPYFEWFQ   EF EY  F+ECL +IE+YM+++GPFDG LGFSQGA+L+AA+PG Q 
Sbjct  88   IFDPPYFEWFQFSPEFTEYRNFDECLSFIENYMIEHGPFDGFLGFSQGAILSAALPGFQA  147

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL+K  KIKFVII+SGAKF         +A  A+S P+ CPSLHFLGE DF    GK
Sbjct  148  KGIALTKVPKIKFVIIVSGAKFRS-----ESVAEKAYSTPIGCPSLHFLGEEDFLMPHGK  202

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             LLE +++P +I HPKGHT+PRLD++++  M  FI +I KM  + E
Sbjct  203  KLLESYIEPTIITHPKGHTIPRLDDKALEVMESFIQRISKMLNETE  248



>ref|XP_006472521.1| PREDICTED: dihydrofolate reductase-like [Citrus sinensis]
Length=223

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 171/226 (76%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K RV+CLHGFRTS EILKK + +WP+ VLD LDL F +   PAQGKS VEG
Sbjct  1    MGSEAGIVRKPRVLCLHGFRTSGEILKKQIGKWPQQVLDNLDLVFPNGAHPAQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  F++CL YIEDYM+K+GPFDG+LGFSQGA+L+A + GMQ 
Sbjct  61   IFDPPYYEWFQFNKEFTEYTNFDKCLAYIEDYMIKHGPFDGLLGFSQGAILSAGLAGMQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL+K  KIKF+II+     GG  F  P +A NA+S P+ CPSLHFLGETDF K  G 
Sbjct  121  KGVALTKVQKIKFLIIV-----GGAMFKAPSVAENAYSSPIRCPSLHFLGETDFLKPYGL  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             LLE  VDP +IHHPKGHT+PRLDE+ + TML FI++I+K  + EE
Sbjct  176  ELLEKCVDPFVIHHPKGHTIPRLDEKGLETMLSFIERIQKTLLDEE  221



>ref|XP_010530073.1| PREDICTED: UPF0483 protein AGAP003155-like [Tarenaya hassleriana]
Length=229

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            +I KK R++CLHGFRTS EI+KK + +WPESVL+RLDL FLDAPFP+QGKS VEGIFDPP
Sbjct  7    MIVKKPRLLCLHGFRTSGEIMKKQIHKWPESVLERLDLVFLDAPFPSQGKSDVEGIFDPP  66

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            Y+EWFQ +KEF EY  FE+CLEYIEDYM+K+GPFDG++GFSQGA+L+  +PG+Q  G AL
Sbjct  67   YYEWFQFNKEFTEYTNFEKCLEYIEDYMIKHGPFDGLVGFSQGAILSGGLPGLQAAGIAL  126

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
             K  KIKF+III     GG KF  P +   AFS  +  PSLHFLGETDF K  G  L+E 
Sbjct  127  QKVPKIKFLIII-----GGGKFKSPSVVEKAFSSLVEIPSLHFLGETDFLKPYGIELIES  181

Query  700  FVDPHLIHHPKGHTVPRL-DEESVGTMLGFIDKIEKMAVQEE  822
            F DP ++HHPKGHTVPRL DE+S+ ++LGF++K+E +  +EE
Sbjct  182  FKDPVVVHHPKGHTVPRLADEKSLESVLGFVEKMENILTEEE  223



>gb|KCW62057.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=207

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 160/197 (81%), Gaps = 2/197 (1%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  9    KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  68

Query  352  FQ--ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            FQ    ++  EY  +EEC+ YIED+MV+NGPFDG+LGFSQGA L A +PGMQ EG AL+K
Sbjct  69   FQFQVHQDHTEYQNYEECIAYIEDFMVQNGPFDGLLGFSQGASLCATLPGMQEEGVALTK  128

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKFVIIISGAK GG K+  PKLAANAF+ P+ CPSLHF+GE DFQK EG  L++ FV
Sbjct  129  VPKIKFVIIISGAKAGGAKYTAPKLAANAFAAPIKCPSLHFIGEQDFQKTEGLALIDSFV  188

Query  706  DPHLIHHPKGHTVPRLD  756
            DP +IHHPK HTVPRL+
Sbjct  189  DPLVIHHPKAHTVPRLE  205



>ref|XP_006433884.1| hypothetical protein CICLE_v10002399mg [Citrus clementina]
 gb|ESR47124.1| hypothetical protein CICLE_v10002399mg [Citrus clementina]
 gb|KDO37492.1| hypothetical protein CISIN_1g027454mg [Citrus sinensis]
Length=223

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 171/226 (76%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K RV+CLHGFRTS EILKK + +WP+ VLD LDL F +   PAQGKS VEG
Sbjct  1    MGSEAGIVRKPRVLCLHGFRTSGEILKKQIGKWPQQVLDNLDLVFPNGAHPAQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  F++CL YIEDYM+K+GPFDG+LGFSQGA+L+A + GMQ 
Sbjct  61   IFDPPYYEWFQFNKEFTEYTNFDKCLAYIEDYMIKHGPFDGLLGFSQGAILSAGLAGMQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL+K  KIKF+II+     GG  F  P +A NA+S P+ CP+LHFLGETDF K  G 
Sbjct  121  KGVALTKVPKIKFLIIV-----GGAMFKAPSVAENAYSSPIRCPTLHFLGETDFLKPYGL  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             LLE  VDP +IHHPKGHT+PRLDE+ + TML FI++I+K  + EE
Sbjct  176  ELLEKCVDPFVIHHPKGHTIPRLDEKGLETMLSFIERIQKTLLDEE  221



>ref|XP_010025399.1| PREDICTED: UPF0483 protein AGAP003155-like [Eucalyptus grandis]
Length=223

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R++CLHGFR SA+IL+  + +WPES+L++LDL +LDAP+P+ GKS  EG+FDPPYFE
Sbjct  8    EKPRILCLHGFRMSAKILETQMHKWPESLLEKLDLVYLDAPYPSMGKSGAEGVFDPPYFE  67

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ ++++ EY  F+EC+++IED+MVKNGPFDG+LGFSQGAVLAAA+PGMQ EG   +K 
Sbjct  68   WFQGNQDYTEYENFKECIDFIEDFMVKNGPFDGLLGFSQGAVLAAALPGMQAEGLVFTKV  127

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             +IKF+I+ISGAK GG KF  P LAANAFS P+ CPSLH +GE D  K +   LL+ FVD
Sbjct  128  PEIKFLILISGAKLGGSKFSAPPLAANAFSSPVKCPSLHVIGENDLVKPDSIALLDSFVD  187

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            P ++HH + HT+PRLD +S+  +  FI+KI+  A 
Sbjct  188  PIIVHHLEDHTIPRLDNQSLEDVNNFIEKIQNHAT  222



>ref|XP_003519835.1| PREDICTED: UPF0483 protein AGAP003155-like [Glycine max]
 gb|KHN00403.1| UPF0483 protein C25G4.2-like protein [Glycine soja]
Length=226

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             +KLR++CLHGFRTS+EILK+LVLRWPE VL +L+  FLD  F AQG+S VEGIFDPPY+
Sbjct  7    QRKLRILCLHGFRTSSEILKQLVLRWPEPVLQKLNFVFLDGQFLAQGRSDVEGIFDPPYY  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQA+++F EY  FEECL YIEDYM+KNGPFDG+LGFSQGAVLAAA+ G+Q +G AL K
Sbjct  67   EWFQANEDFTEYTNFEECLVYIEDYMLKNGPFDGLLGFSQGAVLAAALLGLQAQGVALGK  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+I+ISGAKFGG K+G+PKLAAN +S  + CPSLHF+GE DF K +   LLE F 
Sbjct  127  VNKIKFLIVISGAKFGGRKYGMPKLAANPYSKQMDCPSLHFIGEKDFAKPDSIALLEAFK  186

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
            DP +IHHPKGHTVPRLD++ + TMLGFI+ I+
Sbjct  187  DPMVIHHPKGHTVPRLDDKGLQTMLGFINTIQ  218



>ref|XP_003615240.1| Hydrolase, putative [Medicago truncatula]
 gb|AES98198.1| dihydrofolate reductase-like protein [Medicago truncatula]
 gb|AFK48584.1| unknown [Medicago truncatula]
Length=227

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 173/220 (79%), Gaps = 6/220 (3%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN +   +K R++CLHGFRTS EI+KK + +WP++VLD+LDL F+DAPFP  GKS VEG
Sbjct  1    MENEEK-GRKPRILCLHGFRTSGEIMKKQIHKWPQNVLDKLDLVFVDAPFPCNGKSDVEG  59

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  F+ECL+YIEDYM+K+GPFDG+LGFSQGA+L+  +PG+Q 
Sbjct  60   IFDPPYYEWFQFNKEFTEYTNFDECLQYIEDYMIKHGPFDGLLGFSQGAILSGGLPGLQE  119

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL+K  K+KF+III     GG KF  P +   A+S  + CPSLHFLGE DF KE GK
Sbjct  120  KGVALTKVPKVKFLIII-----GGAKFRAPSVVEKAYSSQIGCPSLHFLGEHDFLKEYGK  174

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
             L++  V+P +IHHPKGHTVPRLD++S+ TM+ FI++I+ 
Sbjct  175  ELIDSCVEPVVIHHPKGHTVPRLDDKSLNTMMSFIERIQN  214



>ref|XP_004152614.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus]
 ref|XP_004170822.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus]
 gb|KGN62729.1| hypothetical protein Csa_2G369800 [Cucumis sativus]
Length=249

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M ++Q    K R +CLHGFRTSA ILKK V +WP SVLD+LDLHFLDAPFPA+GKS VEG
Sbjct  28   MGSDQKFFTKPRFLCLHGFRTSAAILKKQVGKWPLSVLDQLDLHFLDAPFPAEGKSDVEG  87

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPYFEWFQ   EF EY  F+ECL +IE+YM+K+GPFDG LGFSQGA+L+AA+PG Q 
Sbjct  88   IFDPPYFEWFQFSPEFTEYRNFDECLSFIENYMIKHGPFDGFLGFSQGAILSAALPGFQA  147

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL+K  KIKFVII+SGAKF         +A  A+S P+ CPSLHFLGE DF    GK
Sbjct  148  KGIALTKVPKIKFVIIVSGAKFRS-----ESVAEKAYSTPIGCPSLHFLGEEDFLMPHGK  202

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             LLE +++P +I HPKGHT+PRLD++++  M  FI +I K+  + E
Sbjct  203  KLLESYIEPTIITHPKGHTIPRLDDKALEVMESFIHRISKILNENE  248



>ref|XP_010675437.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Beta 
vulgaris subsp. vulgaris]
Length=249

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 170/220 (77%), Gaps = 7/220 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EILKK V +WPESV  +LDL FLDAPFP+QGKS VEGIFDPPY+E
Sbjct  22   RKPRFLCLHGFRTSGEILKKQVNKWPESVRQKLDLVFLDAPFPSQGKSDVEGIFDPPYYE  81

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF  Y  FEE LEYIE+ M+K GP DG+LGFSQGA+L+AA+PG+Q +G AL+K 
Sbjct  82   WFQYNKEFTTYTNFEESLEYIENCMIKYGPIDGLLGFSQGAILSAALPGLQAQGLALTKV  141

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKF++I+SGAK     +        A+  P+ CPS+HFLG+ DF +  G+ LL+C VD
Sbjct  142  PKIKFLVIVSGAKLKAESW------QKAYDSPIECPSIHFLGKEDFLRPHGEDLLKCVVD  195

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            P +IHHP+GHT+PR+DE+S+ TML FIDKI+K+ + EEG 
Sbjct  196  PFVIHHPRGHTIPRIDEQSLPTMLSFIDKIQKI-ISEEGK  234



>ref|XP_010272959.1| PREDICTED: UPF0483 protein AGAP003155-like [Nelumbo nucifera]
Length=233

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 171/219 (78%), Gaps = 5/219 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+ R +CLHGFRTSA ILKK V +WPESVL  +DL F+DAPFPAQG S V+GIFDPPY+E
Sbjct  8    KRPRFLCLHGFRTSANILKKQVGKWPESVLGNIDLVFVDAPFPAQGISDVKGIFDPPYYE  67

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ ++EF EY  F+ECL+YIED M+K+GPFDG+LGFSQGA+L+AA+PG+Q +G AL++ 
Sbjct  68   WFQFNEEFTEYRNFQECLDYIEDCMIKHGPFDGLLGFSQGAILSAALPGLQAKGLALTRV  127

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKFVIII GAKF       P +A NA++  + CPS+HFLGE D+ +  G+ LL+ FV+
Sbjct  128  PKIKFVIIIGGAKFMS-----PTVADNAYASLIECPSVHFLGEEDYLRPHGERLLKSFVN  182

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEG  825
            P +IHHPKGHTVPRLDE+S+  ML FI+KI+   +   G
Sbjct  183  PVVIHHPKGHTVPRLDEKSIEIMLNFIEKIQMKTMSNNG  221



>ref|XP_009626524.1| PREDICTED: dihydrofolate reductase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=230

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN   + KK RV+CLHG   SAEILKK + L WP++VL++LDL FL+ PF  Q K    
Sbjct  1    MENK--LEKKPRVLCLHGHGASAEILKKEMELGWPQTVLEKLDLVFLNGPFLLQDKVDSH  58

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GIF PPYFEWFQ DK++KE+Y F+EC+EY+E  M K GPFDGVLGFSQGAVL A+MPGMQ
Sbjct  59   GIFHPPYFEWFQNDKDYKEFYNFDECVEYVEANMEKYGPFDGVLGFSQGAVLTASMPGMQ  118

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
            R   AL+K   IKFVIIISGAKFGG + G+PKLAANAFS P+ CPSLHF+GE + +K   
Sbjct  119  RVKVALTKVPNIKFVIIISGAKFGGRELGLPKLAANAFSSPIECPSLHFIGEKETKKPNE  178

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            + L++CFV+P +I+HP+GH VP LD ESV T++ FI+K++K+ +Q +GN
Sbjct  179  EELVKCFVNPVVIYHPEGHKVPNLDAESVETVIAFINKVKKIKMQLQGN  227



>ref|XP_010530103.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X3 [Tarenaya hassleriana]
Length=269

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 171/224 (76%), Gaps = 6/224 (3%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            +I KK R++CLHGFRTS EI+KK + +WPESVLDRLDL FLDAPFP+QGKS VE IFDPP
Sbjct  49   MIVKKPRLLCLHGFRTSGEIMKKQIQKWPESVLDRLDLVFLDAPFPSQGKSVVEAIFDPP  108

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            Y+EWFQ +KEF EY  FE+CLEYIEDY++K+GPFDG  GFSQGA+L+  +PG+Q  G AL
Sbjct  109  YYEWFQTNKEFNEYTNFEKCLEYIEDYIIKHGPFDGFAGFSQGAILSGGLPGLQAAGIAL  168

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
             K  KIKF+III     GG KF  P +A  A+S  +  PSLHFLGE DF K  G  L+E 
Sbjct  169  RKVPKIKFLIII-----GGGKFKSPSVAEKAYSSLIEIPSLHFLGEKDFLKPYGIELIES  223

Query  700  FVDPHLIHHPKGHTVPRL-DEESVGTMLGFIDKIEKMAVQEEGN  828
            F DP ++HHPKGH VPRL DE+S+ ++LGF++K+E +  +E+ N
Sbjct  224  FKDPVVVHHPKGHAVPRLADEKSLESVLGFVEKMENILTEEDRN  267



>ref|XP_010463129.1| PREDICTED: UPF0483 protein C25G4.2-like [Camelina sativa]
Length=260

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            K  R++CLHGFRTS  IL+ ++  +WP+++L  LDL FLDAPFPA GKS VE +FDPPY+
Sbjct  35   KNPRILCLHGFRTSGRILRAIITDKWPDTILRNLDLDFLDAPFPATGKSDVERLFDPPYY  94

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EW+QA K FKEY  FEECL YIEDYM+KNGPFDG+LGFSQGA L AA+PGMQ +G AL+K
Sbjct  95   EWYQAKKGFKEYRNFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAALPGMQEQGTALTK  154

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              K+KF++IISGAK  G  FGVPK A NAFS P+ CPSLHF+GE DF K  G+ L++ FV
Sbjct  155  VPKVKFLVIISGAKIPGLIFGVPKAAVNAFSSPVRCPSLHFIGERDFLKTAGEALIQSFV  214

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEG  825
            +P +I H   HT+P+LD ++  T+L F  +I ++   + G
Sbjct  215  EPVVIRHQSAHTIPKLDTKAKETVLSFFQRIRQILSDDSG  254



>gb|KDP41448.1| hypothetical protein JCGZ_15855 [Jatropha curcas]
Length=230

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 162/212 (76%), Gaps = 5/212 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EILKK V +WPESVL ++DL F DAP+PAQGKS VEGIFDPPY+E
Sbjct  9    RKPRFLCLHGFRTSGEILKKQVSKWPESVLQKIDLVFPDAPYPAQGKSDVEGIFDPPYYE  68

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY  F+ECL YIED+M+ +GPFDG+LGFSQGA+L+A + G+Q +G AL   
Sbjct  69   WFQFNKEFTEYTNFDECLAYIEDFMINHGPFDGLLGFSQGAILSAGLAGLQAKGVALKNV  128

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKF+III GAKF       P +A  A++ P+ C S+HFLGETDF K  G  LLE FV+
Sbjct  129  PKIKFLIIIGGAKFKS-----PSVAEKAYASPIQCASIHFLGETDFLKPHGLELLESFVE  183

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            P +IHHPKGHT+PRLDE S  TML FI KIE 
Sbjct  184  PVVIHHPKGHTIPRLDETSQETMLSFIKKIEN  215



>ref|XP_010530093.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X2 [Tarenaya hassleriana]
Length=322

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 171/224 (76%), Gaps = 6/224 (3%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            +I KK R++CLHGFRTS EI+KK + +WPESVLDRLDL FLDAPFP+QGKS VE IFDPP
Sbjct  102  MIVKKPRLLCLHGFRTSGEIMKKQIQKWPESVLDRLDLVFLDAPFPSQGKSVVEAIFDPP  161

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            Y+EWFQ +KEF EY  FE+CLEYIEDY++K+GPFDG  GFSQGA+L+  +PG+Q  G AL
Sbjct  162  YYEWFQTNKEFNEYTNFEKCLEYIEDYIIKHGPFDGFAGFSQGAILSGGLPGLQAAGIAL  221

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
             K  KIKF+III     GG KF  P +A  A+S  +  PSLHFLGE DF K  G  L+E 
Sbjct  222  RKVPKIKFLIII-----GGGKFKSPSVAEKAYSSLIEIPSLHFLGEKDFLKPYGIELIES  276

Query  700  FVDPHLIHHPKGHTVPRL-DEESVGTMLGFIDKIEKMAVQEEGN  828
            F DP ++HHPKGH VPRL DE+S+ ++LGF++K+E +  +E+ N
Sbjct  277  FKDPVVVHHPKGHAVPRLADEKSLESVLGFVEKMENILTEEDRN  320



>ref|XP_010530084.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X1 [Tarenaya hassleriana]
Length=325

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 171/224 (76%), Gaps = 6/224 (3%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            +I KK R++CLHGFRTS EI+KK + +WPESVLDRLDL FLDAPFP+QGKS VE IFDPP
Sbjct  105  MIVKKPRLLCLHGFRTSGEIMKKQIQKWPESVLDRLDLVFLDAPFPSQGKSVVEAIFDPP  164

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            Y+EWFQ +KEF EY  FE+CLEYIEDY++K+GPFDG  GFSQGA+L+  +PG+Q  G AL
Sbjct  165  YYEWFQTNKEFNEYTNFEKCLEYIEDYIIKHGPFDGFAGFSQGAILSGGLPGLQAAGIAL  224

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
             K  KIKF+III     GG KF  P +A  A+S  +  PSLHFLGE DF K  G  L+E 
Sbjct  225  RKVPKIKFLIII-----GGGKFKSPSVAEKAYSSLIEIPSLHFLGEKDFLKPYGIELIES  279

Query  700  FVDPHLIHHPKGHTVPRL-DEESVGTMLGFIDKIEKMAVQEEGN  828
            F DP ++HHPKGH VPRL DE+S+ ++LGF++K+E +  +E+ N
Sbjct  280  FKDPVVVHHPKGHAVPRLADEKSLESVLGFVEKMENILTEEDRN  323



>ref|XP_007141237.1| hypothetical protein PHAVU_008G178800g [Phaseolus vulgaris]
 gb|ESW13231.1| hypothetical protein PHAVU_008G178800g [Phaseolus vulgaris]
Length=217

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 169/213 (79%), Gaps = 5/213 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             +K R++CLHGFRTS EILK  + +WP+SVLD LDL F+DAPFP QGKS VEGIFDPPY+
Sbjct  6    RRKPRLLCLHGFRTSGEILKTQIHKWPQSVLDHLDLVFVDAPFPCQGKSDVEGIFDPPYY  65

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ +KEF EY  F+ECL+YIED M+K+GP DG+LGFSQGA+L+AA+PG+Q +G AL+K
Sbjct  66   EWFQFNKEFTEYTNFDECLKYIEDCMIKHGPIDGLLGFSQGAILSAALPGLQAKGVALTK  125

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              K+KF++I+ GAKF       P +   A+S P+ CPS+HFLGETDF K+ G  L E  V
Sbjct  126  VPKVKFIVIVGGAKFRS-----PLVVDKAYSSPISCPSIHFLGETDFLKKYGMELTESCV  180

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            +P +IHHPKGHT+PRLD++S+ TM+ FI++I+K
Sbjct  181  EPVVIHHPKGHTIPRLDDKSLKTMMDFIERIKK  213



>ref|XP_004299697.1| PREDICTED: UPF0483 protein AAEL000016-like [Fragaria vesca subsp. 
vesca]
Length=226

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            +K R +CLHGFRTS  ILK +L  +WPESVL   DL FLDAPFPA GKS VEGIFDPPY+
Sbjct  10   RKPRFLCLHGFRTSGLILKTQLGNKWPESVLRHFDLDFLDAPFPAIGKSEVEGIFDPPYY  69

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ +KEF EY  F+ECLE+IEDYMVKNGPFDG+LGFSQGA+L+AA+PG+Q +G AL+K
Sbjct  70   EWFQFNKEFSEYTNFDECLEFIEDYMVKNGPFDGLLGFSQGAILSAALPGLQAKGLALTK  129

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+III GAKF       P +  NA+S P+  PSLHFLGE DF K+ G  LLE  V
Sbjct  130  VPKIKFLIIIGGAKFRS-----PTVVENAYSTPIQIPSLHFLGEMDFLKQYGLELLENCV  184

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            DP +IHHPKGHT+PRLDE+ + T++ FI+ I+K   ++E
Sbjct  185  DPSVIHHPKGHTIPRLDEKGLETIMSFIETIQKKLDEKE  223



>ref|XP_002514003.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48586.1| conserved hypothetical protein [Ricinus communis]
Length=224

 Score =   263 bits (671),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 160/210 (76%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK R +CLHGFRTS EILKK + +WPES+L  LDL FLDAP+PA GKS VEGIFDPPY+E
Sbjct  9    KKPRFLCLHGFRTSGEILKKQIHKWPESLLQNLDLVFLDAPYPANGKSEVEGIFDPPYYE  68

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ + EF EY  F+ECL YIED+M+KNGPFDG+LGFSQGA+L+A +PG+Q  G AL+K 
Sbjct  69   WFQFNAEFTEYTNFDECLAYIEDFMIKNGPFDGLLGFSQGAILSAGLPGLQANGVALTKV  128

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIK++III     GG KF  P +A  A+  P+ CPSLHFLGE D+ +  G  LLE  VD
Sbjct  129  PKIKYLIII-----GGAKFRAPSVAEKAYLSPIQCPSLHFLGEMDYLRPYGLELLESCVD  183

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +IHHPKGHT+PRLDE+S   M  FI++I
Sbjct  184  PVVIHHPKGHTIPRLDEKSRAIMHSFIERI  213



>ref|XP_007047825.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOX91982.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=234

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M  +Q+  +K R++CLHGFRTS EILKK++ +WP +VL+  D  F DAPFPA+GKS VEG
Sbjct  1    MLGSQMRRRKPRILCLHGFRTSGEILKKMIGKWPAAVLENFDFDFPDAPFPAKGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            ++ PPY+EW+Q ++     ++   C+ YIEDYMVK+GPFDG+LGFSQG +LAA +P MQR
Sbjct  61   LYGPPYYEWYQVNEVECSNFEE--CIAYIEDYMVKHGPFDGLLGFSQGGMLAAVLPWMQR  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            EG A +K  KIKF+IIISG K    K G PKL  NAFS P+ CPSLH +GE DF KE G 
Sbjct  119  EGVAFTKVPKIKFLIIISGFKLRELKHGPPKLLVNAFSAPVACPSLHLIGEKDFLKEVGF  178

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
             LL+ FV P +IHH  GHTVP+LDE    TML FI+KI++M  Q+
Sbjct  179  TLLKSFVKPSVIHHSMGHTVPKLDENGQETMLKFIEKIQEMFSQD  223



>ref|XP_009130510.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Brassica 
rapa]
Length=277

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 169/224 (75%), Gaps = 1/224 (0%)
 Frame = +1

Query  151  NNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            +++   +  R++CLHGFRTS  IL+ L+  +WP++VL  LDL FLD PFPA GKS +E  
Sbjct  46   SSETKQRNPRILCLHGFRTSGLILRSLITSKWPDTVLRNLDLDFLDGPFPATGKSDIERF  105

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            +DPPY+EW+QA K F+EY  FEECL+Y+EDYM+K+GPFDG+LGFSQGA L+AA+PGMQ +
Sbjct  106  YDPPYYEWYQASKGFREYRNFEECLDYVEDYMIKHGPFDGLLGFSQGAFLSAALPGMQEQ  165

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+K  K+KF+++ISG K  G +FG P+ A  AFS P+ CPSLHF+GE DF K EG++
Sbjct  166  GKALTKVPKVKFLVLISGGKIPGLRFGQPEAAVGAFSSPVRCPSLHFIGERDFLKTEGEV  225

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
            L+E FV+P +I H  GHT+P+L+ E+  T+L F  +I KM   E
Sbjct  226  LVESFVEPVVIRHTSGHTIPKLEAEAEETVLSFFQRIRKMLSDE  269



>ref|XP_010484371.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Camelina 
sativa]
Length=260

 Score =   261 bits (667),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            K  R++CLHGFRTS  IL+ ++  +WPE+++  LDL FLDAPFPA G S VE +FDPPY+
Sbjct  35   KNPRILCLHGFRTSGRILRAIITDKWPETIIRNLDLDFLDAPFPATGNSDVERLFDPPYY  94

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EW+Q +K FKEY  FEECL YIEDYM+KNGPFDG+LGFSQGA L AA+PGMQ +G AL+K
Sbjct  95   EWYQVNKGFKEYRNFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAALPGMQEQGTALTK  154

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              K+KF++IISGAK  G  FG P+ A NAFS P+ CPSLHF+GE DF K  G+ L+E FV
Sbjct  155  VPKVKFLVIISGAKIPGLIFGEPQAAVNAFSSPVRCPSLHFIGERDFLKTAGEALIESFV  214

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEG  825
            +P +I H   HT+P+LD ++  T+L F  +I ++   E G
Sbjct  215  EPVVIRHSSAHTIPKLDTKAEETVLSFFARIRQILSDEPG  254



>gb|KCW62054.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=213

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  9    KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  68

Query  352  FQ--ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            FQ    ++  EY  +EEC+ YIED+MV+NGPFDG+LGFSQ             EG AL+K
Sbjct  69   FQFQVHQDHTEYQNYEECIAYIEDFMVQNGPFDGLLGFSQ------------EEGVALTK  116

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKFVIIISGAK GG K+  PKLAANAF+ P+ CPSLHF+GE DFQK EG  L++ FV
Sbjct  117  VPKIKFVIIISGAKAGGAKYTAPKLAANAFAAPIKCPSLHFIGEQDFQKTEGLALIDSFV  176

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            DP +IHHPK HTVPRLD++SV     F++KI  +A 
Sbjct  177  DPLVIHHPKAHTVPRLDDQSVKIAQNFVEKILNLAT  212



>ref|NP_567701.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC43051.1| unknown protein [Arabidopsis thaliana]
 gb|ABD43025.1| At4g24380 [Arabidopsis thaliana]
 gb|AEE84895.1| uncharacterized protein AT4G24380 [Arabidopsis thaliana]
Length=234

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 166/222 (75%), Gaps = 5/222 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS VEGIFDPPY
Sbjct  8    IARKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAPFPCQGKSDVEGIFDPPY  67

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  FE+CLEY+ED M+K GPFDG++GFSQGA+L+  +PG+Q +G A  
Sbjct  68   YEWFQFNKEFTEYTNFEKCLEYLEDRMIKLGPFDGLIGFSQGAILSGGLPGLQAKGIAFQ  127

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKFVIII GAK         KLA NA+S  L   SLHFLGETDF K  G  L+E +
Sbjct  128  KVPKIKFVIIIGGAKLKS-----AKLAENAYSSSLETLSLHFLGETDFLKPYGTQLIESY  182

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
             +P ++HHPKGHTVPRLDE+S+  +  FID +E + ++E+ N
Sbjct  183  KNPVVVHHPKGHTVPRLDEKSLEKVTAFIDTLEHLVMEEDKN  224



>gb|KHG12242.1| Ovarian cancer-associated protein 2 [Gossypium arboreum]
Length=234

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M  NQ+   K RV+CLHGFRTS EILKK++ +WP SVL+  D  FLDAPFPA+GKS VE 
Sbjct  1    MGGNQVRRNKPRVLCLHGFRTSGEILKKMMGKWPHSVLNNFDFDFLDAPFPARGKSDVES  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            ++DPPY+EW+Q ++    ++    C+  IEDYM+K+GPFDG+LGFSQG +LA+ +P MQR
Sbjct  61   LYDPPYYEWYQVNEIECVHFDE--CIACIEDYMIKHGPFDGLLGFSQGGMLASVVPPMQR  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            EGAA +   KIKFVIIISG +    K G PKL AN +S P+ CPSLH +G+ DF KE G 
Sbjct  119  EGAAFTSVPKIKFVIIISGFELRELKSGPPKLLANVYSVPIDCPSLHLIGDKDFLKERGF  178

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
             LL  FV+P  I+H  GHTVP+LDE+ + TML FI+KI++M  QE
Sbjct  179  TLLRSFVNPLHIYHSMGHTVPKLDEKGLETMLKFIEKIKEMFPQE  223



>ref|XP_011096050.1| PREDICTED: UPF0483 protein AGAP003155 [Sesamum indicum]
Length=230

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            +KLR++CLHGFRTSA+I+KK L  +W +SVL +LDL F+DAPFP+QGKS VEGIFDPPY+
Sbjct  8    RKLRLLCLHGFRTSADIIKKQLTGKWHQSVLHKLDLVFVDAPFPSQGKSDVEGIFDPPYY  67

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ +KEF EY  F+ECL+YI+D M+K+GPFDG+LGFSQGA+LAA + G+Q +G AL+K
Sbjct  68   EWFQFNKEFTEYLNFDECLDYIQDCMIKHGPFDGLLGFSQGAILAAGLAGLQAKGLALTK  127

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIK V+II GAKF       P +A NA+S P+ CPS+HFLG+ DF K  G  LLE F+
Sbjct  128  VPKIKVVVIIGGAKFRN-----PSVAENAYSSPIQCPSVHFLGDEDFLKPYGTELLESFI  182

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            DP +I HPKGHT+PR DE+ + +ML F+++I+K   +E+
Sbjct  183  DPLVIRHPKGHTIPRFDEKGLDSMLSFLERIQKDVKEEK  221



>ref|XP_006841248.1| hypothetical protein AMTR_s00135p00087760 [Amborella trichopoda]
 gb|ERN02923.1| hypothetical protein AMTR_s00135p00087760 [Amborella trichopoda]
Length=230

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 166/217 (76%), Gaps = 5/217 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+LR++CLHGFRTSA+IL++ V +W +SV D+LDL F+DAPFPA+G S VEGIF PPY+E
Sbjct  11   KRLRILCLHGFRTSAQILRQQVGKWGDSVTDKLDLVFVDAPFPAEGASDVEGIFPPPYYE  70

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DKEF EY  FEECL  IED M+K GPFDG+LGFSQGA+L+AA+PG+Q +G AL++ 
Sbjct  71   WFQFDKEFLEYRNFEECLACIEDSMIKLGPFDGLLGFSQGAILSAALPGLQAKGLALTEV  130

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKFVIII     GG KF  P +A  A+S P+ CPSLHFLGE DF +  G++LL+ FVD
Sbjct  131  PKIKFVIII-----GGAKFRCPNVAEKAYSSPITCPSLHFLGEHDFLRPHGEVLLKSFVD  185

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
            P +I HPKGHTVPRLDE+   TM  F+ ++E     E
Sbjct  186  PVVIKHPKGHTVPRLDEKGAETMFSFLTRVENFIASE  222



>emb|CDY33961.1| BnaC02g43760D [Brassica napus]
Length=259

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 166/222 (75%), Gaps = 1/222 (0%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             +  R++CLHGFRTS  IL+ L+  +WP++VL  LDL FLD PFPA GKS +E  +DPPY
Sbjct  33   QRNPRILCLHGFRTSGLILRSLITSKWPDTVLRNLDLDFLDGPFPATGKSDIERFYDPPY  92

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EW+QA K F+EY  FEECL+Y+EDYM+K+GPFDG+LGFSQGA L+AA+P MQ +G AL+
Sbjct  93   YEWYQASKGFREYRNFEECLDYVEDYMIKHGPFDGLLGFSQGAFLSAALPRMQEQGKALT  152

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  K+KF+++ISG K  G +FG PK A  AFS P+ CPSLHF+GE DF K EG++L+E F
Sbjct  153  KVPKVKFLVLISGGKIPGLRFGQPKAAVGAFSSPVRCPSLHFIGERDFLKTEGEVLVESF  212

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            V+P +I H  GHT+P+L+ E+  T+L F  +I KM   E  +
Sbjct  213  VEPVVIRHTSGHTIPKLETEAEETVLSFFQRIRKMLSDEASS  254



>gb|AAM63786.1| unknown [Arabidopsis thaliana]
Length=234

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS VEGIFDPPY
Sbjct  8    IARKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAPFPCQGKSDVEGIFDPPY  67

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  FE+CLEY+ED M+K GPFDG++GFSQGA+L+  +PG+Q +G    
Sbjct  68   YEWFQFNKEFTEYTNFEKCLEYLEDRMIKLGPFDGLIGFSQGAILSGGLPGLQAKGIEFQ  127

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKFVIII GAK         KLA NA+S  L   SLHFLGETDF K  G  L+E +
Sbjct  128  KVPKIKFVIIIGGAKLKS-----AKLAENAYSSSLETLSLHFLGETDFLKPYGTQLIESY  182

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
             +P ++HHPKGHTVPRLDE+S+  +  FID +E + ++E+ N
Sbjct  183  KNPVVVHHPKGHTVPRLDEKSLEKVTAFIDTLEHLVMEEDKN  224



>emb|CAH67099.1| H0818E04.16 [Oryza sativa Indica Group]
Length=245

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 165/217 (76%), Gaps = 6/217 (3%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K R +CLHGFRTS EI++K V+ +WP  V  RLDL F DAPFPA+GKS VEGIFDPPY+E
Sbjct  21   KPRFLCLHGFRTSGEIMRKQVVGKWPADVTARLDLVFADAPFPAEGKSDVEGIFDPPYYE  80

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DK F EY  F+ECL YIE+ M+K GPFDG++GFSQG++L+ A+PG+Q +G AL++ 
Sbjct  81   WFQFDKNFTEYRNFDECLNYIEELMIKEGPFDGLMGFSQGSILSGALPGLQEQGLALTRV  140

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIK++III GAKF       P +A  A+++ + CPS+HFLG+TDF K  G+ L+E +VD
Sbjct  141  PKIKYLIIIGGAKFQS-----PTVAEKAYANNIKCPSVHFLGDTDFLKTHGEKLIESYVD  195

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
            P +I HPKGHTVPRLDE+S+  ML F+DKIEK    E
Sbjct  196  PFIIRHPKGHTVPRLDEKSLEIMLRFLDKIEKETALE  232



>emb|CDY37826.1| BnaAnng04870D [Brassica napus]
Length=260

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 167/224 (75%), Gaps = 1/224 (0%)
 Frame = +1

Query  151  NNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            +++   +  R++CLHGFRTS  IL+ L+  +WP++VL  LDL FLD PFPA GKS +E  
Sbjct  29   SSETKQRNPRILCLHGFRTSGLILRSLITSKWPDTVLRNLDLDFLDGPFPATGKSDIERF  88

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            +DPPY+EW+QA K F+EY  FEECL+Y+EDYM+K+GPFDG+LGFSQGA L+A +PGMQ +
Sbjct  89   YDPPYYEWYQASKGFREYRNFEECLDYVEDYMIKHGPFDGLLGFSQGAFLSATLPGMQEQ  148

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+K  K+KF+++ISG K  G +FG P+ A  AFS P+ CPSLHF+GE DF K EG++
Sbjct  149  GKALTKVPKVKFLVLISGGKIPGLRFGQPEAAVGAFSSPVRCPSLHFIGERDFLKTEGEV  208

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
            L+E FV+P +I H  GHT+P+L+ E+  T+  F  +I KM   E
Sbjct  209  LVESFVEPVVIRHTSGHTIPKLEAEAEETVFSFFQRIRKMLSDE  252



>ref|XP_010098668.1| hypothetical protein L484_026043 [Morus notabilis]
 gb|EXB75571.1| hypothetical protein L484_026043 [Morus notabilis]
Length=238

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 172/235 (73%), Gaps = 20/235 (9%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            + +K R +CLHGFRTS EI+KK V +WPESVL+++DL FLD PFPAQGKS V+GIFDPPY
Sbjct  8    VVRKPRFLCLHGFRTSGEIMKKQVEKWPESVLEKMDLVFLDGPFPAQGKSDVDGIFDPPY  67

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFS---------------QGAVL  477
            +EWF+ +KEF EYY FEECL+YIED+M+KNGPFDG++GFS               QGA+L
Sbjct  68   YEWFRFNKEFTEYYNFEECLQYIEDFMIKNGPFDGLVGFSQLRATNMTKTLNETIQGAIL  127

Query  478  AAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGE  657
            A  +PG+Q +G AL+K  KI+ +III GAKF       P +   A++ P+ CPSLHF GE
Sbjct  128  AGGLPGLQDKGVALTKVPKIQNLIIIGGAKFRS-----PVVVEKAYASPIQCPSLHFFGE  182

Query  658  TDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            TDF K  G   LEC +DP +IHHPKGHTVPRLDE+S+ T+  FI+KI+K   ++E
Sbjct  183  TDFLKPYGLEFLECCLDPVVIHHPKGHTVPRLDEKSLPTVQSFIEKIQKTLSEKE  237



>gb|EPS65400.1| hypothetical protein M569_09376, partial [Genlisea aurea]
Length=218

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 160/209 (77%), Gaps = 6/209 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             KKL+++CLHGFRTSA I+K ++  +WPES+L +LDL + D PFPA+GKS VEGIFDPPY
Sbjct  15   EKKLKLLCLHGFRTSALIMKTQITTKWPESILQKLDLVYADGPFPARGKSDVEGIFDPPY  74

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY   + CLEYIE++M+KNGPFDG+LGFSQGA+L+AA+PG+Q  G AL+
Sbjct  75   YEWFQFNKEFSEYQNMDACLEYIEEFMIKNGPFDGLLGFSQGAILSAALPGLQSRGLALT  134

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIK V+II GAKF  P    P     A+S P+HCPS+HFLG+ DF KE G  L+  +
Sbjct  135  KVGKIKVVVIIGGAKFRDPSLSQP-----AYSSPIHCPSVHFLGDQDFLKEYGIELVGSY  189

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFI  789
            V+P +I HPKGHT+PR DEE +  ML F+
Sbjct  190  VNPLIIKHPKGHTIPRFDEEGLNKMLSFL  218



>ref|XP_011097505.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X1 [Sesamum 
indicum]
Length=223

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 2/221 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   I +K R++CLH FRTS  I + ++ RWPE+V   LDL F DAPFPA+GKS VEG
Sbjct  1    MENE--IRRKPRILCLHSFRTSGRIFQMMISRWPENVTGELDLVFADAPFPAEGKSDVEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF++DKEFKE+Y FE+CL Y+ED+M+ +GPFDGVLGFSQGA LAAA+PGMQ+
Sbjct  59   IYDPPYFEWFKSDKEFKEFYDFEKCLNYLEDFMLTHGPFDGVLGFSQGATLAAALPGMQK  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            EG ALSK   IKF+IIISG KFGG KFG+PKLAA AFS P++CPSLH +GE DF ++E K
Sbjct  119  EGVALSKVPTIKFLIIISGGKFGGAKFGLPKLAARAFSSPVNCPSLHIIGELDFLRDESK  178

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             L+  FVDP +I H KGH VPRL  E    ML FI K   M
Sbjct  179  ALMRSFVDPVVIKHAKGHCVPRLTGEDADKMLQFITKYHCM  219



>gb|KHN35465.1| UPF0483 protein AGAP003155-like protein [Glycine soja]
Length=217

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 165/212 (78%), Gaps = 5/212 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EILK  + +WP+SVLD LDL F+DAPFP  GKS VEGIFDPPY+E
Sbjct  7    RKPRFLCLHGFRTSGEILKTQLHKWPQSVLDNLDLVFVDAPFPCLGKSDVEGIFDPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY  F+ECL+YIE+ M+K GP DG+LGFSQGA+L+AA+PG+Q +G AL+K 
Sbjct  67   WFQFNKEFTEYTNFDECLQYIEECMIKYGPIDGLLGFSQGAILSAALPGLQEKGVALTKV  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             K+KF+II+ GAKF       P +   A+S  + CPSLHF+GETDF  + G  LLE  V+
Sbjct  127  PKVKFLIIVGGAKFRS-----PSVMDKAYSSSISCPSLHFIGETDFLNKYGAELLESCVE  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            P +IHHPKGHT+PRLD++S+ TM+ FI++I+K
Sbjct  182  PVVIHHPKGHTIPRLDDKSLKTMMDFIERIKK  213



>ref|XP_006652342.1| PREDICTED: dihydrofolate reductase-like [Oryza brachyantha]
Length=241

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 167/218 (77%), Gaps = 6/218 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            ++ R +CLHGFRTS EI++K V+ +WP  V  RLDL F DAPFPA+GKS VEGIFDPPY+
Sbjct  16   RRPRFLCLHGFRTSGEIMRKQVVGKWPADVTARLDLVFADAPFPAEGKSDVEGIFDPPYY  75

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY  F+ECL YIE+ M+K+GPFDG++GFSQG++L+ A+PG+Q +G AL++
Sbjct  76   EWFQFDKDFTEYRNFDECLNYIEELMIKDGPFDGLMGFSQGSILSGALPGLQEQGLALTR  135

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIK++III GAKF       P +A  A+++ + CPS+HFLG+TDF K  G+ L+E F 
Sbjct  136  VPKIKYLIIIGGAKFQS-----PTVAEKAYANKIKCPSVHFLGDTDFLKTHGEKLIESFE  190

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
            DP ++ HPKGHTVPRLDE+S+  ML F+DKIEK    E
Sbjct  191  DPFIVRHPKGHTVPRLDEKSLEVMLRFLDKIEKETALE  228



>dbj|BAB11562.1| unnamed protein product [Arabidopsis thaliana]
Length=234

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 173/232 (75%), Gaps = 7/232 (3%)
 Frame = +1

Query  133  LHLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKS  312
            +HLK +N        R++CLHGFRTS  IL+  + +WP+++L  LDL FLDAPFPA GKS
Sbjct  5    IHLKPKNP-------RILCLHGFRTSGRILQAGIGKWPDTILRDLDLDFLDAPFPATGKS  57

Query  313  TVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMP  492
             VE  FDPPY+EW+QA+K FKEY  FEECL YIEDYM+KNGPFDG+LGFSQGA L AA+P
Sbjct  58   DVERFFDPPYYEWYQANKGFKEYRNFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAAIP  117

Query  493  GMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQK  672
            GMQ +G+AL+K  K+KF++IISGAK  G  FG PK A NAFS P+ CPSLHF+GE DF K
Sbjct  118  GMQEQGSALTKVPKVKFLVIISGAKIPGLMFGEPKAAVNAFSSPVRCPSLHFIGERDFLK  177

Query  673  EEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
             EG++L+E FV+P +IHH  GH +P+LD ++  TML F   I +M   E G+
Sbjct  178  IEGEVLVESFVEPVVIHHSGGHIIPKLDTKAEETMLSFFQSIRQMLSDESGS  229



>gb|EAY94329.1| hypothetical protein OsI_16097 [Oryza sativa Indica Group]
Length=245

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 163/213 (77%), Gaps = 6/213 (3%)
 Frame = +1

Query  184  VCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQA  360
            +CLHGFRTS EI++K VL +WP  V  RLDL F DAPFPA+GKS VEGIFDPPY+EWFQ 
Sbjct  25   LCLHGFRTSGEIMRKQVLGKWPADVTARLDLVFADAPFPAEGKSDVEGIFDPPYYEWFQF  84

Query  361  DkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIK  540
            DK F EY  F+ECL YIE+ M+K GPFDG++GFSQG++L+ A+PG+Q +G AL++  KIK
Sbjct  85   DKNFTEYRNFDECLNYIEELMIKEGPFDGLMGFSQGSILSGALPGLQEQGLALTRVPKIK  144

Query  541  FVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLI  720
            ++III GAKF       P +A  A+++ + CPS+HFLG+TDF K  G+ L+E +VDP +I
Sbjct  145  YLIIIGGAKFQS-----PTVAEKAYANNIKCPSVHFLGDTDFLKTHGEKLIESYVDPFII  199

Query  721  HHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
             HPKGHTVPRLDE+S+  ML F+DKIEK    E
Sbjct  200  RHPKGHTVPRLDEKSLEIMLRFLDKIEKETALE  232



>ref|NP_201343.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|ABH04525.1| At5g65400 [Arabidopsis thaliana]
 gb|AED98047.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=252

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 173/232 (75%), Gaps = 7/232 (3%)
 Frame = +1

Query  133  LHLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKS  312
            +HLK +N        R++CLHGFRTS  IL+  + +WP+++L  LDL FLDAPFPA GKS
Sbjct  23   IHLKPKNP-------RILCLHGFRTSGRILQAGIGKWPDTILRDLDLDFLDAPFPATGKS  75

Query  313  TVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMP  492
             VE  FDPPY+EW+QA+K FKEY  FEECL YIEDYM+KNGPFDG+LGFSQGA L AA+P
Sbjct  76   DVERFFDPPYYEWYQANKGFKEYRNFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAAIP  135

Query  493  GMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQK  672
            GMQ +G+AL+K  K+KF++IISGAK  G  FG PK A NAFS P+ CPSLHF+GE DF K
Sbjct  136  GMQEQGSALTKVPKVKFLVIISGAKIPGLMFGEPKAAVNAFSSPVRCPSLHFIGERDFLK  195

Query  673  EEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
             EG++L+E FV+P +IHH  GH +P+LD ++  TML F   I +M   E G+
Sbjct  196  IEGEVLVESFVEPVVIHHSGGHIIPKLDTKAEETMLSFFQSIRQMLSDESGS  247



>ref|XP_009626527.1| PREDICTED: UPF0483 protein CG5412-like isoform X1 [Nicotiana 
tomentosiformis]
Length=228

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 165/229 (72%), Gaps = 5/229 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN     KK RV+CLHG   S EILKK + L WP+ VL++LDL FL+ PF  QGK    
Sbjct  1    MENKS--EKKPRVLCLHGHGASGEILKKEMELGWPQIVLEKLDLVFLNGPFLLQGKVDSH  58

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
             IF PPY+EWFQ D +   +++   C++Y+E  M K GPFDGVLGFSQGA++ A MPGMQ
Sbjct  59   DIFHPPYYEWFQKDSKEIYHFEE--CVQYVEANMEKYGPFDGVLGFSQGAIVTATMPGMQ  116

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
            RE   L+K   IKFVIIISG KFG P+FG PKLAANA+S P+ CPSLHF+GE + +K   
Sbjct  117  RERVVLTKIPNIKFVIIISGFKFGAPEFGCPKLAANAYSSPIECPSLHFIGEKETKKTSE  176

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            + L++CFV+P +IHHP+GH VP LD ESV T++ FI+K++K+ +  +GN
Sbjct  177  EELVKCFVNPVVIHHPEGHKVPNLDAESVKTVIAFINKVKKIKMALQGN  225



>ref|XP_007018157.1| Folic acid and derivative biosynthetic process [Theobroma cacao]
 gb|EOY15382.1| Folic acid and derivative biosynthetic process [Theobroma cacao]
Length=305

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 168/223 (75%), Gaps = 6/223 (3%)
 Frame = +1

Query  142  KMENNQIIHKKLRVVCLHGFRTSAEILKKLV-LRWPESVLDRLDLHFLDAPFPAQGKSTV  318
            +M +   I +K R +CLHGFRTS  ILKK +  +WP+SVL+++DL + DAPFPAQGKS V
Sbjct  68   EMGSEAEIARKPRFLCLHGFRTSGAILKKQIETKWPQSVLEKIDLVYPDAPFPAQGKSDV  127

Query  319  EGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGM  498
            EGIFDPPY+EWFQ +KEF  Y  FEECL YIED M++ GPFDG+LGFSQGA+L+  +PG+
Sbjct  128  EGIFDPPYYEWFQFNKEFTSYTNFEECLAYIEDIMIRQGPFDGLLGFSQGAILSCGLPGL  187

Query  499  QREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEE  678
            Q +G AL+K  KIK++III GAKF         +A  A+S P+ CPSLHFLGETDF K  
Sbjct  188  QAKGVALTKVPKIKYLIIIGGAKFKS-----ESVAEKAYSSPIQCPSLHFLGETDFLKPY  242

Query  679  GKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            G  LLE  VDP +IHHPKGHT+PR DE+ + +++ F+++I++M
Sbjct  243  GLELLESCVDPVVIHHPKGHTIPRFDEKGLESVMSFLERIQRM  285



>ref|NP_001052936.1| Os04g0450100 [Oryza sativa Japonica Group]
 emb|CAD40830.1| OSJNBa0086B14.2 [Oryza sativa Japonica Group]
 dbj|BAF14850.1| Os04g0450100 [Oryza sativa Japonica Group]
 gb|EAZ30909.1| hypothetical protein OsJ_14990 [Oryza sativa Japonica Group]
Length=245

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 163/213 (77%), Gaps = 6/213 (3%)
 Frame = +1

Query  184  VCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQA  360
            +CLHGFRTS EI++K V+ +WP  V  RLDL F DAPFPA+GKS VEGIFDPPY+EWFQ 
Sbjct  25   LCLHGFRTSGEIMRKQVVGKWPADVTARLDLVFADAPFPAEGKSDVEGIFDPPYYEWFQF  84

Query  361  DkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIK  540
            DK F EY  F+ECL YIE+ M+K GPFDG++GFSQG++L+ A+PG+Q +G AL++  KIK
Sbjct  85   DKNFTEYRNFDECLNYIEELMIKEGPFDGLMGFSQGSILSGALPGLQEQGLALTRVPKIK  144

Query  541  FVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLI  720
            ++III GAKF       P +A  A+++ + CPS+HFLG+TDF K  G+ L+E +VDP +I
Sbjct  145  YLIIIGGAKFQS-----PTVAEKAYANNIKCPSVHFLGDTDFLKTHGEKLIESYVDPFII  199

Query  721  HHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQE  819
             HPKGHTVPRLDE+S+  ML F+DKIEK    E
Sbjct  200  RHPKGHTVPRLDEKSLEIMLRFLDKIEKETALE  232



>gb|EYU22769.1| hypothetical protein MIMGU_mgv1a011590mg [Erythranthe guttata]
Length=277

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 165/214 (77%), Gaps = 6/214 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             +KLR++CLHGFRTS EI++K V  +WPESVL++LDL F+DAPFP QGKS VEGIFDPPY
Sbjct  50   ERKLRLLCLHGFRTSGEIIRKQVTGKWPESVLNKLDLVFVDAPFPCQGKSDVEGIFDPPY  109

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF +Y  F+ECL YIED M++ GPFDG+LGFSQGA+L+AA+PG+Q +G AL+
Sbjct  110  YEWFQFNKEFTKYENFDECLAYIEDCMIEKGPFDGLLGFSQGAILSAALPGLQAKGVALT  169

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            +  KIK ++II GAKF       P +  NAFS  + CPS+HFLG+ DF K+ G  LL+ F
Sbjct  170  RVPKIKVLVIIGGAKFRD-----PSIVENAFSSQIQCPSVHFLGDQDFLKQHGTELLDSF  224

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            +DP +I HPKGHT+PR DE+ +  ML F+ +++ 
Sbjct  225  IDPLVIRHPKGHTIPRFDEKGLENMLSFLGRLQN  258



>ref|XP_002864954.1| hypothetical protein ARALYDRAFT_332756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41213.1| hypothetical protein ARALYDRAFT_332756 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 167/224 (75%), Gaps = 0/224 (0%)
 Frame = +1

Query  154  NQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFD  333
            N    K  R++CLHGFRTS  IL+  + +WP+++L  LDL FLDAPFPA GKS VE  FD
Sbjct  24   NYRKQKNPRILCLHGFRTSGRILQAGIGKWPDTILRDLDLDFLDAPFPATGKSDVERFFD  83

Query  334  PPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGA  513
            PPY+EW+QA+K FKEY  FEECL YIEDY++KNGPFDG+LGFSQGA L AA+PGMQ +G 
Sbjct  84   PPYYEWYQANKGFKEYKNFEECLAYIEDYVIKNGPFDGLLGFSQGAFLTAAIPGMQEQGT  143

Query  514  ALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLL  693
            AL+K  K+KF++IISGAK  G  FG PK A NAFS P+ CPSLHF+GE DF K EG++L+
Sbjct  144  ALTKVPKVKFLVIISGAKIPGLMFGKPKAAVNAFSSPVRCPSLHFIGERDFLKTEGEVLV  203

Query  694  ECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEG  825
            E FV+P +IHH  GH +P+LD E+  T+L F  +I +M   E  
Sbjct  204  ESFVEPMVIHHSGGHIIPKLDTEAEETVLSFFQRIRQMRSDESA  247



>ref|XP_003519190.1| PREDICTED: UPF0483 protein AGAP003155-like isoformX1 [Glycine 
max]
 ref|XP_006575343.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X2 [Glycine 
max]
 gb|KHN26116.1| UPF0483 protein AGAP003155-like protein [Glycine soja]
Length=217

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EIL   + +WP++V D LDL F+DAPFP QGKS VEGIFDPPY+E
Sbjct  7    RKPRFLCLHGFRTSGEILNTQLHKWPQTVFDNLDLVFVDAPFPCQGKSDVEGIFDPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY  F+ECL+YIE+ M+K+GP DG+LGFSQGA+L+AA+PG+Q +G AL+K 
Sbjct  67   WFQFNKEFTEYTNFDECLQYIEECMIKHGPIDGLLGFSQGAILSAALPGLQEKGVALTKV  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             K+KF+II+ GAK        P +A  A+S  + CPSLHFLGETDF  + G  LLE   +
Sbjct  127  PKVKFLIIVGGAKLRS-----PSVADKAYSSSIRCPSLHFLGETDFLNKYGAELLESCNE  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            P +IHHPKGHT+PRLD++S+ TM+ FI++I+K
Sbjct  182  PVVIHHPKGHTIPRLDDKSLKTMMDFIERIKK  213



>ref|XP_007018147.1| Folic acid and derivative biosynthetic process [Theobroma cacao]
 gb|EOY15372.1| Folic acid and derivative biosynthetic process [Theobroma cacao]
Length=237

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLV-LRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            M +   I +K R +CLHGFRTS  ILKK +  +WP+SVL+++DL + DAPFPAQGKS VE
Sbjct  1    MGSEAEIARKPRFLCLHGFRTSGAILKKQIETKWPQSVLEKIDLVYPDAPFPAQGKSDVE  60

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GIFDPPY+EWFQ +KEF  Y  FEECL YIED M++ GPFDG+LGFSQGA+L+  +PG+Q
Sbjct  61   GIFDPPYYEWFQFNKEFTSYTNFEECLAYIEDIMIRQGPFDGLLGFSQGAILSCGLPGLQ  120

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
             +G AL+K  KIK++III GAKF         +A  A+S P+ C SLHFLGETDF K  G
Sbjct  121  AKGVALTKVPKIKYLIIIGGAKFKS-----ESVAEKAYSSPIQCSSLHFLGETDFLKPYG  175

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
              LLE  VDP +IHHPKGHT+PR DE+ + +++ F+++I++M
Sbjct  176  LELLESCVDPVVIHHPKGHTIPRFDEKGLESVMSFLERIQRM  217



>ref|XP_006413439.1| hypothetical protein EUTSA_v10026143mg [Eutrema salsugineum]
 dbj|BAJ33821.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54892.1| hypothetical protein EUTSA_v10026143mg [Eutrema salsugineum]
Length=233

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS VEGIFDPPY
Sbjct  7    IVRKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAPFPCQGKSDVEGIFDPPY  66

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  FE CLEY+ED MVK GPFDG++GFSQGA+L+  +PG+Q +G AL 
Sbjct  67   YEWFQFNKEFTEYTNFENCLEYLEDRMVKLGPFDGLIGFSQGAILSGGLPGLQAKGIALQ  126

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKF+III GAKF        K+A NA+S  +   SLHFLGETDF K  G  L++ F
Sbjct  127  KVPKIKFLIIIGGAKFKS-----TKIAENAYSSSVDTLSLHFLGETDFLKPYGIELIDSF  181

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             +P +++HPKGHTVPRLDE+S+  +  FI+ IE+  V EE
Sbjct  182  KNPVVVNHPKGHTVPRLDEKSLEKVTAFIETIEQHLVMEE  221



>gb|KCW62048.1| hypothetical protein EUGRSUZ_H04726 [Eucalyptus grandis]
Length=237

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R++CLHGFR SA+IL+  + +WPES+L++LDL +LDAP+P+ GKS  EG+FDPPYFE
Sbjct  8    EKPRILCLHGFRMSAKILETQMHKWPESLLEKLDLVYLDAPYPSMGKSGAEGVFDPPYFE  67

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ ++++ EY  F+EC+++IED+MVKNGPFDG+LGFSQGAVLAAA+PGMQ EG   +K 
Sbjct  68   WFQGNQDYTEYENFKECIDFIEDFMVKNGPFDGLLGFSQGAVLAAALPGMQAEGLVFTKV  127

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             +IKF+I+ISGAK GG KF  P LAANAFS P+ CPSLH +GE D  K +   LL+ FVD
Sbjct  128  PEIKFLILISGAKLGGSKFSAPPLAANAFSSPVKCPSLHVIGENDLVKPDSIALLDSFVD  187

Query  709  PHLIHHPKGHTVPRL  753
            P ++HH + HT+PRL
Sbjct  188  PIIVHHLEDHTIPRL  202



>emb|CDP11467.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 164/213 (77%), Gaps = 6/213 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            +K R +CLHGFRTS EIL+K V  +WP+SVLD+LDL ++DAPFP QGKS VEGIFDPPY+
Sbjct  9    RKPRFLCLHGFRTSGEILRKQVTTKWPQSVLDKLDLVYVDAPFPCQGKSEVEGIFDPPYY  68

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ +KEF EY  F+ECL YIED MVK+GPFDG+LGFSQGA+L+AA+PG+Q +G AL+K
Sbjct  69   EWFQFNKEFTEYQNFDECLAYIEDCMVKHGPFDGLLGFSQGAILSAALPGLQEKGVALTK  128

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIKF+II+ GAKF         +A  A++ P+ C S+HFLGE DF K  G  L+E  V
Sbjct  129  VPKIKFLIIVGGAKFRN-----QSVAEKAYASPIQCTSVHFLGEQDFLKPYGTKLIESCV  183

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            DP +IHHPKGHT+PR D++++  M  F+D++ K
Sbjct  184  DPLVIHHPKGHTMPRFDDKTLEEMHRFLDRLHK  216



>ref|NP_001145537.1| uncharacterized protein LOC100278972 [Zea mays]
 gb|ACG48294.1| hypothetical protein [Zea mays]
Length=239

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 165/216 (76%), Gaps = 6/216 (3%)
 Frame = +1

Query  157  QIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFD  333
            Q   ++ R +CLHGFRTS EI++K VL +WP  V  RLDL F DAPFPA+GKS V+GIFD
Sbjct  11   QGARRRPRFLCLHGFRTSGEIMRKQVLGKWPADVTARLDLVFADAPFPAEGKSDVDGIFD  70

Query  334  PPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGA  513
            PPY+EWFQ DK F EY  F++CL YIE+ M+K+GPFDG++GFSQG++L+AA+PG+Q +G 
Sbjct  71   PPYYEWFQFDKSFMEYRNFDKCLAYIEELMIKDGPFDGLMGFSQGSILSAALPGLQEQGL  130

Query  514  ALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLL  693
            AL++  K+K++III GAKF       P +A+ A+++ + CPSLHF+GE DF K  G+ L+
Sbjct  131  ALTRVPKVKYLIIIGGAKFQS-----PTVASKAYANKIACPSLHFIGENDFLKVHGEKLI  185

Query  694  ECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
            E  VDP +I HPKGHTVPRLD+ES+  M  F++KIE
Sbjct  186  ESCVDPFVIRHPKGHTVPRLDDESLVVMHRFLEKIE  221



>ref|XP_004975781.1| PREDICTED: dihydrofolate reductase-like [Setaria italica]
Length=241

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            ++ R +CLHGFRTSAEI++K V+ +WP  V  RLDL F DAPFPA+GKS V+GIFDPPY+
Sbjct  17   RRPRFLCLHGFRTSAEIMRKQVVGKWPADVTARLDLVFADAPFPAEGKSDVDGIFDPPYY  76

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DKEF EY  F++CL YIE+ M+K+GPFDG++GFSQGA+L+AA+PG+Q +G AL++
Sbjct  77   EWFQFDKEFTEYKNFDKCLAYIEELMIKDGPFDGLMGFSQGAILSAALPGLQEQGLALTR  136

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIK++III GAKF       P +A  A+++ + C SLHF+G+ DF K  G+ L+E  V
Sbjct  137  VPKIKYLIIIGGAKFLS-----PTVAEKAYANKIACTSLHFIGDNDFLKTHGEKLIESCV  191

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            DP +I HPKGHTVPRLD++S+  ML F++KIEK
Sbjct  192  DPFVIRHPKGHTVPRLDDKSLQVMLRFLEKIEK  224



>ref|XP_009770612.1| PREDICTED: rhodanese-like domain-containing protein 6 [Nicotiana 
sylvestris]
Length=221

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 163/213 (77%), Gaps = 6/213 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             +K R +CLHGFRTS +ILKK V  +WP  V+++LDL F+DAPFP QGKS VEGIFDPPY
Sbjct  9    QRKPRFLCLHGFRTSGQILKKQVFDKWPTQVVEKLDLVFVDAPFPCQGKSEVEGIFDPPY  68

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  F++CL YIE+ M+K+GPFDG+LGFSQGA+L+ A+PG+Q +G AL+
Sbjct  69   YEWFQFNKEFTEYQNFDKCLAYIEECMIKHGPFDGLLGFSQGAILSGALPGLQEKGVALT  128

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIK++III GA+F         +A  A+S  + CPS+HFLGE D+ K+ G  LLE +
Sbjct  129  KVPKIKYLIIIGGAQFKN-----ESVAEKAYSSSITCPSVHFLGEQDYLKKYGIELLESY  183

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
            VDP +IHHPKGHT+PR DE+ + TML FI+ ++
Sbjct  184  VDPVVIHHPKGHTIPRFDEKGLETMLSFIEMVQ  216



>ref|XP_010942650.1| PREDICTED: UPF0483 protein CG5412-like [Elaeis guineensis]
Length=242

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 163/225 (72%), Gaps = 8/225 (4%)
 Frame = +1

Query  139  LKMENNQII--HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGK  309
            L  ENN  I   ++ R +CLHGFRTS EI++  VL +W + V  RLDL F DAPFPA+GK
Sbjct  4    LPEENNATIGARQRPRFLCLHGFRTSGEIMRTQVLGKWLDHVTARLDLFFADAPFPAEGK  63

Query  310  STVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAM  489
            S VEGIF PPY+EWFQ D  F  Y  F+ECL YIE+ M+K+GPFDG++GFSQGA+L+AA+
Sbjct  64   SDVEGIFPPPYYEWFQFDSAFLNYRNFDECLAYIEELMIKHGPFDGLMGFSQGAILSAAL  123

Query  490  PGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQ  669
            PG+Q  G AL++  K+K+V+II+GAK        P +A  A++  + CPSLHF+GE DF 
Sbjct  124  PGLQARGLALTRVPKVKYVVIIAGAKLQS-----PVVAEKAYASKIECPSLHFIGEKDFL  178

Query  670  KEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            K  G+ LL  FVDP +I HPKGHTVPRLD++S+ TML F+ KIE 
Sbjct  179  KTHGERLLASFVDPFVIRHPKGHTVPRLDDKSLATMLDFLQKIEN  223



>ref|NP_001237691.1| uncharacterized protein LOC100500670 [Glycine max]
 gb|ACU15811.1| unknown [Glycine max]
Length=217

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EILK  + + P+SVLD LDL F+DAPF   GKS VEGIFDPPY+E
Sbjct  7    RKPRFLCLHGFRTSGEILKTQLHKRPQSVLDNLDLVFVDAPFSCLGKSDVEGIFDPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY  F+ECL+YIE+ M+K GP DG+LGFSQG++L+AA+PG+Q +G AL+K 
Sbjct  67   WFQFNKEFTEYTNFDECLQYIEECMIKYGPIDGLLGFSQGSILSAALPGLQEKGVALTKV  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             K+KF+II+ GAKF       P +   A+S  + CPSLHF+GETDF  + G  LLE  V+
Sbjct  127  PKVKFLIIVGGAKFRS-----PSVMDKAYSSSISCPSLHFIGETDFLNKYGAELLESCVE  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            P +IHHPKGHT+PRLD++S+ TM+ FI++I+K
Sbjct  182  PVVIHHPKGHTIPRLDDKSLKTMMDFIERIKK  213



>tpg|DAA37561.1| TPA: hypothetical protein ZEAMMB73_807797 [Zea mays]
Length=327

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 164/216 (76%), Gaps = 6/216 (3%)
 Frame = +1

Query  157  QIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFD  333
            Q   ++ R +CLHGFRTS EI++K VL +WP  V  RLDL F DAPFPA+GKS VEGIFD
Sbjct  99   QGARRRPRFLCLHGFRTSGEIMRKQVLGKWPADVTARLDLVFADAPFPAEGKSDVEGIFD  158

Query  334  PPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGA  513
            PPY+EWFQ DK F EY  F++CL YIE+ M+K+GPFDG++GFSQG++L+AA+PG+Q +G 
Sbjct  159  PPYYEWFQFDKSFMEYRNFDKCLAYIEELMIKDGPFDGLMGFSQGSILSAALPGLQEQGL  218

Query  514  ALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLL  693
            AL++  K+K++III GAKF       P +A  A+++ + CPSLHF+GE DF K  G+ L+
Sbjct  219  ALTRVPKVKYLIIIGGAKFQS-----PTVAGKAYANKIACPSLHFIGENDFLKVHGEKLI  273

Query  694  ECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
            E  VDP +I HPKGHTVPRLD+ES+  M  F++KIE
Sbjct  274  ESCVDPFVIRHPKGHTVPRLDDESLVVMHRFLEKIE  309



>ref|XP_010320195.1| PREDICTED: UPF0483 protein CG5412 isoform X2 [Solanum lycopersicum]
Length=227

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 172/226 (76%), Gaps = 7/226 (3%)
 Frame = +1

Query  151  NNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            +++   +K R +CLHGFRTS +ILKK +  +WP  V+D+LDL F+DAPFP+QGKS VEGI
Sbjct  6    DSKTHQRKPRFLCLHGFRTSGKILKKQIFDKWPTEVVDKLDLVFVDAPFPSQGKSEVEGI  65

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  F++CLEYIE+ M+K+GPFDG+LGFSQGA+L+ A+ G+Q +
Sbjct  66   FDPPYYEWFQFNKEFTEYENFDKCLEYIEECMIKHGPFDGLLGFSQGAILSGALSGLQAK  125

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
               L+KA+KIK++III GAKF         +A  A+S  + CPS+HFLGE D+ K+ G  
Sbjct  126  EVGLTKASKIKYLIIIGGAKFRN-----KSVAEKAYSPAIACPSVHFLGEQDYLKQYGIE  180

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI-EKMAVQEE  822
            LLE  VDP +IHHP+GHT+PR DE+ + +ML FI+K+ E+++  E+
Sbjct  181  LLESCVDPVVIHHPRGHTIPRFDEKGLESMLSFIEKVQEEISTSEQ  226



>ref|XP_006338096.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X1 [Solanum tuberosum]
Length=265

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 161/209 (77%), Gaps = 6/209 (3%)
 Frame = +1

Query  178  RVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWF  354
            R +CLHGFRTS  ILKK +  +WP  V+++LDL F+DAPFP+QGKS VEGIFDPPY+EW+
Sbjct  53   RFLCLHGFRTSGAILKKQIFDKWPIQVVNKLDLVFVDAPFPSQGKSEVEGIFDPPYYEWY  112

Query  355  QADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAK  534
            Q +KE KEY  F++CLEYI++ M+K+GPFDG+LGFSQGA+L+ A+PG+Q +G  L+K  K
Sbjct  113  QFNKELKEYENFDKCLEYIQECMIKHGPFDGLLGFSQGAILSGALPGLQDKGVGLTKVPK  172

Query  535  IKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPH  714
            IK++III     GG K  +  LA  A+S  + CPS+HFLGE DF K  G  LLE +VDP 
Sbjct  173  IKYLIII-----GGAKMQITSLAEKAYSPAITCPSVHFLGEKDFLKPSGMKLLESYVDPV  227

Query  715  LIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
            +IHHPKGH++PR DE+ + +ML FI+K++
Sbjct  228  VIHHPKGHSIPRFDEKGLESMLSFIEKVQ  256



>ref|XP_004237969.1| PREDICTED: UPF0483 protein CG5412 isoform X3 [Solanum lycopersicum]
Length=223

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 169/227 (74%), Gaps = 11/227 (5%)
 Frame = +1

Query  151  NNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            +++   +K R +CLHGFRTS +ILKK +  +WP  V+D+LDL F+DAPFP+QGKS VEGI
Sbjct  6    DSKTHQRKPRFLCLHGFRTSGKILKKQIFDKWPTEVVDKLDLVFVDAPFPSQGKSEVEGI  65

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  F++CLEYIE+ M+K+GPFDG+LGFSQGA+L+ A+ G+Q +
Sbjct  66   FDPPYYEWFQFNKEFTEYENFDKCLEYIEECMIKHGPFDGLLGFSQGAILSGALSGLQAK  125

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
               L+KA+KIK++III GAKF         +A  A+S  + CPS+HFLGE D+ K+ G  
Sbjct  126  EVGLTKASKIKYLIIIGGAKFRN-----KSVAEKAYSPAIACPSVHFLGEQDYLKQYGIE  180

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            LLE  VDP +IHHP+GHT+PR DE+   +ML FI+K     VQEE N
Sbjct  181  LLESCVDPVVIHHPRGHTIPRFDEKGSESMLSFIEK-----VQEEIN  222



>ref|XP_008776557.1| PREDICTED: UPF0483 protein AGAP003155-like [Phoenix dactylifera]
Length=242

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 161/214 (75%), Gaps = 6/214 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             ++ R +CLHGFRTS EI++ ++V +WP+ V  RLDL F DAPFPA+GKS VEGIF PPY
Sbjct  15   RQRPRFLCLHGFRTSGEIMRTQVVGKWPDHVTARLDLFFADAPFPAEGKSDVEGIFPPPY  74

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ D++F EY  F+ECL YIE+ M+K+GPFDG++GFSQGA+L+AA+PG+Q  G AL+
Sbjct  75   YEWFQFDRKFLEYRNFDECLAYIEELMIKHGPFDGLMGFSQGAILSAALPGLQARGLALT  134

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            +  K+K V+II GAKF       P +A  A+   + CPSLHF+GE DF K  G+ LLE F
Sbjct  135  RVPKVKCVVIIGGAKFQS-----PAVAEKAYVSKIECPSLHFIGEMDFLKTPGETLLESF  189

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            VDP +I HPKGHTVPRLD++S+  ML F+ KIE 
Sbjct  190  VDPLVIRHPKGHTVPRLDDKSLEMMLDFLQKIEN  223



>gb|KHG17753.1| Uncharacterized protein F383_22151 [Gossypium arboreum]
Length=237

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 161/221 (73%), Gaps = 6/221 (3%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            I +K R + LHGFRTS  ILK ++  +WP+SVL+++D+ + DAPFPAQGKS VEGIFD P
Sbjct  7    IVRKPRFLGLHGFRTSGAILKTQIETKWPKSVLEKIDIVYPDAPFPAQGKSDVEGIFDSP  66

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            Y+EWFQ +KEF  Y  F+ECL YIED ++K GPFDG+LGFSQGA+L+  +PG+Q +G AL
Sbjct  67   YYEWFQFNKEFTTYTNFDECLAYIEDIIIKQGPFDGLLGFSQGAILSGGLPGLQAKGMAL  126

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
            +K  +IK +III GAKF         +A NA+S P+HCPSLHFLGE DF K  G  LLE 
Sbjct  127  TKVPQIKNLIIIGGAKFKN-----ETVAENAYSSPIHCPSLHFLGENDFLKPYGLELLES  181

Query  700  FVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             VDP +IHHPKGHT+PR DE  +  ML F+ ++EK    E+
Sbjct  182  CVDPVVIHHPKGHTIPRFDESGLEMMLSFLKRVEKDIFSEQ  222



>ref|XP_010439048.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X1 [Camelina sativa]
Length=242

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+KK + +WP+SV+DRL+L FLDAPFP QGKS  +GI+DPPY
Sbjct  9    IMRKPRFLCLHGFRTSGEIMKKQLHKWPKSVIDRLELVFLDAPFPCQGKSDYDGIYDPPY  68

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EW+Q +KEF EY   E+C E++ED MVK GPFDG++GFSQGA+L+ A+ GMQ +G A  
Sbjct  69   YEWYQYNKEFTEYTNLEKCFEFLEDRMVKLGPFDGLIGFSQGAILSGALLGMQAKGIAFQ  128

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKFVIII     GG  F   K+  NA+S  L   SLH LGE DF K  G  L E F
Sbjct  129  KVPKIKFVIII-----GGAMFKSTKMRENAYSCSLDTLSLHILGEKDFVKHSGTKLTELF  183

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             +P ++HH KGHTVPRLD+ S+  + GFID IE + ++E+
Sbjct  184  KNPVVVHHSKGHTVPRLDDRSLEKVTGFIDTIEHLVMEED  223



>ref|XP_010106315.1| hypothetical protein L484_019830 [Morus notabilis]
 gb|EXC09732.1| hypothetical protein L484_019830 [Morus notabilis]
Length=202

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = +1

Query  229  LVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEY  408
            L  RWPE+VL++LD+ +LD PFPAQGKS++E ++DPPY+EWFQ +++  E+  F++C++Y
Sbjct  2    LQTRWPETVLEKLDMVYLDGPFPAQGKSSIEDVYDPPYYEWFQCNEDLTEFINFKDCVKY  61

Query  409  IEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFG  588
            +EDYMVK GPFDG+LG SQG  LAA++PGMQ EG AL++  KIKF+I IS  KFGG   G
Sbjct  62   LEDYMVKYGPFDGILGDSQGGNLAASLPGMQNEGVALTRVPKIKFLIFISAGKFGGATMG  121

Query  589  VPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESV  768
             P+LAANAFS P+  PSLHF+G+ D  K  G+ L++ FVDP +I HP+GHTVP LDE+ V
Sbjct  122  TPELAANAFSSPIERPSLHFIGDKDALKPGGEDLVKAFVDPVVIRHPQGHTVPTLDEKQV  181

Query  769  GTMLGFIDKIEKMA  810
              +LGFI+KI+ + 
Sbjct  182  EVVLGFIEKIQNLT  195



>gb|ADE77504.1| unknown [Picea sitchensis]
Length=256

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 160/219 (73%), Gaps = 4/219 (2%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K+RV+CLHGFRTS  IL+K V +W +SVL+R+DL F DAPFPAQGKS VE  F PPY+EW
Sbjct  21   KVRVLCLHGFRTSGSILQKQVGKWEKSVLERMDLCFPDAPFPAQGKSDVEKHFPPPYYEW  80

Query  352  FQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAA  531
            FQ + +F EY   +ECL +IE+YM+KNGPF G+LGFSQGA L+AA+PG+Q +G AL++  
Sbjct  81   FQINSQFTEYQNMDECLSFIEEYMIKNGPFHGLLGFSQGAKLSAALPGLQSKGLALTRVP  140

Query  532  KIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDP  711
             ++FVII+ GAKF      +     +A+S  + CPSLHFLG+ DF K  G+ LL+ FVDP
Sbjct  141  PLQFVIIVGGAKFK----ALLHSKQSAYSSAIECPSLHFLGDKDFLKPYGEELLKSFVDP  196

Query  712  HLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
             +I HP GHTVPRLD+E V  +  F+D++E+    + GN
Sbjct  197  FVIRHPMGHTVPRLDKEGVKAINSFLDRVEESITTKAGN  235



>ref|XP_004237967.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X1 [Solanum lycopersicum]
Length=257

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 163/217 (75%), Gaps = 7/217 (3%)
 Frame = +1

Query  178  RVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWF  354
            R +CLHGFRTS +ILKK +  +WP  V+D+LDL F+DAPFP+QGKS VEGIF PPY+EW+
Sbjct  45   RFLCLHGFRTSGKILKKQIFDKWPIEVVDKLDLVFVDAPFPSQGKSEVEGIFAPPYYEWY  104

Query  355  QADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAK  534
            Q +KE  EY  F+ CL+YI++ M+K+GPFDG+LGFSQGA+L+ A+ G+Q +G  L+K  K
Sbjct  105  QFNKELNEYENFDNCLDYIQECMIKHGPFDGLLGFSQGAILSGALRGLQDKGVGLTKVRK  164

Query  535  IKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPH  714
            IK++III     GG K  +  LA  A+S  + CPS+HFLGE DF K  G  LLE +VDP 
Sbjct  165  IKYLIII-----GGAKMQIKSLAEKAYSPAITCPSVHFLGEKDFLKPYGMELLESYVDPV  219

Query  715  LIHHPKGHTVPRLDEESVGTMLGFIDKI-EKMAVQEE  822
            +IHHPKGHT+PR DE+ + +ML FI+K+ E+++  E+
Sbjct  220  VIHHPKGHTIPRFDEKGLESMLSFIEKVQEEISTSEQ  256



>ref|XP_009409294.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 161/214 (75%), Gaps = 6/214 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            H++ R +CLHGFRTS  I++  V+ +WPE V+ RLDL F DAPFPA+GKS VEGIF PPY
Sbjct  12   HRRPRFLCLHGFRTSGAIMRSQVVGKWPEEVIGRLDLVFPDAPFPAEGKSDVEGIFPPPY  71

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ DK+F EY   ++C  YIED M+++GPFDG++GFSQGA+L+AA+ G+Q  G+AL+
Sbjct  72   YEWFQFDKDFSEYRNLDKCFAYIEDLMIEHGPFDGLMGFSQGAILSAALVGLQARGSALT  131

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            +  K+K +III GAKF       P +A  A++  + C SLHFLG+ DF K+ G+ LLE F
Sbjct  132  RVPKVKHLIIIGGAKFQS-----PAVAEKAYASAVDCTSLHFLGDMDFLKKHGEALLESF  186

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            ++P++I HPKGHTVPRLD++S+ TM  F+ KIE 
Sbjct  187  INPYVIRHPKGHTVPRLDDKSLETMRDFLQKIEN  220



>ref|XP_003581295.1| PREDICTED: UPF0483 protein AGAP003155 [Brachypodium distachyon]
Length=248

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 161/214 (75%), Gaps = 7/214 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            ++ R +CLHGFRTS EI++K V+ +WP  V  RLDL F DAPFPA+GKS VEGIFDPPY+
Sbjct  17   RRPRFLCLHGFRTSGEIMRKQVVGKWPAEVTARLDLVFADAPFPAEGKSEVEGIFDPPYY  76

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY  F++CL YIE+ M+K GPFDG++GFSQG++L+ A+PG+Q +G AL++
Sbjct  77   EWFQFDKDFTEYRNFDKCLAYIEELMIKEGPFDGLMGFSQGSILSGALPGLQEQGLALTR  136

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              KIK++III GAKF       P +   A+ + +  PSLHFLG+ DF K  G+ L+E FV
Sbjct  137  VPKIKYLIIIGGAKFRS-----PAIVEKAYDNKIKIPSLHFLGDNDFLKPHGEQLIESFV  191

Query  706  DPHLIHHPKGHTVPRL-DEESVGTMLGFIDKIEK  804
            DP +I HPKGHTVPRL D++S+  M GF++ +EK
Sbjct  192  DPLIIRHPKGHTVPRLVDDKSLEVMSGFLEMMEK  225



>ref|XP_006338095.1| PREDICTED: rhodanese-like domain-containing protein 6-like [Solanum 
tuberosum]
Length=223

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             +K R +CLHGFRTS  ILKK +  +WP  V+D+LDL F+DAPFP+QGKS VEGIFDPPY
Sbjct  11   QRKPRFLCLHGFRTSGAILKKQIFDKWPTQVVDKLDLVFVDAPFPSQGKSEVEGIFDPPY  70

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  F++CLEYIE+ M+K+GPFDG+LGFSQGA+L+  + G+Q +    +
Sbjct  71   YEWFQFNKEFTEYENFDKCLEYIEECMIKHGPFDGLLGFSQGAILSGGLSGLQAKEVGFT  130

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIK +III GAKF         +A  A+S  + CPSLHFLGE D+ K+ G  LLE  
Sbjct  131  KVPKIKNLIIIGGAKFQN-----KSVAEKAYSSAITCPSLHFLGEKDYLKKYGIELLESC  185

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIE  801
            VDP +IHHP+GHT+PR DE+ + +ML FI+K++
Sbjct  186  VDPVVIHHPRGHTIPRFDEKGLESMLSFIEKVQ  218



>ref|XP_008444881.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Cucumis 
melo]
Length=217

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 150/221 (68%), Gaps = 4/221 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K  ++CLHGFRTS  IL+K + +WP SVL +   HF+D P P+QGKS VEG
Sbjct  1    MTSESKIERKPTILCLHGFRTSGAILRKQIQKWPTSVLHQFHFHFIDGPLPSQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF   K+       E CLE+IE+YMVK+GPFDG+LGFSQGAVL+AA+ G+Q 
Sbjct  61   IYDPPYFEWFGTSKDPTSCENLESCLEFIENYMVKHGPFDGLLGFSQGAVLSAALAGLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKFVIIISG+K           A  A+S  + CPSLHFL E DF    G 
Sbjct  121  RGVALTKVPKIKFVIIISGSKLQSSSLA----AGIAYSPSIACPSLHFLSEKDFLMPSGM  176

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             LL  FV+P +I+H KGHTVPRLD++S+  +  FI  I K+
Sbjct  177  ELLRSFVEPLVINHSKGHTVPRLDDKSLKIVGRFIQNISKL  217



>ref|XP_009138021.1| PREDICTED: UPF0483 protein CG5412 [Brassica rapa]
Length=230

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 169/226 (75%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K R +CLHGFRTS EI+K  + +WP+SVLDRLDL FLDAPFP QGKS VEG
Sbjct  1    MGSEGTIVRKPRFLCLHGFRTSGEIMKIQLHKWPQSVLDRLDLVFLDAPFPCQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  FE+CLEY+ED M++ GPFDG++GFSQGA+L+  +PG+Q 
Sbjct  61   IFDPPYYEWFQFNKEFNEYTNFEKCLEYLEDRMIELGPFDGLIGFSQGAILSGGLPGLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL K  KIKF+III GA F        K+A +A+S  +  PSLHFLGETDF K  G 
Sbjct  121  KGIALQKVPKIKFIIIIGGAMFKS-----TKVAKDAYSSTMDIPSLHFLGETDFLKPYGT  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             L++ F +P ++HHPKGHTVPRLDE+S+  +  FID +E + ++EE
Sbjct  176  ELIDSFENPVVVHHPKGHTVPRLDEKSLEKVTAFIDTLEHLLMEEE  221



>emb|CDY34285.1| BnaA01g13880D [Brassica napus]
Length=230

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 169/226 (75%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K R +CLHGFRTS EI+K  + +WP+SVLDRLDL FLDAPFP QGKS VEG
Sbjct  1    MGSEGTIVRKPRFLCLHGFRTSGEIMKIQLHKWPQSVLDRLDLVFLDAPFPCQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  FE+CLEY+ED M++ GPFDG++GFSQGA+L+  +PG+Q 
Sbjct  61   IFDPPYYEWFQFNKEFNEYTNFEKCLEYLEDRMIELGPFDGLIGFSQGAILSGGLPGLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL K  KIKF+III GA F        K+A +A+S  +  PSLHFLGETDF K  G 
Sbjct  121  KGIALQKVPKIKFIIIIGGAMFKS-----TKVAKDAYSSTMDIPSLHFLGETDFLKPYGT  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             L++ F +P ++HHPKGHTVPRLDE+S+  +  FID +E + +++E
Sbjct  176  ELIDSFENPVVVHHPKGHTVPRLDEKSLEKVTAFIDTLEHLLMEDE  221



>ref|XP_010433772.1| PREDICTED: UPF0483 protein AGAP003155-like [Camelina sativa]
Length=236

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 164/225 (73%), Gaps = 5/225 (2%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E    I +K R +CLHGFRTS EI+K  + +WP+SV DRLDL FLDAPFP QGKS V+GI
Sbjct  4    EGGSSIVRKPRFLCLHGFRTSGEIMKTQLNKWPKSVTDRLDLVFLDAPFPCQGKSDVDGI  63

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  FE+CLE++ED M+K GPFDG++GFSQGA+L+  +PGMQ +
Sbjct  64   FDPPYYEWFQFNKEFTEYTNFEKCLEFLEDRMIKLGPFDGLIGFSQGAILSGGLPGMQAK  123

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL K  KIKF+III GA          KL  NA+S  L   SLHFLGETDF K  G  
Sbjct  124  GVALQKVPKIKFIIIIGGAMLKS-----TKLIENAYSSSLDTLSLHFLGETDFLKPYGTQ  178

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            L+E F +P ++HHPKGHTVPRLDE+S+  + GFI+ IE+  V EE
Sbjct  179  LIEFFKNPVVVHHPKGHTVPRLDEKSLEKVTGFIETIEQHLVMEE  223



>ref|XP_010448573.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Camelina 
sativa]
Length=233

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 156/218 (72%), Gaps = 5/218 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K R +CLHGFRTS EI+KK + +WP+SV+DRL+L FLDAPFP QGKS  EGI+DPPY+E
Sbjct  2    RKPRFLCLHGFRTSGEIMKKQLYKWPKSVIDRLELVFLDAPFPCQGKSDYEGIYDPPYYE  61

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            W+Q +KEF EY   E+C E++ED +VK GPFDG++GFSQGA+L+ A+ GMQ +G A  K 
Sbjct  62   WYQYNKEFTEYPNLEKCFEFLEDRVVKLGPFDGLIGFSQGAILSGAILGMQAKGIAFQKV  121

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
             KIKFVIII GA +        K+  NA+S  L   SLH LGE DF K     L E F +
Sbjct  122  PKIKFVIIIGGAMYKS-----KKMIENAYSSSLDTLSLHILGEKDFVKHSAIKLTELFKN  176

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            P ++HH KGH VPRLD++S+  + GFID IE + ++E+
Sbjct  177  PVVVHHTKGHIVPRLDDKSLEKVTGFIDTIEHLVMEED  214



>ref|XP_009380891.1| PREDICTED: dihydrofolate reductase-like [Musa acuminata subsp. 
malaccensis]
Length=241

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 159/213 (75%), Gaps = 6/213 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            ++ R +CLHGFRTS  I++ ++V +WPE V  RLDL F DAPFPA+GKS VEGIF PPY+
Sbjct  16   RRPRFLCLHGFRTSGAIMRTQVVGKWPEEVTARLDLVFPDAPFPAEGKSDVEGIFSPPYY  75

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY   +EC  YIED M+++GPFDG++GFSQGA+L+AA+ G+Q +G AL++
Sbjct  76   EWFQFDKDFMEYTNLDECFAYIEDLMIQHGPFDGLMGFSQGAILSAALVGLQSKGIALTR  135

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
              K+K++III GAKF         +A  A++  + C SLHFLG+ DF K+ G+ LLE FV
Sbjct  136  VPKVKYLIIIGGAKFQS-----QPVAERAYAAAIDCTSLHFLGDMDFLKKHGEALLESFV  190

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
             P++I HP+GHTVPRLD++S+ TM  F+ KIE 
Sbjct  191  KPYVIRHPRGHTVPRLDDKSLETMHDFLQKIEN  223



>emb|CDY03451.1| BnaC01g16310D [Brassica napus]
Length=230

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 168/226 (74%), Gaps = 5/226 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +   I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS VEG
Sbjct  1    MGSEGTIVRKPRFLCLHGFRTSGEIMKIQLHKWPQSVIDRLDLVFLDAPFPCQGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  FE+CLEY+ED M++ GPFDG++GFSQGA+L+  +PG+Q 
Sbjct  61   IFDPPYYEWFQFNKEFNEYTNFEKCLEYLEDRMIELGPFDGLIGFSQGAILSGGLPGLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G AL K  KIKF+III GA F         +A +A+S  +  PSLHFLGETDF K  G 
Sbjct  121  KGIALQKVPKIKFIIIIGGAMFKS-----TNVAKDAYSSTMDIPSLHFLGETDFLKPYGT  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             L++ F +P ++HHPKGHTVPRLDE+S+  +  FID +E + ++EE
Sbjct  176  ELIDSFENPVVVHHPKGHTVPRLDEKSLEKVTAFIDTLEHLLMEEE  221



>ref|XP_010439046.1| PREDICTED: UPF0483 protein CG5412-like [Camelina sativa]
Length=243

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 163/225 (72%), Gaps = 5/225 (2%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E    + +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS V+GI
Sbjct  4    EGGSSMVRKPRFLCLHGFRTSGEIMKIQLNKWPKSVIDRLDLVFLDAPFPCQGKSDVDGI  63

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FD PY+EWFQ +KEF EY  FE+CLE++ED M+K GPFDG++GFSQGA+L+  +PGMQ +
Sbjct  64   FDSPYYEWFQFNKEFTEYTNFEKCLEFLEDRMIKLGPFDGLIGFSQGAILSGGLPGMQAK  123

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL K  KIKF+III G           KL  +A+S  L   SLHFLGETDF K  G  
Sbjct  124  GVALQKVPKIKFIIIIGGGMLKS-----TKLIEDAYSSSLDTLSLHFLGETDFLKPYGTE  178

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            L+E F +P ++HHPKGHTVPRLD++S+  + GFI+ IE+  V EE
Sbjct  179  LIEFFKNPVVVHHPKGHTVPRLDDKSLEKVTGFIETIEQHLVMEE  223



>ref|XP_010025396.1| PREDICTED: rhodanese-like domain-containing protein 6 isoform 
X2 [Eucalyptus grandis]
Length=184

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             H+K R++CLHGFRTSA+IL+  + +WP+S+L++LDL +LDAP+P+ G+S+VEGIFDPPY
Sbjct  6    THEKPRILCLHGFRTSAKILETQIHKWPDSILEKLDLVYLDAPYPSMGQSSVEGIFDPPY  65

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            FEWFQA+++F EY  FEEC+ +IED+MVKNGPFDG+LGFSQGA LAAA+PGMQ EG  L+
Sbjct  66   FEWFQANQDFTEYENFEECITFIEDFMVKNGPFDGLLGFSQGATLAAALPGMQAEGLVLT  125

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLG  654
            K  KIKF+I+ SGAKFGG KFG P LAANAFS P+ CPSLH +G
Sbjct  126  KVPKIKFLILTSGAKFGGSKFGAPPLAANAFSCPVKCPSLHVIG  169



>emb|CAB45073.1| putative protein [Arabidopsis thaliana]
 emb|CAB79348.1| putative protein [Arabidopsis thaliana]
Length=208

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 148/197 (75%), Gaps = 5/197 (3%)
 Frame = +1

Query  238  RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIED  417
            +WP+SV+DRLDL FLDAPFP QGKS VEGIFDPPY+EWFQ +KEF EY  FE+CLEY+ED
Sbjct  7    KWPKSVIDRLDLVFLDAPFPCQGKSDVEGIFDPPYYEWFQFNKEFTEYTNFEKCLEYLED  66

Query  418  YMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPK  597
             M+K GPFDG++GFSQGA+L+  +PG+Q +G A  K  KIKFVIII GAK         K
Sbjct  67   RMIKLGPFDGLIGFSQGAILSGGLPGLQAKGIAFQKVPKIKFVIIIGGAKLKS-----AK  121

Query  598  LAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTM  777
            LA NA+S  L   SLHFLGETDF K  G  L+E + +P ++HHPKGHTVPRLDE+S+  +
Sbjct  122  LAENAYSSSLETLSLHFLGETDFLKPYGTQLIESYKNPVVVHHPKGHTVPRLDEKSLEKV  181

Query  778  LGFIDKIEKMAVQEEGN  828
              FID +E + ++E+ N
Sbjct  182  TAFIDTLEHLVMEEDKN  198



>ref|XP_010433775.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X1 [Camelina sativa]
Length=242

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 155/220 (70%), Gaps = 5/220 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS E +KK + +WP+SV+ RL+L FLDAPFP +GKS  +GI+DPPY
Sbjct  9    ILRKPRFLCLHGFRTSGEKMKKQLHKWPKSVIGRLELVFLDAPFPCRGKSDYDGIYDPPY  68

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EW+Q +KEF  Y   E+C E++ED MVK GPFDG++GFSQGA+L+ A+ GMQ +G A  
Sbjct  69   YEWYQYNKEFTVYTNLEKCFEFLEDRMVKLGPFDGLIGFSQGAILSGALLGMQAKGIAFQ  128

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKFVIII     GG  F   K+  NA+S  L   SLH LGE DF K  G  L E F
Sbjct  129  KVPKIKFVIII-----GGAMFKSTKMRENAYSSSLDTLSLHILGEKDFVKHSGIKLTELF  183

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             +P ++HH KGHTVPRLD++S+  +  FID IE + ++E+
Sbjct  184  QNPVVVHHSKGHTVPRLDDKSLENVTRFIDTIEHLVMEED  223



>ref|XP_006285371.1| hypothetical protein CARUB_v10006762mg [Capsella rubella]
 gb|EOA18269.1| hypothetical protein CARUB_v10006762mg [Capsella rubella]
Length=274

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 163/222 (73%), Gaps = 5/222 (2%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E    I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS VEGI
Sbjct  43   EGGGAIVRKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAPFPCQGKSDVEGI  102

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  FE+CLEY+ED M+K GPFDG++GFSQGA+L+  +PG+Q +
Sbjct  103  FDPPYYEWFQFNKEFTEYTNFEKCLEYLEDRMIKLGPFDGLIGFSQGAILSGGLPGLQAK  162

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL K  KIK++III GA F        KL  NA+S  L   SLHFLGETDF K  G  
Sbjct  163  GIALQKVPKIKYIIIIGGAMFKS-----TKLIENAYSSSLDTLSLHFLGETDFLKPYGTE  217

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            L+E F  P ++HHPKGHTVPRLDE+S+  + GFI+ +E + +
Sbjct  218  LIEFFKSPVVVHHPKGHTVPRLDEKSLEKVTGFIETLEHLVM  259



>ref|XP_010448568.1| PREDICTED: UPF0483 protein AGAP003155-like [Camelina sativa]
Length=236

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 163/225 (72%), Gaps = 5/225 (2%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E    I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS V+GI
Sbjct  4    EGGASIVRKPRFLCLHGFRTSGEIMKIQLNKWPKSVIDRLDLVFLDAPFPCQGKSDVDGI  63

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            FDPPY+EWFQ +KEF EY  FE+CLE++ED M+K GPFDG++GFSQGA+L+  +PGMQ +
Sbjct  64   FDPPYYEWFQFNKEFTEYTNFEKCLEFLEDRMIKLGPFDGLIGFSQGAILSGGLPGMQAK  123

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G A  K  KIKF+III GA          KL  NA+S  L   SLHFLGETDF K  G  
Sbjct  124  GVAFQKVPKIKFIIIIGGAMLKS-----TKLIENAYSSSLDTLSLHFLGETDFLKPYGTE  178

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            L+  F +P ++HHPKGHTVPRLD++S+  + GFI+ IE+  V EE
Sbjct  179  LINFFKNPVVVHHPKGHTVPRLDDKSLEKVTGFIETIEQHLVSEE  223



>ref|XP_009109248.1| PREDICTED: UPF0483 protein AGAP003155-like [Brassica rapa]
 emb|CDY24838.1| BnaA08g14720D [Brassica napus]
Length=235

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 163/220 (74%), Gaps = 5/220 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTSAEI+K  + +WP++V+DRLDL FLDAPFP QGKS V+GIFDPPY
Sbjct  8    IVRKPRFLCLHGFRTSAEIMKIQLHKWPKAVIDRLDLVFLDAPFPCQGKSDVDGIFDPPY  67

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ ++EF EY  FE CLEY+ED M+K GPFDG++GFSQG +L+  +PG+Q +G AL 
Sbjct  68   YEWFQFNEEFIEYENFENCLEYLEDRMIKLGPFDGLIGFSQGGILSGGLPGLQAKGIALQ  127

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKF+III GA F        K+  +A+S  +  PSLHFLGETDF K  G  L+E F
Sbjct  128  KVPKIKFIIIIGGAMFRS-----TKVVEDAYSFSIDTPSLHFLGETDFLKPYGIKLIESF  182

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             +P ++HHPKGH VPR+DE+S+  +  F++ IE + + EE
Sbjct  183  KNPVVVHHPKGHIVPRIDEKSLEKVTAFLETIENLVMMEE  222



>emb|CDY08935.1| BnaC08g11650D [Brassica napus]
Length=235

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 163/220 (74%), Gaps = 5/220 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTSAEI+K  + +WP++V+DRLDL FLDAPFP QGKS V+G+FDPPY
Sbjct  8    IVRKPRFLCLHGFRTSAEIMKIQLHKWPKAVIDRLDLVFLDAPFPCQGKSDVDGVFDPPY  67

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ ++EF EY  FE CLEY+ED M+K GPFDG++GFSQG +L+  +PG+Q +G AL 
Sbjct  68   YEWFQFNEEFIEYENFENCLEYLEDRMIKLGPFDGLIGFSQGGILSGGLPGLQAKGIALQ  127

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            K  KIKF+III GA F        K+  +A+S  +  PSLHFLGETDF K  G  L+E F
Sbjct  128  KVPKIKFIIIIGGAMFRS-----TKVVEDAYSFSIDTPSLHFLGETDFLKPYGIKLIESF  182

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
             +P ++HHPKGH VPR+DE+S+  +  F++ IE + + EE
Sbjct  183  KNPVVVHHPKGHIVPRIDEKSLEKVTAFLETIENLVMMEE  222



>ref|XP_002446578.1| hypothetical protein SORBIDRAFT_06g018330 [Sorghum bicolor]
 gb|EES10906.1| hypothetical protein SORBIDRAFT_06g018330 [Sorghum bicolor]
Length=261

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 144/188 (77%), Gaps = 5/188 (3%)
 Frame = +1

Query  238  RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIED  417
            +WP  V  RLDL F DAPFP +GKS V+GIFDPPY+EWFQ DK F EY  F++CL YIE+
Sbjct  47   KWPADVTARLDLVFADAPFPTEGKSDVDGIFDPPYYEWFQFDKSFMEYRNFDKCLAYIEE  106

Query  418  YMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPK  597
             M+++GPFDG++GFSQG+ L+AA+PG+Q +G AL++  KIK++III     GG KF  P 
Sbjct  107  LMIRDGPFDGLMGFSQGSYLSAALPGLQEQGLALTRVPKIKYLIII-----GGGKFQSPT  161

Query  598  LAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTM  777
            +A  A+++ + CPSLHF+G+ DF K  G+ L+E FVDP LI HPKGHTVPRLD+ES+  M
Sbjct  162  VAEKAYANKVACPSLHFIGDNDFLKVHGEKLIESFVDPFLIRHPKGHTVPRLDDESLAVM  221

Query  778  LGFIDKIE  801
            L F++KIE
Sbjct  222  LRFLEKIE  229



>emb|CAN80597.1| hypothetical protein VITISV_002641 [Vitis vinifera]
Length=787

 Score =   238 bits (608),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 155/212 (73%), Gaps = 19/212 (9%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            +  +K R +CLHGFRTSA+IL+K V +WPESVL ++DL F DAPFP+ GKS VEGIFDPP
Sbjct  104  VAMRKPRFLCLHGFRTSADILQKQVGKWPESVLGQVDLVFADAPFPSNGKSDVEGIFDPP  163

Query  340  YFEWFQAD--------------kefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVL  477
            Y+EWFQ +              +EF EY  F+ECL YIEDYM+K+GPFDG+LGFSQGA+L
Sbjct  164  YYEWFQFNKVFFEGKFVGFGLRQEFTEYTNFDECLAYIEDYMIKHGPFDGLLGFSQGAIL  223

Query  478  AAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGE  657
            +AA+PG+Q +G AL+K  KI F+III GAK        P LA  A+S  + C S+HFLGE
Sbjct  224  SAALPGLQAKGLALTKVPKINFLIIIGGAKLKS-----PSLAEKAYSSTIQCQSIHFLGE  278

Query  658  TDFQKEEGKLLLECFVDPHLIHHPKGHTVPRL  753
            TDF ++ G  LLE FVDP +IHHPKGHTVPRL
Sbjct  279  TDFLRQYGIELLESFVDPLVIHHPKGHTVPRL  310



>ref|XP_009409293.1| PREDICTED: dihydrofolate reductase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=255

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 150/199 (75%), Gaps = 6/199 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            H++ R +CLHGFRTS  I++  V+ +WPE V+ RLDL F DAPFPA+GKS VEGIF PPY
Sbjct  12   HRRPRFLCLHGFRTSGAIMRSQVVGKWPEEVIGRLDLVFPDAPFPAEGKSDVEGIFPPPY  71

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ DK+F EY   ++C  YIED M+++GPFDG++GFSQGA+L+AA+ G+Q  G+AL+
Sbjct  72   YEWFQFDKDFSEYRNLDKCFAYIEDLMIEHGPFDGLMGFSQGAILSAALVGLQARGSALT  131

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            +  K+K +III GAKF       P +A  A++  + C SLHFLG+ DF K+ G+ LLE F
Sbjct  132  RVPKVKHLIIIGGAKFQS-----PAVAEKAYASAVDCTSLHFLGDMDFLKKHGEALLESF  186

Query  703  VDPHLIHHPKGHTVPRLDE  759
            ++P++I HPKGHTVPRL E
Sbjct  187  INPYVIRHPKGHTVPRLGE  205



>ref|XP_004164784.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus]
Length=217

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 152/221 (69%), Gaps = 4/221 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M + + I +K +++CLHGFRTS  IL+K V RWP S+L +  LHF+D PFP++G+S VEG
Sbjct  1    MASERKIERKPKILCLHGFRTSGAILRKQVQRWPTSILHQFHLHFIDGPFPSKGRSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF   ++       E  LE+IE YM ++GPFDG+LGFSQGAVL+AA+  +Q 
Sbjct  61   IYDPPYFEWFGTSEDPTSCENLESSLEFIESYMAEHGPFDGLLGFSQGAVLSAALALLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKFVI+ISG+K           A  A+S  + CPSLHFL E DF    G 
Sbjct  121  RGVALTKVPKIKFVIVISGSKLQSSSLA----ARIAYSTSIACPSLHFLSEEDFLMPSGL  176

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             LLE FV+P +I+H KGH VPRLDE+S+  + GFI K+ K+
Sbjct  177  KLLESFVEPSIINHSKGHIVPRLDEKSLKIVDGFIQKVSKL  217



>ref|XP_004152616.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus]
Length=217

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 152/221 (69%), Gaps = 4/221 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M + + I +K +++CLHGFRTS  IL+K V RWP S+L +  LHF+D PFP++G+S VEG
Sbjct  1    MASERKIERKPKILCLHGFRTSGAILRKQVQRWPTSILHQFHLHFIDGPFPSKGRSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF   ++       E  LE+IE YM ++GPFDG+LGFSQGA+L+AA+  +Q 
Sbjct  61   IYDPPYFEWFGTSEDPTSCENLESSLEFIESYMAEHGPFDGLLGFSQGAMLSAALALLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKFVI+ISG+K           A  A+S  + CPSLHFL E DF    G 
Sbjct  121  RGVALTKVPKIKFVIVISGSKLQSSSLA----ARIAYSTSIACPSLHFLSEEDFLMPSGL  176

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             LLE FV+P +I+H KGH VPRLDE+S+  + GFI K+ K+
Sbjct  177  KLLESFVEPSIINHSKGHIVPRLDEKSLKIVDGFIQKVSKL  217



>ref|XP_004975783.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X2 [Setaria 
italica]
Length=321

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 152/228 (67%), Gaps = 20/228 (9%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             ++ R +CLHGFRTSAEIL+K V+ RWP  V  RLDL F DAPFPA+GKS V+GIFDPPY
Sbjct  75   RRRPRFLCLHGFRTSAEILRKQVVGRWPADVTARLDLVFADAPFPAEGKSDVDGIFDPPY  134

Query  343  FEWFQ------ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ-  501
            +EWFQ        ++  +    + C  Y+E+ M++ GPFDG+LGFSQGAV++A + G+Q 
Sbjct  135  YEWFQFAGEISGGQDPIKCRNLDRCFSYVEELMIRQGPFDGLLGFSQGAVVSAVLAGLQE  194

Query  502  -------REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGET  660
                   R+G A +  AK+K VI+ISG K   P       AA AF+  + CPSLHF+G+ 
Sbjct  195  QTRLCVFRQGLAFTGVAKVKCVIVISGGKIQAPV-----AAARAFNSKIMCPSLHFIGDD  249

Query  661  DFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            DF K   + L+E F DP +I HP GHT+P LDE+ + TML F+DKIE+
Sbjct  250  DFVKVHSEELVEAFADPLVIRHPCGHTIPNLDEKGLQTMLTFLDKIER  297



>ref|XP_004975784.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X3 [Setaria 
italica]
Length=315

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 151/222 (68%), Gaps = 14/222 (6%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             ++ R +CLHGFRTSAEIL+K V+ RWP  V  RLDL F DAPFPA+GKS V+GIFDPPY
Sbjct  75   RRRPRFLCLHGFRTSAEILRKQVVGRWPADVTARLDLVFADAPFPAEGKSDVDGIFDPPY  134

Query  343  FEWFQ------ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            +EWFQ        ++  +    + C  Y+E+ M++ GPFDG+LGFSQGAV++A + G+Q 
Sbjct  135  YEWFQFAGEISGGQDPIKCRNLDRCFSYVEELMIRQGPFDGLLGFSQGAVVSAVLAGLQE  194

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFL--GETDFQKEE  678
            +G A +  AK+K VI+ISG K        P  AA AF+  + CPSLHF+  G+ DF K  
Sbjct  195  QGLAFTGVAKVKCVIVISGGKIQA-----PVAAARAFNSKIMCPSLHFIVCGDDDFVKVH  249

Query  679  GKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
             + L+E F DP +I HP GHT+P LDE+ + TML F+DKIE+
Sbjct  250  SEELVEAFADPLVIRHPCGHTIPNLDEKGLQTMLTFLDKIER  291



>gb|KCW62058.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=181

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  9    KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  68

Query  352  FQ--ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            FQ    ++  EY  +EEC+ YIED+MV+NGPFDG+LGFSQGA L A +PGMQ EG AL+K
Sbjct  69   FQFQVHQDHTEYQNYEECIAYIEDFMVQNGPFDGLLGFSQGASLCATLPGMQEEGVALTK  128

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLG  654
              KIKFVIIISGAK GG K+  PKLAANAF+ P+ CPSLHF+G
Sbjct  129  VPKIKFVIIISGAKAGGAKYTAPKLAANAFAAPIKCPSLHFIG  171



>ref|XP_006394038.1| hypothetical protein EUTSA_v10005471mg [Eutrema salsugineum]
 gb|ESQ31324.1| hypothetical protein EUTSA_v10005471mg [Eutrema salsugineum]
Length=253

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 162/235 (69%), Gaps = 12/235 (5%)
 Frame = +1

Query  121  LSSFLHLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPA  300
            ++S  H     N++ + K  ++CLHGFRTS  IL+ L+ +WP++VL  LDL FLD PFPA
Sbjct  23   MASANHRSGTENRLRNPK--ILCLHGFRTSGRILQALIGKWPDTVLRDLDLDFLDGPFPA  80

Query  301  QGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLA  480
             GKS VE  FDP     ++          FEECL+YIEDYM+KNGPFDG+LGFSQGA L+
Sbjct  81   TGKSDVERFFDPRITSEYR---------NFEECLDYIEDYMIKNGPFDGLLGFSQGAFLS  131

Query  481  AAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGET  660
            AA+PGMQ +G AL+K  K+KF++IISGAK  G  FG PK A  AFS P+ CPSLHF+GE 
Sbjct  132  AAIPGMQEKGTALTKVPKVKFLVIISGAKIPGLVFGQPKAAVGAFSSPVRCPSLHFIGER  191

Query  661  DFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGT-MLGFIDKIEKMAVQEE  822
            DF K EG++L + FV+P +IHH  GHT+P+L+ ++  T +L F  +I ++   E 
Sbjct  192  DFLKTEGEVLAKSFVEPVVIHHTSGHTIPKLETKAEETVVLSFFQRIRQILSDES  246



>ref|XP_009391336.1| PREDICTED: UPF0483 protein AGAP003155-like [Musa acuminata subsp. 
malaccensis]
Length=243

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = +1

Query  142  KMENNQIIHKKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTV  318
            + E+ +   +K R +CLHGFRTS EI++ +LV +WPE V+ RLDL F DAPFPA GKS V
Sbjct  6    EQESGKSGRRKPRFLCLHGFRTSGEIMRAQLVAKWPEQVISRLDLVFPDAPFPAGGKSEV  65

Query  319  EGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGM  498
            +GIF PPY+EW+Q DK+F  Y   ++    +E+ M++ GPFDG++GFSQGA+L+AA+  +
Sbjct  66   DGIFPPPYYEWYQYDKDFMVYTNLDKAFARVEELMIEQGPFDGLMGFSQGAILSAALASL  125

Query  499  QREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEE  678
            Q +G AL+   K+K+++ + GA F  P+  V ++ + A    + C SLHF+GE DF K+ 
Sbjct  126  QSKGLALTTVPKLKYLVFMGGAMFKAPEV-VERVYSAA---KIDCTSLHFIGEKDFLKKN  181

Query  679  GKLLLECFVDPHLIHHPKGHTVPRL-DEESVGTMLGFIDKIE  801
            G+ LL  FVDP+LI HP+GHTVPRL DEES+ TML F+ KIE
Sbjct  182  GEQLLGKFVDPYLIRHPRGHTVPRLDDEESLKTMLEFLQKIE  223



>ref|XP_004240026.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Solanum 
lycopersicum]
Length=221

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 158/229 (69%), Gaps = 12/229 (5%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            ME  Q   KK RV+CLHG  TSA I KK L L WP+ +LD+LDL FLDAPF  Q K  V 
Sbjct  1    MEKYQY-EKKPRVLCLHGHATSANIFKKELELGWPQYLLDKLDLVFLDAPFLLQDKVDVH  59

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
             IF PPY+EWFQ+ ++FKE Y FEEC++Y+E  M K GPFDGVLGFSQGAV+AA+MPGMQ
Sbjct  60   DIFYPPYYEWFQSTEDFKEIYNFEECIQYVEANMEKYGPFDGVLGFSQGAVIAASMPGMQ  119

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
            R+  AL+K  KIKFV++I+G KFGG + G           P+ CPSLHF+GE D      
Sbjct  120  RDRVALTKVPKIKFVMLIAGGKFGGIELGC----------PIECPSLHFIGEKDPHLLHE  169

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            + L  CFV+P +IH+P+GH VP LD E    ++ FI+K++K+ +  +GN
Sbjct  170  EELAGCFVNPVVIHYPEGHKVPNLDAERTEIVIEFINKVKKIKMPLQGN  218



>ref|XP_006280973.1| hypothetical protein CARUB_v10026973mg [Capsella rubella]
 gb|EOA13871.1| hypothetical protein CARUB_v10026973mg [Capsella rubella]
Length=205

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 141/194 (73%), Gaps = 1/194 (1%)
 Frame = +1

Query  79   ASNYFLGNKELREYLSSFLHLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESV  255
            +S+ F    E R  L   +    + +    K  R++CLHGFRTS  IL+ ++L +WPE+V
Sbjct  5    SSSCFQTAGEFRAGLRFKITAMAQGSHRKSKNPRILCLHGFRTSGRILRAIILNKWPETV  64

Query  256  LDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNG  435
            L  LDL FLDAPFPA GKS VE  FDPPY+EW+QA+KE KEY  FEECL Y+EDYM+KNG
Sbjct  65   LRNLDLDFLDAPFPATGKSDVERFFDPPYYEWYQANKELKEYKNFEECLAYVEDYMIKNG  124

Query  436  PFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAF  615
            PFDG+LGFSQGA L AA+PGMQ +G AL+K  K+KF++IISGAK  G  FG PK A NAF
Sbjct  125  PFDGLLGFSQGAFLTAAIPGMQEQGTALTKVPKVKFLVIISGAKLPGLIFGEPKAAVNAF  184

Query  616  SHPLHCPSLHFLGE  657
            S P+ CPSLHF+ +
Sbjct  185  SSPVRCPSLHFIAK  198



>ref|XP_004975782.1| PREDICTED: UPF0483 protein AGAP003155-like isoform X1 [Setaria 
italica]
Length=323

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 152/230 (66%), Gaps = 22/230 (10%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             ++ R +CLHGFRTSAEIL+K V+ RWP  V  RLDL F DAPFPA+GKS V+GIFDPPY
Sbjct  75   RRRPRFLCLHGFRTSAEILRKQVVGRWPADVTARLDLVFADAPFPAEGKSDVDGIFDPPY  134

Query  343  FEWFQ------ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ-  501
            +EWFQ        ++  +    + C  Y+E+ M++ GPFDG+LGFSQGAV++A + G+Q 
Sbjct  135  YEWFQFAGEISGGQDPIKCRNLDRCFSYVEELMIRQGPFDGLLGFSQGAVVSAVLAGLQE  194

Query  502  -------REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFL--G  654
                   R+G A +  AK+K VI+ISG K        P  AA AF+  + CPSLHF+  G
Sbjct  195  QTRLCVFRQGLAFTGVAKVKCVIVISGGKIQA-----PVAAARAFNSKIMCPSLHFIVCG  249

Query  655  ETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            + DF K   + L+E F DP +I HP GHT+P LDE+ + TML F+DKIE+
Sbjct  250  DDDFVKVHSEELVEAFADPLVIRHPCGHTIPNLDEKGLQTMLTFLDKIER  299



>ref|XP_009626526.1| PREDICTED: dihydrofolate reductase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=196

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 152/229 (66%), Gaps = 37/229 (16%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN   + KK RV+CLHG   SAEILKK + L WP++VL++LDL FL+ PF  Q K    
Sbjct  1    MENK--LEKKPRVLCLHGHGASAEILKKEMELGWPQTVLEKLDLVFLNGPFLLQDKVDSH  58

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GIF PPYFEWFQ DK++KE+Y F+EC+EY+E  M K GPFDGVLGFSQGAVL A+MPGMQ
Sbjct  59   GIFHPPYFEWFQNDKDYKEFYNFDECVEYVEANMEKYGPFDGVLGFSQGAVLTASMPGMQ  118

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
            R   AL+K   IKFVIIISGAKFGG + G+PKLAANAFS P+ CPSLHF           
Sbjct  119  RVKVALTKVPNIKFVIIISGAKFGGRELGLPKLAANAFSSPIECPSLHF-----------  167

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
                                   +D ESV T++ FI+K++K+ +Q +GN
Sbjct  168  -----------------------IDAESVETVIAFINKVKKIKMQLQGN  193



>ref|XP_004152615.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus]
Length=217

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 149/221 (67%), Gaps = 4/221 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +     +K +++CLHGFRTS  IL+K V RWP S+L +  LHF+D   P++GKS VEG
Sbjct  1    MASESKTERKPKILCLHGFRTSGAILRKQVQRWPTSILHQFHLHFIDDSIPSKGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF   ++   Y   E  +E+IE YM+++GPFDG+LGFSQGA+L+AA+  +Q 
Sbjct  61   IYDPPYFEWFGTSEDPTNYENLESSIEFIESYMLEHGPFDGLLGFSQGAMLSAALALLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKFVI+ISG+K           A   +S  + CPSLHFL E DF    G 
Sbjct  121  RGVALTKVPKIKFVIVISGSKLQSSSLA----ARIVYSTSIACPSLHFLSEEDFWMPSGL  176

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             LL+ FV+P +IHH KGH VPRLDE+S+  + GFI K+ K+
Sbjct  177  KLLQSFVEPLVIHHSKGHIVPRLDEKSLKIVNGFIQKVSKL  217



>gb|ACN39839.1| unknown [Picea sitchensis]
Length=250

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 147/212 (69%), Gaps = 5/212 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K LRV+CLHGFRTS   L+K + RW  S+ ++LD+ FLD P+PAQGKS +E IF  PYFE
Sbjct  3    KNLRVLCLHGFRTSGSFLQKQISRWDSSITEKLDMCFLDGPYPAQGKSEIEAIFPAPYFE  62

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F EY   ++   +I DYM KNGPFDG+LGFSQGA L+AA+ G QR+G  L   
Sbjct  63   WFQFEKDFTEYTNLDKAFAFIVDYMEKNGPFDGLLGFSQGATLSAALVGYQRKGLMLKNH  122

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              ++F+I ISG+KF       P++    +S P+ CP++H +G  D+ K  G+ L++ F +
Sbjct  123  PPVRFIISISGSKFRD-----PEMCEILYSPPIKCPTVHLIGAKDWLKLPGEELMQAFEN  177

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            P LI HP+GH VPRLD+E+VG + GF++ + K
Sbjct  178  PLLIAHPQGHLVPRLDKEAVGILNGFLESLMK  209



>gb|KCW62053.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=178

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 133/214 (62%), Gaps = 45/214 (21%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  9    KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  68

Query  352  FQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAA  531
            FQ                                                 +G AL+K  
Sbjct  69   FQFQV---------------------------------------------HQGVALTKVP  83

Query  532  KIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDP  711
            KIKFVIIISGAK GG K+  PKLAANAF+ P+ CPSLHF+GE DFQK EG  L++ FVDP
Sbjct  84   KIKFVIIISGAKAGGAKYTAPKLAANAFAAPIKCPSLHFIGEQDFQKTEGLALIDSFVDP  143

Query  712  HLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
             +IHHPK HTVPRLD++SV     F++KI  +A 
Sbjct  144  LVIHHPKAHTVPRLDDQSVKIAQNFVEKILNLAT  177



>ref|XP_009626528.1| PREDICTED: uncharacterized protein LOC104117218 isoform X2 [Nicotiana 
tomentosiformis]
Length=195

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 142/229 (62%), Gaps = 38/229 (17%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN     KK RV+CLHG   S EILKK + L WP+ VL++LDL FL+ PF  QGK    
Sbjct  1    MENKS--EKKPRVLCLHGHGASGEILKKEMELGWPQIVLEKLDLVFLNGPFLLQGKVDSH  58

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
             IF PPY+EWFQ                                   +GA++ A MPGMQ
Sbjct  59   DIFHPPYYEWFQ-----------------------------------KGAIVTATMPGMQ  83

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
            RE   L+K   IKFVIIISG KFG P+FG PKLAANA+S P+ CPSLHF+GE + +K   
Sbjct  84   RERVVLTKIPNIKFVIIISGFKFGAPEFGCPKLAANAYSSPIECPSLHFIGEKETKKTSE  143

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
            + L++CFV+P +IHHP+GH VP LD ESV T++ FI+K++K+ +  +GN
Sbjct  144  EELVKCFVNPVVIHHPEGHKVPNLDAESVKTVIAFINKVKKIKMALQGN  192



>ref|XP_011097506.1| PREDICTED: UPF0483 protein GA18864-like isoform X2 [Sesamum indicum]
Length=189

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   I +K R++CLH FRTS  I + ++ RWPE+V   LDL F DAPFPA+GKS VEG
Sbjct  1    MENE--IRRKPRILCLHSFRTSGRIFQMMISRWPENVTGELDLVFADAPFPAEGKSDVEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF++DKEFKE+Y FE+CL Y+ED+M+ +GPFDGVLGFSQGA LAAA+PGMQ+
Sbjct  59   IYDPPYFEWFKSDKEFKEFYDFEKCLNYLEDFMLTHGPFDGVLGFSQGATLAAALPGMQK  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQK  672
            EG ALSK   IKF+IIISG KFGG KFG+PKLAA AFS P++CPSLH +   D  K
Sbjct  119  EGVALSKVPTIKFLIIISGGKFGGAKFGLPKLAARAFSSPVNCPSLHIIAGEDADK  174



>gb|KEH28114.1| dihydrofolate reductase-like protein [Medicago truncatula]
Length=175

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 134/172 (78%), Gaps = 6/172 (3%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN +   +K R++CLHGFRTS EI+KK + +WP++VLD+LDL F+DAPFP  GKS VEG
Sbjct  1    MENEEK-GRKPRILCLHGFRTSGEIMKKQIHKWPQNVLDKLDLVFVDAPFPCNGKSDVEG  59

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IFDPPY+EWFQ +KEF EY  F+ECL+YIEDYM+K+GPFDG+LGFSQGA+L+  +PG+Q 
Sbjct  60   IFDPPYYEWFQFNKEFTEYTNFDECLQYIEDYMIKHGPFDGLLGFSQGAILSGGLPGLQE  119

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGET  660
            +G AL+K  K+KF+III     GG KF  P +   A+S  + CPSLHFLG +
Sbjct  120  KGVALTKVPKVKFLIII-----GGAKFRAPSVVEKAYSSQIGCPSLHFLGTS  166



>ref|XP_008669333.1| PREDICTED: ovarian cancer-associated gene 2 protein-like [Zea 
mays]
 tpg|DAA37555.1| TPA: hypothetical protein ZEAMMB73_665799 [Zea mays]
Length=300

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 140/209 (67%), Gaps = 7/209 (3%)
 Frame = +1

Query  184  VCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQ-  357
            +CLHGFRTS EI+++ V+ RW   V  RLDL F D PFPA+G S V G FDPPY+EW Q 
Sbjct  81   LCLHGFRTSGEIMRRQVVGRWAPEVTARLDLVFADGPFPAEGASPVAGAFDPPYYEWCQF  140

Query  358  ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKI  537
              ++F      + C  Y+E+ M + GPFDG+LGFSQGA L+A + G+Q +G AL+  A++
Sbjct  141  VGEDFLSCRNLDRCFSYLEELMAREGPFDGLLGFSQGAGLSAVLAGLQEQGLALTGVAQV  200

Query  538  KFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHL  717
            K VI+I+GAK        P   A AF   + CPSLHF+GE DF K   + L+  F DP +
Sbjct  201  KCVIVIAGAKIR-----APAAVARAFDTKITCPSLHFIGEEDFVKVHSEELVRAFADPLV  255

Query  718  IHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            I HP+GHTVP+LDE+ + TML ++DKIE+
Sbjct  256  IRHPRGHTVPKLDEKGLQTMLTYLDKIER  284



>gb|AFK42671.1| unknown [Lotus japonicus]
Length=223

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 148/221 (67%), Gaps = 27/221 (12%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME++ +   K R++CLHG   S E LK+LVL+WPESV+ +LDL FL+ PFP         
Sbjct  1    MEDHSL--NKPRILCLHGHTRSGEFLKRLVLQWPESVIQKLDLVFLNGPFP---------  49

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            + +P  FEWFQA+++F EY  FEECL YIEDYMVKNGPFDG LG SQG  L         
Sbjct  50   MLEPDSFEWFQANEDFTEYSNFEECLAYIEDYMVKNGPFDGFLGHSQGVTLG--------  101

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFL-GETDFQKEEG  681
                  K  KIKFVI+ S AK GG KF  P+LA+NAFS P+ CPSLHF+ GETD    E 
Sbjct  102  ------KVDKIKFVILSSAAKLGGEKFAAPELASNAFSKPIECPSLHFIGGETDKAMPES  155

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEE-SVGTMLGFIDKIE  801
              LL+ FV+P +I+H +GHTVPRLD++ S+G MLG ID I+
Sbjct  156  IALLKEFVEPVVIYHTQGHTVPRLDDDKSLGIMLGLIDTIQ  196



>ref|XP_006360404.1| PREDICTED: UPF0483 protein GA18864-like [Solanum tuberosum]
Length=179

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            MEN Q   KK RV+CLHG  TSA ILKK L L WP+ +LD+LDL FLDAPF  Q K    
Sbjct  1    MENYQY-EKKPRVMCLHGHATSANILKKELELGWPQYLLDKLDLVFLDAPFLLQDKVDAH  59

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
             IF PPY+EWFQA +++KE Y FEEC++Y+E  MVK GPFDGVLG SQGAV+AA+MPGMQ
Sbjct  60   DIFYPPYYEWFQATEDYKEIYNFEECIQYVEANMVKYGPFDGVLGLSQGAVVAASMPGMQ  119

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD  663
            R+  AL+K  KIKFV++I+G+KFGG   G PKLA+NAF++P+ C SLHF+ E D
Sbjct  120  RDRVALTKVPKIKFVMLIAGSKFGGISLGCPKLASNAFAYPIECTSLHFIAEKD  173



>dbj|BAJ86131.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 136/204 (67%), Gaps = 5/204 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             KKL+V+CLHGFRTS   LKK + +W  S+L + D  F D  FPA GKS +EGIF PPYF
Sbjct  4    EKKLKVLCLHGFRTSGGFLKKQISKWHPSILQQFDTVFPDGQFPAGGKSDIEGIFPPPYF  63

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  L+ 
Sbjct  64   EWFQFDKDFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKVLND  123

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
               IKF++ +SG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F 
Sbjct  124  HPPIKFMVSVSGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKVPSEELASAFA  178

Query  706  DPHLIHHPKGHTVPRLDEESVGTM  777
            DP +I HP+GHTVPRLDE SV  +
Sbjct  179  DPLIIRHPQGHTVPRLDEASVKQL  202



>dbj|BAJ98930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 135/204 (66%), Gaps = 5/204 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             KKL+V+CLHGFRTS   LKK + +W  S+L + D  F D  FPA GKS +EGIF PPYF
Sbjct  4    EKKLKVLCLHGFRTSGGFLKKQISKWHPSILQQFDTVFPDGQFPAGGKSDIEGIFPPPYF  63

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  L+ 
Sbjct  64   EWFQFDKDFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKVLND  123

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
               IKF++  SG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F 
Sbjct  124  HPPIKFMVSASGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKVPSEELASAFA  178

Query  706  DPHLIHHPKGHTVPRLDEESVGTM  777
            DP +I HP+GHTVPRLDE SV  +
Sbjct  179  DPLIIRHPQGHTVPRLDEASVKQL  202



>gb|EMT12142.1| Calmodulin-related protein [Aegilops tauschii]
Length=418

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 140/211 (66%), Gaps = 9/211 (4%)
 Frame = +1

Query  136  HLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKST  315
            HL ME      KKL+V+CLHGFRTS   LKK + +W  S+L + D  F D  FPA GKS 
Sbjct  169  HLHMEQ----EKKLKVLCLHGFRTSGGFLKKQISKWHPSILQQFDTVFPDGQFPAGGKSD  224

Query  316  VEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            +EGIF PPYFEWFQ DK+F EY   EEC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G
Sbjct  225  IEGIFPPPYFEWFQFDKDFTEYTNLEECIAYLCDYMVKNGPFDGLLGFSQGATLSALLIG  284

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKE  675
             Q +G AL+    IKF++ +SG+KF       P +   A+  P+   S+HF+GE D+ K 
Sbjct  285  YQAQGKALNDHPPIKFMVSVSGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKV  339

Query  676  EGKLLLECFVDPHLIHHPKGHTVPRLDEESV  768
              + L   F DP +I HP+GHTVPRLDE SV
Sbjct  340  PSEELASAFADPLIIRHPQGHTVPRLDEASV  370



>ref|XP_004164783.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus]
Length=217

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 146/221 (66%), Gaps = 4/221 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +     +K + +CLHGFRTS  IL+K V RWP SVL +  LHF+D   P++GKS  EG
Sbjct  1    MASESKTERKPKTLCLHGFRTSGAILRKQVQRWPTSVLHQFHLHFIDDSIPSKGKSDFEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF   ++   Y   E  +E+IE YM+++GPFDG+LGFSQGA+L+AA+  +Q 
Sbjct  61   IYDPPYFEWFGTSEDPTNYENLESSIEFIESYMLEHGPFDGLLGFSQGAMLSAALALLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
             G AL+K  KIKFVI+IS +K           A   +S  + CPSLHFL E DF    G 
Sbjct  121  RGVALTKVPKIKFVIVISSSKLQSSSLA----ARIVYSTSIACPSLHFLSEEDFWMPSGL  176

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
             LL+ FV+P +IHH KGH VPRLDE+S+  + GFI K+ K+
Sbjct  177  KLLQSFVEPLVIHHSKGHIVPRLDEKSLKIVNGFIQKVSKL  217



>dbj|BAC10351.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30292.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG90126.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67847.1| hypothetical protein OsJ_25642 [Oryza sativa Japonica Group]
Length=247

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 136/205 (66%), Gaps = 5/205 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            + KK +V+CLHGFRTS   LKK + +W  S+  + D+ F D  FPA GKS +EGIF PPY
Sbjct  3    LDKKFKVLCLHGFRTSGSFLKKQISKWNPSIFQQFDMVFPDGIFPAGGKSEIEGIFPPPY  62

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            FEWFQ +K+F EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  L+
Sbjct  63   FEWFQFNKDFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKVLN  122

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
                IKF++ I+G+KF       P +   A+  P+   S+HF+GE D+ K   + L   F
Sbjct  123  DHPPIKFMVSIAGSKFRD-----PSICNVAYKDPIKVKSVHFIGEKDWLKVPSEELAAAF  177

Query  703  VDPHLIHHPKGHTVPRLDEESVGTM  777
             DP +I HP+GHTVPRLDE SV  +
Sbjct  178  EDPVIIRHPQGHTVPRLDEASVKQL  202



>ref|XP_002964600.1| hypothetical protein SELMODRAFT_82287 [Selaginella moellendorffii]
 gb|EFJ34933.1| hypothetical protein SELMODRAFT_82287 [Selaginella moellendorffii]
Length=211

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 141/206 (68%), Gaps = 6/206 (3%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E N     KLRV+CLHGFRTS  IL+K + +W  S+ + LDL FLDAP+PA+GKS VEG 
Sbjct  4    ERNLGERTKLRVLCLHGFRTSGSILEKQLSKWSSSIHELLDLTFLDAPYPAKGKSDVEGF  63

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            F PPY+EWFQ + +F EY  F+E +++I ++M  NGPFDG+LGFSQG++L++A+ GMQ +
Sbjct  64   FPPPYYEWFQYNHDFTEYTGFDETVQFIANFMENNGPFDGLLGFSQGSILSSALVGMQEK  123

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+    +KFVI +SGAK    KF      A  +S  +  PS+H LG+ D+ +  G+ 
Sbjct  124  GKALTGIPPVKFVISVSGAKLIASKF------AFVYSDGIRRPSVHVLGDKDWLRTPGEE  177

Query  688  LLECFVDPHLIHHPKGHTVPRLDEES  765
            LL+ +  P +I HPKGHTVPRL   S
Sbjct  178  LLKAYESPLVIRHPKGHTVPRLGNTS  203



>ref|XP_002988794.1| hypothetical protein SELMODRAFT_128834 [Selaginella moellendorffii]
 gb|EFJ10056.1| hypothetical protein SELMODRAFT_128834 [Selaginella moellendorffii]
Length=211

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 141/206 (68%), Gaps = 6/206 (3%)
 Frame = +1

Query  148  ENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGI  327
            E N     KLRV+CLHGFRTS  IL+K + +W  S+ + LDL FLDAP+PA+GKS VEG 
Sbjct  4    ERNLGERTKLRVLCLHGFRTSGSILEKQLSKWSSSIHELLDLTFLDAPYPAKGKSDVEGF  63

Query  328  FDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            F PPY+EWFQ + +F EY  F+E +++I ++M  NGPFDG+LGFSQG++L++A+ GMQ +
Sbjct  64   FPPPYYEWFQYNHDFTEYTGFDETVQFIANFMENNGPFDGLLGFSQGSILSSALVGMQEK  123

Query  508  GAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
            G AL+    +KFVI +SGAK    KF      A  +S  +  PS+H LG+ D+ +  G+ 
Sbjct  124  GKALTGIPPVKFVISVSGAKLIASKF------AFVYSDGIRRPSVHVLGDKDWLRTPGEE  177

Query  688  LLECFVDPHLIHHPKGHTVPRLDEES  765
            LL+ +  P +I HPKGHTVPRL   S
Sbjct  178  LLKAYESPLVIRHPKGHTVPRLGNTS  203



>ref|NP_001031707.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84896.1| uncharacterized protein AT4G24380 [Arabidopsis thaliana]
Length=171

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 5/164 (3%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+K  + +WP+SV+DRLDL FLDAPFP QGKS VEGIFDPPY
Sbjct  8    IARKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAPFPCQGKSDVEGIFDPPY  67

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  FE+CLEY+ED M+K GPFDG++GFSQGA+L+  +PG+Q +G A  
Sbjct  68   YEWFQFNKEFTEYTNFEKCLEYLEDRMIKLGPFDGLIGFSQGAILSGGLPGLQAKGIAFQ  127

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLG  654
            K  KIKFVIII     GG K    KLA NA+S  L   SLHFLG
Sbjct  128  KVPKIKFVIII-----GGAKLKSAKLAENAYSSSLETLSLHFLG  166



>gb|EMS55430.1| Calmodulin-related protein [Triticum urartu]
Length=428

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 138/211 (65%), Gaps = 9/211 (4%)
 Frame = +1

Query  136  HLKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKST  315
            H  ME      KKL+V+CLHGFRTS   LKK + +W  S+L + D  F D  FPA GKS 
Sbjct  179  HTHMEQ----EKKLKVLCLHGFRTSGGFLKKQISKWHPSILQQFDTVFPDGQFPAGGKSD  234

Query  316  VEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            +EGIF PPYFEWFQ DK+F EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G
Sbjct  235  IEGIFPPPYFEWFQFDKDFTEYTNLDECIAYLCDYMVKNGPFDGLLGFSQGATLSALLIG  294

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKE  675
             Q +G  L+    IKF++ +SG+KF       P +   A+  P+   S+HF+GE D+ K 
Sbjct  295  YQAQGKVLNDHPPIKFMVSVSGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKV  349

Query  676  EGKLLLECFVDPHLIHHPKGHTVPRLDEESV  768
              + L   F DP +I HP+GHTVPRLDE SV
Sbjct  350  PSEELASAFADPLIIRHPQGHTVPRLDEASV  380



>gb|EEC82715.1| hypothetical protein OsI_27396 [Oryza sativa Indica Group]
Length=247

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 135/205 (66%), Gaps = 5/205 (2%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            + KK +V+CLHGFRTS   LKK + +W  S+  + D+ F D  FPA GKS +EGIF PPY
Sbjct  3    LDKKFKVLCLHGFRTSGSFLKKQISKWNPSIFQQFDMVFPDGIFPAGGKSEIEGIFPPPY  62

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            FEWFQ +K+F EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  L+
Sbjct  63   FEWFQFNKDFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKVLN  122

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
                IKF++ I+G+KF       P +   A+  P+   S+HF+GE D+ K   + L   F
Sbjct  123  DHPPIKFMVSIAGSKFRD-----PSICNVAYKDPIKVKSVHFIGEKDWLKVPSEELAAAF  177

Query  703  VDPHLIHHPKGHTVPRLDEESVGTM  777
             DP +  HP+GHTVPRLDE SV  +
Sbjct  178  EDPVITRHPQGHTVPRLDEASVKQL  202



>ref|XP_003624798.1| Dihydrofolate reductase [Medicago truncatula]
 gb|AES81016.1| serine hydrolase [Medicago truncatula]
Length=257

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 135/210 (64%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +KL+++CLHGFRTS   +KK + +W  S+  +  L F D  FPA GKS +EGIF PPYFE
Sbjct  7    RKLKILCLHGFRTSGSFIKKQISKWDPSIFSQFHLEFPDGKFPAGGKSDIEGIFPPPYFE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DK+F  Y   +EC+ Y+ +Y++ NGPFDG LGFSQGA L+A + G Q +G  L + 
Sbjct  67   WFQFDKDFTVYTNLDECISYLTEYIIANGPFDGFLGFSQGATLSALLIGYQAQGKLLKEH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F  
Sbjct  127  PPIKFLVSISGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKIPSEELASAFDK  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE S G +  F+ +I
Sbjct  182  PLIIRHPQGHTVPRLDEVSTGQLQNFVAEI  211



>ref|NP_001060690.2| Os07g0687100 [Oryza sativa Japonica Group]
 dbj|BAF22604.2| Os07g0687100 [Oryza sativa Japonica Group]
Length=245

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 135/205 (66%), Gaps = 7/205 (3%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            + KK +V+CLHGFRTS   LKK + +W  S+  + D+ F D  FPA GKS +EGIF PPY
Sbjct  3    LDKKFKVLCLHGFRTSGSFLKKQISKWNPSIFQQFDMVFPDGIFPAGGKSEIEGIFPPPY  62

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            FEWFQ +K+F EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L  ++ G Q +G  L+
Sbjct  63   FEWFQFNKDFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATL--SLIGYQAQGKVLN  120

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
                IKF++ I+G+KF       P +   A+  P+   S+HF+GE D+ K   + L   F
Sbjct  121  DHPPIKFMVSIAGSKFRD-----PSICNVAYKDPIKVKSVHFIGEKDWLKVPSEELAAAF  175

Query  703  VDPHLIHHPKGHTVPRLDEESVGTM  777
             DP +I HP+GHTVPRLDE SV  +
Sbjct  176  EDPVIIRHPQGHTVPRLDEASVKQL  200



>tpg|DAA37560.1| TPA: hypothetical protein ZEAMMB73_807797 [Zea mays]
Length=311

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 128/167 (77%), Gaps = 6/167 (4%)
 Frame = +1

Query  157  QIIHKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFD  333
            Q   ++ R +CLHGFRTS EI++K VL +WP  V  RLDL F DAPFPA+GKS VEGIFD
Sbjct  99   QGARRRPRFLCLHGFRTSGEIMRKQVLGKWPADVTARLDLVFADAPFPAEGKSDVEGIFD  158

Query  334  PPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGA  513
            PPY+EWFQ DK F EY  F++CL YIE+ M+K+GPFDG++GFSQG++L+AA+PG+Q +G 
Sbjct  159  PPYYEWFQFDKSFMEYRNFDKCLAYIEELMIKDGPFDGLMGFSQGSILSAALPGLQEQGL  218

Query  514  ALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLG  654
            AL++  K+K++III GAKF       P +A  A+++ + CPSLHF+G
Sbjct  219  ALTRVPKVKYLIIIGGAKFQS-----PTVAGKAYANKIACPSLHFIG  260



>tpg|DAA41804.1| TPA: hypothetical protein ZEAMMB73_848431 [Zea mays]
Length=244

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 131/203 (65%), Gaps = 5/203 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+ +V+CLHGFRTS   LKK + +W  S+L + ++ F D  FPA GKS +EGIF PPYFE
Sbjct  5    KRTKVLCLHGFRTSGAFLKKQISKWHPSILQQFEMVFPDGVFPAGGKSEIEGIFPPPYFE  64

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            W+Q + EF +Y   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L A + G Q +G  LS  
Sbjct  65   WYQFNMEFTDYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLLALLVGYQAQGKVLSDH  124

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKFV+ ISG KF       P +    +  P+   S+HF+GE D+ K   + L   F +
Sbjct  125  PPIKFVVSISGCKFKD-----PSICDVTYKDPIKVKSVHFIGEKDWLKVPSEELASAFDE  179

Query  709  PHLIHHPKGHTVPRLDEESVGTM  777
            P +I HP GHTVPRLD+ SV  +
Sbjct  180  PLIIRHPHGHTVPRLDDVSVKQL  202



>ref|NP_001144323.1| uncharacterized protein LOC100277218 [Zea mays]
 gb|ACG39526.1| hypothetical protein [Zea mays]
Length=244

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 137/210 (65%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+  V+CLHGFRTS   LKK + +W  S+  + ++ F D  FPA GKS +EGIF PPYFE
Sbjct  5    KRAEVLCLHGFRTSGSFLKKQISKWHPSIFQQFEMVFPDGLFPAGGKSEIEGIFPPPYFE  64

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  LS  
Sbjct  65   WFQFNKEFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKLLSDH  124

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F +
Sbjct  125  PPIKFMVSISGSKFRD-----PIICDVAYKDPIKVKSVHFIGEKDWLKVPSEELASAFDE  179

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLD+ SV  +  +  ++
Sbjct  180  PLIIRHPQGHTVPRLDDVSVKQLSEWSSRV  209



>ref|XP_004958754.1| PREDICTED: UPF0483 protein AGAP003155-like [Setaria italica]
Length=396

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 137/210 (65%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK +V+CLHGFRTS   LKK + +W  S+  + D+ F D  FPA GKS +EGIF PPYFE
Sbjct  157  KKAKVLCLHGFRTSGSFLKKQISKWHPSIFQQFDMVFPDGIFPAGGKSEIEGIFPPPYFE  216

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY   +EC+ Y+ DYMV+NGPF+G+LGFSQGA L+A + G Q +G  LS  
Sbjct  217  WFQFNKEFTEYTNLDECISYLCDYMVRNGPFEGLLGFSQGATLSALLIGYQAQGKVLSDH  276

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+   +   S+HF+GE D+ K   + L   F D
Sbjct  277  PPIKFMVSISGSKFRD-----PSICDIAYKDLIKVKSVHFIGEKDWLKVPSEELASAFDD  331

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLD+ SV  + G+   I
Sbjct  332  PLIIRHPQGHTVPRLDDASVKQLSGWSSSI  361



>ref|XP_006658157.1| PREDICTED: UPF0483 protein AGAP003155-like [Oryza brachyantha]
Length=398

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 140/208 (67%), Gaps = 9/208 (4%)
 Frame = +1

Query  157  QIIH----KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            +IIH    KK++V+CLHGFRTS   LKK + +W  S+L + D+ F D  FPA  KS +EG
Sbjct  149  KIIHMEHEKKVKVLCLHGFRTSGSFLKKQISKWHPSILQQFDMVFPDGIFPAGDKSEIEG  208

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IF PPYFEWFQ +K+F EY   +EC+ ++ DYM++NGPFDG+LGFSQGA L+A + G Q 
Sbjct  209  IFPPPYFEWFQFNKDFTEYTNLDECITHLCDYMMENGPFDGLLGFSQGATLSALLIGYQA  268

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G  L+    +KF++ I+G+KF       P + + A+  P+   S+HF+GE D+ K   +
Sbjct  269  QGKILNDHPPVKFMVSIAGSKFMD-----PSICSVAYKDPIKVKSVHFIGEKDWLKVPSE  323

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESV  768
             L   F DP +I HP+GHTVPRLDE SV
Sbjct  324  ELAAAFEDPVIIRHPQGHTVPRLDEASV  351



>ref|XP_009586875.1| PREDICTED: rhodanese-like domain-containing protein 6 [Nicotiana 
tomentosiformis]
Length=200

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 124/164 (76%), Gaps = 6/164 (4%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVL-RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             +K R +CLHGFRTS +ILKK V  +WP  V++ LDL F+DAPFP QGKS VEGIFDPPY
Sbjct  11   QRKPRFLCLHGFRTSGQILKKQVFDKWPTQVVENLDLVFVDAPFPCQGKSEVEGIFDPPY  70

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ +KEF EY  F++CL YIE+  +K+GPFDG+LGFSQGA+L+ A+PG+Q +G AL+
Sbjct  71   YEWFQFNKEFTEYQNFDKCLAYIEECFIKHGPFDGLLGFSQGAILSGALPGLQEKGVALT  130

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLG  654
            K  KIK++III GA+F         +A  A+S  + CPS+HFLG
Sbjct  131  KVPKIKYLIIIGGAQFKN-----ESVAEKAYSSSITCPSVHFLG  169



>ref|XP_002461247.1| hypothetical protein SORBIDRAFT_02g043510 [Sorghum bicolor]
 gb|EER97768.1| hypothetical protein SORBIDRAFT_02g043510 [Sorghum bicolor]
Length=414

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 134/200 (67%), Gaps = 5/200 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+ +V+CLHGFRTS   LKK + +W  S+  + ++ F D  FPA GKS +EGIF PPYFE
Sbjct  157  KRAKVLCLHGFRTSGSFLKKQISKWHPSIFQQFEMVFPDGIFPAGGKSEIEGIFPPPYFE  216

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  LS  
Sbjct  217  WFQFNKEFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKVLSDH  276

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F +
Sbjct  277  PPIKFMVSISGSKFRD-----PSICDVAYKDPIKVKSVHFIGEKDWLKVPSEELASAFDE  331

Query  709  PHLIHHPKGHTVPRLDEESV  768
            P +I HP+GHTVPRLD+ SV
Sbjct  332  PLIIRHPQGHTVPRLDDVSV  351



>ref|XP_010055417.1| PREDICTED: dihydrofolate reductase-like [Eucalyptus grandis]
 gb|KCW89970.1| hypothetical protein EUGRSUZ_A02175 [Eucalyptus grandis]
Length=257

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 136/210 (65%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++++CLHGFRTS   LKK + +W  S+    D+ F D  FPA GKS +EGIF PPYFE
Sbjct  10   KKMKILCLHGFRTSGSFLKKQISKWDPSIFAHFDMDFPDGLFPAGGKSDIEGIFPPPYFE  69

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F EY   EEC++Y+ +Y++  GPFDG+LGFSQGA L+A + G Q +G  L   
Sbjct  70   WFQFEKDFTEYTNLEECVKYLCEYIMSKGPFDGLLGFSQGATLSALLLGYQAQGKVLKDH  129

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              +KF I ISG+     KF  P +   A+  P+   S+HF+G+ D+ K   + L   F +
Sbjct  130  PPLKFFISISGS-----KFRTPDICDVAYKDPIKAKSVHFIGDKDWLKLPSQDLATAFDN  184

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE +V  M G+  +I
Sbjct  185  PLIIRHPQGHTVPRLDETTVVQMRGWTAEI  214



>ref|XP_004493280.1| PREDICTED: family of serine hydrolases 3-like [Cicer arietinum]
Length=405

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 136/210 (65%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++++CLHGFRTS   +KK + +W  S+  +  + F D  FPA GKS +EGIF PPYFE
Sbjct  157  KKMKILCLHGFRTSGSFIKKQISKWDPSIFSQFHMEFPDGKFPAGGKSDIEGIFPPPYFE  216

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DK+F +Y   EEC+ Y+ +Y++ NGPFDG LGFSQGA L+A + G Q +G  L + 
Sbjct  217  WFQFDKDFTKYTNLEECISYLTEYIIANGPFDGFLGFSQGATLSALLIGYQAQGKLLKEH  276

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F  
Sbjct  277  PPIKFLVSISGSKFRD-----PSICDVAYKEPIKAKSVHFIGEKDWLKIPSEELASAFHK  331

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE + G +  ++ +I
Sbjct  332  PLIIRHPQGHTVPRLDEVATGQLQNWVAEI  361



>tpg|DAA64212.1| TPA: calmodulin [Zea mays]
Length=396

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 134/200 (67%), Gaps = 5/200 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+ +V+CLHGFRTS   LKK + +W  S+  + ++ F D  FPA GKS +EGIF PPYFE
Sbjct  157  KRAKVLCLHGFRTSGSFLKKQISKWHPSIFQQFEMVFPDGLFPAGGKSEIEGIFPPPYFE  216

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  LS  
Sbjct  217  WFQFNKEFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKLLSNH  276

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F +
Sbjct  277  PPIKFMVSISGSKFRD-----PIICDVAYKDPIKVKSVHFIGEKDWLKVPSEELASAFDE  331

Query  709  PHLIHHPKGHTVPRLDEESV  768
            P +I HP+GHTVPRLD+ SV
Sbjct  332  PLIIRHPQGHTVPRLDDVSV  351



>gb|KCW62056.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=132

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  421  MVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKL  600
            MV+NGPFDG+LGFSQGA L A +PGMQ EG AL+K  KIKFVIIISGAK GG K+  PKL
Sbjct  1    MVQNGPFDGLLGFSQGASLCATLPGMQEEGVALTKVPKIKFVIIISGAKAGGAKYTAPKL  60

Query  601  AANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTML  780
            AANAF+ P+ CPSLHF+GE DFQK EG  L++ FVDP +IHHPK HTVPRLD++SV    
Sbjct  61   AANAFAAPIKCPSLHFIGEQDFQKTEGLALIDSFVDPLVIHHPKAHTVPRLDDQSVKIAQ  120

Query  781  GFIDKIEKMAV  813
             F++KI  +A 
Sbjct  121  NFVEKILNLAT  131



>ref|XP_010111313.1| hypothetical protein L484_027968 [Morus notabilis]
 gb|EXC30791.1| hypothetical protein L484_027968 [Morus notabilis]
Length=262

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 137/218 (63%), Gaps = 7/218 (3%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN     KK++++CLHGFRTS   L+K + +W  S+     L F D  FPAQGKS +EG
Sbjct  1    MENQN--EKKMKILCLHGFRTSGSFLQKQISKWDPSIFAHFQLDFPDGIFPAQGKSDIEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IF PPYFEWFQ  K+F EY   +EC+ Y+ DY+  NGP+DG+LGFSQGA LAA + G Q 
Sbjct  59   IFPPPYFEWFQFAKDFTEYMNLDECVSYLCDYITSNGPYDGLLGFSQGATLAALLLGYQA  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G  L +   +KF + ISG+     KF  P +   A+  P+   S+H +G  D+ K   +
Sbjct  119  QGKVLKEHPPLKFFVSISGS-----KFRTPAICDVAYKDPIKVKSIHLIGAKDWLKLPSQ  173

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             L   F +P +I HP+GHTVPRLD+E+V  +  + ++I
Sbjct  174  ELATSFDNPLIIRHPQGHTVPRLDDEAVKQLRRWTEEI  211



>ref|XP_007161838.1| hypothetical protein PHAVU_001G102300g [Phaseolus vulgaris]
 gb|ESW33832.1| hypothetical protein PHAVU_001G102300g [Phaseolus vulgaris]
Length=239

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 133/209 (64%), Gaps = 5/209 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++++CLHGFRTS   LKK + +W  S+  R D+ F D  +PA GKS +EGIF PPY+E
Sbjct  7    KKMKILCLHGFRTSGSFLKKQISKWDPSLFTRFDMEFPDGKYPAGGKSDIEGIFPPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F  Y+  EEC+ Y+ +Y+  NGPFDG LGFSQGA L+A + G Q +G  L   
Sbjct  67   WFQFEKDFTVYFNLEECISYLCEYITANGPFDGFLGFSQGATLSALLLGYQAQGKVLKDH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF I ISG+KF       P +   A+  P+   S+HF+G+ D+ K   + L   F  
Sbjct  127  PPIKFFISISGSKFRD-----PSICDVAYKDPIKAKSVHFIGDKDWLKLPSEDLASAFDK  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDK  795
            P ++ HP+GHTVPRLDE +   +  +I++
Sbjct  182  PLILRHPQGHTVPRLDEVTTNQLRNWINE  210



>ref|XP_003554076.1| PREDICTED: dihydrofolate reductase-like [Glycine max]
Length=268

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 133/207 (64%), Gaps = 5/207 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KKL+++CLHGFRTS   LKK + +W  S+  + D+ F D  +PA GKS +EGIF PPY+E
Sbjct  7    KKLKILCLHGFRTSGSFLKKQISKWDPSLFIQFDMVFPDGKYPAGGKSDIEGIFPPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F  Y+  EEC+ Y+ DY+  NGPFDG LGFSQGA L+A + G Q +G  L + 
Sbjct  67   WFQFEKDFTVYFNLEECISYLCDYITANGPFDGFLGFSQGATLSALLIGYQAQGKVLKEH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF I ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F  
Sbjct  127  PPIKFFISISGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKLPSEDLASAFDK  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFI  789
            P +I HP+GHTVPRLDE ++  +  +I
Sbjct  182  PFIIRHPQGHTVPRLDEVAISQLRKWI  208



>gb|KHN34600.1| Dihydrofolate reductase [Glycine soja]
Length=268

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 133/207 (64%), Gaps = 5/207 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KKL+++CLHGFRTS   LKK + +W  S+  + D+ F D  +PA GKS +EGIF PPY+E
Sbjct  7    KKLKILCLHGFRTSGSFLKKQISKWDPSLFIQFDMVFPDGKYPAGGKSDIEGIFPPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F  Y+  EEC+ Y+ DY+  NGPFDG LGFSQGA L+A + G Q +G  L + 
Sbjct  67   WFQFEKDFTVYFNLEECISYLCDYITANGPFDGFLGFSQGATLSALLIGYQAQGKVLKEH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF I ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F  
Sbjct  127  PPIKFFISISGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKLPSEDLASAFDK  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFI  789
            P +I HP+GHTVPRLDE ++  +  +I
Sbjct  182  PFIIRHPQGHTVPRLDEVAISQLRKWI  208



>gb|EYU20847.1| hypothetical protein MIMGU_mgv1a012528mg [Erythranthe guttata]
Length=248

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 135/211 (64%), Gaps = 5/211 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME  ++  KK +++CLHGFRTS   L K + +W  S+    D+ F D  FPA GKS +EG
Sbjct  1    MEAKEVAIKKKKILCLHGFRTSGSFLCKQISKWDPSIFAHFDMDFPDGIFPAGGKSDIEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IF PPYFEWFQ DKEF EY   +EC++Y+ DY+   GPF G+LGFSQGA L+A + G Q 
Sbjct  61   IFPPPYFEWFQFDKEFTEYTNLDECIDYLCDYITSKGPFHGLLGFSQGATLSALLLGYQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G  L +   ++  + ISG+KF       P +   A+  P++  S+HF+GE D+ K   +
Sbjct  121  QGKILKEHPPMELFVSISGSKFRQ-----PSICEVAYKDPINVKSVHFIGEKDWLKLPSE  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTM  777
             L   FVDP +I HP+GHTVPRLDE++V  +
Sbjct  176  ELASAFVDPLIIRHPQGHTVPRLDEDAVKKL  206



>gb|AFK38495.1| unknown [Medicago truncatula]
Length=257

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 132/210 (63%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +KL+++CLHGFRTS   +KK + +W  S+  +  L F D  FPA GKS +EGIF PPY E
Sbjct  7    RKLKILCLHGFRTSGSFIKKQISKWDPSIFSQFHLEFPDGKFPAGGKSDIEGIFPPPYLE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DK+F  Y   +EC+ Y+ +Y++ NGPFDG LGFSQGA L+A + G Q +G  L + 
Sbjct  67   WFQFDKDFTVYTNLDECISYLTEYIIANGPFDGFLGFSQGATLSALLIGYQAQGKLLKEH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F  
Sbjct  127  PPIKFLVSISGSKFRD-----PSICDVAYKDPIKAKSVHFIGEKDWLKIPFEELASAFDK  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+G TVPRLDE   G +  F+ +I
Sbjct  182  PLIIRHPQGRTVPRLDEVFTGQLQNFVAEI  211



>ref|XP_009419840.1| PREDICTED: dihydrofolate reductase-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 146/245 (60%), Gaps = 19/245 (8%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++V+CLHGFRTS   L+K + +W  S+     L F D  +PA GKS +EGIF PPYFE
Sbjct  6    KKMKVLCLHGFRTSGSFLRKQISKWDPSIFHHFHLDFPDGIYPAGGKSDIEGIFPPPYFE  65

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY  FEEC+ Y+ DY+ KNGPF G+LGFSQGA L+A + G Q +G  L   
Sbjct  66   WFQFNKEFTEYKNFEECISYLCDYITKNGPFHGLLGFSQGATLSALLIGYQAQGKVLKDH  125

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ ISG+KF       P +   A+  P+   S+HF+GE D+ K   + L   F +
Sbjct  126  PPIKFLVSISGSKFRD-----PSICDIAYKDPIKVKSVHFIGEKDWLKLPSEELAAAFDN  180

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN*PRFSLNDYICMVMI*SNMQ  888
            P ++ HP+GHTVPRLDE +   +  +   I              S +++ C   +  N++
Sbjct  181  PLILRHPQGHTVPRLDEAAAKQLSEWTASI--------------SRSEFPCGTSVPKNVE  226

Query  889  CLISN  903
            C ++N
Sbjct  227  CEMNN  231



>ref|XP_010439049.1| PREDICTED: dihydrofolate reductase-like isoform X2 [Camelina 
sativa]
 ref|XP_010439050.1| PREDICTED: dihydrofolate reductase-like isoform X2 [Camelina 
sativa]
Length=187

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 120/166 (72%), Gaps = 5/166 (3%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+KK + +WP+SV+DRL+L FLDAPFP QGKS  +GI+DPPY
Sbjct  9    IMRKPRFLCLHGFRTSGEIMKKQLHKWPKSVIDRLELVFLDAPFPCQGKSDYDGIYDPPY  68

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EW+Q +KEF EY   E+C E++ED MVK GPFDG++GFSQGA+L+ A+ GMQ +G A  
Sbjct  69   YEWYQYNKEFTEYTNLEKCFEFLEDRMVKLGPFDGLIGFSQGAILSGALLGMQAKGIAFQ  128

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGET  660
            K  KIKFVIII GA F        K+  NA+S  L   SLH LG  
Sbjct  129  KVPKIKFVIIIGGAMFKS-----TKMRENAYSCSLDTLSLHILGRA  169



>ref|XP_010909407.1| PREDICTED: dihydrofolate reductase-like [Elaeis guineensis]
Length=267

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 141/224 (63%), Gaps = 5/224 (2%)
 Frame = +1

Query  142  KMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVE  321
            ++E  ++  KK++V+CLHGFRTS   L+K + +W   + +   L F D  FPA GKS +E
Sbjct  6    EVERKEVNLKKMKVLCLHGFRTSGSFLRKQISKWDPCIFEDFHLDFPDGIFPAGGKSDIE  65

Query  322  GIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ  501
            GI+ PPYFEWFQ +K+F EY   EEC+ Y+ +YM KNGPFDG+LGFSQGA L+A + G Q
Sbjct  66   GIYPPPYFEWFQFNKDFTEYTNLEECISYLCEYMTKNGPFDGMLGFSQGATLSALLIGYQ  125

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
                 L+    IKF++ ISG+KF       P++   A+  P    S+HF+G+ D+ ++  
Sbjct  126  AREKILTDHPPIKFLVSISGSKFRD-----PRICDIAYKDPNKVKSVHFIGDKDWLRQPS  180

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAV  813
            + L   F  P ++ HP+GHTVPRLDE +V  +  +   I K ++
Sbjct  181  EELAAAFDSPLILRHPQGHTVPRLDEITVKKLSEWTASILKRSI  224



>ref|XP_006466282.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Citrus 
sinensis]
Length=142

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  397  CLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGG  576
             + YIEDYM  +GPFD +LGFSQGA +AAA PGMQ EG A +K  KIKFVI+I+GAKF G
Sbjct  6    SIAYIEDYMETHGPFDDLLGFSQGAFIAAASPGMQAEGVAFTKVPKIKFVILIAGAKFLG  65

Query  577  PKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLD  756
             KFG PKLA NAFS P+ CPSLH +GE DF KE+G +LLE FVDP +I+H KGHT+PR+D
Sbjct  66   FKFGQPKLAVNAFSSPVQCPSLHIIGENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRID  125

Query  757  EESVGTMLGFIDKIE  801
            E    TML FI K +
Sbjct  126  ERGQETMLSFIQKFQ  140



>ref|XP_010233722.1| PREDICTED: dihydrofolate reductase-like [Brachypodium distachyon]
Length=211

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 128/195 (66%), Gaps = 5/195 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK +V+CLHGFRTS   LKK + +W  S+L   ++ F D  FPA GKS +EGIF PPYFE
Sbjct  5    KKFKVLCLHGFRTSGSFLKKQISKWHPSILHLFEMVFPDGIFPAGGKSDIEGIFPPPYFE  64

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DKEF +Y   EEC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +G  L+  
Sbjct  65   WFQFDKEFTKYTNLEECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQGKVLNDH  124

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF++ +SG+KF       P +   A+   +   S+HF+G+ D+ K   + L   F  
Sbjct  125  PPIKFMVSVSGSKFRD-----PSICNVAYKELIKARSVHFIGDKDWLKLPSEELAAAFAG  179

Query  709  PHLIHHPKGHTVPRL  753
            P +I HP+GHTVPRL
Sbjct  180  PLIIRHPQGHTVPRL  194



>ref|XP_010673347.1| PREDICTED: dihydrofolate reductase-like [Beta vulgaris subsp. 
vulgaris]
Length=256

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++++CLHGFRTS   LKK + +W  S+    DL F D  FPA GKS +EG F PPY+E
Sbjct  7    KKMKILCLHGFRTSGSFLKKQISKWDPSIFGNFDLDFPDGIFPAGGKSDIEGFFPPPYYE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ DKEF EY   EEC+ Y+ +Y+   GPFDG+LGFSQGA L+A + G Q +G  L   
Sbjct  67   WFQFDKEFTEYTNLEECISYLCEYITTKGPFDGLLGFSQGATLSALLLGYQSQGKVLKDH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
               KF I ISG      KF  P +   A+   +   S+HF+GE D  K   + L   F D
Sbjct  127  PPFKFFISISGT-----KFRTPSICEVAYKESIKAKSVHFIGEKDRLKLPSEELATTFQD  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE +   +  +++++
Sbjct  182  PLIIRHPQGHTVPRLDEAASKQLRNWVEEL  211



>ref|XP_010439051.1| PREDICTED: dihydrofolate reductase-like isoform X3 [Camelina 
sativa]
Length=167

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 119/163 (73%), Gaps = 5/163 (3%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS EI+KK + +WP+SV+DRL+L FLDAPFP QGKS  +GI+DPPY
Sbjct  9    IMRKPRFLCLHGFRTSGEIMKKQLHKWPKSVIDRLELVFLDAPFPCQGKSDYDGIYDPPY  68

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EW+Q +KEF EY   E+C E++ED MVK GPFDG++GFSQGA+L+ A+ GMQ +G A  
Sbjct  69   YEWYQYNKEFTEYTNLEKCFEFLEDRMVKLGPFDGLIGFSQGAILSGALLGMQAKGIAFQ  128

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFL  651
            K  KIKFVIII     GG  F   K+  NA+S  L   SLH L
Sbjct  129  KVPKIKFVIII-----GGAMFKSTKMRENAYSCSLDTLSLHIL  166



>ref|XP_006832894.1| hypothetical protein AMTR_s00095p00115990 [Amborella trichopoda]
 gb|ERM98172.1| hypothetical protein AMTR_s00095p00115990 [Amborella trichopoda]
Length=241

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 131/210 (62%), Gaps = 5/210 (2%)
 Frame = +1

Query  175  LRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWF  354
            ++++CLHGFRTS   L+K + +W   ++   +L FLD  FPA GKS +EGIF PPYFEWF
Sbjct  1    MKILCLHGFRTSGSFLQKQIGKWDPQIVAGFELVFLDGQFPASGKSEIEGIFPPPYFEWF  60

Query  355  QADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAK  534
            Q +++F  Y   + C+ Y+ DY+ KNGPFDG LGFSQGA +   + G Q +G  L     
Sbjct  61   QFNEDFTAYQNLDSCISYLCDYIEKNGPFDGFLGFSQGAAIGGYLLGYQSKGLILKNHPP  120

Query  535  IKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPH  714
            +K  I ISG+KF       P +   A+  P+   S+HF+G  D+ KE  +     F++P 
Sbjct  121  MKMFISISGSKFRD-----PTICEAAYIEPIKVKSVHFIGAKDWLKEPNEEFASAFIEPL  175

Query  715  LIHHPKGHTVPRLDEESVGTMLGFIDKIEK  804
            +I HP+GHTVP+LDE +V  + G+I+ + K
Sbjct  176  IIRHPQGHTVPKLDEATVELLKGWIEGVVK  205



>ref|XP_011079224.1| PREDICTED: UPF0483 protein C25G4.2-like [Sesamum indicum]
Length=269

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 129/199 (65%), Gaps = 5/199 (3%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K+R+VCLHGFRTS   L+K + +W  S+    D+ F D  FPA GKS +EGIF PPYFEW
Sbjct  8    KMRIVCLHGFRTSGSFLRKQISKWNPSIFAHFDMDFPDGIFPAGGKSEIEGIFPPPYFEW  67

Query  352  FQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAA  531
            FQ +K+F EY   EEC+ Y+ +Y+   GPFDG+LGFSQGA L+A + G Q +G  L +  
Sbjct  68   FQFNKDFTEYTNLEECIAYLCEYITSKGPFDGLLGFSQGATLSALLLGYQAQGKILKEHP  127

Query  532  KIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDP  711
              K  + ISG+KF       P +   A+  P+   S+HF+G+ D+ K   + L   FV+P
Sbjct  128  PFKLFVSISGSKFRD-----PSICEVAYKDPIRVKSVHFIGDKDWLKLPSEELATAFVNP  182

Query  712  HLIHHPKGHTVPRLDEESV  768
             +I HP+GHTVPRLDE++V
Sbjct  183  LVIRHPQGHTVPRLDEDAV  201



>ref|XP_007202241.1| hypothetical protein PRUPE_ppa008733mg [Prunus persica]
 gb|EMJ03440.1| hypothetical protein PRUPE_ppa008733mg [Prunus persica]
Length=321

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 134/218 (61%), Gaps = 5/218 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME+ Q   KK++++CLHGFRTS   L+K + +W  S+  + DL F D  FPA GKS +EG
Sbjct  1    MESQQHKEKKMKILCLHGFRTSGSFLQKQISKWDASIFSQFDLDFPDGIFPAGGKSDIEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IF PPY+EWFQ DK+F EY   EEC+ Y+ DY+   GPFDG+LGFSQGA L+  + G Q 
Sbjct  61   IFPPPYYEWFQFDKDFTEYTNLEECITYLCDYITSKGPFDGLLGFSQGATLSGLLLGYQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G  L +    KF I ISGAKF       PK+   A+   +   S+HF+G  D+ K   +
Sbjct  121  QGKLLKEHPPFKFFISISGAKFRD-----PKICDIAYKDTIKAKSVHFIGAKDWLKLPSE  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             L   F +P +I HP+GH VPRLDE +   + G+   I
Sbjct  176  DLASEFDNPLIIRHPQGHMVPRLDEAATEQLRGWTAAI  213



>ref|XP_004136600.1| PREDICTED: UPF0483 protein AGAP003155-like [Cucumis sativus]
 ref|XP_004171179.1| PREDICTED: UPF0483 protein AGAP003155-like [Cucumis sativus]
 gb|KGN59361.1| hypothetical protein Csa_3G813300 [Cucumis sativus]
Length=254

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = +1

Query  139  LKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTV  318
            ++M + +   K+L+++CLHGFRT+   L+K + +W  S+    D+ F D  FPA GKS +
Sbjct  1    MEMSSKRDDKKRLKILCLHGFRTNGSFLRKQISKWDPSIFAHFDMEFPDGIFPAGGKSEI  60

Query  319  EGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGM  498
            EG F PPYFEWFQ +++F EY   EEC++Y+ +Y+  NGPF G+LGFSQGAVL+A + G 
Sbjct  61   EGYFPPPYFEWFQFNEDFTEYKNLEECIDYVCNYITTNGPFHGLLGFSQGAVLSALLLGY  120

Query  499  QREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEE  678
            Q +G  L +   +K  + ISG KF         +   A+ H +   S+HF+GE D+ K  
Sbjct  121  QAQGKVLKEHPPMKMFVSISGTKFKD-----ESICEVAYKHKIKVKSVHFIGEKDWLKLP  175

Query  679  GKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             + L   F +P +I HP+GHTVPRLDE +   +  ++D I
Sbjct  176  SQQLASVFHEPLIIRHPQGHTVPRLDESATKELKCWVDAI  215



>gb|KCW89972.1| hypothetical protein EUGRSUZ_A02175 [Eucalyptus grandis]
Length=205

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 128/196 (65%), Gaps = 5/196 (3%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++++CLHGFRTS   LKK + +W  S+    D+ F D  FPA GKS +EGIF PPYFE
Sbjct  10   KKMKILCLHGFRTSGSFLKKQISKWDPSIFAHFDMDFPDGLFPAGGKSDIEGIFPPPYFE  69

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F EY   EEC++Y+ +Y++  GPFDG+LGFSQGA L+A + G Q +G  L   
Sbjct  70   WFQFEKDFTEYTNLEECVKYLCEYIMSKGPFDGLLGFSQGATLSALLLGYQAQGKVLKDH  129

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              +KF I ISG+     KF  P +   A+  P+   S+HF+G+ D+ K   + L   F +
Sbjct  130  PPLKFFISISGS-----KFRTPDICDVAYKDPIKAKSVHFIGDKDWLKLPSQDLATAFDN  184

Query  709  PHLIHHPKGHTVPRLD  756
            P +I HP+GHTVPRLD
Sbjct  185  PLIIRHPQGHTVPRLD  200



>ref|XP_002307937.2| hypothetical protein POPTR_0006s02780g [Populus trichocarpa]
 gb|EEE91460.2| hypothetical protein POPTR_0006s02780g [Populus trichocarpa]
Length=270

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             KK++++CLHGFRTS   L+K + +W  S+  + DL F D  FPA+GKS +EGIF PPYF
Sbjct  7    EKKMKILCLHGFRTSGNFLQKQISKWDPSIFSQFDLDFPDGVFPARGKSEIEGIFPPPYF  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY   EEC+ Y+ +Y+   GPFDG LGFSQGA L+A + G Q +G  L  
Sbjct  67   EWFQFDKDFTEYTNLEECISYLCEYITTRGPFDGFLGFSQGATLSALLLGYQAQGKVLKD  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
                K  + +SG+KF       P +   A+   +   S+HF+G  D+ KE  + L   F 
Sbjct  127  HPPFKLFVSVSGSKFRD-----PSICDVAYKDTIKVKSVHFIGAKDWLKEPSEDLATAFD  181

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             P +I HP+GHTVPRLDE +   +  +  +I
Sbjct  182  SPLIIRHPQGHTVPRLDEAATEQLRAWATEI  212



>emb|CBI18718.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   +  K R++CLHGFRT AEILKKLV +WPE+VL  LDL FLDAPFPAQGKS VEG
Sbjct  1    MENQ--LQNKPRILCLHGFRTRAEILKKLVGKWPETVLGNLDLVFLDAPFPAQGKSDVEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            +FDPPY+EWFQ++++F EY  FEECL YIEDYM+K+GPF G+LGFSQGA+LAAA+PGMQ 
Sbjct  59   LFDPPYYEWFQSNQDFTEYINFEECLAYIEDYMLKHGPFHGLLGFSQGAILAAALPGMQA  118

Query  505  EGAALSK  525
            +G AL+K
Sbjct  119  QGVALTK  125



>ref|XP_010433777.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog isoform 
X2 [Camelina sativa]
Length=180

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            I +K R +CLHGFRTS E +KK + +WP+SV+ RL+L FLDAPFP +GKS  +GI+DPPY
Sbjct  9    ILRKPRFLCLHGFRTSGEKMKKQLHKWPKSVIGRLELVFLDAPFPCRGKSDYDGIYDPPY  68

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EW+Q +KEF  Y   E+C E++ED MVK GPFDG++GFSQGA+L+ A+ GMQ +G A  
Sbjct  69   YEWYQYNKEFTVYTNLEKCFEFLEDRMVKLGPFDGLIGFSQGAILSGALLGMQAKGIAFQ  128

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGE  657
            K  KIKFVIII     GG  F   K+  NA+S  L   SLH LG 
Sbjct  129  KVPKIKFVIII-----GGAMFKSTKMRENAYSSSLDTLSLHILGN  168



>ref|XP_004287203.1| PREDICTED: dihydrofolate reductase-like [Fragaria vesca subsp. 
vesca]
Length=274

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KKL+++CLHGFRTS   L+K + +W  S+L + D+ F D  FPA GKS +EGIF PPYFE
Sbjct  7    KKLKILCLHGFRTSGSFLQKQLSKWDASILSQFDMEFPDGKFPAGGKSDIEGIFPPPYFE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F EY   E C+ Y+ DY+   GPFDG+LGFSQGA L   + G Q +G  L + 
Sbjct  67   WFQFEKDFMEYTNLEACISYLCDYITGKGPFDGLLGFSQGATLCGLLLGYQAQGKLLKEH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
               +F I ISGA     KF  P +   A+   +   S+HF+G  D+ K   + L   F +
Sbjct  127  PTFRFFISISGA-----KFRQPSICEIAYKQKIKAKSVHFIGAKDWLKLPSEELASEFHN  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE ++  +  +   I
Sbjct  182  PLIIRHPQGHTVPRLDEVAIEQLREWTKTI  211



>ref|XP_006430437.1| hypothetical protein CICLE_v10012464mg [Citrus clementina]
 gb|ESR43677.1| hypothetical protein CICLE_v10012464mg [Citrus clementina]
Length=270

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 132/209 (63%), Gaps = 5/209 (2%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            KL+++CLHGFRTS + L+K + +W  S+    D+ F D  FPA GKS +EGIF PPYFEW
Sbjct  12   KLKLLCLHGFRTSGKFLQKQISKWDPSIFAHFDMDFPDGIFPAGGKSDIEGIFPPPYFEW  71

Query  352  FQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAA  531
            FQ +KEF EY   EEC+ Y+ +Y+  NGPFDG+LGFSQGA L+A + G Q +G  L +  
Sbjct  72   FQFNKEFTEYTNLEECVSYLTEYITSNGPFDGLLGFSQGATLSALLLGYQAQGKVLKEHP  131

Query  532  KIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDP  711
             +K  + ISG+KF       P +   A+   ++  S HF+G  D+ K   + L   F +P
Sbjct  132  PMKLFVSISGSKFRD-----PSICEVAYKDTINVKSAHFIGAKDWLKLPSEELATAFHNP  186

Query  712  HLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             +I HP+GHTVPRLDE +   + G+  +I
Sbjct  187  LIIRHPQGHTVPRLDEAATELLRGWTVEI  215



>ref|XP_006481982.1| PREDICTED: dihydrofolate reductase-like [Citrus sinensis]
Length=270

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 131/210 (62%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
             KL+++CLHGFRTS + L+K + +W  S+    D+ F D  FPA GKS +EGIF PPYFE
Sbjct  11   NKLKLLCLHGFRTSGKFLQKQISKWDPSIFAHFDMEFPDGIFPAGGKSDIEGIFPPPYFE  70

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +KEF EY   EEC+ Y+ +Y+  NGPFDG+LGFSQGA L+A + G Q +G  L + 
Sbjct  71   WFQFNKEFTEYTNLEECVSYLTEYITSNGPFDGLLGFSQGATLSALLLGYQAQGKVLKEH  130

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              +K  + ISG+KF       P +   A+    +  S HF+G  D+ K   + L   F +
Sbjct  131  PPMKLFVSISGSKFRD-----PSICEVAYKDTFNVKSAHFIGAKDWLKLPSEELATAFHN  185

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE +   + G+  +I
Sbjct  186  PLIIRHPQGHTVPRLDEAATELLRGWTVEI  215



>ref|XP_008443142.1| PREDICTED: UPF0483 protein C25G4.2-like [Cucumis melo]
Length=252

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 134/218 (61%), Gaps = 5/218 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME+ +   ++L+++CLHGFRT+   L+K + +W  S+     + F D  FPA GKS +EG
Sbjct  1    MESGKRDEERLKILCLHGFRTNGSFLRKQLSKWDPSIFALFHMEFPDGIFPAGGKSEIEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
             F PPYFEWFQ +++F EY   EEC++Y+ +Y+  NGPF G+LGFSQGAVL+A + G Q 
Sbjct  61   YFPPPYFEWFQFNEDFTEYKNLEECIDYVCNYITTNGPFHGLLGFSQGAVLSALLLGYQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G  L +   IK  + ISG KF         +   A+ H +   S+HF+GE D+ K   +
Sbjct  121  QGKVLREHPPIKMFVSISGTKFKD-----ESICEVAYKHKIKVKSVHFIGEKDWLKLPSQ  175

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             L   F  P +I HP+GHTVPRLDE +   +  ++D I
Sbjct  176  QLASVFHQPLIIRHPQGHTVPRLDESATKELQCWVDTI  213



>gb|ABK94803.1| unknown [Populus trichocarpa]
Length=262

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 127/208 (61%), Gaps = 5/208 (2%)
 Frame = +1

Query  175  LRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWF  354
            ++++CLHGFRTS   L+K + +W  S+  + DL F D  FPA+GKS +EGIF PPYFEWF
Sbjct  1    MKILCLHGFRTSGNFLQKQISKWDPSIFSQFDLDFPDGVFPARGKSEIEGIFPPPYFEWF  60

Query  355  QADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAK  534
            Q DK+F EY   EEC+ Y+ +Y+   GPFDG LGFSQGA L+A + G Q +G  L     
Sbjct  61   QFDKDFTEYTNLEECISYLCEYITTRGPFDGFLGFSQGATLSALLLGYQAQGKVLKDHPP  120

Query  535  IKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPH  714
             K  + +SG+KF       P +   A+   +   S+HF+G  D+ KE  + L   F  P 
Sbjct  121  FKLFVSVSGSKFRD-----PSICDVAYKDTIKVKSVHFIGAKDWLKEPSEDLATAFDSPL  175

Query  715  LIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            +I HP+GHTVPRLDE +   +  +  +I
Sbjct  176  IIRHPQGHTVPRLDEAATEQLRAWATEI  203



>ref|XP_011040680.1| PREDICTED: dihydrofolate reductase-like [Populus euphratica]
Length=271

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
             KK++++CLHGFRTS   L++ + +W  S+    DL F D  FPA GKS +EGIF PPYF
Sbjct  7    EKKMKILCLHGFRTSGSFLQRQISKWDPSIFSHFDLDFPDGVFPAGGKSEIEGIFPPPYF  66

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EWFQ DK+F EY   EEC+ Y+ +Y+   GPFDG LGFSQGA L+A + G Q +G  L  
Sbjct  67   EWFQFDKDFTEYTNLEECISYLCEYITTRGPFDGFLGFSQGATLSALLLGYQAQGKVLKD  126

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
                K  + +SG+KF       P +   A+   +   S+HF+G  D+ KE  + L   F 
Sbjct  127  HPPFKLFVSVSGSKFRD-----PSICDIAYKDTIKVKSVHFIGAKDWLKEPSEELATAFD  181

Query  706  DPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             P +I HP+GHTVPRLDE +   +  +  +I
Sbjct  182  SPLIIRHPQGHTVPRLDEAATEQLRAWATEI  212



>ref|XP_010251742.1| PREDICTED: UPF0483 protein CBG03338-like [Nelumbo nucifera]
Length=290

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 135/218 (62%), Gaps = 7/218 (3%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME  Q   K+++++CLHGFRTS + L+K + +W  S+    D+ F D  FPA GKS +EG
Sbjct  1    MEGGQ--EKRMKILCLHGFRTSGKFLQKQISKWDPSIFSEFDMVFPDGIFPAGGKSEIEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            IF PPY EWFQ + +F EY   +EC+ Y+ D+++KNGPFDG+LGFSQGA L+A + G Q 
Sbjct  59   IFPPPYCEWFQFNPDFTEYTNLDECISYLCDFIMKNGPFDGLLGFSQGATLSALLLGYQA  118

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGK  684
            +G  L +   +K  + ISG+KF       P +   A+  P+   S+HF+G  D+ +   +
Sbjct  119  QGKLLKEHPPMKLFVSISGSKFRD-----PSICDVAYKDPIRVRSVHFIGAKDWLRVPSE  173

Query  685  LLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             L   F  P +I H +GHTVPRLDE +   + G+  +I
Sbjct  174  ELATAFDKPLIIRHLQGHTVPRLDEAATEQLRGWTSEI  211



>ref|XP_006366754.1| PREDICTED: dihydrofolate reductase-like [Solanum tuberosum]
Length=257

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 131/213 (62%), Gaps = 5/213 (2%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            I  KK++++CLHGFRTS   LKK + +W  S+    ++ F D  F A GKS +EGIF PP
Sbjct  5    IGEKKMKILCLHGFRTSGNFLKKQLSKWDPSIFAHFEMEFPDGIFAAGGKSDIEGIFPPP  64

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            YFEWFQ +++F EY   EEC+ Y+ +Y+   GPFDG+LGFSQGA L+  + G   +G  L
Sbjct  65   YFEWFQYNEDFTEYENLEECISYLCEYITSKGPFDGLLGFSQGATLSGLLLGYMEQGKIL  124

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
             +   +K  + ISGAKF       P +   A+   +   S+HF+GE D+ K   + L   
Sbjct  125  KEHPPMKLFVSISGAKFRD-----PNICNIAYKDMMKVKSVHFIGEKDWLKLPSQELTTA  179

Query  700  FVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            F +P +I HP+GHTVPRLDE +V T+  +  +I
Sbjct  180  FENPLIIRHPQGHTVPRLDEAAVETLKTWTREI  212



>ref|XP_007018156.1| Uncharacterized protein TCM_034460 [Theobroma cacao]
 gb|EOY15381.1| Uncharacterized protein TCM_034460 [Theobroma cacao]
Length=222

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +1

Query  142  KMENNQIIHKKLRVVCLHGFRTSAEILKKLV-LRWPESVLDRLDLHFLDAPFPAQGKSTV  318
            +M +   I +K R +CLHGFRT   ILKK +   WP+SVL+++DL + DAPFPAQGK+ V
Sbjct  37   EMASEAEIVRKPRFLCLHGFRTRGAILKKQIETNWPQSVLEKIDLVYPDAPFPAQGKADV  96

Query  319  EGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGM  498
            EGIFDPPY+EWFQ +KEF  Y  FEECL YIED M+K GPFDG+LGFSQGA+L+  +PG+
Sbjct  97   EGIFDPPYYEWFQFNKEFTSYTNFEECLAYIEDIMIKQGPFDGLLGFSQGAILSGGLPGL  156

Query  499  QREGAALSKAAKIKFVIIISGAKF  570
            Q +G AL+K  KIK++III GAKF
Sbjct  157  QAKGLALTKVPKIKYLIIIGGAKF  180



>ref|XP_004242010.1| PREDICTED: dihydrofolate reductase-like [Solanum lycopersicum]
Length=257

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 132/213 (62%), Gaps = 5/213 (2%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPP  339
            I  KK++++CLHGFRTS   LKK + +W  S+    ++ F D  F A+GKS +EGIF PP
Sbjct  5    IEEKKMKILCLHGFRTSGNFLKKQLSKWDPSIFANSEMDFPDGIFAAKGKSDIEGIFPPP  64

Query  340  YFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAAL  519
            YFEWFQ +++F EY   EEC+ Y+ +Y+   GPFDG+LGFSQGA L+  + G   +G  L
Sbjct  65   YFEWFQYNEDFTEYENLEECITYLCEYITSKGPFDGLLGFSQGATLSGLLLGYMEQGEIL  124

Query  520  SKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLEC  699
             +   +K  + ISGAKF       P +   A+   +   S+HF+GE D+ K   + L   
Sbjct  125  KEHPPMKLFVSISGAKFRD-----PNICNIAYKDMMKVKSVHFIGEKDWLKLPSQELTTD  179

Query  700  FVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            F +P +I HP+GHTVPR+DE +V T+  +  ++
Sbjct  180  FENPIIIRHPQGHTVPRIDEAAVETLKSWTREV  212



>ref|XP_009345365.1| PREDICTED: dihydrofolate reductase-like [Pyrus x bretschneideri]
Length=262

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 129/222 (58%), Gaps = 7/222 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILK-KLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             KK++++CLHGFRTS   LK ++  +WP S   + D+ F D  FPA GKS +EG++ PPY
Sbjct  4    QKKMKILCLHGFRTSGAFLKNQITTKWP-SFASQFDMDFPDGIFPAAGKSDIEGVYPPPY  62

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            +EWFQ DK+F EY   EEC+ Y+ DY+   GPFDG+LGFSQGA L+  + G Q +G  L 
Sbjct  63   YEWFQFDKDFTEYTNLEECITYLCDYITTKGPFDGLLGFSQGATLSGLLLGYQAQGKVLK  122

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
                 KF I  SGA F       P +   A+  P+   S+HF+G  D+ +   +     F
Sbjct  123  DHPPFKFCISTSGAMFRD-----PSICDIAYKDPIKAKSVHFIGAKDWLRRPSEDFAAAF  177

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEGN  828
             +P +I HP GHT PRLDE +   + G+   I +    E G+
Sbjct  178  DNPLIIRHPYGHTFPRLDEAATEQLCGWTKTIIECNNTENGD  219



>ref|XP_002283808.1| PREDICTED: dihydrofolate reductase [Vitis vinifera]
 emb|CBI32856.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 128/208 (62%), Gaps = 5/208 (2%)
 Frame = +1

Query  175  LRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWF  354
            ++++CLHGFRTS   L K + +W  S+  +  + F D  FPA GKS +EGIF PPYFEWF
Sbjct  1    MKILCLHGFRTSGSFLHKQISKWDPSIFAQFQMEFPDGMFPAGGKSDIEGIFPPPYFEWF  60

Query  355  QADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAK  534
            Q +KEF EY   EEC+ Y+ +Y+   GPFDG+LGFSQGA L+A + G Q +G  L +   
Sbjct  61   QFNKEFTEYTNLEECIAYLCEYITTKGPFDGLLGFSQGATLSALLLGYQAQGKVLKEHPP  120

Query  535  IKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPH  714
            +K  + ISG+KF       P +   A+  P+   S+HF+G  D+ +   + L   F +P 
Sbjct  121  MKLFVSISGSKFRD-----PSICDVAYKDPIKVRSVHFIGAKDWLRLPSEDLATAFDNPL  175

Query  715  LIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            +I HP+GHTVPRLDE +   +  +  +I
Sbjct  176  IIRHPQGHTVPRLDEAATEQLRSWTTEI  203



>gb|KGN62728.1| hypothetical protein Csa_2G369790 [Cucumis sativus]
Length=181

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M + + I +K +++CLHGFRTS  IL+K V RWP S+L +  LHF+D PFP++G+S VEG
Sbjct  1    MASERKIERKPKILCLHGFRTSGAILRKQVQRWPTSILHQFHLHFIDGPFPSKGRSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
            I+DPPYFEWF   ++       E  LE+IE YM ++GPFDG+LGFSQGAVL+AA+  +Q 
Sbjct  61   IYDPPYFEWFGTSEDPTSCENLESSLEFIESYMAEHGPFDGLLGFSQGAVLSAALALLQA  120

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGE  657
             G AL+K  KIKFVI+ISG+K           A  A+S  + CPSLHFL  
Sbjct  121  RGVALTKVPKIKFVIVISGSKLQSSSLA----ARIAYSTSIACPSLHFLSN  167



>ref|XP_007028389.1| Folic acid and derivative biosynthetic process isoform 1 [Theobroma 
cacao]
 gb|EOY08891.1| Folic acid and derivative biosynthetic process isoform 1 [Theobroma 
cacao]
Length=274

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            +K++++CLHGFRTS   L K + +W  SV    D+ F D  FPA GKS +EGIF PPYFE
Sbjct  7    QKMKILCLHGFRTSGSFLHKQISKWDPSVFCHFDMDFPDGLFPAGGKSDIEGIFPPPYFE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F EY   EEC+ ++ +Y+   GPF G+LGFSQGA L A + G Q +G  L + 
Sbjct  67   WFQFNKDFTEYTNLEECVSHLCEYITTKGPFHGLLGFSQGATLCALLLGYQAQGKVLKEH  126

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
               KF + ISG+     KF  P +   A+   +   S+HF+G  D+ K   + L   F +
Sbjct  127  PPFKFFVSISGS-----KFREPSICEVAYKDTIKVKSVHFIGAKDWLKLPSEELATAFDN  181

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
            P +I HP+GHTVPRLDE S   +  +  KI
Sbjct  182  PLIIRHPQGHTVPRLDEASTEQLSNWTAKI  211



>gb|EMT15239.1| hypothetical protein F775_04967 [Aegilops tauschii]
Length=427

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 124/190 (65%), Gaps = 19/190 (10%)
 Frame = +1

Query  238  RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQ-ADkefkeyykfeeCLEYIE  414
            RWP  V  RLDL F DAPFPA+G S V G+FDPPY+EW   A ++F +Y  F ECL  IE
Sbjct  251  RWPAGVTSRLDLAFADAPFPAEGDSPVRGVFDPPYYEWCHFAGEDFLKYKNFGECLAGIE  310

Query  415  DYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVP  594
            + MV+ GPFDG+ GFSQ              G AL+   ++K+V+IISGAK   P     
Sbjct  311  ELMVRQGPFDGLFGFSQ-------------VGLALNMVPRVKYVMIISGAKIQSPA----  353

Query  595  KLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGT  774
             LAA A+++ ++C SLHF+G+ DF K  G+ L + FVDP +I HP GHTVPR DE+ +  
Sbjct  354  -LAAKAYANKINCTSLHFIGDGDFVKAHGEELADSFVDPLVIRHPAGHTVPRFDEKGLQA  412

Query  775  MLGFIDKIEK  804
            MLG++DKIE+
Sbjct  413  MLGYLDKIER  422


 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 101/137 (74%), Gaps = 6/137 (4%)
 Frame = +1

Query  397  CLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGG  576
            CL YIE+ M+K GPFDG++GFSQG++L+ A+PG+Q +G AL++  KIK++III GAKF  
Sbjct  81   CLAYIEELMIKEGPFDGLMGFSQGSILSGALPGLQEQGLALTRVPKIKYLIIIGGAKFRS  140

Query  577  PKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRL-  753
                 P +A  A+++ +  PSLHFLG+ DF K  G+ L+E FVDP +I HPKGHTVPRL 
Sbjct  141  -----PAIADKAYANMIKIPSLHFLGDNDFLKPHGEQLIESFVDPFIIRHPKGHTVPRLV  195

Query  754  DEESVGTMLGFIDKIEK  804
            DE S+  M  F+DK+EK
Sbjct  196  DETSLEVMSRFLDKMEK  212



>gb|KHN42155.1| Dihydrofolate reductase [Glycine soja]
Length=254

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 123/207 (59%), Gaps = 19/207 (9%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KKL+++CLHGFRTS   LKK + +W  S+  + D+ F D  +PA GKS +EGIF PPYFE
Sbjct  7    KKLKILCLHGFRTSGSFLKKQISKWDPSIFTQFDMVFPDGKYPAGGKSDIEGIFPPPYFE  66

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKA  528
            WFQ +K+F  Y+  EEC+ Y+ +Y+  NGPFDG LGFSQG +L    P            
Sbjct  67   WFQFEKDFTVYFNLEECISYLCEYITANGPFDGFLGFSQGKLLKEHPP------------  114

Query  529  AKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVD  708
              IKF+I ISG KF       P +   A+   +   S+HF+GE D+ K   + L   F  
Sbjct  115  --IKFLISISGCKFRN-----PSICDVAYKDTIKAKSVHFIGEKDWLKLPSEDLTSAFDK  167

Query  709  PHLIHHPKGHTVPRLDEESVGTMLGFI  789
            P +I HP+GHTVPRLDE +   +  +I
Sbjct  168  PLIIRHPQGHTVPRLDEVATSQLRKWI  194



>gb|KCW89971.1| hypothetical protein EUGRSUZ_A02175 [Eucalyptus grandis]
Length=238

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 129/229 (56%), Gaps = 38/229 (17%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            KK++++CLHGFRTS   LKK + +W  S+    D+ F D  FPA GKS +EGIF PPYFE
Sbjct  10   KKMKILCLHGFRTSGSFLKKQISKWDPSIFAHFDMDFPDGLFPAGGKSDIEGIFPPPYFE  69

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQ---------  501
            WFQ +K+F EY   EEC++Y+ +Y++  GPFDG+LGFSQGA L+A + G Q         
Sbjct  70   WFQFEKDFTEYTNLEECVKYLCEYIMSKGPFDGLLGFSQGATLSALLLGYQAQASRIASF  129

Query  502  ------------------------REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAAN  609
                                    ++G  L     +KF I ISG+     KF  P +   
Sbjct  130  IFIVLLCNIFSREVMVDMADIYFWKQGKVLKDHPPLKFFISISGS-----KFRTPDICDV  184

Query  610  AFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLD  756
            A+  P+   S+HF+G+ D+ K   + L   F +P +I HP+GHTVPRLD
Sbjct  185  AYKDPIKAKSVHFIGDKDWLKLPSQDLATAFDNPLIIRHPQGHTVPRLD  233



>ref|XP_002990786.1| hypothetical protein SELMODRAFT_272162 [Selaginella moellendorffii]
 gb|EFJ08059.1| hypothetical protein SELMODRAFT_272162 [Selaginella moellendorffii]
Length=206

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 126/200 (63%), Gaps = 9/200 (5%)
 Frame = +1

Query  238  RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIED  417
            RW   V+D L L +LDAPFPA+G STV+G F+PP++EW++ + +F E+Y+ EEC+ YI D
Sbjct  9    RWGAPVMDLLKLSYLDAPFPAEGPSTVQGFFEPPFYEWYRTNNDFTEFYQVEECISYISD  68

Query  418  YMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPK  597
            YM  +GPFDG++GFSQGA LA  + G QR    L     IKFVI+I G   G       K
Sbjct  69   YMKSHGPFDGLMGFSQGAFLAGQLAGYQRLKEDL-LPTPIKFVILIGGGMSGY------K  121

Query  598  LAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTM  777
              + A+  P+ CPSLH +G  DF +  G+ L+  F +P ++ HP GH VP LD +S+   
Sbjct  122  PMSAAYDTPIKCPSLHTIGRKDFNRPAGETLVTKFENPVILRHPHGHRVPELDNDSIAEF  181

Query  778  LGFIDKIEKMAVQEEGN*PR  837
              F+ K+  +A+++E   P+
Sbjct  182  RSFLLKM--LALRDEDEDPK  199



>ref|XP_002974512.1| hypothetical protein SELMODRAFT_271081 [Selaginella moellendorffii]
 gb|EFJ24734.1| hypothetical protein SELMODRAFT_271081 [Selaginella moellendorffii]
Length=206

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 126/200 (63%), Gaps = 9/200 (5%)
 Frame = +1

Query  238  RWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIED  417
            RW   V+D L L +LDAPFPA+G STV+G F+PP++EW++ + +F E+Y+ EEC+ YI D
Sbjct  9    RWGAPVMDLLKLSYLDAPFPAEGPSTVQGFFEPPFYEWYRTNNDFTEFYQVEECISYISD  68

Query  418  YMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPK  597
            YM  +GPFDG++GFSQGA LA  + G QR    L     IKFVI+I G   G       K
Sbjct  69   YMKSHGPFDGLMGFSQGAFLAGQLAGYQRLKEDL-LPTPIKFVILIGGGMSGY------K  121

Query  598  LAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTM  777
              + A+  P+ CPSLH +G  DF +  G+ L+  F +P ++ HP GH VP LD +S+   
Sbjct  122  PMSAAYDTPIKCPSLHTIGRKDFNRPAGETLVTKFENPVILRHPHGHRVPELDNDSIAEF  181

Query  778  LGFIDKIEKMAVQEEGN*PR  837
              F+ K+  +A+++E   P+
Sbjct  182  RSFLLKM--LALRDEDEDPK  199



>ref|XP_006360392.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Solanum 
tuberosum]
Length=139

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  421  MVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKL  600
            M K GPFDGVLGFS+GA++ A+MPGMQR+  AL+K  KIKFV++I+GAKFGG   G PKL
Sbjct  1    MEKYGPFDGVLGFSEGAIVTASMPGMQRDRVALTKVPKIKFVMLIAGAKFGGVALGCPKL  60

Query  601  AANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTML  780
            A+NAF+ P+ CPSLHF+GE D      + L  CFV+P +IH+P+GH VP LD E   T++
Sbjct  61   ASNAFASPIECPSLHFIGEKDPHILNEEELAGCFVNPVVIHYPEGHKVPNLDAERTETVI  120

Query  781  GFIDKIEKMAVQEEGN  828
             FI+K++K+ +  +GN
Sbjct  121  EFINKVKKIKMPLQGN  136



>tpg|DAA37559.1| TPA: hypothetical protein ZEAMMB73_807797 [Zea mays]
Length=156

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 103/135 (76%), Gaps = 5/135 (4%)
 Frame = +1

Query  397  CLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGG  576
            CL YIE+ M+K+GPFDG++GFSQG++L+AA+PG+Q +G AL++  K+K++III GAKF  
Sbjct  9    CLAYIEELMIKDGPFDGLMGFSQGSILSAALPGLQEQGLALTRVPKVKYLIIIGGAKFQS  68

Query  577  PKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLD  756
            P      +A  A+++ + CPSLHF+GE DF K  G+ L+E  VDP +I HPKGHTVPRLD
Sbjct  69   PT-----VAGKAYANKIACPSLHFIGENDFLKVHGEKLIESCVDPFVIRHPKGHTVPRLD  123

Query  757  EESVGTMLGFIDKIE  801
            +ES+  M  F++KIE
Sbjct  124  DESLVVMHRFLEKIE  138



>gb|KHG11174.1| Dihydrofolate reductase [Gossypium arboreum]
Length=310

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 128/212 (60%), Gaps = 6/212 (3%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLRW-PESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            ++ ++++CLHGFRTS + L+K + +W P   L    + F D  F A GKS +EGIF PPY
Sbjct  5    NQNMKILCLHGFRTSGKFLQKQISKWDPSLFLHHFQMDFPDGLFSAGGKSDIEGIFPPPY  64

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
            FEWFQ +KEF EY   EEC+ ++  Y+  NGPF G+LGFSQGA L A + G + +G  L 
Sbjct  65   FEWFQFNKEFTEYTNLEECISHLCQYITHNGPFHGLLGFSQGATLGALLLGYKAQGKVLK  124

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECF  702
            +    K  + ISG+     KF  P +   A+   ++  S+HF+G  D+ K   + L   F
Sbjct  125  EHPPFKMFVSISGS-----KFREPSICEVAYKDKINVKSVHFIGAKDWLKLPSEDLATAF  179

Query  703  VDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             DP +I HP+GHTVPRLDEES   +  +I  I
Sbjct  180  HDPLIIRHPQGHTVPRLDEESTEQLRKWIANI  211



>ref|XP_006495447.1| PREDICTED: rhodanese-like domain-containing protein 6-like [Citrus 
sinensis]
Length=181

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN   I KK R++CLHGFRTS EILKK + RWPES+L +LDL FLDAPFPA GKS VE 
Sbjct  53   MENG--IPKKPRILCLHGFRTSGEILKKQIGRWPESILRKLDLDFLDAPFPALGKSDVEA  110

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
             FDPPY+EW+Q +++  +Y  FE+ + YIEDYMV +GPFDG+LGFSQGA +AAA PGMQ 
Sbjct  111  FFDPPYYEWYQRNEDCTQYINFEQSIAYIEDYMVTHGPFDGLLGFSQGAFIAAASPGMQA  170

Query  505  EGAALS  522
            E   +S
Sbjct  171  EVLEMS  176



>ref|XP_001758505.1| predicted protein [Physcomitrella patens]
 gb|EDQ76483.1| predicted protein [Physcomitrella patens]
Length=215

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 130/201 (65%), Gaps = 8/201 (4%)
 Frame = +1

Query  157  QIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDP  336
            Q   +KLR++ LHGFRTS +IL++ + +W  S+ D +D+  +DAP P+ GKS VEGIF+ 
Sbjct  10   QKTQRKLRLLGLHGFRTSGDILQRQLSKWDPSLHDLIDVDCIDAPLPSVGKSDVEGIFEG  69

Query  337  PYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFS-QGAVLAAAMPGMQREGA  513
            PY+EWF+ +K+F E+Y  +E   YI DYM  +GP+DG++GFS QGA+++  + G+Q +G 
Sbjct  70   PYYEWFRFNKDFTEFYYMDEMFSYITDYMKLHGPYDGLIGFSQQGAIISGCIAGLQEKGL  129

Query  514  ALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHP-LHCPSLHFLGETDFQKEEGKLL  690
            AL     I+ V++++ A+   P   +       +  P + CP+L FLG+ D+ +  G   
Sbjct  130  ALQDVPPIRLVVLVAPAQLRAPHLKI------VYEEPTIKCPTLAFLGDKDWLRSAGLDA  183

Query  691  LECFVDPHLIHHPKGHTVPRL  753
            L+ F +  +I+H  GHTVPRL
Sbjct  184  LKSFANCTIINHRHGHTVPRL  204



>gb|KCW62059.1| hypothetical protein EUGRSUZ_H04730 [Eucalyptus grandis]
Length=130

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEW  351
            K R++CLHGFRTSA IL+  + +WPES+L++LDL FLDA +P+ GKS+VEGIFDPPY+EW
Sbjct  9    KPRILCLHGFRTSAAILETQIRKWPESILEKLDLVFLDARYPSAGKSSVEGIFDPPYYEW  68

Query  352  --FQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
              FQ  ++  EY  +EEC+ YIED+MV+NGPFDG+LGFSQGA L A +PGMQ E
Sbjct  69   FQFQVHQDHTEYQNYEECIAYIEDFMVQNGPFDGLLGFSQGASLCATLPGMQEE  122



>ref|XP_009630893.1| PREDICTED: uncharacterized protein LOC104120762 [Nicotiana tomentosiformis]
Length=115

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  502  REGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEG  681
            +E  AL+K  +IKF+IIISGAKFGG  + VP+LAANAFS P++CPSLHFLGETDFQK++G
Sbjct  14   KERVALTKVPEIKFLIIISGAKFGGLTYVVPQLAANAFSSPINCPSLHFLGETDFQKKDG  73

Query  682  KLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKM  807
            ++LLE FVDP +IHH KGHT+P+LD+ S+  MLGFI+KI+K+
Sbjct  74   EILLESFVDPQVIHHSKGHTIPKLDDSSLEIMLGFIEKIQKL  115



>ref|XP_009802159.1| PREDICTED: uncharacterized protein LOC104247763 [Nicotiana sylvestris]
Length=144

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 101/155 (65%), Gaps = 17/155 (11%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKK-LVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
             KK +V+ LHG   +AEILKK + L WP++VL++LDL FL+ PF  Q K    GIF+PPY
Sbjct  6    EKKPQVLSLHGHGANAEILKKEMELGWPQAVLEKLDLVFLNGPFLLQDKVDSHGIFNPPY  65

Query  343  FEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALS  522
             EWFQ DK  ++ Y                GPFDGVLGFSQG VL A+MP MQR    L+
Sbjct  66   SEWFQNDKIIRKAY----------------GPFDGVLGFSQGGVLTASMPRMQRGKVTLT  109

Query  523  KAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPL  627
            K   IKFV IISGAKF G + G+PKLA+NAFS P+
Sbjct  110  KVPNIKFVTIISGAKFVGRELGLPKLASNAFSSPI  144



>ref|NP_001242178.1| uncharacterized protein LOC100812874 [Glycine max]
 gb|ACU20223.1| unknown [Glycine max]
Length=228

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = +1

Query  277  FLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLG  456
            F D  +PA GKS +EGIF PPYFEWFQ +K+F  Y+  EEC+ Y+ +Y+  NGPFDG LG
Sbjct  3    FPDGKYPAGGKSDIEGIFPPPYFEWFQFEKDFTVYFNLEECISYLCEYITANGPFDGFLG  62

Query  457  FSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCP  636
            FSQGA L+A + G Q +G  L +   IKF+I ISG KF       P +   A+   +   
Sbjct  63   FSQGATLSALLIGYQAQGKLLKEHPPIKFLISISGCKFRN-----PSICDVAYKDTIKAK  117

Query  637  SLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFI  789
            S+HF+GE D+ K   + L   F  P +I HP+GHTVPRLDE +   +  +I
Sbjct  118  SVHFIGEKDWLKLPSEDLTSAFDKPLIIRHPQGHTVPRLDEVATSQLRKWI  168



>gb|AFK41646.1| unknown [Medicago truncatula]
Length=133

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 5/124 (4%)
 Frame = +1

Query  433  GPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANA  612
            GPFDG+LGFSQGA+L+  +PG+Q +G AL+K  K+KF+III     GG KF  P +   A
Sbjct  2    GPFDGLLGFSQGAILSGGLPGLQEKGVALTKVPKVKFLIII-----GGTKFRAPSVVEKA  56

Query  613  FSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFID  792
            +S  + CPSLHFLG  DF KE GK L++  V+P +IHHPKGHTVPRLD++S+  M+ FI+
Sbjct  57   YSSQIGCPSLHFLGGHDFLKEYGKELIDFCVEPVVIHHPKGHTVPRLDDKSLNPMMSFIE  116

Query  793  KIEK  804
            +I+ 
Sbjct  117  RIQN  120



>gb|KDO57359.1| hypothetical protein CISIN_1g025495mg [Citrus sinensis]
Length=252

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 107/175 (61%), Gaps = 5/175 (3%)
 Frame = +1

Query  274  HFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVL  453
            +F D  FPA GKS +EGIF PPYFEWFQ +KEF EY   EEC+ Y+ +Y+  NGPFDG+L
Sbjct  28   YFPDGIFPAGGKSDIEGIFPPPYFEWFQFNKEFTEYTNLEECVSYLTEYITSNGPFDGLL  87

Query  454  GFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHC  633
            GFSQGA L+A + G Q +G  L +   +K  + ISG+KF       P +   A+    + 
Sbjct  88   GFSQGATLSALLLGYQAQGKVLKEHPPMKLFVSISGSKFRD-----PSICEVAYKDTFNV  142

Query  634  PSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI  798
             S HF+G  D+ K   + L   F +P +I HP+GHTVPRLDE +   + G+   I
Sbjct  143  KSAHFIGAKDWLKLPSEELATAFHNPLIIRHPQGHTVPRLDEAATELLRGWTVDI  197



>ref|XP_001779260.1| predicted protein [Physcomitrella patens]
 gb|EDQ55948.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = +1

Query  139  LKMENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTV  318
            L+ EN+Q   +KL+++ LH FRTSA+I K+ + +W  S+ +  D+ +++ P P  GKS V
Sbjct  3    LETENDQAPQRKLKLLGLHSFRTSADIFKRQLTKWSPSLHELFDVDYINGPLPCSGKSDV  62

Query  319  EGIFDPPYFEWFQ-ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            EGIF+ PY+EW++      + YY  E  L YI +YM  +GP+DG+LGFSQGA L   +  
Sbjct  63   EGIFEGPYYEWYRFKKDYTEFYYVDENLLSYISNYMKLHGPYDGILGFSQGACLGGYLAA  122

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHP-LHCPSLHFLGETDFQK  672
            +Q +G  L   + ++ +++I+ AK             + +  P + CP+L  +G  D  +
Sbjct  123  IQEKGVGLQDVSPLRVLVLIAPAKLRAQHL------KHVYDDPKIKCPTLALIGARDPLR  176

Query  673  EEGKLLLECFVDPHLIHHPKGHTVPRLDE  759
              G  +L+ F +   I H  GHTVPRL E
Sbjct  177  IPGFDVLKSFENHIAIEHRFGHTVPRLGE  205



>ref|XP_002983136.1| hypothetical protein SELMODRAFT_271605 [Selaginella moellendorffii]
 gb|EFJ15945.1| hypothetical protein SELMODRAFT_271605 [Selaginella moellendorffii]
Length=247

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 125/225 (56%), Gaps = 18/225 (8%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLV--LRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            ++LRV+CLHG   ++  L+  +  ++W +SVL+ LDL FLDAPFP          F PPY
Sbjct  4    RRLRVLCLHGHGDNSRQLQAQLSAVKWDDSVLNLLDLSFLDAPFPVIDGEKRN--FAPPY  61

Query  343  FEWFQADkefkeyykfe--eCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAA  516
             EWF+ +KE          + +  I  YM K GPFDG+LG S G ++A A+ GMQ+   +
Sbjct  62   LEWFRGNKEMTIVDYKSFEQGISCISRYMKKCGPFDGLLGMSLGGIVAGALAGMQQTKKS  121

Query  517  LSKAAKIKFVIIISGAKFGGPKFGVPKLA--ANAFSHPLHCPSLHFLGETD-FQKEEGKL  687
            +    ++KFVIIISG        G+ +       + HP+HCPS H +GE D   K  G+ 
Sbjct  122  I-LPTELKFVIIISG--------GIIRCQPLCKVYDHPIHCPSFHLIGELDTIFKSSGED  172

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            L + FV P +I HP GH +P LD  S  +++ F+  I K  V  E
Sbjct  173  LAKKFVKPVIIVHPYGHCLPPLDNASTVSLVEFLQDIIKENVMIE  217



>ref|XP_008776461.1| PREDICTED: uncharacterized protein LOC103696567 [Phoenix dactylifera]
Length=459

 Score =   144 bits (364),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 110/178 (62%), Gaps = 5/178 (3%)
 Frame = +1

Query  292  FPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGA  471
            F A GKS +E I+ PPYFEWFQ +K+F EY   EEC+ Y+ DYM KNGPFDG+LGFSQGA
Sbjct  247  FLAGGKSDIEDIYPPPYFEWFQFNKDFTEYTNLEECILYLCDYMTKNGPFDGMLGFSQGA  306

Query  472  VLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFL  651
             L+A +   Q +G  L     IKF++ ISG KF       PK+   A+  P+   S+HF+
Sbjct  307  TLSALLISYQAKGKILKDHPPIKFLVSISGCKFRD-----PKICDIAYKDPIKVKSVHFI  361

Query  652  GETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEEG  825
            G+ D+ ++  + L   F  P ++ HP+GHTVPRLDE +V  +  +   I K ++  + 
Sbjct  362  GDKDWLRQPSEELTAAFDSPLILRHPQGHTVPRLDEINVKNLSEWTRSILKSSITYDA  419



>ref|XP_002965892.1| hypothetical protein SELMODRAFT_227576 [Selaginella moellendorffii]
 gb|EFJ33312.1| hypothetical protein SELMODRAFT_227576 [Selaginella moellendorffii]
Length=247

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 123/225 (55%), Gaps = 18/225 (8%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLV--LRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPY  342
            ++LRV+CLHG   ++  L+  +  ++W +SVL+ LDL FLDAPFP          F PPY
Sbjct  4    RRLRVLCLHGHGDNSRQLQAQLSAVKWDDSVLNLLDLSFLDAPFPVIDGEKRN--FAPPY  61

Query  343  FEWFQADkefkeyykfe--eCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAA  516
             EWF+ +KE          + +  I  YM K GPFDG+LG S G  +A A+ GMQ+   +
Sbjct  62   LEWFRGNKEMTIVDYKSFEQGISCISRYMKKCGPFDGLLGMSLGGFVAGALAGMQQTKKS  121

Query  517  LSKAAKIKFVIIISGAKFGGPKFGVPKLA--ANAFSHPLHCPSLHFLGETD-FQKEEGKL  687
            +    ++KFVIIISG        G+ +       + HP+HCPS H +GE D   K  G+ 
Sbjct  122  I-LPTELKFVIIISG--------GIIRCQPLCKVYDHPIHCPSFHLIGELDTIFKSSGED  172

Query  688  LLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKIEKMAVQEE  822
            L + FV P +I HP GH +P LD  S  + + F+  I K  V  E
Sbjct  173  LAKKFVKPIIIVHPYGHCLPPLDNASTVSFVEFLQDIIKENVMIE  217



>gb|EPS74177.1| hypothetical protein M569_00573 [Genlisea aurea]
Length=360

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 110/187 (59%), Gaps = 5/187 (3%)
 Frame = +1

Query  250  SVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVK  429
            S L   +  F D   PA G+S +EGIF PPY+EWFQ +K+F +Y   E C+ ++  Y+  
Sbjct  164  STLPSRNNDFPDGIHPAGGRSEIEGIFPPPYYEWFQFNKDFTDYTNLEHCIHHLCHYINS  223

Query  430  NGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAAN  609
            NGPF G+LGFSQGA L A + G Q +G  L    K+K  + ISG+KF       PK+   
Sbjct  224  NGPFYGLLGFSQGATLCALLLGYQAQGKILQDHPKMKLFVSISGSKFRD-----PKICDI  278

Query  610  AFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFI  789
            A+  P+  PSLHF+G+ D+ K   + L   F  P +I HP+GHTVPRLDE +V  +  + 
Sbjct  279  AYKTPIQVPSLHFIGDKDWLKSPSEELAAAFHQPVIIRHPQGHTVPRLDEAAVEKLRSWT  338

Query  790  DKIEKMA  810
              + ++ 
Sbjct  339  KDVLRIG  345



>tpg|DAA64211.1| TPA: calmodulin [Zea mays]
Length=312

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYFE  348
            K+ +V+CLHGFRTS   LKK + +W  S+  + ++ F D  FPA GKS +EGIF PPYFE
Sbjct  157  KRAKVLCLHGFRTSGSFLKKQISKWHPSIFQQFEMVFPDGLFPAGGKSEIEGIFPPPYFE  216

Query  349  WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQRE  507
            WFQ +KEF EY   +EC+ Y+ DYMVKNGPFDG+LGFSQGA L+A + G Q +
Sbjct  217  WFQFNKEFTEYTNLDECISYLCDYMVKNGPFDGLLGFSQGATLSALLIGYQAQ  269



>gb|KGN62727.1| hypothetical protein Csa_2G369780 [Cucumis sativus]
Length=111

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            M +     +K +++CLHGFRTS  IL+K V RWP SVL +  LHF+D   P++GKS VEG
Sbjct  1    MASESKTERKPKILCLHGFRTSGAILRKQVQRWPTSVLHQFHLHFIDDSIPSKGKSDVEG  60

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQ  465
            I+DPPYFEWF   ++   Y   E  +E+IE YM+++GPFDG+LGFSQ
Sbjct  61   IYDPPYFEWFGTSEDPTNYENLESSIEFIESYMLEHGPFDGLLGFSQ  107



>ref|XP_006481467.1| PREDICTED: dihydrofolate reductase-like isoform X2 [Citrus sinensis]
Length=129

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  400  LEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGP  579
            + YIEDYM  +GPFD +LGFSQGA +AAA PGMQ EG A +K  KIKFVI+I GAKF G 
Sbjct  7    IAYIEDYMETHGPFDDLLGFSQGAFIAAASPGMQAEGVAFTKVPKIKFVILIVGAKFLGF  66

Query  580  KFGVPKLAANAFSHPLHCPSLHFL  651
            +F  PKL  NAFS P+ CPSLH +
Sbjct  67   EFRQPKLVVNAFSSPVQCPSLHII  90



>ref|XP_006481466.1| PREDICTED: dihydrofolate reductase-like isoform X1 [Citrus sinensis]
Length=203

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  400  LEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGP  579
            + YIEDYM  +GPFD +LGFSQGA +AAA PGMQ EG A +K  KIKFVI+I GAKF G 
Sbjct  7    IAYIEDYMETHGPFDDLLGFSQGAFIAAASPGMQAEGVAFTKVPKIKFVILIVGAKFLGF  66

Query  580  KFGVPKLAANAFSHPLHCPSLHFL  651
            +F  PKL  NAFS P+ CPSLH +
Sbjct  67   EFRQPKLVVNAFSSPVQCPSLHII  90



>emb|CBI18719.3| unnamed protein product [Vitis vinifera]
Length=82

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  583  FGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEE  762
            FG+  L  NAFS P+ CPSLHF+GETD  K+EG  LLE FVDP +IHHP+GHTVPRLDE+
Sbjct  3    FGLVTLIPNAFSPPIPCPSLHFIGETDVLKQEGTALLESFVDPVVIHHPQGHTVPRLDEK  62

Query  763  SVGTMLGFIDKIEKMAVQEE  822
            +  T+L FI KI  ++ QEE
Sbjct  63   AQETVLQFIRKIWNISSQEE  82



>ref|XP_007028390.1| Folic acid and derivative biosynthetic process isoform 2 [Theobroma 
cacao]
 gb|EOY08892.1| Folic acid and derivative biosynthetic process isoform 2 [Theobroma 
cacao]
Length=144

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            ME  Q   +K++++CLHGFRTS   L K + +W  SV    D+ F D  FPA GKS +EG
Sbjct  1    MEEAQ--KQKMKILCLHGFRTSGSFLHKQISKWDPSVFCHFDMDFPDGLFPAGGKSDIEG  58

Query  325  IFDPPYFEWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQ  465
            IF PPYFEWFQ +K+F EY   EEC+ ++ +Y+   GPF G+LGFSQ
Sbjct  59   IFPPPYFEWFQFNKDFTEYTNLEECVSHLCEYITTKGPFHGLLGFSQ  105



>gb|KEH25891.1| serine hydrolase [Medicago truncatula]
Length=106

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN + + +K +++CLHGFRTS EI+KK + +WP++VLD+LDL F++APFP   KS VE 
Sbjct  1    MENEEKV-RKPKILCLHGFRTSGEIMKKQIHKWPQNVLDKLDLVFVEAPFPCNDKSDVED  59

Query  325  IFDPPYFEWF  354
            IFDPPY+EWF
Sbjct  60   IFDPPYYEWF  69



>ref|XP_002957066.1| hypothetical protein VOLCADRAFT_121595 [Volvox carteri f. nagariensis]
 gb|EFJ41868.1| hypothetical protein VOLCADRAFT_121595 [Volvox carteri f. nagariensis]
Length=324

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 97/204 (48%), Gaps = 26/204 (13%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGK--STVEGIFDPPYF  345
            +LRV+CLH FRTS  I ++                F+D P PA G     V   F  PY+
Sbjct  12   RLRVLCLHSFRTSGAIFQQQT--------------FIDGPHPASGPIPRDVRPYFGGPYY  57

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKN----GPFDGVLGFSQGAVLAAAMPGMQREGA  513
            EWF  +         E  ++  E ++       GPFDGV+GFSQGA ++AA+  +QR G 
Sbjct  58   EWFTVESVGDRLEFDEVKMQASERFLTAQLALRGPFDGVMGFSQGAAMSAALVALQRSGV  117

Query  514  --ALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKL  687
               LS  A ++F I+ +G K   P       A    S  + CPSLH  G+ D  K    +
Sbjct  118  RPELSAVAPLRFCILFAGIKSRHPDHVA---AFEELSGKVPCPSLHVYGDKDALKNPHCV  174

Query  688  -LLECFVDPHLIHHPKGHTVPRLD  756
             L + F +  ++ H +GH +P L 
Sbjct  175  ELADAFQNATVLLHQRGHVIPALQ  198



>ref|XP_004988593.1| hypothetical protein PTSG_10254 [Salpingoeca rosetta]
 gb|EGD79972.1| hypothetical protein PTSG_10254 [Salpingoeca rosetta]
Length=540

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 93/194 (48%), Gaps = 13/194 (7%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQG--KSTVEGIFDPPYF  345
            K +V+CLHG+RTSA I+K     +P  V    +  F+DA  PA G     V   F+PP+F
Sbjct  334  KPKVLCLHGWRTSASIMKYQFRDFPADV----EYVFVDACHPASGPPHGVVAAYFEPPFF  389

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREGAALSK  525
            EW+  D            L+YI D     GPF GV GFSQGA LA  +  M +     + 
Sbjct  390  EWWDKDDSNAYTGLDAS-LKYIADINRTQGPFVGVAGFSQGAALAVLLCAMMQHDRTTAP  448

Query  526  AAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFV  705
               +KF ++ S    G P        A+ F  PL  P+    GETD+ K E +  ++   
Sbjct  449  LPDLKFALLTSPFVPGDPSL------AHLFKAPLTIPAFVSFGETDYIKSECERCVKSLP  502

Query  706  DPHLIHHPKGHTVP  747
            +  ++ H  GH VP
Sbjct  503  NAQVLVHTGGHEVP  516



>ref|XP_009823046.1| hypothetical protein H257_01496 [Aphanomyces astaci]
 gb|ETV88183.1| hypothetical protein H257_01496 [Aphanomyces astaci]
Length=230

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 108/210 (51%), Gaps = 16/210 (8%)
 Frame = +1

Query  151  NNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQG--KSTVEG  324
            +   + ++LR++CLHG RT+  ++   V  + ++     D   LDAPFPA G  +  +  
Sbjct  2    STSCLQQRLRILCLHGGRTNGTVVSLQVSGFVQAFGPAADFVELDAPFPASGPPEEDILN  61

Query  325  IF--DPPYFEWFQADkefkeyy-kfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            +F  D PYFEW+ A+      Y  +E  LE+++  +   GPFD ++GFSQGA++A  +  
Sbjct  62   LFGDDEPYFEWWDANHHTNAVYPGWERSLEFLKREITAQGPFDAIIGFSQGAMMATLLTA  121

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHP--LHCPSLHFLGETDFQ  669
               +          K +I++ G     P+ G+P +  +  +    L+ PS H LGE DF 
Sbjct  122  HYLQ----KHWVPFKAIILVCGM---WPQDGMPAIKESPTTGKPLLNFPSFHVLGEKDFM  174

Query  670  KEEGKLLLECF--VDPHLIHHPKGHTVPRL  753
             E+GK  +E F     H+  H +GH  P L
Sbjct  175  YEDGKAQVEYFSASSRHVYTHDQGHRFPPL  204



>ref|XP_002501981.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63239.1| predicted protein [Micromonas sp. RCC299]
Length=247

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 115/231 (50%), Gaps = 25/231 (11%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILK---KLVLRWPESVLDRLDLHFLDAPFPAQGK--STVEGIFDP  336
            KLRV+ LH FRTS  I +   + +  WP ++ D  +  ++DAP PA G+    V   F  
Sbjct  2    KLRVLALHSFRTSGSIFRDQLEALGNWPNAIGDLCEFVYVDAPHPASGEVPEDVASFFQG  61

Query  337  PYFEWFQA--------DkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAV---LAA  483
            PYFEW+ A        + +  +Y   E  LE++E+     GPFDG++GFSQGA    L A
Sbjct  62   PYFEWWNATSFGVEGKEGKVLQYEGLERSLEFVEEVWRTKGPFDGIVGFSQGATFTGLLA  121

Query  484  AMPGMQREGAALSKAAKI--KFVIIISGAKFGGPKFGVPKLAANAFSH-PLHCPSLHFLG  654
            A   ++  G  + + A     F I+ISG +    +    +L   A     +   +LH +G
Sbjct  122  ATGKVEGRGPFVPRDAGDPGAFAILISGMQARTDE--AKRLYTEASGEMGMDIATLHIVG  179

Query  655  ETD--FQKEEGKLLLECFVDPH--LIHHPKGHTVPRLDEESVGTMLGFIDK  795
            ETD            + FV+    +I H +GH VPRLD +++ ++  ++ +
Sbjct  180  ETDRAIPPAMSDRASQMFVEERRAVIRHGRGHVVPRLDGDNLKSVRSWLQE  230



>ref|XP_003057558.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59203.1| predicted protein [Micromonas pusilla CCMP1545]
Length=285

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 111/222 (50%), Gaps = 23/222 (10%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKK--LVLRWPES----VLDRLDLHFLDAPFPAQGK--STVEGI  327
            KLRV+ LH +RTSA I  K   V  W       + D+ +   +DAP PA G+    V   
Sbjct  42   KLRVLALHSWRTSASIFAKQLAVAGWTNDDGTGLGDQCEFVCVDAPHPASGEIPRDVARA  101

Query  328  FDPPYFEWFQADkefkeyy----kfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLA---AA  486
            F+ PY+EW+ A ++ ++        +  + ++E    ++GPFDGV+GFSQGA  A   AA
Sbjct  102  FEGPYYEWWDASRDDRDGSLRYVGDDASVAFVERVAREDGPFDGVVGFSQGATFAGLLAA  161

Query  487  MPGMQREG--AALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHC--PSLHFLG  654
            +  +   G  AA+S  A   F I++SG      +       A A   P H   P++H +G
Sbjct  162  IGAVDGRGPFAAVSAEAPPVFAILLSGMLARTSE--AAATYAEAKDSPRHASIPTMHVIG  219

Query  655  ETD--FQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGT  774
              D        + L   F DP ++ H +GH VPRL+ +++ T
Sbjct  220  AADRVMPPALSERLASEFADPVIVTHERGHVVPRLERDALAT  261



>ref|XP_005525847.1| PREDICTED: ovarian cancer-associated gene 2 protein homolog [Pseudopodoces 
humilis]
Length=228

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 20/203 (10%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAP--FPAQGKSTVEGIFDPPY  342
            + LR++ LHG+R SA  L++      +++  R +L  +DAP   PA  +   +G  DPP 
Sbjct  5    RPLRLLALHGYRQSARRLRQRTGALRKALRGRAELLIIDAPHPLPAAAEDDSDGD-DPPR  63

Query  343  FEWF------QADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
              WF      +A +        +E L  +   + + GPFDG+LGFSQGA LAA +  ++ 
Sbjct  64   GWWFSGPGTFEAGEAAAAPVGLDESLSTVAAALAEYGPFDGLLGFSQGAALAAMVCALRA  123

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD--FQKEE  678
             G    +   + F ++++G     P  G      + +  P+  P+LH +G+TD       
Sbjct  124  RG---DRRFPVTFAVLVAGFASRSPAHG------HFYREPIALPTLHIVGDTDAVIAAAL  174

Query  679  GKLLLECFVDPHLIHHPKGHTVP  747
             + L  CFV+P ++ HP GH +P
Sbjct  175  SRELARCFVEPVILTHPGGHFIP  197



>gb|KDD75386.1| FSH1 serine hydrolase [Helicosporidium sp. ATCC 50920]
Length=230

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 106/232 (46%), Gaps = 37/232 (16%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLR--------------WPESVLDRLDLHFLDAPFPA  300
            + +KLR++  H FRTSA I ++ V +                +++ D +++ ++DAP PA
Sbjct  1    MTRKLRLLAFHSFRTSANIFQQQVRKNCALALSTFMLRAGLDKALDDLIEVVYIDAPNPA  60

Query  301  QGK--STVEGIFDPPYFEWFQADkefkeyykfeeCLEYIED-------YMVKNGPFDGVL  453
             G     V   F  PY+EW+               L+Y ++        +   GPFDGV+
Sbjct  61   SGPIPDDVLPFFQGPYYEWWNV-----TPTATSMVLKYADESFALAAKVLKDRGPFDGVM  115

Query  454  GFSQGAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHC  633
            GFSQG  +A    G+QR G        ++F +  +G +    +        + ++     
Sbjct  116  GFSQGGAMATLTVGLQRLGTHFQDVPPLRFCMCFAGVRVRMRELD------HVYATLADL  169

Query  634  PSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRL---DEESVGTML  780
            P++H +G+ D  K     L+E F +P +I+H + H VP L   D E + T L
Sbjct  170  PAVHIIGDRDPVKNMTNYLIEAFKNPVVINHTRSHVVPPLKGNDLERLRTFL  221



>ref|XP_005844648.1| hypothetical protein CHLNCDRAFT_138988 [Chlorella variabilis]
 gb|EFN52546.1| hypothetical protein CHLNCDRAFT_138988 [Chlorella variabilis]
Length=240

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (47%), Gaps = 34/235 (14%)
 Frame = +1

Query  166  HKKLRVVCLHGFRTSAEILKKLVLR--WPESVLDRLDLHFLDAPFPAQGK--STVEGIFD  333
            H++LRV+  H FRTS +I  + + R    +++ D +++ ++DAP  A G     V   F 
Sbjct  4    HRRLRVLATHSFRTSGKIFSEQMQRAGLDKALEDLIEVCYIDAPNAASGPIPDDVAPYFQ  63

Query  334  PPYFEWFQA---DkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQ-------------  465
             PY EW+ A   ++    Y  ++  +  +E+ + ++GPFDG++GFSQ             
Sbjct  64   GPYHEWWNASRDEQGAWTYEGWQRSVAAMEEALRRHGPFDGLMGFSQARPLGWAGQAFKA  123

Query  466  ------GAVLAAAMPGMQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPL  627
                  G  +A+   GMQR G A      ++F I  +G +   P+          F   +
Sbjct  124  WFTGRPGGAMASLAIGMQRSGFAFKDTPPLRFCICFAGIRVRDPQL-------ECFYEAM  176

Query  628  H-CPSLHFLGETDFQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFI  789
               PSLH +G+ D  K     L+  F  P +I+H +GH +P +    +  +  F+
Sbjct  177  RPAPSLHIIGDRDPVKRLTNQLIASFDHPVVINHTRGHVIPAMQPPDLQRLRAFL  231



>dbj|BAJ95682.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=73

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEI-LKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDP  336
            ++ ++ R +C+H FRTS EI LK++V  WP+ V  R DL F DAPFPA+GKS V+ IFDP
Sbjct  8    VVARRPRFLCMHVFRTSGEIMLKQVVGNWPDEVTVRFDLVFADAPFPAEGKSDVDDIFDP  67

Query  337  PYFEWF  354
            PY+EWF
Sbjct  68   PYYEWF  73



>ref|XP_009514215.1| hypothetical protein PHYSODRAFT_308487 [Phytophthora sojae]
 gb|EGZ26940.1| hypothetical protein PHYSODRAFT_308487 [Phytophthora sojae]
Length=220

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 97/206 (47%), Gaps = 23/206 (11%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFP----------AQGKSTV  318
             K RV+CLHG+R  A  L+  +     +    ++   LDAPF           A    T 
Sbjct  2    NKYRVLCLHGYRQDALKLRGRIAALRRTFKSSVEFVCLDAPFDVPYQPTSEEHANNGETG  61

Query  319  EGIFDPPYFEWFQADke-fkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            + +    +F++ + ++       + +E +EY+  ++ K GPFDG+ GFSQG  +A+ +  
Sbjct  62   DNVKQLKWFDFIRDEETGQYLLERVDEAVEYVASFVKKEGPFDGIFGFSQGGTMASLI--  119

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD--FQ  669
            +QR+ +      + +F   +S    G PK+        A    +  PSLH +GETD    
Sbjct  120  LQRQVSTPESPFEFRFAFFVSAGACGDPKY--------ATDVKVDLPSLHVIGETDAVVD  171

Query  670  KEEGKLLLECFVDPHLIHHPKGHTVP  747
             E    L + FVD  L+ HP GH +P
Sbjct  172  NERSLALRDLFVDAKLLMHPGGHYIP  197



>ref|XP_002909515.1| serine hydrolase (FSH1), putative [Phytophthora infestans T30-4]
 gb|EEY58329.1| serine hydrolase (FSH1), putative [Phytophthora infestans T30-4]
Length=220

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 97/210 (46%), Gaps = 23/210 (11%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFP----------AQGKSTV  318
             K RV+CLHG+R  A  L+  +     +    ++   LDAPF           A    T 
Sbjct  2    NKFRVLCLHGYRQDALKLRGRIAALRRTFKSSVEFVCLDAPFEVPYEPTAEEHANNGETG  61

Query  319  EGIFDPPYFEWFQADke-fkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            E +    + ++ + ++       + EE +EYI +++ K GPFDG+ GFSQG  +A+ +  
Sbjct  62   ENVKQLKWCDFTRDEETGQYLLSRVEEAIEYIANFVTKEGPFDGIFGFSQGGSMASMI--  119

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD--FQ  669
            +QR+ +        +F I +S    G PK+             +  PSLH +GETD    
Sbjct  120  LQRQVSTSESPFAFRFSIFVSAGAIGDPKY--------MSDVKVDMPSLHVIGETDAVVD  171

Query  670  KEEGKLLLECFVDPHLIHHPKGHTVPRLDE  759
             E    L + FV+P +  HP GH +P   E
Sbjct  172  NERSLALKDIFVNPTVFMHPGGHYIPTNKE  201



>gb|AFA26163.1| hypothetical protein, partial [Lolium perenne]
Length=107

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +1

Query  544  VIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQKEEGKLLLECFVDPHLIH  723
            +III GA+F G    V K  AN     +  PSLHFLG+ DF K+ G+ L+E FVDP +I 
Sbjct  1    LIIIGGAQFRGSHTIVEKPYANK----IKIPSLHFLGDNDFLKDGGEKLIESFVDPFIIR  56

Query  724  HPKGHTVPRL-DEESVGTMLGFIDKIEK  804
            HPKGHTVPRL DEE++  M  F+DK+EK
Sbjct  57   HPKGHTVPRLVDEENLKVMTRFLDKMEK  84



>ref|XP_001758707.1| predicted protein [Physcomitrella patens]
 gb|EDQ76685.1| predicted protein [Physcomitrella patens]
Length=100

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +1

Query  172  KLRVVCLHGFRTSAEILKKLV--LRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFDPPYF  345
            KLR++CLHGFR+S  IL++ +   +W + + D ++L F+DAP+ A G S +E  F PPY+
Sbjct  1    KLRLLCLHGFRSSGCILRQQIEEAKWMKEIGDLVELIFVDAPWLATGPSHLEKDFKPPYY  60

Query  346  EWFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQ  465
            EW+QA+KEF E    +  +EY+E  +  +GP DG L FSQ
Sbjct  61   EWYQANKEFTEARGLDVAVEYLEKTIEDHGPIDGFLAFSQ  100



>ref|XP_008870246.1| hypothetical protein H310_06832 [Aphanomyces invadans]
 gb|ETW01248.1| hypothetical protein H310_06832 [Aphanomyces invadans]
Length=225

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 107/207 (52%), Gaps = 16/207 (8%)
 Frame = +1

Query  160  IIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQG--KSTVEGIF-  330
            I  ++LR++CLHG R+++ ++   V  + ++     +   LD PFPA G  +  +  +F 
Sbjct  3    IGQERLRILCLHGGRSNSIVVSLQVSGFVQAFGPAAEFVELDGPFPASGPPEEDILNLFG  62

Query  331  -DPPYFEWFQADkefkeyy-kfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQR  504
             D  YFEW+ A+    + Y  +E  +EY++  +   GPFD ++GFSQGA++A        
Sbjct  63   EDDSYFEWWDANSHTDKAYPGWERSVEYLQREIATQGPFDVIIGFSQGAMMATLATAHYM  122

Query  505  EGAALSKAAKIKFVIIISGAKFGGPKFGVPKL--AANAFSHPLHCPSLHFLGETDFQKEE  678
            E      +   K ++++ G     P+ G+P +  AA+     L  PS H +GE DF  EE
Sbjct  123  E----KHSVPYKAIVLVCGM---WPQDGMPDMYSAASPGKPQLAFPSFHIMGEKDFMYEE  175

Query  679  GKLLLECFVDP--HLIHHPKGHTVPRL  753
             K  ++ F +   H+  H +GH  P L
Sbjct  176  SKAQVDYFSEATRHVYSHSQGHRFPPL  202



>ref|XP_008903312.1| hypothetical protein PPTG_10388 [Phytophthora parasitica INRA-310]
 gb|ETI50641.1| hypothetical protein F443_05799 [Phytophthora parasitica P1569]
 gb|ETL97166.1| hypothetical protein L917_05491 [Phytophthora parasitica]
 gb|ETM50320.1| hypothetical protein L914_05609 [Phytophthora parasitica]
 gb|ETN11521.1| hypothetical protein PPTG_10388 [Phytophthora parasitica INRA-310]
 gb|ETO79464.1| hypothetical protein F444_05847 [Phytophthora parasitica P1976]
 gb|ETP48415.1| hypothetical protein F442_05845 [Phytophthora parasitica P10297]
Length=217

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 96/210 (46%), Gaps = 23/210 (11%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFP----------AQGKSTV  318
             K RV+CLHG+R  A  L+  +     +    ++   LDAPF           A    T 
Sbjct  2    NKYRVLCLHGYRQDALKLRGRIAALRRTFKSSVEFVCLDAPFEVPYEPTSEEHANNGETG  61

Query  319  EGIFDPPYFEWFQADke-fkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            E +    + ++ + ++       + EE +EY+ +++ K GPFDG+ GFSQG  +A+ +  
Sbjct  62   ENVKQLKWCDFTRDEETGQYLLSRVEESIEYVANFVKKEGPFDGIFGFSQGGSMASMI--  119

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD--FQ  669
            +QR+ +        +F I +S    G PK+             +  PSLH +GETD    
Sbjct  120  LQRQVSTSESPFAFRFAIFVSAGAVGDPKY--------MRDVKVDMPSLHIIGETDAVVD  171

Query  670  KEEGKLLLECFVDPHLIHHPKGHTVPRLDE  759
             E    L + FV P +  HP GH +P   E
Sbjct  172  NERSLALKDIFVKPTVFMHPGGHYIPTNKE  201



>gb|KDP44791.1| hypothetical protein JCGZ_01291 [Jatropha curcas]
Length=94

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +1

Query  145  MENNQIIHKKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEG  324
            MEN     KK++++CLHGFRTS   L+K + +W  S+L   DL F +  FPA GKS ++G
Sbjct  1    MEN----EKKMKILCLHGFRTSGSFLQKQISKWDPSILAHFDLDFPNGIFPAGGKSDIDG  56

Query  325  IFDPPYFEWFQAD  363
            IF PPYFEWFQ +
Sbjct  57   IFPPPYFEWFQYN  69



>ref|XP_009495806.1| hypothetical protein H696_03658 [Fonticula alba]
 gb|KCV70200.1| hypothetical protein H696_03658 [Fonticula alba]
Length=288

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/237 (30%), Positives = 112/237 (47%), Gaps = 26/237 (11%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAP--FPAQ--------GKSTV  318
            + LRV+CLHGF  +   L +   R  +++    +  F+D+P  F A+          S V
Sbjct  43   QPLRVLCLHGFLQNGATLSQKTGRLRKAIKKVANFEFVDSPVLFTAEELAADEVLKNSQV  102

Query  319  EGIFDPPYFE-WFQADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
                DP     W++ D +   Y+ F+E L  +E    + GPFDGV GFSQGA + A +  
Sbjct  103  LDTSDPDTLRSWWRMDTQRLVYHSFDETLANLEQVFREQGPFDGVFGFSQGAAMGALLAH  162

Query  496  MQREG----AALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD  663
            ++ +G    + L   A ++F I++SG +   P           F  P+  PSLH +GE D
Sbjct  163  LKSKGGPDRSGLPWLADLRFAILVSGFRARDPSLRY------LFDTPVDFPSLHIIGEGD  216

Query  664  --FQKEEGKLLLECFVDPHLIHHPKGHTVPRLDEESVGTMLGFIDKI--EKMAVQEE  822
                      L E F+ P ++ H   H VP  D+++   +L F+  +  EK A Q +
Sbjct  217  RIVAPSRSVTLSETFLQPEVLSHQGKHFVP-TDKQTCEVVLTFLSHMLAEKTARQAD  272



>ref|XP_009823045.1| hypothetical protein H257_01495 [Aphanomyces astaci]
 gb|ETV88182.1| hypothetical protein H257_01495 [Aphanomyces astaci]
Length=223

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 107/204 (52%), Gaps = 18/204 (9%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFPAQGKSTVEGIFD-----  333
             KLR++CLHG RT+++I+   V  + ++  +  D   +DAPFPA G+   +GI D     
Sbjct  2    SKLRILCLHGSRTNSDIISMQVAGFRQAFGNTADFVVVDAPFPASGRPE-QGIIDFFGEE  60

Query  334  PPYFEWFQA-DkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPGMQREG  510
             PYFEW++A ++    Y  + E L Y+++ +   GP+D VLGFSQGA +A  +    +  
Sbjct  61   GPYFEWWEAFERTKVNYPGWGESLAYLQNVVNTQGPYDIVLGFSQGASVATLLTAHYQ--  118

Query  511  AALSKAAKIKFVIIISGAKFGGPKFGVPK---LAANAFSHPLHCPSLHFLGETDFQKEEG  681
             A ++    K V+++ G     P+ G+P+   +      + L  PS+H LG  D   +  
Sbjct  119  -AKNQKIPFKAVVLVCGL---CPRDGMPQHLLVEPGTTKYDLKIPSIHILGAKDDIFDLS  174

Query  682  KLLLECF--VDPHLIHHPKGHTVP  747
            + L+E +  +   +  H  GH  P
Sbjct  175  QDLVEAYSPLGRQVHVHSDGHRFP  198



>ref|XP_008880138.1| hypothetical protein H310_14123 [Aphanomyces invadans]
 gb|ETV91301.1| hypothetical protein H310_14123 [Aphanomyces invadans]
Length=222

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 108/213 (51%), Gaps = 28/213 (13%)
 Frame = +1

Query  163  IHKKLRVVCLHGFRTSAEILKKLVLRWPESV-LDRLDLHFLDAPFPAQG--KSTVEGIFD  333
            + ++LR++CLHG+RT+A ++   +  + ++   D +D   L APF A G   +TV   FD
Sbjct  6    VPRRLRLLCLHGWRTNAAVMNAQLQGFRKAFGPDGVDFTILHAPFAASGPAHTTVSDNFD  65

Query  334  PPYFEWFQ------ADkefkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
             P+FEW+          +  EY  ++  LE+  D + ++GPFD ++GFSQGA +A  +  
Sbjct  66   GPFFEWWDYIEHPAGAPKRHEYVGWKASLEFAMDRIDRDGPFDALVGFSQGAGMATLLT-  124

Query  496  MQREGAALSKAAKIKF--VIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETDFQ  669
                 A  S   +I +  V++  G     P+ G+P+      + PL  PS H LG+ D +
Sbjct  125  -----AHYSSTTRIPYSAVVLCCGLL---PRDGMPR----GLALPLSIPSFHILGKADSR  172

Query  670  KEEGKLLLECFVDP---HLIHHPKGHTVPRLDE  759
               G+ LL  + DP    +  H  GH  P   E
Sbjct  173  YGWGRKLLSAY-DPRQRQVFEHAGGHRFPVYPE  204



>gb|ETK90603.1| hypothetical protein L915_05667 [Phytophthora parasitica]
 gb|ETL44014.1| hypothetical protein L916_05605 [Phytophthora parasitica]
 gb|ETP20416.1| hypothetical protein F441_05805 [Phytophthora parasitica CJ01A1]
Length=217

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 96/210 (46%), Gaps = 23/210 (11%)
 Frame = +1

Query  169  KKLRVVCLHGFRTSAEILKKLVLRWPESVLDRLDLHFLDAPFP----------AQGKSTV  318
             K RV+CLHG+R  A  L+  +     +    ++   LDAPF           A    T 
Sbjct  2    NKYRVLCLHGYRQDALKLRGRIAALRRTFKSSVEFVCLDAPFEVPYEPTSEEHANYGETG  61

Query  319  EGIFDPPYFEWFQADke-fkeyykfeeCLEYIEDYMVKNGPFDGVLGFSQGAVLAAAMPG  495
            E +    + ++ + ++       + EE +EY+ +++ K GPFDG+ GFSQG  +A+ +  
Sbjct  62   ENVKQLKWCDFTRDEETGQYLLSRVEESIEYVANFVKKEGPFDGIFGFSQGGSMASMI--  119

Query  496  MQREGAALSKAAKIKFVIIISGAKFGGPKFGVPKLAANAFSHPLHCPSLHFLGETD--FQ  669
            +QR+ +        +F I +S    G PK+             +  PSLH +GETD    
Sbjct  120  LQRQVSTSESPFAFRFAIFVSAGAVGDPKY--------MRDVKVDMPSLHIIGETDAVVD  171

Query  670  KEEGKLLLECFVDPHLIHHPKGHTVPRLDE  759
             E    L + FV P +  HP GH +P   E
Sbjct  172  NERSLALKDIFVKPTVFMHPGGHYIPTNKE  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3165861689260