BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78152_g1_i1 len=1379 path=[1357:0-1378]

Length=1379
                                                                      Score     E

ref|NP_001275338.1|  protein THYLAKOID FORMATION1, chloroplastic        454   6e-155   
gb|ABV24460.1|  chloroplast-localized protein                           452   2e-154   Nicotiana benthamiana
ref|XP_004243305.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    452   2e-154   
ref|XP_009774759.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    452   4e-154   
ref|XP_011100338.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    447   2e-152   
ref|XP_009598990.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    442   1e-150   
gb|EYU26097.1|  hypothetical protein MIMGU_mgv1a011040mg                427   2e-144   
gb|KHG00427.1|  thylakoid formation 1, chloroplastic -like protein      425   2e-143   
ref|XP_007043465.1|  Photosystem II reaction center PSB29 protein       423   5e-143   
ref|XP_008230205.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    422   6e-143   
ref|XP_008348123.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    422   2e-142   
ref|XP_010657410.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    421   5e-142   
ref|XP_008455361.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    421   6e-142   
ref|XP_002275686.2|  PREDICTED: protein THYLAKOID FORMATION1, chl...    421   7e-142   Vitis vinifera
ref|XP_008230204.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    419   2e-141   
ref|XP_009353207.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    418   4e-141   
ref|XP_009350521.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    418   6e-141   
ref|XP_007149902.1|  hypothetical protein PHAVU_005G108600g             417   1e-140   
ref|XP_004136805.1|  PREDICTED: protein THYLAKOID FORMATION 1, ch...    417   1e-140   
ref|XP_004293467.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    415   1e-139   
ref|XP_010277914.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    414   4e-139   
ref|XP_003540338.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    413   7e-139   
ref|XP_003543363.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    412   1e-138   
gb|ACU18621.1|  unknown                                                 412   2e-138   Glycine max [soybeans]
ref|XP_006298953.1|  hypothetical protein CARUB_v10015078mg             411   3e-138   
ref|XP_008341932.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    410   7e-138   
gb|KDO55787.1|  hypothetical protein CISIN_1g022333mg                   410   1e-137   
ref|XP_010268869.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    409   2e-137   
ref|XP_007215765.1|  hypothetical protein PRUPE_ppa009554mg             407   5e-137   
ref|XP_004507227.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    408   6e-137   
gb|KDP24201.1|  hypothetical protein JCGZ_25858                         408   7e-137   
ref|XP_006447402.1|  hypothetical protein CICLE_v10016098mg             407   9e-137   
ref|NP_565491.1|  protein THYLAKOID FORMATION 1                         405   8e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467756.1|  PREDICTED: protein THYLAKOID FORMATION 1, ch...    405   1e-135   
emb|CDP11909.1|  unnamed protein product                                404   2e-135   
ref|XP_002517999.1|  Protein THYLAKOID FORMATION1, chloroplast pr...    404   2e-135   Ricinus communis
gb|KFK40470.1|  hypothetical protein AALP_AA3G376900                    402   7e-135   
ref|XP_002319386.1|  hypothetical protein POPTR_0013s14450g             402   2e-134   Populus trichocarpa [western balsam poplar]
emb|CDY13852.1|  BnaA09g43540D                                          401   3e-134   
ref|XP_004487338.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    399   9e-134   
gb|AAM64943.1|  unknown                                                 400   1e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409029.1|  hypothetical protein EUTSA_v10002049mg             400   1e-133   
ref|XP_009117460.1|  PREDICTED: protein THYLAKOID FORMATION 1, ch...    398   3e-133   
ref|XP_006841855.1|  hypothetical protein AMTR_s00003p00271230          398   6e-133   
ref|XP_006409030.1|  hypothetical protein EUTSA_v10002049mg             398   8e-133   
emb|CDX81988.1|  BnaC08g36130D                                          396   3e-132   
ref|XP_010488976.1|  PREDICTED: protein THYLAKOID FORMATION 1, ch...    396   3e-132   
gb|KEH29600.1|  photosystem II biogenesis protein                       396   4e-132   
ref|XP_003539891.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    395   4e-132   
gb|AFK45541.1|  unknown                                                 394   2e-131   
ref|XP_008812650.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    394   2e-131   
ref|XP_010095846.1|  Protein THYLAKOID FORMATION1                       394   2e-131   
ref|XP_009417272.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    392   6e-131   
emb|CBI28372.3|  unnamed protein product                                390   1e-130   
ref|XP_002884230.1|  hypothetical protein ARALYDRAFT_900469             391   2e-130   
ref|XP_002326111.1|  hypothetical protein POPTR_0019s14050g             391   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010924048.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    390   4e-130   
ref|XP_011047479.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    390   6e-130   
gb|AFK36101.1|  unknown                                                 389   1e-129   
ref|XP_003527468.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    389   2e-129   
ref|XP_010689310.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    388   3e-129   
ref|XP_010526529.1|  PREDICTED: protein THYLAKOID FORMATION 1, ch...    386   1e-128   
ref|XP_008800357.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    387   1e-128   
ref|XP_004958013.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    385   3e-128   
ref|XP_010051514.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    385   6e-128   
ref|XP_007132624.1|  hypothetical protein PHAVU_011G110700g             384   7e-128   
ref|XP_011048471.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    384   1e-127   
dbj|BAJ85363.1|  predicted protein                                      383   2e-127   
gb|KDO55793.1|  hypothetical protein CISIN_1g022333mg                   380   6e-127   
gb|AFK41560.1|  unknown                                                 381   1e-126   
ref|XP_008800359.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    378   2e-125   
gb|ACJ84959.1|  unknown                                                 377   3e-125   Medicago truncatula
gb|KDO55788.1|  hypothetical protein CISIN_1g022333mg                   377   4e-125   
ref|NP_001288825.1|  protein THYLAKOID FORMATION 1, chloroplastic       377   5e-125   
gb|EPS62074.1|  hypothetical protein M569_12719                         373   2e-124   
ref|NP_001168867.1|  uncharacterized protein LOC100382672               375   4e-124   Zea mays [maize]
gb|ACG46365.1|  chloroplast-localized Ptr ToxA-binding protein1         374   1e-123   Zea mays [maize]
ref|XP_003562907.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    373   1e-123   
gb|EAZ04323.1|  hypothetical protein OsI_26464                          372   7e-123   Oryza sativa Indica Group [Indian rice]
gb|AFO59570.1|  chloroplast Ptr ToxA-binding protein                    370   3e-122   
ref|NP_001131923.1|  chloroplast-localized Ptr ToxA-binding protein1    369   4e-122   Zea mays [maize]
ref|XP_011047480.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    368   2e-121   
ref|XP_002463017.1|  hypothetical protein SORBIDRAFT_02g036270          367   2e-121   Sorghum bicolor [broomcorn]
ref|NP_001059976.1|  Os07g0558500                                       367   3e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657830.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    367   6e-121   
gb|AAU82110.1|  chloroplast inositol phosphatase-like protein           366   1e-120   Triticum aestivum [Canadian hard winter wheat]
gb|AAR24582.1|  chloroplast-localized Ptr ToxA-binding protein1         366   1e-120   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010904849.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    364   8e-120   
gb|EMT21650.1|  hypothetical protein F775_29610                         363   2e-119   
gb|KHN22891.1|  Protein THYLAKOID FORMATION1, chloroplastic             360   2e-119   
gb|ABK22548.1|  unknown                                                 359   8e-118   Picea sitchensis
gb|EMS60897.1|  Protein THYLAKOID FORMATION1, chloroplastic             355   6e-116   
ref|XP_006592410.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    348   3e-114   
ref|XP_009412441.1|  PREDICTED: protein THYLAKOID FORMATION1, chl...    342   2e-111   
gb|KDO55789.1|  hypothetical protein CISIN_1g022333mg                   309   3e-99    
ref|XP_001774109.1|  predicted protein                                  307   7e-99    
ref|XP_001771049.1|  predicted protein                                  307   8e-99    
gb|KDO55790.1|  hypothetical protein CISIN_1g022333mg                   306   6e-98    
ref|XP_002985488.1|  hypothetical protein SELMODRAFT_122474             304   7e-98    
gb|KCW89478.1|  hypothetical protein EUGRSUZ_A01774                     298   1e-94    
gb|ACJ84665.1|  unknown                                                 263   1e-81    Medicago truncatula
tpg|DAA63111.1|  TPA: hypothetical protein ZEAMMB73_220735              257   3e-79    
ref|XP_005648137.1|  photosystem II biogenesis protein Psp29            228   6e-67    
dbj|BAJ90199.1|  predicted protein                                      208   3e-60    
gb|KFM25912.1|  Protein THYLAKOID FORMATION1, chloroplastic             202   7e-58    
ref|XP_001693657.1|  inositol phosphatase-like protein                  201   3e-57    Chlamydomonas reinhardtii
ref|XP_002957794.1|  hypothetical protein VOLCADRAFT_107813             185   6e-50    
ref|WP_015118635.1|  photosystem II biogenesis protein Psp29            178   6e-49    
ref|XP_005849113.1|  hypothetical protein CHLNCDRAFT_143677             178   2e-48    
emb|CEF97146.1|  Photosystem II Psp29, biogenesis                       177   2e-48    
ref|XP_002501243.1|  predicted protein                                  177   4e-48    Micromonas commoda
ref|XP_001416959.1|  predicted protein                                  175   6e-48    Ostreococcus lucimarinus CCE9901
ref|WP_015148891.1|  photosystem II biogenesis protein Psp29            174   3e-47    
ref|WP_006631394.1|  inositol phosphatase                               162   6e-43    
gb|EHC09457.1|  Protein thf1                                            162   9e-43    
ref|WP_009785061.1|  inositol phosphatase                               161   2e-42    
ref|WP_023064575.1|  photosystem II biogenesis protein Psp29            160   5e-42    
ref|WP_015175941.1|  Protein thf1                                       159   1e-41    
ref|WP_012165139.1|  inositol phosphatase                               158   3e-41    
ref|WP_036265526.1|  inositol phosphatase                               157   4e-41    
ref|WP_029315500.1|  inositol phosphatase                               157   4e-41    
ref|WP_026794064.1|  MULTISPECIES: inositol phosphatase                 157   7e-41    
ref|XP_007511153.1|  Thf1-like protein                                  155   1e-40    
ref|WP_026148835.1|  inositol phosphatase                               155   1e-40    
ref|WP_029637574.1|  inositol phosphatase [                             156   1e-40    
ref|WP_017717307.1|  hypothetical protein                               155   2e-40    
ref|WP_026786592.1|  MULTISPECIES: inositol phosphatase                 155   2e-40    
ref|WP_011321244.1|  inositol phosphatase                               154   4e-40    
ref|WP_010994822.1|  inositol phosphatase                               154   5e-40    
ref|WP_009554533.1|  photosystem II biogenesis protein Psp29            155   5e-40    
ref|WP_035986160.1|  inositol phosphatase                               155   5e-40    
ref|XP_003062325.1|  predicted protein                                  153   1e-39    
ref|WP_037217462.1|  inositol phosphatase                               154   1e-39    
ref|WP_015224959.1|  photosystem II biogenesis protein Psp29            153   1e-39    
ref|WP_039743748.1|  inositol phosphatase                               153   1e-39    
ref|WP_011610915.1|  inositol phosphatase                               153   2e-39    
emb|CDN11204.1|  FIG00875504: hypothetical protein                      154   2e-39    
ref|WP_035735784.1|  inositol phosphatase                               153   2e-39    
ref|WP_026100273.1|  inositol phosphatase                               153   2e-39    
ref|WP_015136573.1|  photosystem II biogenesis protein Psp29            153   2e-39    
ref|WP_015208593.1|  photosystem II biogenesis protein Psp29            152   2e-39    
ref|WP_009631983.1|  photosystem II biogenesis protein Psp29            152   4e-39    
gb|KFB84293.1|  inositol phosphatase                                    152   5e-39    
ref|WP_026097795.1|  inositol phosphatase                               152   5e-39    
ref|WP_026104408.1|  inositol phosphatase                               150   1e-38    
ref|WP_014274922.1|  hypothetical protein                               151   1e-38    
ref|WP_008314478.1|  photosystem II biogenesis protein Psp29            151   1e-38    
ref|WP_015113336.1|  Protein thf1                                       150   1e-38    
ref|WP_041035889.1|  inositol phosphatase                               150   1e-38    
ref|WP_015170179.1|  photosystem II biogenesis protein Psp29            150   2e-38    
ref|WP_015227926.1|  photosystem II biogenesis protein Psp29            150   2e-38    
ref|WP_026730990.1|  inositol phosphatase                               150   3e-38    
gb|KIJ82299.1|  inositol phosphatase                                    149   3e-38    
ref|WP_012411456.1|  inositol phosphatase                               149   5e-38    
ref|WP_015215758.1|  Protein thf1                                       148   8e-38    
ref|WP_008049328.1|  inositol phosphatase                               148   1e-37    
ref|XP_005702855.1|  thylakoid protein                                  150   1e-37    
ref|WP_015161455.1|  photosystem II biogenesis protein Psp29            147   3e-37    
gb|ERN42112.1|  photosystem II biogenesis protein Psp29                 147   3e-37    
emb|CBN56193.1|  Protein thf1 [ [                                       148   3e-37    
ref|WP_015130001.1|  Protein thf1                                       146   4e-37    
ref|WP_039727320.1|  inositol phosphatase                               146   1e-36    
ref|WP_040655274.1|  inositol phosphatase                               145   3e-36    
ref|WP_015190899.1|  Protein thf1                                       144   4e-36    
ref|WP_015201976.1|  Protein thf1                                       143   6e-36    
ref|WP_015157124.1|  photosystem II biogenesis protein Psp29            143   9e-36    
ref|WP_013191519.1|  inositol phosphatase                               142   1e-35    
ref|WP_015201078.1|  Protein thf1                                       142   1e-35    
ref|WP_015166017.1|  Protein thf1                                       142   3e-35    
ref|WP_008178223.1|  inositol phosphatase                               141   5e-35    
ref|WP_012630488.1|  inositol phosphatase                               140   5e-35    
ref|WP_039715196.1|  inositol phosphatase                               141   6e-35    
ref|WP_015185178.1|  photosystem II biogenesis protein Psp29            139   2e-34    
ref|WP_026093255.1|  inositol phosphatase                               138   3e-34    
ref|WP_011242326.1|  hypothetical protein                               139   5e-34    
ref|WP_008228834.1|  hypothetical protein                               138   5e-34    
ref|WP_040009938.1|  inositol phosphatase                               137   6e-34    
ref|WP_039755956.1|  inositol phosphatase                               138   6e-34    
ref|WP_040554058.1|  inositol phosphatase                               137   7e-34    
ref|WP_015079355.1|  photosystem II biogenesis protein Psp29            136   1e-33    
ref|WP_017299677.1|  hypothetical protein                               137   1e-33    
ref|WP_016871386.1|  MULTISPECIES: inositol phosphatase                 135   1e-33    
ref|WP_035996920.1|  inositol phosphatase                               137   2e-33    
ref|WP_015957104.1|  inositol monophosphatase                           135   2e-33    
ref|WP_028090006.1|  inositol phosphatase                               135   4e-33    
ref|WP_026222227.1|  inositol phosphatase                               135   4e-33    
ref|WP_017714683.1|  hypothetical protein                               135   5e-33    
ref|WP_036534113.1|  inositol phosphatase                               135   5e-33    
ref|WP_031291698.1|  inositol phosphatase                               135   7e-33    
gb|ESA38273.1|  photosystem ii bioproteinsis protein psp29              135   8e-33    
ref|WP_008200624.1|  inositol monophosphatase                           134   1e-32    
ref|WP_013325147.1|  inositol monophosphatase                           134   1e-32    
ref|WP_015136201.1|  Protein thf1                                       134   1e-32    
ref|WP_027400742.1|  inositol phosphatase                               133   2e-32    
gb|KIE11052.1|  inositol phosphatase                                    132   2e-32    
ref|WP_024969803.1|  inositol phosphatase                               133   2e-32    
ref|WP_002732851.1|  photosystem II biogenesis protein Psp29            133   2e-32    
ref|WP_002791587.1|  inositol monophosphatase                           133   2e-32    
ref|WP_004160330.1|  Protein thf1                                       133   2e-32    
ref|WP_002767805.1|  inositol monophosphatase                           133   3e-32    
ref|WP_004161335.1|  inositol monophosphatase                           133   3e-32    
ref|WP_015192780.1|  Protein thf1                                       133   3e-32    
ref|WP_036021484.1|  inositol phosphatase                               133   3e-32    
emb|CAO88510.1|  unnamed protein product                                132   3e-32    Microcystis aeruginosa PCC 7806
ref|WP_016515471.1|  Thf1-like protein                                  132   3e-32    
ref|XP_003078204.1|  inositol phosphatase-like protein (ISS)            139   4e-32    
ref|WP_004163909.1|  inositol monophosphatase                           132   4e-32    
ref|WP_002754204.1|  inositol monophosphatase                           132   4e-32    
dbj|GAL93135.1|  hypothetical protein N44_01822                         132   4e-32    
gb|EKV03409.1|  photosystem II biogenesis protein Psp29                 133   5e-32    
ref|WP_017310934.1|  inositol phosphatase                               131   5e-32    
ref|WP_012306361.1|  MULTISPECIES: inositol monophosphatase             132   5e-32    
ref|WP_012267057.1|  inositol monophosphatase                           132   6e-32    
ref|WP_006511842.1|  photosystem II biogenesis protein Psp29            132   8e-32    
ref|WP_002761048.1|  inositol monophosphatase                           131   8e-32    
ref|WP_006456152.1|  inositol monophosphatase                           132   9e-32    
ref|WP_016868313.1|  inositol phosphatase                               130   1e-31    
ref|WP_016859299.1|  inositol phosphatase                               130   1e-31    
ref|WP_017303638.1|  hypothetical protein                               131   1e-31    
gb|EKD11393.1|  Thf1-like protein                                       130   2e-31    
ref|WP_040936134.1|  inositol phosphatase                               130   2e-31    
sp|P0C1D1.1|THF1_SYNJB  RecName: Full=Protein Thf1                      130   2e-31    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_012594487.1|  inositol monophosphatase                           130   3e-31    
ref|WP_040944787.1|  inositol phosphatase                               130   3e-31    
ref|WP_015783503.1|  inositol monophosphatase                           130   3e-31    
ref|WP_028083521.1|  inositol phosphatase                               130   3e-31    
ref|WP_040934895.1|  inositol phosphatase                               130   3e-31    
ref|WP_015144955.1|  photosystem II biogenesis protein Psp29            130   4e-31    
ref|WP_019503989.1|  hypothetical protein                               130   4e-31    
ref|WP_017315549.1|  hypothetical protein                               129   4e-31    
ref|WP_009629378.1|  Protein thf1                                       128   2e-30    
ref|WP_011430990.1|  hypothetical protein                               127   4e-30    
ref|WP_006196164.1|  inositol phosphatase                               125   6e-30    
ref|WP_017740537.1|  hypothetical protein                               125   6e-30    
ref|WP_023174142.1|  Thf1                                               125   8e-30    
ref|WP_006668039.1|  MULTISPECIES: inositol phosphatase                 125   9e-30    
ref|WP_024124360.1|  photosystem II biogenesis protein Psp29            125   1e-29    
ref|WP_035154467.1|  inositol phosphatase                               124   2e-29    
ref|WP_011056976.1|  hypothetical protein                               124   2e-29    
ref|WP_008275933.1|  inositol monophosphatase                           125   2e-29    
ref|WP_036482552.1|  inositol phosphatase                               124   2e-29    
ref|WP_015169823.1|  photosystem II biogenesis protein Psp29            124   3e-29    
ref|WP_009546529.1|  MULTISPECIES: inositol monophosphatase             124   5e-29    
ref|WP_011935822.1|  inositol phosphatase                               123   6e-29    
ref|WP_026722507.1|  inositol phosphatase                               122   7e-29    
ref|WP_019487189.1|  MULTISPECIES: inositol phosphatase                 120   3e-28    
ref|WP_016877846.1|  hypothetical protein                               120   4e-28    
ref|WP_017292756.1|  hypothetical protein                               120   4e-28    
ref|WP_038026633.1|  hypothetical protein                               120   7e-28    
ref|WP_007304401.1|  inositol monophosphatase                           120   7e-28    
ref|WP_028947168.1|  inositol phosphatase                               119   2e-27    
ref|WP_036946680.1|  inositol phosphatase                               119   2e-27    
ref|WP_017321388.1|  hypothetical protein                               118   3e-27    
ref|WP_011141400.1|  hypothetical protein                               118   3e-27    
ref|WP_015123600.1|  photosystem II biogenesis protein Psp29            118   6e-27    
ref|WP_010872648.1|  inositol monophosphatase                           115   5e-26    
ref|WP_015219418.1|  Protein thf1                                       114   9e-26    
ref|WP_006530359.1|  photosystem II biogenesis protein Psp29            114   9e-26    
ref|WP_015222907.1|  photosystem II biogenesis protein Psp29            114   1e-25    
ref|WP_011130053.1|  inositol phosphatase                               114   1e-25    
gb|EFA68717.1|  conserved hypothetical protein                          112   2e-25    
gb|EFA71721.1|  Protein thf1                                            112   3e-25    
ref|WP_008234640.1|  hypothetical protein                               112   3e-25    
ref|WP_006101461.1|  inositol phosphatase                               112   4e-25    
gb|AGE52429.1|  thylakoid formation protein                             111   5e-25    
gb|AGE55183.1|  thylakoid formation protein                             111   7e-25    
ref|YP_001497380.1|  hypothetical protein NY2A_b184R                    112   8e-25    Paramecium bursaria Chlorella virus NY2A
gb|AGE51413.1|  thylakoid formation protein                             111   1e-24    
ref|NP_048481.1|  hypothetical protein                                  110   1e-24    Paramecium bursaria Chlorella virus 1
gb|AGE54783.1|  thylakoid formation protein                             111   2e-24    
ref|WP_011826182.1|  inositol phosphatase                               111   2e-24    
gb|AGE53784.1|  thylakoid formation protein                             109   3e-24    
dbj|BAP17297.1|  Thf1-like protein                                      110   4e-24    
gb|AGE54479.1|  thylakoid formation protein                             108   8e-24    
ref|YP_001498256.1|  hypothetical protein AR158_C174R                   108   1e-23    Paramecium bursaria Chlorella virus AR158
ref|WP_036915229.1|  MULTISPECIES: inositol phosphatase                 107   5e-23    
gb|AFA52594.1|  hypothetical protein                                    107   5e-23    
gb|KHN27780.1|  Protein THYLAKOID FORMATION1, chloroplastic             100   2e-22    
ref|WP_006852633.1|  inositol phosphatase                               103   1e-21    
ref|WP_038004925.1|  inositol phosphatase                               102   2e-21    
ref|WP_007097879.1|  inositol phosphatase                               102   2e-21    
gb|EAR18749.1|  hypothetical protein WH7805_02902                       102   3e-21    
ref|WP_011619342.1|  inositol phosphatase                             99.8    2e-20    
ref|XP_005535558.1|  photosystem II biogenesis protein Psb29            100   5e-20    
ref|WP_010308876.1|  inositol phosphatase                             97.1    1e-19    
ref|WP_040054909.1|  inositol phosphatase                             97.1    2e-19    
ref|WP_012954040.1|  inositol monophosphatase                         97.1    2e-19    
ref|WP_038548330.1|  inositol phosphatase                             96.3    3e-19    
ref|WP_007309818.1|  inositol monophosphatase                         95.9    3e-19    
gb|AII43376.1|  hypothetical protein KR100_08380                      95.9    4e-19    
ref|WP_035829992.1|  inositol phosphatase                             95.1    7e-19    
ref|WP_029626329.1|  inositol phosphatase                             92.4    7e-18    
ref|WP_038027773.1|  inositol phosphatase                             89.4    7e-18    
ref|WP_011933120.1|  inositol phosphatase                             92.0    9e-18    
ref|WP_007102425.1|  inositol phosphatase                             90.9    2e-17    
gb|KGG12501.1|  hypothetical protein EV05_1713                        90.1    4e-17    
gb|EJK76212.1|  hypothetical protein THAOC_02035                      89.0    2e-16    
ref|WP_011359855.1|  inositol phosphatase                             87.0    5e-16    
ref|WP_012195396.1|  hypothetical protein                             86.7    6e-16    
ref|WP_006171541.1|  inositol phosphatase                             86.7    1e-15    
ref|XP_002182081.1|  predicted protein                                86.7    2e-15    
ref|WP_019480476.1|  hypothetical protein                             85.1    2e-15    
ref|WP_028951968.1|  inositol phosphatase                             85.1    2e-15    
ref|WP_009789710.1|  inositol phosphatase                             85.1    2e-15    
ref|WP_036903721.1|  hypothetical protein                             84.3    3e-15    
emb|CAK23639.1|  Conserved hypothetical protein                       84.0    4e-15    
ref|WP_011364410.1|  inositol phosphatase                             83.6    6e-15    
ref|WP_038554708.1|  inositol phosphatase                             82.8    1e-14    
ref|WP_036920703.1|  inositol phosphatase                             82.4    2e-14    
gb|AHF63604.1|  Thf1-like protein                                     82.4    2e-14    
emb|CBN76436.1|  conserved unknown protein                            82.0    2e-14    
gb|AII45196.1|  hypothetical protein KR49_01790                       80.5    8e-14    
ref|WP_011128166.1|  inositol phosphatase                             79.7    1e-13    
ref|WP_025926342.1|  inositol phosphatase                             79.3    2e-13    
ref|WP_034417378.1|  hypothetical protein                             76.3    2e-12    
ref|WP_026032330.1|  inositol phosphatase                             75.9    3e-12    
ref|WP_011818248.1|  inositol phosphatase                             75.1    5e-12    
ref|XP_005838990.1|  hypothetical protein GUITHDRAFT_150871           75.9    7e-12    
ref|WP_025960415.1|  inositol phosphatase                             74.7    7e-12    
ref|WP_011125071.1|  MULTISPECIES: hypothetical protein               73.9    1e-11    
ref|WP_015108280.1|  photosystem II biogenesis protein Psp29          73.9    2e-11    
ref|WP_032516955.1|  inositol phosphatase                             73.2    2e-11    
ref|WP_025943365.1|  inositol phosphatase                             73.6    2e-11    
ref|WP_032522290.1|  inositol phosphatase                             73.2    3e-11    
ref|WP_012007555.1|  inositol phosphatase                             72.8    3e-11    
gb|EEE40406.1|  photosystem II biogenesis protein Psp29               72.8    3e-11    
gb|KGF95856.1|  hypothetical protein EU95_1158                        72.8    3e-11    
ref|WP_033829988.1|  inositol phosphatase                             72.8    3e-11    
ref|WP_036909795.1|  hypothetical protein                             72.8    3e-11    
sp|Q31BD6.2|THF1_PROM9  RecName: Full=Protein Thf1                    72.4    3e-11    
ref|WP_011376304.1|  inositol phosphatase                             72.4    4e-11    
ref|WP_025931749.1|  MULTISPECIES: inositol phosphatase               72.4    4e-11    
ref|WP_025961051.1|  inositol phosphatase                             72.4    5e-11    
gb|KGF92419.1|  hypothetical protein EU93_0684                        71.6    6e-11    
ref|WP_025973861.1|  inositol phosphatase                             71.6    7e-11    
gb|KGF89731.1|  hypothetical protein EU92_1521                        71.6    7e-11    
ref|WP_032513476.1|  inositol phosphatase                             71.6    8e-11    
gb|KGF87736.1|  hypothetical protein EU91_0769                        71.2    9e-11    
ref|XP_002287212.1|  hypothetical protein THAPSDRAFT_261275           71.2    1e-10    
sp|Q7V1W1.2|THF1_PROMP  RecName: Full=Protein Thf1                    70.9    1e-10    
ref|WP_032524284.1|  inositol phosphatase                             70.9    1e-10    
gb|KGG09510.1|  hypothetical protein EV02_0095                        70.5    2e-10    
ref|WP_011132375.1|  inositol phosphatase                             70.5    2e-10    
ref|WP_025955575.1|  inositol phosphatase                             70.5    2e-10    
ref|WP_025962361.1|  inositol phosphatase                             70.5    2e-10    
ref|WP_032518739.1|  inositol phosphatase                             70.1    2e-10    
gb|ABM72050.1|  conserved hypothetical protein                        70.1    2e-10    
gb|KGG02446.1|  hypothetical protein EU98_0386                        70.1    2e-10    
ref|WP_029985821.1|  inositol phosphatase                             69.7    2e-10    
gb|KGF98430.1|  hypothetical protein EU96_0393                        69.7    3e-10    
ref|WP_032515249.1|  inositol phosphatase                             69.7    3e-10    
ref|WP_011820155.1|  inositol phosphatase                             69.7    3e-10    
ref|WP_029958327.1|  inositol phosphatase                             69.7    4e-10    
ref|WP_025942883.1|  MULTISPECIES: inositol phosphatase               69.7    4e-10    
ref|WP_025932452.1|  inositol phosphatase                             69.7    4e-10    
ref|WP_025893145.1|  MULTISPECIES: inositol phosphatase               69.7    4e-10    
ref|WP_032526016.1|  inositol phosphatase                             69.3    4e-10    
ref|WP_029976777.1|  inositol phosphatase                             68.9    4e-10    
ref|WP_025972024.1|  inositol phosphatase                             68.9    5e-10    
ref|WP_025971227.1|  inositol phosphatase                             68.9    6e-10    
ref|WP_025959919.1|  inositol phosphatase                             68.9    6e-10    
ref|WP_011293825.1|  inositol phosphatase                             68.6    6e-10    
ref|WP_025944606.1|  inositol phosphatase                             68.6    7e-10    
ref|WP_025900451.1|  MULTISPECIES: inositol phosphatase               68.6    9e-10    
ref|WP_025940088.1|  inositol phosphatase                             68.2    1e-09    
ref|WP_029983136.1|  inositol phosphatase                             68.2    1e-09    
ref|WP_038655180.1|  inositol phosphatase                             67.8    1e-09    
ref|WP_025969165.1|  inositol phosphatase                             67.8    1e-09    
ref|WP_025928288.1|  inositol phosphatase                             67.8    1e-09    
gb|AIQ97071.1|  hypothetical protein EW15_0979                        67.8    1e-09    
ref|WP_025940254.1|  inositol phosphatase                             67.4    2e-09    
ref|WP_011823651.1|  inositol phosphatase                             67.0    2e-09    
ref|WP_025953729.1|  inositol phosphatase                             67.4    2e-09    
ref|WP_036907910.1|  inositol phosphatase                             67.0    2e-09    
gb|ABO17424.1|  conserved hypothetical protein                        67.0    2e-09    
ref|WP_025980389.1|  inositol phosphatase                             67.0    2e-09    
ref|WP_025954562.1|  inositol phosphatase                             67.0    3e-09    
gb|AIQ94849.1|  hypothetical protein EW14_0830                        66.6    3e-09    
ref|WP_025938219.1|  inositol phosphatase                             66.6    3e-09    
ref|WP_011862780.1|  inositol phosphatase                             66.6    3e-09    
ref|WP_025941719.1|  inositol phosphatase                             66.6    3e-09    
gb|KGG19715.1|  hypothetical protein EV03_2101                        66.6    4e-09    
ref|WP_025894364.1|  MULTISPECIES: inositol phosphatase               66.2    4e-09    
ref|XP_009039491.1|  hypothetical protein AURANDRAFT_66018            68.6    8e-09    
ref|YP_002048838.1|  hypothetical protein PCC_0178                    64.3    2e-08    
ref|WP_025951530.1|  inositol phosphatase                             63.9    2e-08    
gb|KGG15239.1|  hypothetical protein EV06_1110                        63.5    3e-08    
gb|KGG24785.1|  hypothetical protein EV12_2657                        58.9    7e-07    
ref|XP_005712285.1|  unnamed protein product                          59.3    7e-07    
ref|WP_036918248.1|  MULTISPECIES: hypothetical protein               58.5    1e-06    



>ref|NP_001275338.1| protein THYLAKOID FORMATION1, chloroplastic [Solanum tuberosum]
 sp|Q7XAB8.1|THF1_SOLTU RecName: Full=Protein THYLAKOID FORMATION1, chloroplastic; Flags: 
Precursor [Solanum tuberosum]
 gb|AAQ19850.1| light-regulated chloroplast-localized protein [Solanum tuberosum]
Length=293

 Score =   454 bits (1167),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 224/302 (74%), Positives = 258/302 (85%), Gaps = 12/302 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTS+SFSAI QS +RK+       +   S + D FRFR+NF+FDS+N R  SS S S
Sbjct  1     MAAVTSVSFSAITQSAERKS-------SVSSSRSIDTFRFRSNFSFDSVNVR--SSNSTS  51

Query  365   RMVVHCMST---DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VVHC S+   D+PTV++TK  FL AYKRPIP+VY+TVLQELIVQQHL RYKKSYQYDP
Sbjct  52    RFVVHCTSSSAADLPTVADTKLKFLTAYKRPIPTVYNTVLQELIVQQHLTRYKKSYQYDP  111

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+EED+ AIF+AYI+AL E+PEQYRADAQKLEEWAR Q+ N+L
Sbjct  112   VFALGFVTVYDQLMEGYPSEEDRNAIFKAYIEALKEDPEQYRADAQKLEEWARTQNANTL  171

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSS+EGE+E+I KDI++RAG+KD F YSR FA+GLFRLLEL+N TDPTILEKLCAALN
Sbjct  172   VDFSSKEGEIENIFKDIAQRAGTKDGFCYSRLFAVGLFRLLELANVTDPTILEKLCAALN  231

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYESV  1075
             VNK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGERE+QK+NE VTKCLG Y+  
Sbjct  232   VNKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERETQKANETVTKCLGDYQYA  291

Query  1076  AR  1081
              R
Sbjct  292   GR  293



>gb|ABV24460.1| chloroplast-localized protein [Nicotiana benthamiana]
Length=295

 Score =   452 bits (1164),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 223/302 (74%), Positives = 261/302 (86%), Gaps = 10/302 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTS+SFSAI QS +RK+       +   S + D FRFR+N +FD  N R+S+S    
Sbjct  1     MAAVTSVSFSAIAQSAERKS-------SVSPSRSVDTFRFRSNVSFDCFNVRSSNSSFSR  53

Query  365   R---MVVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
                  VVHCMSTD+PTV+ETK NFL+AYKRPIP+VY+TVLQELIVQQHL++YKKSY+YDP
Sbjct  54    STSRFVVHCMSTDLPTVAETKMNFLKAYKRPIPTVYNTVLQELIVQQHLIKYKKSYRYDP  113

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+EED++AIF+AYI+ALNE+P QYRADAQK EEWAR Q+ N+L
Sbjct  114   VFALGFVTVYDQLMEGYPSEEDRDAIFKAYIEALNEDPVQYRADAQKFEEWARTQNANTL  173

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSSR+GEVE+ILKDI++RAG+KDSF YSR FA+GLFRLLEL+N TDPTILEKLCA+LN
Sbjct  174   VDFSSRDGEVENILKDIAQRAGTKDSFCYSRLFAVGLFRLLELANVTDPTILEKLCASLN  233

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYESV  1075
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGERESQK+NEAVTKCLG Y+  
Sbjct  234   INKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERESQKANEAVTKCLGDYQYA  293

Query  1076  AR  1081
              R
Sbjct  294   GR  295



>ref|XP_004243305.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Solanum 
lycopersicum]
Length=293

 Score =   452 bits (1163),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 258/302 (85%), Gaps = 12/302 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTS+SFSAI QS +RK+       +   S + D FRFR+NF+FDS+N R  SS S S
Sbjct  1     MAAVTSVSFSAITQSAERKS-------SVSSSRSIDTFRFRSNFSFDSVNVR--SSNSTS  51

Query  365   RMVVHCMST---DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VVHC S+   D+PTV++TK  FL AYKRPIP+VY+TVLQELIVQQHL RYKKSYQYDP
Sbjct  52    RFVVHCTSSSAADLPTVADTKMKFLTAYKRPIPTVYNTVLQELIVQQHLTRYKKSYQYDP  111

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+EED+ AIF+AY++AL E+PEQYRADAQKLEEWAR Q+ N+L
Sbjct  112   VFALGFVTVYDQLMEGYPSEEDRNAIFKAYVEALKEDPEQYRADAQKLEEWARTQNANTL  171

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSS++GE+E+I KDI++RAG+KD F YSR FA+GLFRLLEL+N TDPTILEKLCAALN
Sbjct  172   VDFSSKDGEIENIFKDIAQRAGTKDGFCYSRLFAVGLFRLLELANVTDPTILEKLCAALN  231

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYESV  1075
             VNK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGERE+QK+NE VTKCLG Y+  
Sbjct  232   VNKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERETQKANETVTKCLGDYQYA  291

Query  1076  AR  1081
              R
Sbjct  292   GR  293



>ref|XP_009774759.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Nicotiana 
sylvestris]
Length=297

 Score =   452 bits (1162),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 224/304 (74%), Positives = 262/304 (86%), Gaps = 12/304 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTS+SFSAI QS +RK+       +   S + D FRFR+N +FD  N R+S+S   S
Sbjct  1     MAAVTSVSFSAIAQSAERKS-------SVSPSRSVDTFRFRSNLSFDCFNVRSSNSSFSS  53

Query  365   RM-----VVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
                    VVHCMSTD+PTV+ETK NFL+AYKRPIP+VY+TVLQELIVQQHL++YKKSY+Y
Sbjct  54    NSSTSRFVVHCMSTDLPTVAETKMNFLKAYKRPIPTVYNTVLQELIVQQHLIKYKKSYRY  113

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             DPVFALGFVTVYD+LMEGYP+EED++AIF+AYI+ALNE+P QYRADAQK EEWAR Q+ N
Sbjct  114   DPVFALGFVTVYDQLMEGYPSEEDRDAIFKAYIEALNEDPVQYRADAQKFEEWARTQNAN  173

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             +LVDFSSR+GEVE+ILKDI++RAG+KDSF YSR FA+GLFRLLEL+N TDPTILEKLCA+
Sbjct  174   TLVDFSSRDGEVENILKDIAQRAGTKDSFCYSRLFAVGLFRLLELANVTDPTILEKLCAS  233

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYE  1069
             LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGERESQK+NEAVTKCLG Y+
Sbjct  234   LNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERESQKANEAVTKCLGDYQ  293

Query  1070  SVAR  1081
                R
Sbjct  294   YAGR  297



>ref|XP_011100338.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Sesamum 
indicum]
Length=296

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/302 (75%), Positives = 258/302 (85%), Gaps = 9/302 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TS+SF+AI QS DRK     S  +      S+ + F+    +DS NFR+ SS S  
Sbjct  1     MAALTSVSFAAITQSTDRKV----SVPSTRTYLASNFYAFKLRLPYDSCNFRSGSSSS--  54

Query  365   RMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVVHCMST  D PTVSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK+SYQYDPV
Sbjct  55    RMVVHCMSTATDPPTVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRSYQYDPV  114

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP++ED+EAIF+AYI+ALNE+P QYRADA+KLEEWAR+Q  +SLV
Sbjct  115   FALGFVTVYDQLMEGYPSDEDREAIFKAYIEALNEDPAQYRADAKKLEEWARSQSASSLV  174

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             DF+SREGEVE ILKDIS RAGSK SF YSRFFA+GLFRLLELSNAT+PTIL+KLC ALNV
Sbjct  175   DFASREGEVEGILKDISTRAGSKGSFSYSRFFAVGLFRLLELSNATEPTILDKLCLALNV  234

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE-SQKSNEAVTKCLGQYESV  1075
             NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK  ER  SQK+NEAVTKCL +Y+S 
Sbjct  235   NKKSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKVEERTASQKANEAVTKCLAEYQSA  294

Query  1076  AR  1081
             AR
Sbjct  295   AR  296



>ref|XP_009598990.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Nicotiana 
tomentosiformis]
Length=297

 Score =   442 bits (1138),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/304 (73%), Positives = 259/304 (85%), Gaps = 12/304 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTS+SFSAI QS +RK+       +   S   D FRFR+N +FD  N R+S+S   S
Sbjct  1     MAAVTSVSFSAISQSAERKS-------SVSPSRYVDTFRFRSNVSFDCFNVRSSNSSFSS  53

Query  365   RM-----VVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
                    VVHCMSTD+PTV+ETK NFL+AYKRPIP+VY+TVLQELIV QHL++YKKSY+Y
Sbjct  54    NSSTSRFVVHCMSTDLPTVAETKMNFLKAYKRPIPTVYNTVLQELIVLQHLIKYKKSYRY  113

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             DPVFALGFVTVYD+LMEGYP+EED++AIF+AYI+ALNE+P QYRADAQK EEWAR Q+ N
Sbjct  114   DPVFALGFVTVYDQLMEGYPSEEDRDAIFKAYIEALNEDPVQYRADAQKFEEWARTQNAN  173

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             +LVDFSSR+GEVE+ILKDI++RAG+K+SF YSR FA+GLFRLLEL+N TDPTILEKLCA+
Sbjct  174   TLVDFSSRDGEVENILKDIAQRAGTKNSFCYSRLFAVGLFRLLELANVTDPTILEKLCAS  233

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYE  1069
             LN +K+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGERESQK+NEAVTKCLG Y+
Sbjct  234   LNTDKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERESQKANEAVTKCLGDYQ  293

Query  1070  SVAR  1081
                R
Sbjct  294   YAGR  297



>gb|EYU26097.1| hypothetical protein MIMGU_mgv1a011040mg [Erythranthe guttata]
Length=294

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/297 (71%), Positives = 254/297 (86%), Gaps = 13/297 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV S+SF+ I QSPDRK      ++    +S  DAF+ R   ++DS NFR S S   +
Sbjct  1     MAAVNSVSFAGIVQSPDRK-----FTARSNSASNFDAFKLRGTVSYDSYNFRASRS---T  52

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVVHCM+  TD+PTVS+TK+NFL+AYKRPIPS+Y+TVLQELIVQQHL+RYK++Y+YDPV
Sbjct  53    RMVVHCMTAVTDIPTVSQTKSNFLKAYKRPIPSIYNTVLQELIVQQHLVRYKRTYRYDPV  112

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVT+YD+LMEGYP++ED++AIF+AY++ALNE+P QYR DAQKLEEWARAQ  +SLV
Sbjct  113   FALGFVTIYDKLMEGYPSDEDRDAIFKAYVEALNEDPAQYRVDAQKLEEWARAQSSSSLV  172

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             DF+S+EGEVE ILKDI+ERAGS  +F YSRFFA+GLFRLLEL+NAT+PTIL+KLCAALN+
Sbjct  173   DFTSKEGEVEGILKDIAERAGSNGNFSYSRFFAVGLFRLLELANATEPTILDKLCAALNI  232

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER---ESQKSNEAVTKCLG  1060
             NK+S+DRDLDVYRNLLSKLVQAKELLKEYV REKKK  ER    SQK++EAVTK LG
Sbjct  233   NKKSIDRDLDVYRNLLSKLVQAKELLKEYVDREKKKMAERAAAASQKASEAVTKMLG  289



>gb|KHG00427.1| thylakoid formation 1, chloroplastic -like protein [Gossypium 
arboreum]
Length=298

 Score =   425 bits (1092),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/298 (72%), Positives = 252/298 (85%), Gaps = 7/298 (2%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV+SLSF AIGQ+   +  N  S      +     FRFRT+  + S+  R S++ S S
Sbjct  1     MAAVSSLSFPAIGQTSGDRKLNVPSPRYLASNFEG--FRFRTSLLYQSVGLRASTTASPS  58

Query  365   RMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
               VV+CMST  D PTVSETK++FL+AYKRPIPSVY+TVLQELIVQQHLMRYKK+Y+YD V
Sbjct  59    --VVYCMSTATDTPTVSETKSSFLKAYKRPIPSVYNTVLQELIVQQHLMRYKKTYRYDAV  116

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP++ED++AIF+AYI AL E+P+QYRADAQKLEEWARAQ  +SLV
Sbjct  117   FALGFVTVYDQLMEGYPSDEDRDAIFQAYINALKEDPQQYRADAQKLEEWARAQTSSSLV  176

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
              FSSR+GEVE+ILKDI+ERAGSK SF YSRFFAIGLFRLLEL+NAT+PT+LEKLCAALN+
Sbjct  177   KFSSRDGEVEAILKDIAERAGSKGSFSYSRFFAIGLFRLLELANATEPTVLEKLCAALNI  236

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYE  1069
             +K+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER ES K+NEAV KC G+Y+
Sbjct  237   DKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERSESPKANEAVKKCSGEYQ  294



>ref|XP_007043465.1| Photosystem II reaction center PSB29 protein [Theobroma cacao]
 gb|EOX99296.1| Photosystem II reaction center PSB29 protein [Theobroma cacao]
Length=298

 Score =   423 bits (1088),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 259/303 (85%), Gaps = 9/303 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQ-SPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAV+SLS SAIGQ S DRK    +  SAR L+S  +  RFRT+  + S+  R S+S S 
Sbjct  1     MAAVSSLSLSAIGQTSGDRKV---NVPSARYLASNFEGLRFRTSVLYHSVGVRGSASASP  57

Query  362   SRMVVHCM--STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             S  VVHCM  +TDVPTVSETK NFL+AYKRPIPSVY+TVLQELIVQQHLMRYK +Y+YD 
Sbjct  58    S--VVHCMCAATDVPTVSETKLNFLKAYKRPIPSVYNTVLQELIVQQHLMRYKWTYRYDA  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP++ED++AIF+AYIKAL E+P+QYR DAQKLEEWAR+Q  +SL
Sbjct  116   VFALGFVTVYDQLMEGYPSDEDRDAIFQAYIKALKEDPQQYRIDAQKLEEWARSQTSSSL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSSR+GEVE+ILKDI+ERAG   SF YSRFFA+GLFRLLEL+NAT+PT+LEKLCAALN
Sbjct  176   VEFSSRDGEVEAILKDIAERAGRMGSFSYSRFFAVGLFRLLELANATEPTVLEKLCAALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYES  1072
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER ESQK+NEAV KCLG+ + 
Sbjct  236   INKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERSESQKANEAVKKCLGECQY  295

Query  1073  VAR  1081
             V +
Sbjct  296   VGQ  298



>ref|XP_008230205.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic isoform 
X2 [Prunus mume]
Length=284

 Score =   422 bits (1086),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 252/290 (87%), Gaps = 7/290 (2%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV SLSFSA+ Q  DRK+     SS R L+  S+  R RT+F+ ++   R SSS S  
Sbjct  1     MAAVASLSFSALSQCSDRKSI---ISSTRNLAYNSEGLRLRTSFSCNNGGVRASSSSS--  55

Query  365   RMVVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFA  544
             RMV+HCMS D PTV++TK NFL+AYKRPIPSVY+TVLQELIVQQHL++YKKSY+YDPVFA
Sbjct  56    RMVIHCMS-DAPTVADTKLNFLKAYKRPIPSVYNTVLQELIVQQHLIKYKKSYRYDPVFA  114

Query  545   LGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF  724
             LGFVTV+D+LM+GYP++ED+EAIF+AYIKALNE+PEQYR DAQKLEEWARAQ  +SLV+F
Sbjct  115   LGFVTVFDQLMDGYPSDEDREAIFQAYIKALNEDPEQYRIDAQKLEEWARAQTSSSLVEF  174

Query  725   SSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNK  904
              SREGE+E  LKDI+ERA SK SF YSRFFA+GLFRLLEL+NAT+PTILEKLCAALN++K
Sbjct  175   PSREGEIEGTLKDIAERAASKGSFSYSRFFAVGLFRLLELANATEPTILEKLCAALNIDK  234

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             +SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR ER E+QK+NEAVTK
Sbjct  235   RSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKREERVENQKANEAVTK  284



>ref|XP_008348123.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Malus 
domestica]
Length=295

 Score =   422 bits (1084),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 254/297 (86%), Gaps = 8/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV SLSFSA+ Q  DRK+     SSAR L S ++  RFRT+ +      R SSS S  
Sbjct  1     MAAVASLSFSALSQCSDRKSV---VSSARNLGSNAEGIRFRTSISSHYGGIRASSSSS--  55

Query  365   RMVVHCM--STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVVHCM  S+D PTV++TK NFL+AYKRPIPSVY++VLQELIVQQHLM+YK++Y+YDPV
Sbjct  56    RMVVHCMAGSSDAPTVADTKLNFLKAYKRPIPSVYNSVLQELIVQQHLMKYKRTYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP++ED+EAIF+AYIKALNE+PEQYR DAQKLEEWARAQ  +SLV
Sbjct  116   FALGFVTVYDQLMDGYPSDEDREAIFQAYIKALNEDPEQYRTDAQKLEEWARAQTSSSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F SREGEVE  LKDI+ERA  K+SF YSRFFAIGLFRLLE++ AT+PT+LEKLCAALN+
Sbjct  176   EFPSREGEVEVALKDIAERAAGKESFSYSRFFAIGLFRLLEVAKATEPTVLEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             +K+SVDRDLDVYRNLLSKLVQAKELL+EYVAREKKKR ER E+QK++E VTKCLG Y
Sbjct  236   DKRSVDRDLDVYRNLLSKLVQAKELLREYVAREKKKREERVETQKASETVTKCLGDY  292



>ref|XP_010657410.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic isoform 
X2 [Vitis vinifera]
Length=297

 Score =   421 bits (1082),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 218/298 (73%), Positives = 256/298 (86%), Gaps = 8/298 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTSLSFSA+GQS +RK       + R  +S  +AFRFR NF   ++  R+SSS S S
Sbjct  1     MAAVTSLSFSALGQSSERKV---PVPTTRSFASAFEAFRFRANFY--AVGVRSSSSSSSS  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVV CMS  TDVPTVSETK NFL+ YKRPIPS+Y+T+LQEL+VQQHLMRYK++Y+YD V
Sbjct  56    RMVVQCMSSVTDVPTVSETKMNFLKNYKRPIPSIYNTLLQELMVQQHLMRYKRTYRYDAV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP++ED++ IF+ YIKAL E+PEQYR DAQ LEEWAR+Q  +SLV
Sbjct  116   FALGFVTVYDQLMDGYPSDEDRDIIFQVYIKALREDPEQYRKDAQMLEEWARSQTASSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSS+EGEVE ILKDI+ERAG K SF YSRFFAIGLFRLLEL+NAT+PTILEKLCAA N+
Sbjct  176   EFSSKEGEVEGILKDIAERAGGKGSFSYSRFFAIGLFRLLELANATEPTILEKLCAAFNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYE  1069
             +K+SVDRDLDVYRNLL+KLVQAKELLKEYV REKKKR ER ESQK+NEA+TKCLG+YE
Sbjct  236   SKRSVDRDLDVYRNLLTKLVQAKELLKEYVDREKKKREERVESQKANEAITKCLGEYE  293



>ref|XP_008455361.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Cucumis 
melo]
Length=298

 Score =   421 bits (1081),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 253/297 (85%), Gaps = 8/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV S+SFS + Q  DR+       S+R LSS  D FRFRT+  F   + R   S   S
Sbjct  1     MAAVNSISFSTLNQCSDRR---FPVPSSRSLSSNFDGFRFRTSL-FTHYS-RVRPSTFSS  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMV+HCMS  TDV TV+ETK NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YDPV
Sbjct  56    RMVIHCMSAGTDVTTVAETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP++ED+EAIF+AYIKALNE+PEQYR DAQKLEEWAR+Q   SLV
Sbjct  116   FALGFVTVYDQLMEGYPSDEDREAIFQAYIKALNEDPEQYRIDAQKLEEWARSQTAASLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F+SREGEVESILKDI+ERAGSK +F YSRFFAIGLFRLLEL+NAT+P+ILEKLCAALN+
Sbjct  176   EFASREGEVESILKDIAERAGSKGNFSYSRFFAIGLFRLLELANATEPSILEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE-SQKSNEAVTKCLGQY  1066
             +K+ VDRDLDVYRNLLSKLVQAKELLKEY+ REKKKR ER  SQ +NEA+TKCLG+Y
Sbjct  236   DKKGVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKRDERAGSQTANEAITKCLGEY  292



>ref|XP_002275686.2| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic isoform 
X1 [Vitis vinifera]
Length=299

 Score =   421 bits (1081),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 218/298 (73%), Positives = 256/298 (86%), Gaps = 8/298 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTSLSFSA+GQS +RK       + R  +S  +AFRFR NF   ++  R+SSS S S
Sbjct  1     MAAVTSLSFSALGQSSERKV---PVPTTRSFASAFEAFRFRANFY--AVGVRSSSSSSSS  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVV CMS  TDVPTVSETK NFL+ YKRPIPS+Y+T+LQEL+VQQHLMRYK++Y+YD V
Sbjct  56    RMVVQCMSSVTDVPTVSETKMNFLKNYKRPIPSIYNTLLQELMVQQHLMRYKRTYRYDAV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP++ED++ IF+ YIKAL E+PEQYR DAQ LEEWAR+Q  +SLV
Sbjct  116   FALGFVTVYDQLMDGYPSDEDRDIIFQVYIKALREDPEQYRKDAQMLEEWARSQTASSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSS+EGEVE ILKDI+ERAG K SF YSRFFAIGLFRLLEL+NAT+PTILEKLCAA N+
Sbjct  176   EFSSKEGEVEGILKDIAERAGGKGSFSYSRFFAIGLFRLLELANATEPTILEKLCAAFNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYE  1069
             +K+SVDRDLDVYRNLL+KLVQAKELLKEYV REKKKR ER ESQK+NEA+TKCLG+YE
Sbjct  236   SKRSVDRDLDVYRNLLTKLVQAKELLKEYVDREKKKREERVESQKANEAITKCLGEYE  293



>ref|XP_008230204.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic isoform 
X1 [Prunus mume]
Length=287

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 252/292 (86%), Gaps = 8/292 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV SLSFSA+ Q  DRK+     SS R L+  S+  R RT+F+ ++   R SSS S  
Sbjct  1     MAAVASLSFSALSQCSDRKSI---ISSTRNLAYNSEGLRLRTSFSCNNGGVRASSSSS--  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMV+HCMS  +  PTV++TK NFL+AYKRPIPSVY+TVLQELIVQQHL++YKKSY+YDPV
Sbjct  56    RMVIHCMSGASYAPTVADTKLNFLKAYKRPIPSVYNTVLQELIVQQHLIKYKKSYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTV+D+LM+GYP++ED+EAIF+AYIKALNE+PEQYR DAQKLEEWARAQ  +SLV
Sbjct  116   FALGFVTVFDQLMDGYPSDEDREAIFQAYIKALNEDPEQYRIDAQKLEEWARAQTSSSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F SREGE+E  LKDI+ERA SK SF YSRFFA+GLFRLLEL+NAT+PTILEKLCAALN+
Sbjct  176   EFPSREGEIEGTLKDIAERAASKGSFSYSRFFAVGLFRLLELANATEPTILEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             +K+SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR ER E+QK+NEAVTK
Sbjct  236   DKRSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKREERVENQKANEAVTK  287



>ref|XP_009353207.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=295

 Score =   418 bits (1075),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 253/297 (85%), Gaps = 8/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV SLSFSA+ Q  DRK+     S AR L S ++  RFRT+ +      R SS  S  
Sbjct  1     MAAVASLSFSALSQCSDRKSV---VSPARNLGSNAEGIRFRTSISSHYGGIRASSWSS--  55

Query  365   RMVVHCM--STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVVHCM  S+D PTV++TK NFL+AYKRPIPSVY++VLQELIVQQHLM+YK++Y+YDPV
Sbjct  56    RMVVHCMAGSSDSPTVADTKLNFLKAYKRPIPSVYNSVLQELIVQQHLMKYKRTYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP++ED+EAIF+AYIKALNE+PEQYR DAQKLEEWARAQ  +SLV
Sbjct  116   FALGFVTVYDQLMDGYPSDEDREAIFQAYIKALNEDPEQYRTDAQKLEEWARAQTSSSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F SREGEVE+ LKDI+ERA  K+SF YSRFFAIGLFRLLE++ AT+PT+LEKLCAALN+
Sbjct  176   EFPSREGEVEAALKDIAERAAGKESFSYSRFFAIGLFRLLEVAKATEPTVLEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             +K+SVDRDLDVYRNLLSKLVQAKELL+EYVAREKKKR ER E+QK++E VTKCLG Y
Sbjct  236   DKRSVDRDLDVYRNLLSKLVQAKELLREYVAREKKKREERAETQKASETVTKCLGDY  292



>ref|XP_009350521.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=297

 Score =   418 bits (1075),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 258/302 (85%), Gaps = 8/302 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV +LSFSA+ Q  DRK+     SS R L+S +D  RFRT+ +  +   R SSS S  
Sbjct  1     MAAVAALSFSALSQFSDRKSV---VSSTRNLASNADGLRFRTSISSHNGGIRASSSSS--  55

Query  365   RMVVHCM--STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVVHCM  S+D+PTV++TK NFL+AYKRPIPSVY++VLQELIVQQHLM+YK++Y+YDPV
Sbjct  56    RMVVHCMAGSSDIPTVADTKLNFLKAYKRPIPSVYNSVLQELIVQQHLMKYKRTYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP++ED+ AIF+AY+KALNE+PEQYR DAQKLEEWARAQ  +SLV
Sbjct  116   FALGFVTVYDQLMDGYPSDEDRVAIFQAYVKALNEDPEQYRIDAQKLEEWARAQTSSSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F SREG+VE+ LKDI+ERA  K+SF YSRFFAIGLFRLLE++ AT+PT+LEKLCAALN+
Sbjct  176   EFPSREGKVEAALKDIAERAAGKESFSYSRFFAIGLFRLLEVAKATEPTVLEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYESV  1075
             +K+SVDRDLDVYRNLLSKLVQAKELL+EYVAREKKKR ER E+QK++E V KCLG Y  V
Sbjct  236   DKRSVDRDLDVYRNLLSKLVQAKELLREYVAREKKKREERVETQKASETVAKCLGDYNHV  295

Query  1076  AR  1081
             ++
Sbjct  296   SQ  297



>ref|XP_007149902.1| hypothetical protein PHAVU_005G108600g [Phaseolus vulgaris]
 gb|ESW21896.1| hypothetical protein PHAVU_005G108600g [Phaseolus vulgaris]
Length=297

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/296 (71%), Positives = 248/296 (84%), Gaps = 7/296 (2%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFSA+   P+RK    SS+     SS    F  RT+F++   + R  +S S S
Sbjct  1     MAALTSLSFSAVTHCPERKKLTLSSTRFLTSSSDF--FGLRTHFSYH--HVRLPASNSTS  56

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
              MV  CMS  TD PTVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLM+YK+SY+YDPV
Sbjct  57    NMVFQCMSSVTDAPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKRSYRYDPV  116

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP++ED++AIF+AYIKAL E+P++YR DA+KLEEWA  Q+ +SL 
Sbjct  117   FALGFVTVYDKLMEGYPSDEDRDAIFQAYIKALKEDPQEYRIDARKLEEWAMVQNSSSLP  176

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSS+EGEVE ILKDI+ERA  KD F YSRFFAIGLFRLLEL+NAT+PTILEKLCAALN+
Sbjct  177   EFSSKEGEVEGILKDIAERAAGKDEFSYSRFFAIGLFRLLELANATEPTILEKLCAALNI  236

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER E QK+NEA+TKCLG+
Sbjct  237   NKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKRDERAEPQKANEAITKCLGE  292



>ref|XP_004136805.1| PREDICTED: protein THYLAKOID FORMATION 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004159194.1| PREDICTED: protein THYLAKOID FORMATION 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN43574.1| hypothetical protein Csa_7G046130 [Cucumis sativus]
Length=298

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 250/297 (84%), Gaps = 8/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV S+SFS + Q  DR+       S+R  SS    F FRT+  F   + R  +S   S
Sbjct  1     MAAVNSISFSTLNQCSDRRLL---LPSSRSHSSNFHGFPFRTS-VFTHYS-RVRASTFSS  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMV+HCMS  TDV TV+ETK NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YDPV
Sbjct  56    RMVIHCMSAGTDVTTVAETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP++ED+EAIF+AYIKALNE+PEQYR DA+K EEWAR+Q   SLV
Sbjct  116   FALGFVTVYDQLMEGYPSDEDREAIFQAYIKALNEDPEQYRIDAKKFEEWARSQTAASLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F+SREGEVESILKDI+ERAGSK +F YSRFFAIGLFRLLEL+NAT+P+ILEKLCAALN+
Sbjct  176   EFASREGEVESILKDIAERAGSKGNFSYSRFFAIGLFRLLELANATEPSILEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE-SQKSNEAVTKCLGQY  1066
             +K+ VDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER  SQ +NEA+TKCLG+Y
Sbjct  236   DKKGVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKRDERAGSQTANEAITKCLGEY  292



>ref|XP_004293467.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 252/301 (84%), Gaps = 13/301 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAVTSLSFSA+ QS    A N  S+S           RFRT+F+     FR+SSS    
Sbjct  1     MAAVTSLSFSALTQSSFPSARNLGSNSDS--------LRFRTSFSLHYGGFRSSSSSP--  50

Query  365   RMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             R+VVHCMS+  ++PTV++TK NFL+AYKRPIPSVY++VLQELIVQQHLMRYK++Y+YDPV
Sbjct  51    RLVVHCMSSSSELPTVADTKLNFLKAYKRPIPSVYNSVLQELIVQQHLMRYKRTYRYDPV  110

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP++ED++AIF+AY+ AL E+PEQYR DA+KLEEWARAQ  +SL+
Sbjct  111   FALGFVTVYDQLMDGYPSDEDRDAIFKAYVNALKEDPEQYRTDAKKLEEWARAQSSSSLI  170

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F S+EGEVE ILKDI+ERAG K SF YSRFFA+GLFR+LEL+NAT+PT+LEKLCAALN+
Sbjct  171   EFPSKEGEVEGILKDIAERAGGKGSFSYSRFFAVGLFRILELANATEPTVLEKLCAALNI  230

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYESV  1075
              K+SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR ER  +QK+NEA+  CLG+ +S+
Sbjct  231   EKRSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKREERVGTQKANEAIASCLGEPQSM  290

Query  1076  A  1078
              
Sbjct  291   G  291



>ref|XP_010277914.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Nelumbo 
nucifera]
Length=297

 Score =   414 bits (1063),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 250/298 (84%), Gaps = 8/298 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SLSF+A+GQ   RK      SSAR  SST D FRFR      S++  T +    S
Sbjct  1     MAAISSLSFTALGQVSGRKRL---VSSARPFSSTFDGFRFRKKIF--SVSIGTKTQNLNS  55

Query  365   RM-VVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             RM ++ CMS  T+VPTV ETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++YQYD 
Sbjct  56    RMAIIQCMSSVTEVPTVCETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDA  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP +ED+EAIFRAYI+AL E+PEQYR DAQKLE+WAR Q  + L
Sbjct  116   VFALGFVTVYDKLMEGYPNDEDREAIFRAYIQALKEDPEQYRNDAQKLEDWARTQSASLL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             ++F+SREGEVE ILKD+SERAG   SF YSRFFAIGLFRLLEL+NAT+PT+LEKLCAALN
Sbjct  176   IEFASREGEVEGILKDVSERAGDSGSFSYSRFFAIGLFRLLELANATEPTVLEKLCAALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYE  1069
             +NK+S+DRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER  Q++NEA+TKC+G+++
Sbjct  236   INKRSIDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERADQRANEAITKCIGEFQ  293



>ref|XP_003540338.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Glycine 
max]
 gb|KHN04291.1| Protein THYLAKOID FORMATION1, chloroplastic [Glycine soja]
Length=297

 Score =   413 bits (1061),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 213/297 (72%), Positives = 253/297 (85%), Gaps = 9/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFSA+    +RK    + SS R L+S+S+ F FRT+F++  +  R  +S S S
Sbjct  1     MAALTSLSFSAVTHCSERKV---TLSSTRFLASSSEIFGFRTDFSYHYVGVR--ASNSPS  55

Query  365   RMVVHCMS--TDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             +MVV CMS  TDVP TVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLM+YK+SY+YDP
Sbjct  56    KMVVQCMSSATDVPPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKRSYRYDP  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVT+YD+LMEGYP++ED++AIF+AYIKAL E+PEQYR DA+KLEEWAR Q   SL
Sbjct  116   VFALGFVTIYDKLMEGYPSDEDRDAIFQAYIKALKEDPEQYRIDARKLEEWARVQKPTSL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSS+EGEVE ILKDI+ERAG K  F YSRFFA+GLFRLLEL+NAT+PTIL+KLC ALN
Sbjct  176   VEFSSKEGEVEGILKDIAERAGGKGEFSYSRFFAVGLFRLLELANATEPTILDKLCVALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             +NK+SVDRDLDVYR LLSKLVQAKELLKEY+ REKKKR ER E QK+NEA+T CLGQ
Sbjct  236   INKRSVDRDLDVYRILLSKLVQAKELLKEYIDREKKKRDERAEPQKANEAITTCLGQ  292



>ref|XP_003543363.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Glycine 
max]
 gb|KHN36598.1| Protein THYLAKOID FORMATION1, chloroplastic [Glycine soja]
Length=297

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/297 (71%), Positives = 253/297 (85%), Gaps = 9/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFSA+    +RK    + SS R L+S+S+ F FRT+F++  +  R  +S S S
Sbjct  1     MAALTSLSFSAVTHCSERKV---TLSSTRFLASSSELFGFRTDFSYHYVGVR--ASNSAS  55

Query  365   RMVVHCMS--TDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             +MVV CMS  TDVP TVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLM+YK+SY+YDP
Sbjct  56    KMVVQCMSSATDVPPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKRSYRYDP  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVT+YD+LMEGYP++ED++AIF+AYIKAL E+PEQYR DA+KLEEWAR Q   SL
Sbjct  116   VFALGFVTIYDKLMEGYPSDEDRDAIFQAYIKALKEDPEQYRIDARKLEEWARVQSPTSL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSS+EGE E ILKDI+ERAG K  F YSRFFA+GLFRL+EL+NAT+PTIL+KLCAALN
Sbjct  176   VEFSSKEGEAERILKDIAERAGGKGEFSYSRFFAVGLFRLVELANATEPTILDKLCAALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             +NK+SVDRDLDVYR LLSKLVQAKELLKEY+ REKKKR ER E QK+NEA+T CLGQ
Sbjct  236   INKRSVDRDLDVYRILLSKLVQAKELLKEYIDREKKKRDERVEPQKANEAITTCLGQ  292



>gb|ACU18621.1| unknown [Glycine max]
Length=297

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/297 (71%), Positives = 253/297 (85%), Gaps = 9/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFSA+    +RK    + SS R L+S+S+ F FRT+F++  +  R  +S S S
Sbjct  1     MAALTSLSFSAVIHCSERKV---TLSSTRFLASSSELFGFRTDFSYHYVGVR--ASNSAS  55

Query  365   RMVVHCMS--TDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             +MVV CMS  TDVP TVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLM+YK+SY+YDP
Sbjct  56    KMVVQCMSSATDVPPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKRSYRYDP  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVT+YD+LMEGYP++ED++AIF+AYIKAL E+PEQYR DA+KLEEWAR Q   SL
Sbjct  116   VFALGFVTIYDKLMEGYPSDEDRDAIFQAYIKALKEDPEQYRIDARKLEEWARVQSPTSL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSS+EGE E ILKDI+ERAG K  F YSRFFA+GLFRL+EL+NAT+PTIL+KLCAALN
Sbjct  176   VEFSSKEGEAERILKDIAERAGGKGEFSYSRFFAVGLFRLVELANATEPTILDKLCAALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             +NK+SVDRDLDVYR LLSKLVQAKELLKEY+ REKKKR ER E QK+NEA+T CLGQ
Sbjct  236   INKRSVDRDLDVYRILLSKLVQAKELLKEYIDREKKKRDERVEPQKANEAITTCLGQ  292



>ref|XP_006298953.1| hypothetical protein CARUB_v10015078mg [Capsella rubella]
 gb|EOA31851.1| hypothetical protein CARUB_v10015078mg [Capsella rubella]
Length=301

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 249/297 (84%), Gaps = 15/297 (5%)
 Frame = +2

Query  182   AMAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             A  A++SLSF A+GQS D+       S+       + A R  T F+  SL +R++S  S 
Sbjct  2     AATAISSLSFPALGQSSDK------ISNFALSRPLASAIRICTKFSRHSLTYRSTSRSS-  54

Query  362   SRMVVHCMST---DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
                 +HCMS+   DVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YD
Sbjct  55    ----IHCMSSVTDDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYD  110

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
             PVFALGFVTVYD+LMEGYP+++D++AIF+AYI+ALNE+P+QYR DAQK+EEWAR+Q   S
Sbjct  111   PVFALGFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYRIDAQKMEEWARSQTSAS  170

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             LVDF SREGEVES+LKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLCA+L
Sbjct  171   LVDFFSREGEVESVLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASL  230

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             N+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER ESQK+NE ++KCLG
Sbjct  231   NINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAESQKTNETISKCLG  287



>ref|XP_008341932.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Malus 
domestica]
Length=297

 Score =   410 bits (1054),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 255/302 (84%), Gaps = 8/302 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV +LSFSA+    DRK+     SS R L+ST+D  RFR   +  S   R SSS S  
Sbjct  1     MAAVAALSFSALSPCSDRKSV---VSSTRNLASTADGLRFRRCISSRSGGIRASSSSS--  55

Query  365   RMVVHCM--STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMVVHCM  S+D PTV++TK  FL+AYKRPIPSVY++VLQELIVQQHLM+YK++Y+YDPV
Sbjct  56    RMVVHCMAGSSDPPTVADTKLKFLKAYKRPIPSVYNSVLQELIVQQHLMKYKRTYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP+++D+EAIF+AYIKALNE+PEQYR DAQKLEEWARAQ  +SLV
Sbjct  116   FALGFVTVYDQLMDGYPSDDDREAIFQAYIKALNEDPEQYRTDAQKLEEWARAQTSSSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSSREGEVE+ LKDI+ERA  K SF YSRFFAIGLFRLLE++ AT+PT+LEKLC ALN+
Sbjct  176   EFSSREGEVEAALKDIAERAAGKGSFSYSRFFAIGLFRLLEVAKATEPTVLEKLCGALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYESV  1075
             +K+SVDRDLDVYRNLLSKLVQAKELL+EYV REKKKR ER E+Q+++E VTKCLG Y+ V
Sbjct  236   DKRSVDRDLDVYRNLLSKLVQAKELLREYVDREKKKREERAETQRASETVTKCLGDYDYV  295

Query  1076  AR  1081
             ++
Sbjct  296   SQ  297



>gb|KDO55787.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
Length=299

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/298 (70%), Positives = 250/298 (84%), Gaps = 8/298 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MA++TS++F++IGQ+  ++  N SS+ +   +     FRFRT+     + FR  +S S S
Sbjct  1     MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEG--FRFRTSLFCHCVRFR--ASSSSS  56

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             RM++ CMST  DVP TV+ETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK++YQYDP
Sbjct  57    RMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDP  116

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYDRLMEGYP+EED+EAIF+AYI AL E+PEQYR DAQKLEEWAR Q  +SL
Sbjct  117   VFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSL  176

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+F S+EGEVE +LKDI+ERA  K +F YSRFFA+GLFRLLEL+NAT+PT+LEKLCA LN
Sbjct  177   VEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLN  236

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             VNK+SVDRDLDVYRNLLSKL+QAKELLKEYV REKKKR ER E QK+NEA+ KCLG+Y
Sbjct  237   VNKRSVDRDLDVYRNLLSKLLQAKELLKEYVDREKKKREERTEPQKANEAIKKCLGEY  294



>ref|XP_010268869.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Nelumbo 
nucifera]
Length=297

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/297 (71%), Positives = 251/297 (85%), Gaps = 8/297 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SLSF+A+GQ+ +RK    + SS R L ST   FRFRT    DS   RT +S S  
Sbjct  1     MAAISSLSFTALGQASERK---HAVSSIRSLGSTFYGFRFRTISVSDSPGVRTRNSTS--  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RMV+ CMS  TDVPTVSETK +FL+AYKRPIP+VY+TVLQELIVQQHLMRYK++Y+YD V
Sbjct  56    RMVIQCMSSATDVPTVSETKLSFLKAYKRPIPTVYNTVLQELIVQQHLMRYKRTYRYDAV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP +ED++AIF+AYIKAL E+PEQYR+DAQKLE+WAR Q+ NSL+
Sbjct  116   FALGFVTVYDQLMEGYPNDEDRDAIFQAYIKALKEDPEQYRSDAQKLEDWARTQNANSLI  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F  REGEVE ILKDISE+A    SF YSRFFAIGLFRLLEL+ AT+P+ILE+ CAALN+
Sbjct  176   EFPYREGEVEGILKDISEQARGNGSFSYSRFFAIGLFRLLELAKATEPSILEQFCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER  SQK+NEA++KC+G++
Sbjct  236   NKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERMGSQKANEAISKCVGEF  292



>ref|XP_007215765.1| hypothetical protein PRUPE_ppa009554mg [Prunus persica]
 gb|EMJ16964.1| hypothetical protein PRUPE_ppa009554mg [Prunus persica]
Length=287

 Score =   407 bits (1047),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 252/292 (86%), Gaps = 8/292 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAAV SLSFSA+ Q  DRK+     SS R L+  S+  R RT+F+ ++   R  +S S S
Sbjct  1     MAAVASLSFSALSQCSDRKSV---ISSTRNLAYNSEGLRLRTSFSCNNGGVR--ASSSSS  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             RM++HCMS  +  PTV++TK NFL+AYKRPIPSVY+TVLQELIVQQHL++YKKSY+YDPV
Sbjct  56    RMMIHCMSGASYAPTVADTKLNFLKAYKRPIPSVYNTVLQELIVQQHLIKYKKSYRYDPV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTV+D+LM+GYP++ED+EAIF+AYI+ALNE+PEQYR DAQKLEEWARAQ  +SLV
Sbjct  116   FALGFVTVFDQLMDGYPSDEDREAIFQAYIEALNEDPEQYRIDAQKLEEWARAQTSSSLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +F SREGE+E  LKDI+ERA SK SF YSRFFA+GLFRLLEL+NAT+PTILEKLCAALN+
Sbjct  176   EFPSREGEIEGTLKDIAERAASKGSFSYSRFFAVGLFRLLELANATEPTILEKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             +K+SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR ER E+QK+NEAVTK
Sbjct  236   DKRSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKREERVENQKANEAVTK  287



>ref|XP_004507227.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Cicer 
arietinum]
Length=302

 Score =   408 bits (1048),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 212/297 (71%), Positives = 249/297 (84%), Gaps = 8/297 (3%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAVTS  S S + QS  RK     SSS R ++S SD+FRFR +F+   +  R  +S S 
Sbjct  1     MAAVTSSFSLSTLTQSSQRKL--TLSSSPRFVNSDSDSFRFRLSFSSHCVGLR--ASNSV  56

Query  362   SRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             S+MVV C S+  D PTVSETK NFL AYKRPIPS+Y++VLQELIVQQHLMRYK+SY YDP
Sbjct  57    SKMVVRCSSSVSDPPTVSETKLNFLEAYKRPIPSIYNSVLQELIVQQHLMRYKRSYTYDP  116

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP++ED++AIF+AYIKALNE+P+QYR DAQKLEEWAR Q+  SL
Sbjct  117   VFALGFVTVYDQLMEGYPSDEDRDAIFKAYIKALNEDPDQYRVDAQKLEEWARGQNSTSL  176

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             ++FSSREGEVE +LKDI+ERAG K  F YSRFFA+GLFRLLEL+NA +PTILEKLC ALN
Sbjct  177   IEFSSREGEVEGVLKDIAERAGGKGDFSYSRFFAVGLFRLLELANAMEPTILEKLCGALN  236

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKKR ER E Q++NEA+TKC+GQ
Sbjct  237   INKRSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKREERAEPQQANEAITKCVGQ  293



>gb|KDP24201.1| hypothetical protein JCGZ_25858 [Jatropha curcas]
Length=297

 Score =   408 bits (1048),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 223/303 (74%), Positives = 254/303 (84%), Gaps = 13/303 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSP-DRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAVTS+SFSAI QSP DRKAF   +S  R  +S  D  RFRT F    +  RTS+S S 
Sbjct  1     MAAVTSVSFSAINQSPGDRKAF---ASCTRSFASNFDNCRFRTRFHCHYVGVRTSNSTS-  56

Query  362   SRMVVHCMSTDV---PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
              RMV+HCMST     PTVSETK NFL+AYK+PIPS+Y+TVLQELIVQQHLMRYK++Y+YD
Sbjct  57    -RMVIHCMSTATDMPPTVSETKFNFLKAYKKPIPSIYNTVLQELIVQQHLMRYKRTYRYD  115

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
             PVFALGFVTVYD+LMEGYP++ED+EAIF+AYIKAL EEPEQYR DA+KLEEWAR+Q  +S
Sbjct  116   PVFALGFVTVYDQLMEGYPSDEDREAIFQAYIKALKEEPEQYRVDAKKLEEWARSQTSSS  175

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             LVDFSSREGEVE ILKDI+ERA S  SF YSRFFA+GLFRLLELSN+T+PTILEKLCAAL
Sbjct  176   LVDFSSREGEVEGILKDIAERARS-GSFSYSRFFAVGLFRLLELSNSTEPTILEKLCAAL  234

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYV-AREKKKRGERESQKSNEAVTKCLG--Q  1063
             NVNK+SVDRDLDVYRNLLSKLVQAKELLKEYV   +KK+    E+QK+NEAV +CLG  Q
Sbjct  235   NVNKRSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKREERTETQKANEAVKQCLGEPQ  294

Query  1064  YES  1072
             Y S
Sbjct  295   YAS  297



>ref|XP_006447402.1| hypothetical protein CICLE_v10016098mg [Citrus clementina]
 ref|XP_006469826.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Citrus 
sinensis]
 gb|ESR60642.1| hypothetical protein CICLE_v10016098mg [Citrus clementina]
Length=299

 Score =   407 bits (1047),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 249/298 (84%), Gaps = 8/298 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MA++TS++F++IGQ+  ++  N SS+ +   +     FRFRT+     + FR  +S S S
Sbjct  1     MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEG--FRFRTSLFCHCVRFR--ASSSSS  56

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             RM++ CMST  DVP TV+ETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK++YQYDP
Sbjct  57    RMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDP  116

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYDRLMEGYP++ED+EAIF+AYI AL E+PEQYR DAQKLEEWAR Q  +SL
Sbjct  117   VFALGFVTVYDRLMEGYPSDEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSL  176

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+F S+EGEVE IL DI+ERA  K +F YSRFFA+GLFRLLEL+NAT+PT+LEKLCA LN
Sbjct  177   VEFPSKEGEVEGILNDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLN  236

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             VNK+SVDRDLDVYRNLLSKL+QAKELLKEYV REKKKR ER E QK+NEA+ KCLG+Y
Sbjct  237   VNKRSVDRDLDVYRNLLSKLLQAKELLKEYVDREKKKREERTEPQKANEAIKKCLGEY  294



>ref|NP_565491.1| protein THYLAKOID FORMATION 1 [Arabidopsis thaliana]
 sp|Q9SKT0.1|THF1_ARATH RecName: Full=Protein THYLAKOID FORMATION 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD20906.1| expressed protein [Arabidopsis thaliana]
 gb|AAL32877.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10158.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07092.1| protein THYLAKOID FORMATION 1 [Arabidopsis thaliana]
Length=300

 Score =   405 bits (1041),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 245/297 (82%), Gaps = 16/297 (5%)
 Frame = +2

Query  182   AMAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             A  A++SLSF A+GQS     F             + A R  T F+  SLN R     S 
Sbjct  2     AATAISSLSFPALGQSDKISNF-------ASSRPLASAIRICTKFSRLSLNSR-----ST  49

Query  362   SRMVVHCMST---DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             S+ ++HCMS    DVP VSETK+ FL+AYKRPIPS+Y+TVLQELIVQQHLMRYKK+Y+YD
Sbjct  50    SKSLIHCMSNVTADVPPVSETKSKFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYD  109

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
             PVFALGFVTVYD+LMEGYP+++D++AIF+AYI+ALNE+P+QYR DAQK+EEWAR+Q   S
Sbjct  110   PVFALGFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYRIDAQKMEEWARSQTSAS  169

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             LVDFSS+EG++E++LKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLCA+L
Sbjct  170   LVDFSSKEGDIEAVLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASL  229

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             N+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER +SQK+NE ++KCLG
Sbjct  230   NINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAQSQKANETISKCLG  286



>ref|XP_010467756.1| PREDICTED: protein THYLAKOID FORMATION 1, chloroplastic [Camelina 
sativa]
Length=303

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/299 (67%), Positives = 245/299 (82%), Gaps = 17/299 (6%)
 Frame = +2

Query  182   AMAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             A  A++SLSF A+GQS     F             + A R  T F+  SL +R++S    
Sbjct  2     AATAISSLSFPALGQSDKIPNF-------APSRPLASAIRICTKFSRHSLTYRSTSRSPP  54

Query  362   SRMVVHCMST-----DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQ  526
                 +HCMS+     DVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+
Sbjct  55    ----IHCMSSVTAADDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYR  110

Query  527   YDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDG  706
             YDPVFALGFVTVYD+LM+GYP+++D++AIF+AYI+ALNE+P+QYR DAQK+EEWAR+Q  
Sbjct  111   YDPVFALGFVTVYDQLMDGYPSDQDRDAIFKAYIQALNEDPKQYRIDAQKMEEWARSQTS  170

Query  707   NSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCA  886
              SLVDFSS+EGEVES+LKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLC 
Sbjct  171   ASLVDFSSKEGEVESLLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCT  230

Query  887   ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             +LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER ESQK+NE ++KCLG
Sbjct  231   SLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAESQKTNETISKCLG  289



>emb|CDP11909.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/300 (71%), Positives = 249/300 (83%), Gaps = 13/300 (4%)
 Frame = +2

Query  185   MAAVTSLS-FSAIGQSPDRKAFNassssarclssts-daFRFRTNF--AFDSLNFRTSSS  352
             MAAV+S+S FS I     R++F++    +    S++ +AF+ R +F    DS+N   S+S
Sbjct  1     MAAVSSVSTFSGI----KRQSFDSFKKISARNLSSNFEAFKLRLSFFYGLDSVNISYSNS  56

Query  353   GSGSRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQ  526
                    VHCMST  DVPTVSETK NFL+AYKRPIPS+Y TVLQEL+VQQHLMRYK++Y+
Sbjct  57    EKSRCFAVHCMSTARDVPTVSETKLNFLKAYKRPIPSIYGTVLQELLVQQHLMRYKRTYK  116

Query  527   YDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYR--ADAQKLEEWARAQ  700
             YD VFALGFVTVYDRLMEGYP++ED+EAIF+AYIKAL EEPE+YR  +DAQKLEEWA  Q
Sbjct  117   YDAVFALGFVTVYDRLMEGYPSDEDREAIFQAYIKALKEEPEKYRQVSDAQKLEEWACTQ  176

Query  701   DGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKL  880
             +  +LVDFSSR+GEVESILKDI+ERAGSK+ F YSRFFAIGLFRLLEL+NAT+P ILEKL
Sbjct  177   NAGTLVDFSSRKGEVESILKDIAERAGSKEGFSYSRFFAIGLFRLLELANATEPAILEKL  236

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCL  1057
             CAALNVNK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER ESQK++EAV KCL
Sbjct  237   CAALNVNKKSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERAESQKASEAVKKCL  296



>ref|XP_002517999.1| Protein THYLAKOID FORMATION1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF44517.1| Protein THYLAKOID FORMATION1, chloroplast precursor, putative 
[Ricinus communis]
Length=299

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 216/299 (72%), Positives = 255/299 (85%), Gaps = 11/299 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQS-PDRKAFNassssarclsstsdaFRFRTN-FAFDSLNFRTSSSGS  358
             MAAVTS+SFSAI QS  +RK+    +S +R  SS  D+FRF    F+   +  + S+S S
Sbjct  1     MAAVTSVSFSAIAQSFTERKSV---ASWSRSFSSNFDSFRFPVGGFSCHYVGVKASNSSS  57

Query  359   GSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
              SRM++HCMST  DVP TVSETK NFL +YK+PIPS+Y+TVLQELIVQQHLMRYK+SY+Y
Sbjct  58    -SRMLIHCMSTATDVPPTVSETKFNFLNSYKKPIPSIYNTVLQELIVQQHLMRYKRSYRY  116

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             DPVFALGFVTVYD+LM+GYP++ED+EAIF+AYI ALNEEPEQYR DA+KLE+WAR+Q  +
Sbjct  117   DPVFALGFVTVYDQLMQGYPSDEDREAIFQAYINALNEEPEQYRIDAKKLEDWARSQTPS  176

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             SLVDFSS+EGEVE ILKDI+ERAG+  SF YSRFFAIGLFRLLELSN+T+PT+LEKLCAA
Sbjct  177   SLVDFSSKEGEVEGILKDIAERAGN-GSFSYSRFFAIGLFRLLELSNSTEPTVLEKLCAA  235

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             LN+NK+ VDRDLDVYRNLLSKLVQAKELLKEYV REKKK+ ER  SQK+NEAV  CLG+
Sbjct  236   LNINKRGVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKQEERASSQKANEAVKSCLGE  294



>gb|KFK40470.1| hypothetical protein AALP_AA3G376900 [Arabis alpina]
Length=296

 Score =   402 bits (1034),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 242/295 (82%), Gaps = 16/295 (5%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SLSF A+GQS    +F  S   A    S              ++   + +    S
Sbjct  1     MAAISSLSFPALGQSQKISSFAPSRPLASVSVSA-------------AIRSHSLTCSRPS  47

Query  365   RMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             R  +HCMST  DVP VS+TK+NFL+AYKRPIPS+Y+TVLQELIVQQHL+RYKK+Y+YDPV
Sbjct  48    RSFIHCMSTLTDVPPVSDTKSNFLKAYKRPIPSIYNTVLQELIVQQHLVRYKKTYRYDPV  107

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP+++D++AIF+AY++ALNE+P+QYR DAQK+EEWAR Q   SL+
Sbjct  108   FALGFVTVYDQLMEGYPSDQDRDAIFKAYVEALNEDPQQYRDDAQKMEEWARTQSSASLL  167

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             DFSSR+GE+E+ILKDI+ RAGSKD F YSRFFA+GLFRLLEL+ ATDPT+L+KLCA+LN+
Sbjct  168   DFSSRDGEIEAILKDIAARAGSKDGFSYSRFFAVGLFRLLELAAATDPTVLDKLCASLNI  227

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER ESQK+NE ++KCLG
Sbjct  228   NKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAESQKANETISKCLG  282



>ref|XP_002319386.1| hypothetical protein POPTR_0013s14450g [Populus trichocarpa]
 gb|EEE95309.1| hypothetical protein POPTR_0013s14450g [Populus trichocarpa]
Length=298

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 247/303 (82%), Gaps = 9/303 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             M A+TSLSFSA+ QS   +  N   SS    + + + FR R+ F+   +  +  +S S S
Sbjct  1     MTAITSLSFSAVNQSSSER--NTFVSSLASRNLSFEGFRLRSVFSCHYVGVK--ASNSTS  56

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R  +HCMST  DVP TVSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYKK+Y YDP
Sbjct  57    RTAIHCMSTSTDVPPTVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYLYDP  116

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VF LG VTVYD+LMEGYP++ED+EAIF+AYIKAL E+PEQYR DA+KLEEWARAQ  +SL
Sbjct  117   VFGLGLVTVYDQLMEGYPSDEDREAIFQAYIKALKEDPEQYRIDAKKLEEWARAQTHSSL  176

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSS+EGE+E ILK I+ERA S + F YSRFFA+GLFRLLELSNA++PT+LEKLC+ALN
Sbjct  177   VDFSSKEGEIEGILKGIAERAASGN-FSYSRFFAVGLFRLLELSNASEPTVLEKLCSALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYES  1072
             +NK+SVDRDLDVYR LLSKLVQAKELLKEYV REKKK+ ER ESQK+NE V KCLG  + 
Sbjct  236   INKRSVDRDLDVYRGLLSKLVQAKELLKEYVDREKKKQEERAESQKANEMVAKCLGDPQV  295

Query  1073  VAR  1081
             V +
Sbjct  296   VGQ  298



>emb|CDY13852.1| BnaA09g43540D [Brassica napus]
Length=296

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 252/309 (82%), Gaps = 27/309 (9%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTS------  346
             MAA+ SLSF A+GQS   K  N + S              R   +F +++ R S      
Sbjct  1     MAAIASLSFPALGQSG--KLSNPTPS--------------RPLASFSAISRRISRRSLTS  44

Query  347   --SSGSGSRMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYK  514
                S S S+ V+HCMS  TDVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK
Sbjct  45    SRPSTSSSKFVIHCMSSVTDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYK  104

Query  515   KSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR  694
             ++Y+YDPVFALGFVTVYD+LM+GYP+++D+++IF+AY++ALNE+P+QYR DAQK+EEWAR
Sbjct  105   RTYRYDPVFALGFVTVYDQLMDGYPSDQDRDSIFQAYVEALNEDPKQYRIDAQKMEEWAR  164

Query  695   AQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILE  874
             +Q   SLVDFSS+EGEVE+ILKDISERAGSK+ F YSRFFA+GLFRLLEL+ ATDPT+L+
Sbjct  165   SQTSASLVDFSSKEGEVEAILKDISERAGSKEGFSYSRFFAVGLFRLLELAGATDPTVLD  224

Query  875   KLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             KLCA+LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGER ESQK+NE+++K
Sbjct  225   KLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERAESQKANESISK  284

Query  1052  CLGQYESVA  1078
              LG   S++
Sbjct  285   SLGDNNSLS  293



>ref|XP_004487338.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Cicer 
arietinum]
Length=289

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 237/300 (79%), Gaps = 15/300 (5%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFS + Q   RK+            + +     RT+F++           S S
Sbjct  1     MAALTSLSFSTLTQCSKRKS------------TMTSTLGIRTHFSYHHNYVGVRPFNSTS  48

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             +MV+ CMS  TD+P+VSETK +FL+AYKRPIPS+Y+ VLQELIVQ HLMRYK SY+YDPV
Sbjct  49    KMVIQCMSSVTDIPSVSETKLSFLKAYKRPIPSIYNNVLQELIVQHHLMRYKTSYRYDPV  108

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVT+YD+LMEGYP++ED++AIF+AYI AL E+P+QYR DAQKLEEWARAQ+  SLV
Sbjct  109   FALGFVTIYDKLMEGYPSDEDRDAIFKAYINALKEDPQQYRIDAQKLEEWARAQNSTSLV  168

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSS+EGEVE ILKD++ERAG K  F YSRFFA+GLFRLLEL+NAT+PTIL+KLCA LNV
Sbjct  169   EFSSKEGEVEGILKDVAERAGGKGEFSYSRFFAVGLFRLLELANATEPTILDKLCAVLNV  228

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYESV  1075
             NK+SVDRDLDVYR LLSKLVQAKELL+EY+ REKKKR ER E Q +N A+ KCLGQ  SV
Sbjct  229   NKRSVDRDLDVYRMLLSKLVQAKELLREYIDREKKKREERAEPQNANGAIAKCLGQQLSV  288



>gb|AAM64943.1| unknown [Arabidopsis thaliana]
 gb|AAW82331.1| chloroplast thylakoid formation 1 [Arabidopsis thaliana]
Length=300

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 243/297 (82%), Gaps = 16/297 (5%)
 Frame = +2

Query  182   AMAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             A  A++SLSF A+GQS     F             + A R  T F+  SLN R     S 
Sbjct  2     AATAISSLSFPALGQSDKISNF-------ASSRPLASAIRICTKFSRLSLNSR-----ST  49

Query  362   SRMVVHCMST---DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             S+ ++HCMS    DVP VSETK+ FL+AYKRPIPS+Y+TVLQELIVQQHLMRYKK+Y+YD
Sbjct  50    SKSLIHCMSNVTADVPPVSETKSKFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYD  109

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
             PVFALGFVTVYD+LMEGYP+++D++AIF+AYI+ALNE+P+QYR DAQK+EEWAR+Q   S
Sbjct  110   PVFALGFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYRIDAQKMEEWARSQTSAS  169

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             LVDFSS+EG++E++LKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLCA+L
Sbjct  170   LVDFSSKEGDIEAVLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASL  229

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             N+NK+SVDRDLDVYRNLLSKLVQA ELLKEYV REKKK+ ER +SQK+NE ++KCLG
Sbjct  230   NINKKSVDRDLDVYRNLLSKLVQANELLKEYVEREKKKQEERAQSQKANETISKCLG  286



>ref|XP_006409029.1| hypothetical protein EUTSA_v10002049mg [Eutrema salsugineum]
 gb|ESQ50482.1| hypothetical protein EUTSA_v10002049mg [Eutrema salsugineum]
Length=305

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/296 (69%), Positives = 250/296 (84%), Gaps = 10/296 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+ SLSF A+GQS   K  N +        S S   R    F+  SL+  + +S S S
Sbjct  1     MAAIASLSFPALGQSD--KISNFAPCRPLASVSASAICR---RFSRHSLS-FSRASTSSS  54

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             R ++HCMS  TDVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YDPV
Sbjct  55    RSIIHCMSSVTDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYDPV  114

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP+++D++AIF+AY++ALNE+P+QYR DAQK+EEWAR+Q   SLV
Sbjct  115   FALGFVTVYDQLMDGYPSDQDRDAIFKAYVEALNEDPKQYRIDAQKMEEWARSQTSASLV  174

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             DFSSR+GEVE+ILKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLCA+LN+
Sbjct  175   DFSSRDGEVEAILKDIAARAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASLNI  234

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER--ESQKSNEAVTKCLG  1060
             NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER  ESQK+NE ++KCLG
Sbjct  235   NKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAAESQKANETISKCLG  290



>ref|XP_009117460.1| PREDICTED: protein THYLAKOID FORMATION 1, chloroplastic [Brassica 
rapa]
Length=296

 Score =   398 bits (1023),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 204/309 (66%), Positives = 251/309 (81%), Gaps = 27/309 (9%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTS------  346
             MAA+ SLSF A+GQS   K  N + S              R   +  +++ R S      
Sbjct  1     MAAIASLSFPALGQSG--KLSNPTPS--------------RPLASVSAISRRISRRSLTS  44

Query  347   --SSGSGSRMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYK  514
                S S S+ V+HCMS  TDVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK
Sbjct  45    SRPSTSSSKFVIHCMSSVTDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYK  104

Query  515   KSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR  694
             ++Y+YDPVFALGFVTVYD+LM+GYP+++D+++IF+AY++ALNE+P+QYR DAQK+EEWAR
Sbjct  105   RTYRYDPVFALGFVTVYDQLMDGYPSDQDRDSIFQAYVEALNEDPKQYRIDAQKMEEWAR  164

Query  695   AQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILE  874
             +Q   SLVDFSS+EGEVE+ILKDISERAGSK+ F YSRFFA+GLFRLLEL+ ATDPT+L+
Sbjct  165   SQTSASLVDFSSKEGEVEAILKDISERAGSKEGFSYSRFFAVGLFRLLELAGATDPTVLD  224

Query  875   KLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             KLCA+LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGER ESQK+NE+++K
Sbjct  225   KLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERAESQKANESISK  284

Query  1052  CLGQYESVA  1078
              LG   S++
Sbjct  285   SLGDNNSLS  293



>ref|XP_006841855.1| hypothetical protein AMTR_s00003p00271230 [Amborella trichopoda]
 gb|ERN03530.1| hypothetical protein AMTR_s00003p00271230 [Amborella trichopoda]
Length=298

 Score =   398 bits (1022),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SLSF+A   + +RK       +        + FR R+      +N R+ +S S S
Sbjct  1     MAAISSLSFAAATPASERKGL--CRPTLSNNLFNIEPFRLRSTNGSYLVNARSIASYSPS  58

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
               ++ C+S  TDVPTV+ETK NFLR+YKRPIPS+Y+TVLQELIVQQHL+RYK++YQYD +
Sbjct  59    --IIRCVSSATDVPTVAETKGNFLRSYKRPIPSIYNTVLQELIVQQHLLRYKRTYQYDAI  116

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
              ALGFVTVYD+LMEG+P+ ED++AIF+AY++AL E+PEQYR DA+KLEEWARAQ+ NS+V
Sbjct  117   LALGFVTVYDQLMEGFPSNEDRDAIFKAYVEALKEDPEQYRNDAKKLEEWARAQNANSIV  176

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             DFSSREGEVE+ILKDIS RAG K +F YSRFFAIGLFRLLEL+N TD  ILEKLCAALNV
Sbjct  177   DFSSREGEVEAILKDISGRAGGKGNFSYSRFFAIGLFRLLELANVTDSAILEKLCAALNV  236

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             +K+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKKR ER ESQK+NEAVTKC+G +
Sbjct  237   DKRSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKREERSESQKANEAVTKCVGDF  293



>ref|XP_006409030.1| hypothetical protein EUTSA_v10002049mg [Eutrema salsugineum]
 gb|ESQ50483.1| hypothetical protein EUTSA_v10002049mg [Eutrema salsugineum]
Length=306

 Score =   398 bits (1022),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 250/297 (84%), Gaps = 11/297 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+ SLSF A+GQS   K  N +        S S   R    F+  SL+  + +S S S
Sbjct  1     MAAIASLSFPALGQSD--KISNFAPCRPLASVSASAICR---RFSRHSLS-FSRASTSSS  54

Query  365   RMVVHCMST---DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R ++HCMS+   DVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YDP
Sbjct  55    RSIIHCMSSVTEDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYDP  114

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LM+GYP+++D++AIF+AY++ALNE+P+QYR DAQK+EEWAR+Q   SL
Sbjct  115   VFALGFVTVYDQLMDGYPSDQDRDAIFKAYVEALNEDPKQYRIDAQKMEEWARSQTSASL  174

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSSR+GEVE+ILKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLCA+LN
Sbjct  175   VDFSSRDGEVEAILKDIAARAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASLN  234

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER--ESQKSNEAVTKCLG  1060
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER  ESQK+NE ++KCLG
Sbjct  235   INKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAAESQKANETISKCLG  291



>emb|CDX81988.1| BnaC08g36130D [Brassica napus]
Length=295

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 243/295 (82%), Gaps = 11/295 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+ SLSF A+GQS   K  N +        S       R +         +  S S  
Sbjct  1     MAAIASLSFPALGQSG--KISNPTPCRPLASVSAICRRLSRRSLT------SSRPSTSSP  52

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             + V+HCMS  TDVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YDPV
Sbjct  53    KFVIHCMSSVTDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYDPV  112

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LM+GYP+++D+++IF+AY++ALNE+P+QYR DAQK+EEWAR+Q   SLV
Sbjct  113   FALGFVTVYDQLMDGYPSDQDRDSIFQAYVEALNEDPKQYRIDAQKMEEWARSQTSASLV  172

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             DFSS+EGEVE+ILKDISERAGSK+ F YSRFFA+GLFRLLEL+ ATDPT+L+KLCA+LN+
Sbjct  173   DFSSKEGEVEAILKDISERAGSKEGFSYSRFFAVGLFRLLELAGATDPTVLDKLCASLNI  232

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGER ESQK+NE+++K LG
Sbjct  233   NKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGERAESQKANESISKSLG  287



>ref|XP_010488976.1| PREDICTED: protein THYLAKOID FORMATION 1, chloroplastic-like, 
partial [Camelina sativa]
Length=294

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 239/291 (82%), Gaps = 17/291 (6%)
 Frame = +2

Query  206   SFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGSRMVVHCM  385
             SF A+GQS     F             + A R  T F+  SL +R++S        +HCM
Sbjct  1     SFPALGQSDKIPNF-------PPSRPLASAIRICTKFSRHSLTYRSTSRSHP----IHCM  49

Query  386   ST-----DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALG  550
             S+     DVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK++Y+YDPVFALG
Sbjct  50    SSVTAADDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRTYRYDPVFALG  109

Query  551   FVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS  730
             FVTVYD+LM+GYP+++D++AIF+AYI+ALNE+P+QYR DAQK+EEWAR+Q   SLVDFSS
Sbjct  110   FVTVYDQLMDGYPSDQDRDAIFKAYIQALNEDPKQYRIDAQKMEEWARSQTSASLVDFSS  169

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQS  910
             +EGEVES+LKDI+ RAGSK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLC +LN+NK+S
Sbjct  170   KEGEVESLLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCTSLNINKKS  229

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             VDRDLDVYRNLLSKLVQAKELLKEYV REKKK+GER ESQK+NE ++KCLG
Sbjct  230   VDRDLDVYRNLLSKLVQAKELLKEYVQREKKKQGERAESQKTNETISKCLG  280



>gb|KEH29600.1| photosystem II biogenesis protein [Medicago truncatula]
Length=303

 Score =   396 bits (1017),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 239/297 (80%), Gaps = 7/297 (2%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAVTS  SFS + QS  RK    SS+      S +  FRF  +  +  +     +S   
Sbjct  1     MAAVTSSFSFSTLTQSSQRKLTTLSSTRFFGSDSDAVRFRFSISLRYVGV---VRTSNFV  57

Query  362   SRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             S++VV C S+  D PTVSETK NFL+AYKRPIPS+Y++VLQELIVQQHLMRYKKSY+YDP
Sbjct  58    SKLVVRCSSSVSDPPTVSETKLNFLKAYKRPIPSIYNSVLQELIVQQHLMRYKKSYRYDP  117

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP++ED++AIF+AYI AL E+P QYR DAQKLEEWARAQ+  SL
Sbjct  118   VFALGFVTVYDQLMEGYPSDEDRDAIFQAYINALKEDPAQYRVDAQKLEEWARAQNATSL  177

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             ++FSSREGEVE  LKDI+ERAG    F YSRFFA+GLFRLLEL+NA +PTILEKLC+ALN
Sbjct  178   IEFSSREGEVEGTLKDIAERAGGNGDFSYSRFFAVGLFRLLELANAMEPTILEKLCSALN  237

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKK  ER E QK+NEA++KCLGQ
Sbjct  238   INKKSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKIEERAEPQKANEAISKCLGQ  294



>ref|XP_003539891.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X1 [Glycine max]
Length=291

 Score =   395 bits (1016),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 238/290 (82%), Gaps = 12/290 (4%)
 Frame = +2

Query  191   AVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGSRM  370
              ++S SFS + QS  ++     SS++         FRFR  F+   LN    +S S S+M
Sbjct  4     VISSFSFSTLTQSSSQRNLTTLSSNSPT-------FRFRVGFS--CLNVGVRASNSASKM  54

Query  371   VVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFA  544
             VV C S+  + PTVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK+SY+YD VFA
Sbjct  55    VVRCSSSVAEPPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRSYRYDAVFA  114

Query  545   LGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF  724
             LGFVTVY++LMEGYP++ED++AIF+AYI+AL E+PEQYR DA+KLEEWAR+Q+ NSL++F
Sbjct  115   LGFVTVYEQLMEGYPSDEDRDAIFQAYIQALKEDPEQYRVDAKKLEEWARSQNPNSLLEF  174

Query  725   SSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNK  904
             SSREGEVE ILKDI+ERAG K  F YSRFFAIGLFRLLEL+NA +PTILEKLCA LNVNK
Sbjct  175   SSREGEVEGILKDIAERAGGKGDFSYSRFFAIGLFRLLELANAMEPTILEKLCAVLNVNK  234

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             +SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER E QKSNEA+T+
Sbjct  235   RSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERAEPQKSNEAITQ  284



>gb|AFK45541.1| unknown [Medicago truncatula]
Length=303

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/297 (68%), Positives = 238/297 (80%), Gaps = 7/297 (2%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAVTS  SFS + QS  RK    SS+      S +  FRF  +  +  +     +S   
Sbjct  1     MAAVTSSFSFSTLTQSSQRKLTTLSSTRFFGSDSDAVRFRFSISLRYVGV---VRTSNFV  57

Query  362   SRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             S++VV C S+  D PTVSETK NFL+AYKRPIPS+Y++VLQELIVQQHLMRYKKSY+YDP
Sbjct  58    SKLVVRCSSSVSDPPTVSETKLNFLKAYKRPIPSIYNSVLQELIVQQHLMRYKKSYRYDP  117

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP++ED++AIF+AYI AL E+P QYR DAQKLEEWARAQ+  SL
Sbjct  118   VFALGFVTVYDQLMEGYPSDEDRDAIFQAYINALKEDPAQYRVDAQKLEEWARAQNATSL  177

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             ++FSSREGEVE  LKDI+ERAG    F YSRFFA+GLFRLLEL+N  +PTILEKLC+ALN
Sbjct  178   IEFSSREGEVEGTLKDIAERAGGNGDFSYSRFFAVGLFRLLELANTMEPTILEKLCSALN  237

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKK  ER E QK+NEA++KCLGQ
Sbjct  238   INKKSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKIEERAEPQKANEAISKCLGQ  294



>ref|XP_008812650.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Phoenix 
dactylifera]
Length=289

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/240 (78%), Positives = 219/240 (91%), Gaps = 4/240 (2%)
 Frame = +2

Query  359   GSRMVVHCMSTDV---PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
             GSRMVV C++      PTVSETK+NFL++YKRPIPS+Y+TVLQEL+VQQHLMRYK++YQY
Sbjct  45    GSRMVVRCLAASTYVPPTVSETKSNFLKSYKRPIPSIYNTVLQELLVQQHLMRYKRTYQY  104

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             D VFALGFVTV+++LMEGYP+ +D++AIFRAYI+AL E+PE+YR DAQKLEEWARAQ+ N
Sbjct  105   DAVFALGFVTVFEQLMEGYPSNDDRDAIFRAYIQALKEDPEEYRCDAQKLEEWARAQNAN  164

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             +LVDFSSREGEVE ILK+ISERA  K +F YSRFFA+GLFRLLEL+NAT+PTILEKLCAA
Sbjct  165   TLVDFSSREGEVEDILKNISERAQGKGNFSYSRFFAVGLFRLLELANATEPTILEKLCAA  224

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER ESQK+NEA+TKC+G +
Sbjct  225   LNINKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERVESQKANEAITKCMGDF  284



>ref|XP_010095846.1| Protein THYLAKOID FORMATION1 [Morus notabilis]
 gb|EXB62314.1| Protein THYLAKOID FORMATION1 [Morus notabilis]
Length=297

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/299 (70%), Positives = 253/299 (85%), Gaps = 10/299 (3%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MA++TS LSFSA+ Q  D+KA      S+R L+S SD FR R  F+   + FR  +S S 
Sbjct  1     MASLTSSLSFSALSQCSDKKAV---VPSSRSLASNSDWFRIRAGFSCHYVGFR--ASNSS  55

Query  362   SRMVVHCMSTDV---PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             SRMVVHCMS+     PTV++TK NFL+AYKRPIPSVY+TVLQEL+VQ HLM+YK++++YD
Sbjct  56    SRMVVHCMSSTAEAPPTVADTKLNFLKAYKRPIPSVYNTVLQELLVQHHLMKYKRTFRYD  115

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
             PVFALGFVTVYD+LM+GYP++ED+ AIF++YIKALNEEPEQYR D+QKLEEWARAQ+ +S
Sbjct  116   PVFALGFVTVYDQLMDGYPSDEDRAAIFQSYIKALNEEPEQYRIDSQKLEEWARAQNASS  175

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             L++FSS+EGEVE  LKDISERA S  +F YSRFFA+GLFR+LEL+NAT+PTILEKLC+AL
Sbjct  176   LIEFSSKEGEVEGTLKDISERA-SHGNFSYSRFFAVGLFRILELANATEPTILEKLCSAL  234

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYE  1069
             N+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER   K+NEA+TKCLG YE
Sbjct  235   NINKRSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKREERTESKANEAITKCLGDYE  293



>ref|XP_009417272.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=285

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 240/302 (79%), Gaps = 26/302 (9%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSL-NFRTSSSGSG  361
             MA++ S+SF+    SP R+A                    R  FA  +L  FR  +    
Sbjct  1     MASIPSVSFA----SPCRQAAER-----------------RLTFAGPALRGFRFEAPKFS  39

Query  362   SRMVVHCM---STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             SRMVV C+   S   PTVSETK NFL++YKRPIPS+Y+TVLQEL+VQQHLMRYK++YQYD
Sbjct  40    SRMVVRCVAAASYAPPTVSETKLNFLKSYKRPIPSIYNTVLQELLVQQHLMRYKRTYQYD  99

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
              VFALGFVTVY++LMEGYP  ED++AIF+AYI+AL E+PEQYR+DA+KLEEWARAQ  NS
Sbjct  100   AVFALGFVTVYEQLMEGYPNSEDRDAIFQAYIQALKEDPEQYRSDAKKLEEWARAQTANS  159

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             L++FS+REGEVE+ILKDISERA SK +F YSRFFAIGLFRLLEL+NAT+PT+LEKLCAAL
Sbjct  160   LIEFSTREGEVETILKDISERALSKGNFSYSRFFAIGLFRLLELANATEPTVLEKLCAAL  219

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE-SQKSNEAVTKCLGQYE  1069
             N+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER  +QK+NEA+TKC G + 
Sbjct  220   NINKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERSGTQKANEAITKCTGDFR  279

Query  1070  SV  1075
             SV
Sbjct  280   SV  281



>emb|CBI28372.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   390 bits (1001),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 216/237 (91%), Gaps = 3/237 (1%)
 Frame = +2

Query  368   MVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVF  541
             MVV CMS  TDVPTVSETK NFL+ YKRPIPS+Y+T+LQEL+VQQHLMRYK++Y+YD VF
Sbjct  1     MVVQCMSSVTDVPTVSETKMNFLKNYKRPIPSIYNTLLQELMVQQHLMRYKRTYRYDAVF  60

Query  542   ALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVD  721
             ALGFVTVYD+LM+GYP++ED++ IF+ YIKAL E+PEQYR DAQ LEEWAR+Q  +SLV+
Sbjct  61    ALGFVTVYDQLMDGYPSDEDRDIIFQVYIKALREDPEQYRKDAQMLEEWARSQTASSLVE  120

Query  722   FSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVN  901
             FSS+EGEVE ILKDI+ERAG K SF YSRFFAIGLFRLLEL+NAT+PTILEKLCAA N++
Sbjct  121   FSSKEGEVEGILKDIAERAGGKGSFSYSRFFAIGLFRLLELANATEPTILEKLCAAFNIS  180

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYE  1069
             K+SVDRDLDVYRNLL+KLVQAKELLKEYV REKKKR ER ESQK+NEA+TKCLG+YE
Sbjct  181   KRSVDRDLDVYRNLLTKLVQAKELLKEYVDREKKKREERVESQKANEAITKCLGEYE  237



>ref|XP_002884230.1| hypothetical protein ARALYDRAFT_900469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60489.1| hypothetical protein ARALYDRAFT_900469 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 218/232 (94%), Gaps = 3/232 (1%)
 Frame = +2

Query  374   VHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFAL  547
             +HCMST  DVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYKK+Y+YDPVFAL
Sbjct  54    IHCMSTVTDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYDPVFAL  113

Query  548   GFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFS  727
             GFVTVYD+LMEGYP+++D++AIF+AYI+ALNE+P+QYR DAQK+EEWAR+Q   SLVDFS
Sbjct  114   GFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYRIDAQKMEEWARSQTSASLVDFS  173

Query  728   SREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQ  907
             SR+GE+E++LKDI+ RA SK+ F YSRFFA+GLFRLLEL++ATDPT+L+KLCA+LN+NK+
Sbjct  174   SRQGEIEALLKDIAGRAASKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASLNINKK  233

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             SVDRDLDVYRNLLSKLVQAKELL+EYV REKKK+GER ESQK+NE ++KCLG
Sbjct  234   SVDRDLDVYRNLLSKLVQAKELLREYVEREKKKQGERAESQKANETISKCLG  285



>ref|XP_002326111.1| hypothetical protein POPTR_0019s14050g [Populus trichocarpa]
 gb|EEF00493.1| hypothetical protein POPTR_0019s14050g [Populus trichocarpa]
Length=296

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/266 (73%), Positives = 233/266 (88%), Gaps = 7/266 (3%)
 Frame = +2

Query  296   FRFRTNFAFDSLNFRTSSSGSGSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYS  466
             FRFR++F+   +  R  +S S SRMV+HCMST  DVP TV++TK NFL+AYKRPIPS+Y+
Sbjct  34    FRFRSSFSCHYVGVR--ASNSTSRMVIHCMSTSTDVPPTVADTKLNFLKAYKRPIPSIYN  91

Query  467   TVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEE  646
             TVLQELIVQQHLM+YKK+++YDPVF LGFVTVYD+LMEGYP++ED+EAIF+AYIKAL E+
Sbjct  92    TVLQELIVQQHLMKYKKTFRYDPVFGLGFVTVYDQLMEGYPSDEDREAIFQAYIKALEED  151

Query  647   PEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             PEQYR DA+KLEEWARAQ  +SLVDFSSREGE+E  LKDI+ER  S + F YSRFFA+GL
Sbjct  152   PEQYRIDAKKLEEWARAQTPSSLVDFSSREGEIEGTLKDIAERVASGN-FSYSRFFAVGL  210

Query  827   FRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKK  1006
             FRLLELSNA++PT+LEKLC+ALN+NK+SVDRDLDVYR LLSKLVQA+ELLKEYV REKKK
Sbjct  211   FRLLELSNASEPTVLEKLCSALNINKRSVDRDLDVYRGLLSKLVQARELLKEYVDREKKK  270

Query  1007  RGER-ESQKSNEAVTKCLGQYESVAR  1081
             + ER ESQK++E VTKCLG+ + V +
Sbjct  271   QEERAESQKASETVTKCLGEPQFVGQ  296



>ref|XP_010924048.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Elaeis 
guineensis]
Length=289

 Score =   390 bits (1002),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 202/301 (67%), Positives = 243/301 (81%), Gaps = 28/301 (9%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQS-----PDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSS  349
             MAA++S+SF+++ Q+     P   AF +                F T+ AF    FR   
Sbjct  1     MAAISSVSFASLRQASSERRPTPSAFGS----------------FATS-AFRGPRFRPPK  43

Query  350   SGSGSRMVVHCM--STDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKS  520
               S  R VV C+  +TDVP TVSETK+NFL++Y+RPIPS+Y++VLQEL+VQ HLMRYK++
Sbjct  44    LRS--RKVVQCVAATTDVPPTVSETKSNFLKSYRRPIPSIYNSVLQELLVQHHLMRYKRT  101

Query  521   YQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQ  700
             YQYDPVFALGFVTV+++LMEGYP+ +D++AIFRAYI+AL E+PEQYR DAQKLEEWA+AQ
Sbjct  102   YQYDPVFALGFVTVFEQLMEGYPSNDDRDAIFRAYIQALKEDPEQYRCDAQKLEEWAQAQ  161

Query  701   DGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKL  880
             + NSLVDFSSREGEVE ILK+ISERA  K +F YSRFFAIGLFRLLEL+NAT+PTILEKL
Sbjct  162   NANSLVDFSSREGEVEDILKNISERAQGKGNFSYSRFFAIGLFRLLELANATEPTILEKL  221

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCL  1057
             C ALN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER ESQK+NEA+TKC+
Sbjct  222   CGALNINKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERVESQKANEAITKCM  281

Query  1058  G  1060
             G
Sbjct  282   G  282



>ref|XP_011047479.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X1 [Populus euphratica]
Length=296

 Score =   390 bits (1002),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 210/304 (69%), Positives = 254/304 (84%), Gaps = 13/304 (4%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSP-DRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAVTS+SFSAI QS  DR+AF   + +     S     RFR++F+   +  R  SS S 
Sbjct  1     MAAVTSVSFSAISQSSSDRRAFCTVARNLGFEGS-----RFRSSFSCHYVGVR--SSNST  53

Query  362   SRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             SRMV+HCMST  DVP TV++TK NFL+AYKRPIPS+Y+TVLQELIVQQHLM+YKK+++YD
Sbjct  54    SRMVIHCMSTSTDVPPTVADTKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKKTFRYD  113

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
             PVF LGFVTV+D+LMEGYP++ED+EAIF+AYIKAL E+PEQYR DA+KLEEWARAQ  +S
Sbjct  114   PVFGLGFVTVFDQLMEGYPSDEDREAIFQAYIKALEEDPEQYRIDAKKLEEWARAQTPSS  173

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             LVDFSSREGE+E  LKDI+ER  S + F YSRFFA+GLFRLLELSNA++PT+LEKLC+AL
Sbjct  174   LVDFSSREGEIEGTLKDIAERVASGN-FSYSRFFAVGLFRLLELSNASEPTVLEKLCSAL  232

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYE  1069
             N+NK+SVDRDLDVYR LLSKLVQA+ELLKEYV REKKK+ ER ESQK++E VTKCLG+ +
Sbjct  233   NINKRSVDRDLDVYRGLLSKLVQARELLKEYVDREKKKQEERAESQKASETVTKCLGEPQ  292

Query  1070  SVAR  1081
              V +
Sbjct  293   FVGQ  296



>gb|AFK36101.1| unknown [Lotus japonicus]
Length=298

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 238/297 (80%), Gaps = 9/297 (3%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MA VTS  SFSA+ QS  RK    + SS   L S SD  RFR +F    +  +  +S S 
Sbjct  1     MATVTSSFSFSALTQSSQRK---HTLSSTCVLGSNSDGIRFRKSFLCQQVGVQ--ASNSA  55

Query  362   SRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             S++VV C S+  D P VSETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMR+K+SY+YDP
Sbjct  56    SKLVVRCSSSVSDPPPVSETKLNFLKEYKRPIPSIYNTVLQELIVQQHLMRFKRSYRYDP  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVY++LMEGYP++ED++AIF+ YIKAL E+P QYR DAQKLEEWAR Q   SL
Sbjct  116   VFALGFVTVYEQLMEGYPSDEDRDAIFQTYIKALKEDPGQYREDAQKLEEWARTQSSTSL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             ++FSSREGEVE  LKDI+ERAG K  F YSRFFAIGLFRLLEL NA +P ILEKLCAALN
Sbjct  176   IEFSSREGEVEGALKDIAERAGGKGDFSYSRFFAIGLFRLLELGNAMEPAILEKLCAALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             V+K+SVDRDLDVYRNLLSKLVQAKELLKEY  REKKK+ ER E QK+NEA+TKCLGQ
Sbjct  236   VDKRSVDRDLDVYRNLLSKLVQAKELLKEYADREKKKQEERAEPQKANEAITKCLGQ  292



>ref|XP_003527468.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Glycine 
max]
 gb|KHN41169.1| Protein THYLAKOID FORMATION1, chloroplastic [Glycine soja]
Length=291

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 237/293 (81%), Gaps = 13/293 (4%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MA VTS  SFS + QS   +  +  SS++         FR R  F+   +  R  +S S 
Sbjct  1     MATVTSSFSFSTLTQSSSPRNLSTLSSNSPT-------FRIRVGFSCHYVGVR--ASNSA  51

Query  362   SRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             S++VV C S   + PTVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK+SY+YD 
Sbjct  52    SKIVVRCSSAVAEPPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRSYRYDA  111

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVY++LMEGYP++ED++AIF+AYI+AL E+PEQYR DA+KLEEWARAQ+  SL
Sbjct  112   VFALGFVTVYEQLMEGYPSDEDRDAIFQAYIQALKEDPEQYRVDAKKLEEWARAQNPTSL  171

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSSREGEVE ILKDI+ERAG K  F YSRFFAIGLFRLLEL+NA +PTILEKLCA LN
Sbjct  172   VDFSSREGEVEGILKDIAERAGGKGDFSYSRFFAIGLFRLLELANAMEPTILEKLCAVLN  231

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             V+K+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER E QKSNEA+T+
Sbjct  232   VDKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERAEPQKSNEAITQ  284



>ref|XP_010689310.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=288

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 212/293 (72%), Positives = 246/293 (84%), Gaps = 9/293 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFD-SLNFRTSSSGSG  361
             MAAVTSLSFSA+ QS +R+    + SS R  SS  ++ R R+NF+ D S   R S+S SG
Sbjct  1     MAAVTSLSFSALSQSFERRV---NFSSTRTFSSAFESIRLRSNFSCDFSAAVRASNSSSG  57

Query  362   SRMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
               +V+ CMS  TD P VS+TK NFL+AYKRPIPS+Y+ VLQELIVQQHLMRYK++Y+YDP
Sbjct  58    --LVIQCMSPTTDTPPVSQTKLNFLKAYKRPIPSIYNNVLQELIVQQHLMRYKRTYRYDP  115

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP++ED+ AIF AYI ALNE+PEQYR DAQKLEEWARAQ   SL
Sbjct  116   VFALGFVTVYDQLMEGYPSDEDRSAIFEAYINALNEDPEQYRKDAQKLEEWARAQTPASL  175

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             VDFSSREGE+E ILKDI+ RAG   SF YSRFFA+GLFRLLEL+NA++PTILEKLC+ALN
Sbjct  176   VDFSSREGEIEDILKDIAGRAGGTGSFSYSRFFAVGLFRLLELANASEPTILEKLCSALN  235

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             VNK++VDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER + QK+NEAVTK
Sbjct  236   VNKKNVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKREERSDIQKANEAVTK  288



>ref|XP_010526529.1| PREDICTED: protein THYLAKOID FORMATION 1, chloroplastic [Tarenaya 
hassleriana]
Length=290

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/296 (68%), Positives = 240/296 (81%), Gaps = 22/296 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+ SLS  A+GQS  R AF  S                       S++   S S   S
Sbjct  1     MAALASLSLPAMGQSEKRAAFVPSR-------------------PLPSISLSRSLSCRSS  41

Query  365   RMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             R+VV CMST  DVPTVSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYKK+Y+YDPV
Sbjct  42    RLVVRCMSTVSDVPTVSETKSNFLQAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYDPV  101

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGYP++ED++AIF++YIKALNE+PEQYR DAQK+EEWAR+Q   SLV
Sbjct  102   FALGFVTVYDQLMEGYPSDEDRDAIFKSYIKALNEDPEQYRIDAQKMEEWARSQTSASLV  161

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSSREGEVE+ILKDI+ERAGSK+ F YSRFFA+GLFRLLEL+NAT+P IL+KLCA+LN+
Sbjct  162   EFSSREGEVEAILKDIAERAGSKEGFSYSRFFAVGLFRLLELANATEPNILDKLCASLNI  221

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYV-AREKKKRGERESQKSNEAVTKCLGQ  1063
             +K+SVDRDLDVYRNLLSKLVQAKELLKEY+   +KKK    ESQK+NE +TKCLG+
Sbjct  222   DKKSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKKEERAESQKANETITKCLGE  277



>ref|XP_008800357.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008800358.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=300

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 217/239 (91%), Gaps = 4/239 (2%)
 Frame = +2

Query  362   SRMVVHCM--STDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             SRMVV C+  ++DVP TVSETK NFL++YK+PIPS+Y++VLQELIVQQHLMRYK+SYQYD
Sbjct  46    SRMVVRCVAATSDVPPTVSETKLNFLKSYKQPIPSIYNSVLQELIVQQHLMRYKRSYQYD  105

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
              VFA+GFVTV+++LMEGYP+ +D++AIFRAYI+AL E+PEQYR DAQKLEEWARAQ+ NS
Sbjct  106   AVFAVGFVTVFEQLMEGYPSNDDRDAIFRAYIQALKEDPEQYRCDAQKLEEWARAQNANS  165

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             L DFSSREGEVE ILK+ISERA  K +F YSRFFAIGLFRLLE +NAT+PTILEKLCAAL
Sbjct  166   LADFSSREGEVEDILKNISERAQGKGNFSYSRFFAIGLFRLLEQANATEPTILEKLCAAL  225

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             N++KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR ER ESQK+NEA T C+G +
Sbjct  226   NIDKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKREERVESQKANEATTTCVGAF  284



>ref|XP_004958013.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Setaria 
italica]
Length=284

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/243 (77%), Positives = 221/243 (91%), Gaps = 4/243 (2%)
 Frame = +2

Query  359   GSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
             GSR VV C++T  DVP TV+ETK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK++YQY
Sbjct  40    GSRSVVRCVATAGDVPPTVAETKLNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKRTYQY  99

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             DPVFALGFVTVYD+LM+GYP+ ED+++IF+AYI ALNE+P+QYRADAQK+EEWAR+Q+G+
Sbjct  100   DPVFALGFVTVYDQLMDGYPSNEDRDSIFKAYITALNEDPDQYRADAQKMEEWARSQNGS  159

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             SLVDFSSR+GE+E+ILKDISERA  K +F YSRFFA+GLFRLLEL+NAT+PTIL+KLCAA
Sbjct  160   SLVDFSSRDGEIEAILKDISERAKGKGNFSYSRFFAVGLFRLLELANATEPTILDKLCAA  219

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             LNVNK+SVDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ K NEAVTK  G  
Sbjct  220   LNVNKRSVDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSETPKPNEAVTKFDGDL  279

Query  1067  ESV  1075
              S+
Sbjct  280   YSM  282



>ref|XP_010051514.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW89477.1| hypothetical protein EUGRSUZ_A01774 [Eucalyptus grandis]
Length=309

 Score =   385 bits (989),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 249/307 (81%), Gaps = 9/307 (3%)
 Frame = +2

Query  188   AAVTSLSFSAIGQSPDRKAFNassssarcls----stsdaFRFRTNFAFDSLNFRTSSSG  355
             AAV SL FSAIGQS ++++  +  ++A   +    S  +  RFR++   D    RTS S 
Sbjct  3     AAVASLCFSAIGQSCEKRSLASLPATATATARGFGSNFEGIRFRSSVLSDYGGVRTSVST  62

Query  356   SGS--RMVVHCM--STDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSY  523
             S S  RMVV CM  + DVPTV+ETK NFL AYKRPIPS+Y+TVLQEL+VQQHLMRYKK Y
Sbjct  63    SNSSSRMVVRCMCSAVDVPTVAETKQNFLTAYKRPIPSIYNTVLQELLVQQHLMRYKKFY  122

Query  524   QYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQD  703
             +YDPVFALGFVTV+D+LMEGY ++ED+E IF+AYI+ALNE+PEQYR DAQKLEEWAR Q 
Sbjct  123   KYDPVFALGFVTVFDQLMEGYQSDEDRETIFQAYIRALNEDPEQYRVDAQKLEEWARNQS  182

Query  704   GNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLC  883
              +SLV FSSR GE+E  LKDI+ERAG K SF YSRFFA+GLFRLLEL+NAT+PT+L+KLC
Sbjct  183   SDSLVTFSSRGGEIEDKLKDIAERAGGKGSFSYSRFFAVGLFRLLELANATEPTVLDKLC  242

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYV-AREKKKRGERESQKSNEAVTKCLG  1060
             AALN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV   +KK+   +ESQK+NEA+TKC+G
Sbjct  243   AALNINKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKREERKESQKANEAITKCVG  302

Query  1061  QYESVAR  1081
             +Y+ V +
Sbjct  303   EYQEVGQ  309



>ref|XP_007132624.1| hypothetical protein PHAVU_011G110700g [Phaseolus vulgaris]
 gb|ESW04618.1| hypothetical protein PHAVU_011G110700g [Phaseolus vulgaris]
Length=289

 Score =   384 bits (987),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 205/294 (70%), Positives = 231/294 (79%), Gaps = 16/294 (5%)
 Frame = +2

Query  185   MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MA VTS   FS + QS  R            LSS S    FR  F+   L  R SS  S 
Sbjct  1     MATVTSSFHFSTLIQSSQRN---------LTLSSNSPTLSFRVGFSCHYLGVRASSYAS-  50

Query  362   SRMVVHCMS---TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
              +MVV C S   TD PTVSETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK+SY+YD
Sbjct  51    -KMVVRCSSSSVTDPPTVSETKLNFLKEYKRPIPSIYNTVLQELIVQQHLMRYKRSYRYD  109

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
              VFALGFVTVY++LMEGYP++ED++AIF+AYIKAL E+PEQYR DA+KLEEWARAQ+  S
Sbjct  110   AVFALGFVTVYEQLMEGYPSDEDRDAIFQAYIKALKEDPEQYRVDAKKLEEWARAQNSTS  169

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             LV+FSSREGEVE ILKDI+ERAG K  F YSRFFAIGLFRLLEL+NA +PTILEKLCA L
Sbjct  170   LVEFSSREGEVEGILKDIAERAGGKGDFSYSRFFAIGLFRLLELANAMEPTILEKLCAVL  229

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERES-QKSNEAVTK  1051
             NVNK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKK  ER   QK+NEA+T+
Sbjct  230   NVNKRSVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKIEERAGPQKTNEAITQ  283



>ref|XP_011048471.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Populus 
euphratica]
Length=298

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/266 (72%), Positives = 225/266 (85%), Gaps = 7/266 (3%)
 Frame = +2

Query  296   FRFRTNFAFDSLNFRTSSSGSGSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYS  466
             FR R+ F+   +  +  +S S SR  +HCMST  DVP TVSETK+NFL+ YKRPIPS+Y+
Sbjct  36    FRLRSVFSCHYVGVK--ASNSTSRTAIHCMSTSTDVPPTVSETKSNFLKVYKRPIPSIYN  93

Query  467   TVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEE  646
             TVLQELIVQQHLMRYKK+Y YDPVF LG VTV+D LMEGYP++ED+EAIF+AYIKAL E+
Sbjct  94    TVLQELIVQQHLMRYKKTYLYDPVFGLGLVTVFDHLMEGYPSDEDREAIFQAYIKALKED  153

Query  647   PEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             PEQYR DA+KLEEWARAQ  +SLVDFSS+EGE+E ILK I+ERA S + F YSRFFA+GL
Sbjct  154   PEQYRIDAKKLEEWARAQTHSSLVDFSSKEGEIEGILKGIAERAASGN-FSYSRFFAVGL  212

Query  827   FRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKK  1006
             FRLLELSNA++PT+LEKLC+ALN+NK+SVDRDLDVYR LLSKLVQAKELLKEYV REKKK
Sbjct  213   FRLLELSNASEPTVLEKLCSALNINKRSVDRDLDVYRGLLSKLVQAKELLKEYVDREKKK  272

Query  1007  RGER-ESQKSNEAVTKCLGQYESVAR  1081
             + ER ESQK+NE V KCLG  + V +
Sbjct  273   QEERAESQKANEIVAKCLGDPQVVGQ  298



>dbj|BAJ85363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 238/296 (80%), Gaps = 21/296 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SL F+A+ ++ D +   A+++ +                    LN R      GS
Sbjct  1     MAAISSLPFAALRRAADWRPSTATAAVSVSGGVM--------------LNARARR---GS  43

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VV C+ T  D+P TV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYDP
Sbjct  44    RSVVRCVITAGDIPPTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQYDP  103

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+ ED++AIF++Y+ ALNE+PEQYRADAQ++EEWAR+Q+GN L
Sbjct  104   VFALGFVTVYDQLMEGYPSNEDRDAIFKSYVTALNEDPEQYRADAQRMEEWARSQNGNLL  163

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSSR+GE+ESILKDISERA  K +F YSRFFA+GLFRLLELSNAT+PT+L+KLCAALN
Sbjct  164   VEFSSRDGEIESILKDISERAQGKGNFSYSRFFAVGLFRLLELSNATEPTVLDKLCAALN  223

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKR ER E+ K NEAV K  G
Sbjct  224   INKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRAERLETPKPNEAVAKFDG  279



>gb|KDO55793.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
Length=235

 Score =   380 bits (976),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 208/230 (90%), Gaps = 2/230 (1%)
 Frame = +2

Query  383   MSTDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVT  559
             M +DVP TV+ETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK++YQYDPVFALGFVT
Sbjct  1     MISDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDPVFALGFVT  60

Query  560   VYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREG  739
             VYDRLMEGYP+EED+EAIF+AYI AL E+PEQYR DAQKLEEWAR Q  +SLV+F S+EG
Sbjct  61    VYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSLVEFPSKEG  120

Query  740   EVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDR  919
             EVE +LKDI+ERA  K +F YSRFFA+GLFRLLEL+NAT+PT+LEKLCA LNVNK+SVDR
Sbjct  121   EVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLNVNKRSVDR  180

Query  920   DLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             DLDVYRNLLSKL+QAKELLKEYV REKKKR ER E QK+NEA+ KCLG+Y
Sbjct  181   DLDVYRNLLSKLLQAKELLKEYVDREKKKREERTEPQKANEAIKKCLGEY  230



>gb|AFK41560.1| unknown [Medicago truncatula]
 gb|KEH39038.1| photosystem II biogenesis protein [Medicago truncatula]
Length=287

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/291 (68%), Positives = 240/291 (82%), Gaps = 8/291 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFSA  Q   RK+   + SS R L+S+SD F  RT+ ++  +  R  +S S  
Sbjct  1     MAALTSLSFSATSQCSQRKS---TLSSTRFLASSSDMFGIRTDSSYHCVGVRVGNSAS--  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             +MV+ CMS  TDVP+VSETK NFL+AYKRPIPS+Y+ VLQELIVQ HLMRYK SYQYD V
Sbjct  56    KMVIQCMSSVTDVPSVSETKLNFLKAYKRPIPSIYNNVLQELIVQHHLMRYKTSYQYDSV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGY +EE+++ IF+AYI AL E+PEQYR DA+KLE+WA+AQ+  SLV
Sbjct  116   FALGFVTVYDKLMEGYSSEEERDTIFKAYINALKEDPEQYRIDAKKLEDWAKAQNSISLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSSREGEVE +LKDI++RAG K  F YSRFFA+GLFRLLEL+NAT+PTIL+KLCAALN+
Sbjct  176   EFSSREGEVEGVLKDIAKRAGEKGEFSYSRFFAVGLFRLLELANATEPTILDKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVT  1048
             +K+SVDRDLDVYR LLSKLVQAKEL +E++ REKKKR ER E QK+N A+T
Sbjct  236   DKRSVDRDLDVYRMLLSKLVQAKELQREFIDREKKKREERVEPQKANGAIT  286



>ref|XP_008800359.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=300

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 214/239 (90%), Gaps = 4/239 (2%)
 Frame = +2

Query  362   SRMVVHCM--STDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYD  532
             SRMVV C+  ++DVP TVSETK NFL++YK+PIPS+Y++VLQELIVQQHLMRYK+SYQYD
Sbjct  46    SRMVVRCVAATSDVPPTVSETKLNFLKSYKQPIPSIYNSVLQELIVQQHLMRYKRSYQYD  105

Query  533   PVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNS  712
              VFA+GFVTV+++LMEGYP+ +D++AIFRAYI+AL E+PEQYR DAQKLEEWARAQ+ NS
Sbjct  106   AVFAVGFVTVFEQLMEGYPSNDDRDAIFRAYIQALKEDPEQYRCDAQKLEEWARAQNANS  165

Query  713   LVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAAL  892
             L DFSSREGEVE ILK+ISERA  K +F YSRFFAIGLFRLLE +NAT+PTILEKLCAAL
Sbjct  166   LADFSSREGEVEDILKNISERAQGKGNFSYSRFFAIGLFRLLEQANATEPTILEKLCAAL  225

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             N++KQSVDRDL VYRNLLSK VQAK+LLKEYV REKKKR ER ESQK+NEA T C+G +
Sbjct  226   NIDKQSVDRDLTVYRNLLSKFVQAKDLLKEYVDREKKKREERVESQKANEATTTCVGAF  284



>gb|ACJ84959.1| unknown [Medicago truncatula]
Length=287

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 239/291 (82%), Gaps = 8/291 (3%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA+TSLSFSA  Q   RK+   + SS R L+S+SD F  RT+ ++  +  R  +S S  
Sbjct  1     MAALTSLSFSATSQCSQRKS---TLSSTRFLASSSDMFGIRTDSSYHCVGVRVGNSAS--  55

Query  365   RMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             +MV+ CMS  TDVP+VSETK NFL+AYKRPIPS+Y+ VLQELIVQ HLMRYK SYQYD V
Sbjct  56    KMVIQCMSSVTDVPSVSETKLNFLKAYKRPIPSIYNNVLQELIVQHHLMRYKTSYQYDSV  115

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             FALGFVTVYD+LMEGY +EE+++ IF+AYI AL E+PEQYR DA+KLE+WA+AQ+  SLV
Sbjct  116   FALGFVTVYDKLMEGYSSEEERDTIFKAYINALKEDPEQYRIDAKKLEDWAKAQNSISLV  175

Query  719   DFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNV  898
             +FSSRE EVE +LKDI++RAG K  F YSRFFA+GLFRLLEL+NAT+PTIL+KLCAALN+
Sbjct  176   EFSSREREVEGVLKDIAKRAGEKGEFSYSRFFAVGLFRLLELANATEPTILDKLCAALNI  235

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVT  1048
             +K+SVDRDLDVYR LLSKLVQAKEL +E++ REKKKR ER E QK+N A+T
Sbjct  236   DKRSVDRDLDVYRMLLSKLVQAKELQREFIDREKKKREERVEPQKANGAIT  286



>gb|KDO55788.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
Length=269

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 190/273 (70%), Positives = 229/273 (84%), Gaps = 7/273 (3%)
 Frame = +2

Query  185  MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
            MA++TS++F++IGQ+  ++  N SS+ +   +     FRFRT+     + FR  +S S S
Sbjct  1    MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEG--FRFRTSLFCHCVRFR--ASSSSS  56

Query  365  RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
            RM++ CMST  DVP TV+ETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK++YQYDP
Sbjct  57   RMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDP  116

Query  536  VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
            VFALGFVTVYDRLMEGYP+EED+EAIF+AYI AL E+PEQYR DAQKLEEWAR Q  +SL
Sbjct  117  VFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSL  176

Query  716  VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
            V+F S+EGEVE +LKDI+ERA  K +F YSRFFA+GLFRLLEL+NAT+PT+LEKLCA LN
Sbjct  177  VEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLN  236

Query  896  VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAR  994
            VNK+SVDRDLDVYRNLLSKL+QAKELLKEYV R
Sbjct  237  VNKRSVDRDLDVYRNLLSKLLQAKELLKEYVDR  269



>ref|NP_001288825.1| protein THYLAKOID FORMATION 1, chloroplastic [Brassica rapa]
 gb|ABV89647.1| chloroplast light-regulated protein [Brassica rapa]
Length=273

 Score =   377 bits (967),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 233/288 (81%), Gaps = 26/288 (9%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTS------  346
             MAA+ SLSF A+GQS   K  N + S              R   +  +++ R S      
Sbjct  1     MAAIASLSFPALGQSG--KLSNPTPS--------------RPLASVSAISRRISRRSLTS  44

Query  347   --SSGSGSRMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYK  514
                S S S+ V+HCMS  TDVP VSETK+NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK
Sbjct  45    SRPSTSSSKFVIHCMSSVTDVPPVSETKSNFLKAYKRPIPSIYNTVLQELIVQQHLMRYK  104

Query  515   KSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR  694
             ++Y+YDPVFALGFVTVYD+LM+GYP+++D+++IF+AY++ALNE P+QYR DAQK+EEWAR
Sbjct  105   RTYRYDPVFALGFVTVYDQLMDGYPSDQDRDSIFQAYVEALNEVPKQYRIDAQKMEEWAR  164

Query  695   AQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILE  874
             +Q   SLVDFS +EGEVE+ILKDISERAGSK+ F YSRFFA+GLFRLLEL+ ATDPT+L+
Sbjct  165   SQTSASLVDFSFKEGEVEAILKDISERAGSKEGFSYSRFFAVGLFRLLELAGATDPTVLD  224

Query  875   KLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
             KLCA+LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEYV REKKKRGER
Sbjct  225   KLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKRGER  272



>gb|EPS62074.1| hypothetical protein M569_12719, partial [Genlisea aurea]
Length=226

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 203/224 (91%), Gaps = 2/224 (1%)
 Frame = +2

Query  353   GSGSRMVVHCMS--TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQ  526
              S  R +VHCMS   DVPTVS+TK+NFL+AYK PIPS+Y+TVLQELIVQQHLMRYKKSYQ
Sbjct  3     ASRCRSLVHCMSLDADVPTVSQTKSNFLKAYKTPIPSIYNTVLQELIVQQHLMRYKKSYQ  62

Query  527   YDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDG  706
             YDPVFALGFVTVYD+LMEGYP+ ED++AIF+AYI+ALNE+P QYRADAQKLEEWA  Q  
Sbjct  63    YDPVFALGFVTVYDQLMEGYPSAEDRDAIFKAYIEALNEDPAQYRADAQKLEEWASGQSA  122

Query  707   NSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCA  886
             +SLVD++SR+G+VE ILKDI+ RAGSK +F YSRFFA+GLFRLLEL+NAT+PTIL+KLCA
Sbjct  123   SSLVDYASRDGDVEGILKDIAGRAGSKGNFSYSRFFAVGLFRLLELANATEPTILDKLCA  182

Query  887   ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
             ALNVNK+SVDRDLDVYRNLLSKLVQAKELL EY+ REKKK+ ER
Sbjct  183   ALNVNKKSVDRDLDVYRNLLSKLVQAKELLNEYIGREKKKKEER  226



>ref|NP_001168867.1| uncharacterized protein LOC100382672 [Zea mays]
 gb|ACN30897.1| unknown [Zea mays]
Length=284

 Score =   375 bits (962),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 218/248 (88%), Gaps = 6/248 (2%)
 Frame = +2

Query  344   SSSGSGSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYK  514
             S  GSGS  VV C++T  DVP TV ETK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK
Sbjct  37    SRRGSGS--VVRCVATASDVPPTVGETKLNFLKSYKRPIPSIYSTVLQELLVQQHLMRYK  94

Query  515   KSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR  694
             ++YQYD VFALGFVTVYD+LMEGYP+ ED+++IF+AYI ALNE+P QYRADA K+E WAR
Sbjct  95    RTYQYDAVFALGFVTVYDQLMEGYPSIEDRDSIFKAYITALNEDPNQYRADALKMEGWAR  154

Query  695   AQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILE  874
             +Q+G+SLVDFSSR+GE+ESILKDISERA  K +F YSRFFA+GLFRLLEL+NAT+PT+L+
Sbjct  155   SQNGSSLVDFSSRDGEIESILKDISERAKGKGNFSYSRFFAVGLFRLLELANATEPTVLD  214

Query  875   KLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             KLCAALN+NK+SVDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ K NEAVTK
Sbjct  215   KLCAALNINKRSVDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSETPKPNEAVTK  274

Query  1052  CLGQYESV  1075
               G   S+
Sbjct  275   FDGNLYSI  282



>gb|ACG46365.1| chloroplast-localized Ptr ToxA-binding protein1 [Zea mays]
Length=284

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/245 (76%), Positives = 217/245 (89%), Gaps = 4/245 (2%)
 Frame = +2

Query  341   TSSSGSGSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRY  511
             ++ S  GS  VV C++T  DVP TV+ETK NFL++YKRPIPS+YS VLQEL+VQQHLMRY
Sbjct  34    SARSRRGSCSVVRCVATTGDVPPTVAETKLNFLKSYKRPIPSIYSAVLQELLVQQHLMRY  93

Query  512   KKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWA  691
             KK+YQYD VFALGFVTVYD+LME YP+ EDK++IF+AYI ALNE+P+QYRADA K+EEWA
Sbjct  94    KKTYQYDAVFALGFVTVYDQLMERYPSNEDKDSIFKAYITALNEDPDQYRADALKMEEWA  153

Query  692   RAQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL  871
             R+Q+G+SLVDFSSR+GE+E+ILKDISERA  K +F YSRFFA+GLFRLLELSNAT+PTIL
Sbjct  154   RSQNGSSLVDFSSRDGEIEAILKDISERAKGKGNFSYSRFFAVGLFRLLELSNATEPTIL  213

Query  872   EKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVT  1048
             +KLCAALNV+K+SVDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ K NEAVT
Sbjct  214   DKLCAALNVSKRSVDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSEAPKPNEAVT  273

Query  1049  KCLGQ  1063
             K  G 
Sbjct  274   KFDGN  278



>ref|XP_003562907.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic [Brachypodium 
distachyon]
Length=286

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 213/238 (89%), Gaps = 4/238 (2%)
 Frame = +2

Query  359   GSRMVVHCM--STDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
             GSR VV C+  + D+P TV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQY
Sbjct  42    GSRSVVRCVAATADIPPTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQY  101

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             DPVFALGFVTVYD+LMEGYP+ ED++AIF++YI ALNE+PEQYRADAQK+EEWARAQ+G+
Sbjct  102   DPVFALGFVTVYDQLMEGYPSNEDRDAIFKSYITALNEDPEQYRADAQKMEEWARAQNGS  161

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
              LV+FSSR+GE+E++LKDISERA    +F YSRFFA+GLFRLLEL+NAT+PT+L+KLCAA
Sbjct  162   LLVEFSSRDGEIEAVLKDISERAQGNGNFSYSRFFAVGLFRLLELANATEPTVLDKLCAA  221

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             LN+NK+SVDRDLD+YRNLLSKLVQAKELLKEY+ REKKKR ER E+ K NE V K  G
Sbjct  222   LNINKRSVDRDLDIYRNLLSKLVQAKELLKEYIDREKKKREERLETPKPNEPVAKFDG  279



>gb|EAZ04323.1| hypothetical protein OsI_26464 [Oryza sativa Indica Group]
Length=287

 Score =   372 bits (954),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 244/301 (81%), Gaps = 20/301 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SL F+A+ ++ D +   A++++     +   + R R                 GS
Sbjct  1     MAAISSLPFAALRRAADCRPSTAAAAAGAGAGAVVLSVRPR----------------RGS  44

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VV C++T  DVP TV+ETK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYD 
Sbjct  45    RSVVRCVATAGDVPPTVAETKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKTTYQYDA  104

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+ ED++AIF+AYI ALNE+PEQYRADAQK+EEWAR+Q+GNSL
Sbjct  105   VFALGFVTVYDQLMEGYPSNEDRDAIFKAYITALNEDPEQYRADAQKMEEWARSQNGNSL  164

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSS++GE+E+ILKDISERA  K SF YSRFFA+GLFRLLEL+NAT+PTIL+KLCAALN
Sbjct  165   VEFSSKDGEIEAILKDISERAQGKGSFSYSRFFAVGLFRLLELANATEPTILDKLCAALN  224

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYES  1072
             +NK+SVDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ KSNEAVTK  G   S
Sbjct  225   INKRSVDRDLDVYRNILSKLVQAKELLKEYVEREKKKREERSETPKSNEAVTKFDGSLNS  284

Query  1073  V  1075
             +
Sbjct  285   M  285



>gb|AFO59570.1| chloroplast Ptr ToxA-binding protein [Saccharum hybrid cultivar 
GT28]
Length=284

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 210/232 (91%), Gaps = 4/232 (2%)
 Frame = +2

Query  380   CMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALG  550
             C++T  DVP TVSETK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK++YQYDPVF LG
Sbjct  47    CVATAGDVPPTVSETKLNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKRTYQYDPVFGLG  106

Query  551   FVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS  730
             FVTVYD+LMEGYP+ ED+++IFR YI ALNE+P+QYRADA K+EEWAR+Q+G+SLVDFSS
Sbjct  107   FVTVYDQLMEGYPSNEDRDSIFRTYITALNEDPDQYRADALKMEEWARSQNGSSLVDFSS  166

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQS  910
             R+GE+E+ILKDISERA  K +F YSRFFA+GLFRLLEL+NAT+PT+L+KLC ALNV+K+S
Sbjct  167   RDGEIEAILKDISERAKGKGNFSYSRFFAVGLFRLLELANATEPTVLDKLCTALNVSKRS  226

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             VDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ K NEAVTK  G 
Sbjct  227   VDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSETPKPNEAVTKFDGN  278



>ref|NP_001131923.1| chloroplast-localized Ptr ToxA-binding protein1 [Zea mays]
 gb|ACF80550.1| unknown [Zea mays]
 gb|ACG41839.1| chloroplast-localized Ptr ToxA-binding protein1 [Zea mays]
 tpg|DAA63110.1| TPA: chloroplast-localized Ptr ToxA-binding protein1 [Zea mays]
Length=284

 Score =   369 bits (948),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 211/232 (91%), Gaps = 4/232 (2%)
 Frame = +2

Query  380   CMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALG  550
             C++T  DVP TV+ETK NFL++YKRPIPS+YS VLQEL+VQQHLMRYKK+YQYD VFALG
Sbjct  47    CVATTGDVPPTVAETKLNFLKSYKRPIPSIYSAVLQELLVQQHLMRYKKTYQYDAVFALG  106

Query  551   FVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS  730
             FVTVYD+LMEGYP+ ED+++IF+AYI ALNE+P+QYRADA K+EEWAR+Q+G+SLVDFSS
Sbjct  107   FVTVYDQLMEGYPSNEDRDSIFKAYITALNEDPDQYRADALKMEEWARSQNGSSLVDFSS  166

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQS  910
             R+GE+E+ILKDISERA  K +F YSRFFA+GLFRLLELSNAT+PTIL+KLCAALNV+K+S
Sbjct  167   RDGEIEAILKDISERAKGKGNFSYSRFFAVGLFRLLELSNATEPTILDKLCAALNVSKRS  226

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQ  1063
             VDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ K NEAVTK  G 
Sbjct  227   VDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSEAPKPNEAVTKFDGN  278



>ref|XP_011047480.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=285

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 245/301 (81%), Gaps = 18/301 (6%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSP-DRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
             MAAVTS+SFSAI QS  DR+AF   + +     S     RFR++F+   +  R+S+S S 
Sbjct  1     MAAVTSVSFSAISQSSSDRRAFCTVARNLGFEGS-----RFRSSFSCHYVGVRSSNSTS-  54

Query  362   SRMVVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVF  541
                  H      PTV++TK NFL+AYKRPIPS+Y+TVLQELIVQQHLM+YKK+++YDPVF
Sbjct  55    -----HVP----PTVADTKLNFLKAYKRPIPSIYNTVLQELIVQQHLMKYKKTFRYDPVF  105

Query  542   ALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVD  721
              LGFVTV+D+LMEGYP++ED+EAIF+AYIKAL E+PEQYR DA+KLEEWARAQ  +SLVD
Sbjct  106   GLGFVTVFDQLMEGYPSDEDREAIFQAYIKALEEDPEQYRIDAKKLEEWARAQTPSSLVD  165

Query  722   FSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVN  901
             FSSREGE+E  LKDI+ER  S + F YSRFFA+GLFRLLELSNA++PT+LEKLC+ALN+N
Sbjct  166   FSSREGEIEGTLKDIAERVASGN-FSYSRFFAVGLFRLLELSNASEPTVLEKLCSALNIN  224

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYESVA  1078
             K+SVDRDLDVYR LLSKLVQA+ELLKEYV REKKK+ ER ESQK++E VTKCLG+ + V 
Sbjct  225   KRSVDRDLDVYRGLLSKLVQARELLKEYVDREKKKQEERAESQKASETVTKCLGEPQFVG  284

Query  1079  R  1081
             +
Sbjct  285   Q  285



>ref|XP_002463017.1| hypothetical protein SORBIDRAFT_02g036270 [Sorghum bicolor]
 gb|EER99538.1| hypothetical protein SORBIDRAFT_02g036270 [Sorghum bicolor]
Length=284

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 211/236 (89%), Gaps = 4/236 (2%)
 Frame = +2

Query  380   CMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALG  550
             C++T  DVP TV+ETK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK++YQYDPVF LG
Sbjct  47    CVATAGDVPPTVAETKLNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKRTYQYDPVFGLG  106

Query  551   FVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS  730
             FVTVYD+LMEGYP+ ED+++IFRAYI ALNE+P QYRADA K+EEWAR+Q+ +SLVDFSS
Sbjct  107   FVTVYDQLMEGYPSNEDRDSIFRAYITALNEDPTQYRADALKMEEWARSQNASSLVDFSS  166

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQS  910
             R+GE+E+ILKDISERA  K +F YSRFFA+GLFRLLEL+NAT+PT+L+KLC ALNV+K+S
Sbjct  167   RDGEIEAILKDISERAKGKGNFSYSRFFAVGLFRLLELANATEPTVLDKLCTALNVSKRS  226

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYESV  1075
             VDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ K NEAVTK  G   S+
Sbjct  227   VDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSETPKPNEAVTKFDGNLYSM  282



>ref|NP_001059976.1| Os07g0558500 [Oryza sativa Japonica Group]
 sp|Q84PB7.1|THF1_ORYSJ RecName: Full=Protein THYLAKOID FORMATION1, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|AAO72565.1| inositol phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAC84034.1| inositol phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAF21890.1| Os07g0558500 [Oryza sativa Japonica Group]
 gb|EAZ40280.1| hypothetical protein OsJ_24722 [Oryza sativa Japonica Group]
 dbj|BAG89278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=287

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 243/301 (81%), Gaps = 20/301 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SL F+A+ ++ D +   A++++     +   + R R                 GS
Sbjct  1     MAAISSLPFAALRRAADCRPSTAAAAAGAGAGAVVLSVRPR----------------RGS  44

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VV C++T  DVP TV+ETK NFL++YKRPI S+YSTVLQEL+VQQHLMRYK +YQYD 
Sbjct  45    RSVVRCVATAGDVPPTVAETKMNFLKSYKRPILSIYSTVLQELLVQQHLMRYKTTYQYDA  104

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+ ED++AIF+AYI ALNE+PEQYRADAQK+EEWAR+Q+GNSL
Sbjct  105   VFALGFVTVYDQLMEGYPSNEDRDAIFKAYITALNEDPEQYRADAQKMEEWARSQNGNSL  164

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSS++GE+E+ILKDISERA  K SF YSRFFA+GLFRLLEL+NAT+PTIL+KLCAALN
Sbjct  165   VEFSSKDGEIEAILKDISERAQGKGSFSYSRFFAVGLFRLLELANATEPTILDKLCAALN  224

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQYES  1072
             +NK+SVDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ KSNEAVTK  G   S
Sbjct  225   INKRSVDRDLDVYRNILSKLVQAKELLKEYVEREKKKREERSETPKSNEAVTKFDGSLNS  284

Query  1073  V  1075
             +
Sbjct  285   M  285



>ref|XP_006657830.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Oryza 
brachyantha]
Length=284

 Score =   367 bits (941),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/243 (76%), Positives = 221/243 (91%), Gaps = 4/243 (2%)
 Frame = +2

Query  359   GSRMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
             GSR VV C++T  D+P TV+ETK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK++YQY
Sbjct  40    GSRSVVRCVATAGDIPPTVAETKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKRTYQY  99

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             DPVFALGFVTVYD+LMEGYP+ ED+++IF++YI ALNE+PEQYRADAQK+EEWAR+Q+GN
Sbjct  100   DPVFALGFVTVYDQLMEGYPSNEDRDSIFKSYITALNEDPEQYRADAQKMEEWARSQNGN  159

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             SLV+FSSR+GE+E+ILKDISERA  K +F YSRFFA+GLFRLLEL+NAT+PT+L+KLC +
Sbjct  160   SLVEFSSRDGEIEAILKDISERAQGKGNFSYSRFFAVGLFRLLELANATEPTVLDKLCFS  219

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLGQY  1066
             LN+NK+SVDRDLDVYRN+LSKLVQAKELLKEYV REKKKR ER E+ KSNEAVTK  G  
Sbjct  220   LNINKRSVDRDLDVYRNILSKLVQAKELLKEYVEREKKKREERSETPKSNEAVTKFDGNL  279

Query  1067  ESV  1075
              S+
Sbjct  280   YSM  282



>gb|AAU82110.1| chloroplast inositol phosphatase-like protein [Triticum aestivum]
Length=286

 Score =   366 bits (939),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 239/296 (81%), Gaps = 21/296 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SL F+A+ ++ D +   A+++ +                    LN R      GS
Sbjct  1     MAAISSLPFAALRRAADWRPSTATAAVSVSGGVM--------------LNARARR---GS  43

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VV C++T  D+P TV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYDP
Sbjct  44    RSVVRCVATAGDIPPTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQYDP  103

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+ ED++AIF++Y+ ALNE+PEQYRADAQ++EEWAR+Q+GN L
Sbjct  104   VFALGFVTVYDQLMEGYPSTEDRDAIFKSYVTALNEDPEQYRADAQRMEEWARSQNGNLL  163

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSSR+GE+ESILKDISERA  K +F YSRFFA+GLFRLLELSNAT+PT+L+KLCAALN
Sbjct  164   VEFSSRDGEIESILKDISERAQGKGNFSYSRFFAVGLFRLLELSNATEPTVLDKLCAALN  223

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKKR ER E+ K NEAV K  G
Sbjct  224   INKKSVDRDLDVYRNLLSKLVQAKELLKEYIKREKKKREERLETPKPNEAVAKFDG  279



>gb|AAR24582.1| chloroplast-localized Ptr ToxA-binding protein1 [Triticum aestivum]
 gb|ABB60085.1| chloroplast-localized Ptr ToxA-binding protein1 [Triticum aestivum]
Length=286

 Score =   366 bits (939),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 239/296 (81%), Gaps = 21/296 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SL F+A+ ++ D +   A+++ +                    LN R      GS
Sbjct  1     MAAISSLPFAALRRAADWRPSTATAAVSVSGGVM--------------LNARARR---GS  43

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VV C++T  D+P TV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYDP
Sbjct  44    RSVVRCVATAGDIPPTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQYDP  103

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+ ED++AIF++Y+ ALNE+PEQYRADAQ++EEWAR+Q+GN L
Sbjct  104   VFALGFVTVYDQLMEGYPSTEDRDAIFKSYVTALNEDPEQYRADAQRMEEWARSQNGNLL  163

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSSR+GE+ESILKDISERA  K +F YSRFFA+GLFRLLELSNAT+PT+L+KLCAALN
Sbjct  164   VEFSSRDGEIESILKDISERAQGKGNFSYSRFFAVGLFRLLELSNATEPTVLDKLCAALN  223

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKKR ER E+ K NEAV K  G
Sbjct  224   INKKSVDRDLDVYRNLLSKLVQAKELLKEYIEREKKKREERLETPKPNEAVAKFDG  279



>ref|XP_010904849.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Elaeis 
guineensis]
Length=289

 Score =   364 bits (934),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 213/240 (89%), Gaps = 4/240 (2%)
 Frame = +2

Query  359   GSRMVVHCM--STDVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQY  529
             G+RM V C+  S+DVP TV+ETK NFL++YKRPIPS+Y++VLQEL+VQ HLMRYK++YQY
Sbjct  45    GARMAVRCLAASSDVPPTVAETKLNFLKSYKRPIPSIYNSVLQELLVQHHLMRYKRTYQY  104

Query  530   DPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN  709
             D VFALGFVTV+++LMEGYP  +D++AIF AYI+AL E+PEQYR DAQKLEEWARAQ+ N
Sbjct  105   DAVFALGFVTVFEQLMEGYPGNDDRDAIFSAYIQALKEDPEQYRCDAQKLEEWARAQNAN  164

Query  710   SLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAA  889
             +LVDFSSREGEVE ILK+ISERA  K +F YSRF AIGLFRLLEL+NAT+PTILEKLCAA
Sbjct  165   TLVDFSSREGEVEDILKNISERAQGKGNFSYSRFLAIGLFRLLELANATEPTILEKLCAA  224

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYV-AREKKKRGERESQKSNEAVTKCLGQY  1066
             LN+NK+SVDRDLDVYRNLLSKLVQAKELLKEY+   +KK+  + ESQK+NEA+TKC+G +
Sbjct  225   LNINKRSVDRDLDVYRNLLSKLVQAKELLKEYIDREKKKREEKVESQKANEAITKCMGDF  284



>gb|EMT21650.1| hypothetical protein F775_29610 [Aegilops tauschii]
Length=286

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 237/296 (80%), Gaps = 21/296 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MAA++SL F+A+ ++ D +   A+ + +                    LN R      GS
Sbjct  1     MAAISSLPFAALRRAADWRPSTATPAVSVSGGVM--------------LNARARR---GS  43

Query  365   RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             R VV C++T  D+P TV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYDP
Sbjct  44    RSVVRCVATAGDIPPTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQYDP  103

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             VFALGFVTVYD+LMEGYP+ ED++AIF++Y+ ALNE+PE YRADAQ++EEWAR+Q+GN L
Sbjct  104   VFALGFVTVYDQLMEGYPSTEDRDAIFKSYVTALNEDPETYRADAQRMEEWARSQNGNLL  163

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSSR+GE+ESILKDISERA  K +F YSRFFA+GLFRLLELSNAT+PT+L+KLCAALN
Sbjct  164   VEFSSRDGEIESILKDISERAQGKGNFSYSRFFAVGLFRLLELSNATEPTVLDKLCAALN  223

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             +NK+SVDRDLDVYRNLLSKLVQAKELLKEY+ REKKKR ER E+ K NEAV K  G
Sbjct  224   INKKSVDRDLDVYRNLLSKLVQAKELLKEYIEREKKKREERLETPKPNEAVAKFDG  279



>gb|KHN22891.1| Protein THYLAKOID FORMATION1, chloroplastic [Glycine soja]
Length=225

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 202/224 (90%), Gaps = 3/224 (1%)
 Frame = +2

Query  368   MVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVF  541
             MVV C S+  + PTVSETK NFL+AYKRPIPS+Y+TVLQELIVQQHLMRYK+SY+YD VF
Sbjct  1     MVVRCSSSVAEPPTVSETKLNFLKAYKRPIPSIYNTVLQELIVQQHLMRYKRSYRYDAVF  60

Query  542   ALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVD  721
             ALGFVTVY++LMEGYP++ED++AIF+AYI+AL E+PEQYR DA+KLEEWAR+Q+ NSL++
Sbjct  61    ALGFVTVYEQLMEGYPSDEDRDAIFQAYIQALKEDPEQYRVDAKKLEEWARSQNPNSLLE  120

Query  722   FSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVN  901
             FSSREGEVE ILKDI+ERAG K  F YSRFFAIGLFRLLEL+NA +PTILEKLCA LNVN
Sbjct  121   FSSREGEVEGILKDIAERAGGKGDFSYSRFFAIGLFRLLELANAMEPTILEKLCAVLNVN  180

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER-ESQK  1030
             K+SVDRDLDVYRNLLSKLVQAKELLKEYV R KKKR ER E QK
Sbjct  181   KRSVDRDLDVYRNLLSKLVQAKELLKEYVDRVKKKREERAEPQK  224



>gb|ABK22548.1| unknown [Picea sitchensis]
Length=304

 Score =   359 bits (922),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 213/268 (79%), Gaps = 11/268 (4%)
 Frame = +2

Query  296   FRFRTNFAFDSLNF----------RTSSSGSGSRMVVHCMSTDVPTVSETKTNFLRAYKR  445
              R+RT    D L            + SSS S +R  +   ++D+PTV+ETK+ FL+AYKR
Sbjct  36    LRWRTITGHDQLLLTVNISSRSLPKASSSLSVTRCSMSITASDIPTVAETKSAFLKAYKR  95

Query  446   PIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAY  625
             PIPS+Y+ V+QELIVQQHLMRYK++YQYD VFALGFV+VYD+LM+GYP++ D EAIFRAY
Sbjct  96    PIPSIYNNVIQELIVQQHLMRYKRTYQYDAVFALGFVSVYDQLMDGYPSDGDSEAIFRAY  155

Query  626   IKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYS  805
             I AL E+PEQYR+DA+KLEEWA +QD  S+V+F SR+GEVE ILKDI+ERA  K  F YS
Sbjct  156   INALKEDPEQYRSDAKKLEEWASSQDAKSIVEFQSRDGEVEGILKDIAERAREKKIFSYS  215

Query  806   RFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEY  985
             RFFAIGLFRLLE +NATDP +LEKLC ALN++K SVDRDLD+YRN+LSKLVQ+KELLKEY
Sbjct  216   RFFAIGLFRLLERANATDPVVLEKLCGALNISKPSVDRDLDIYRNILSKLVQSKELLKEY  275

Query  986   VAREKKKRGERES-QKSNEAVTKCLGQY  1066
             V REKKKR ERES QKS+EAV K    Y
Sbjct  276   VEREKKKRTERESNQKSSEAVAKIESTY  303



>gb|EMS60897.1| Protein THYLAKOID FORMATION1, chloroplastic [Triticum urartu]
Length=333

 Score =   355 bits (912),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 175/222 (79%), Positives = 205/222 (92%), Gaps = 1/222 (0%)
 Frame = +2

Query  398   PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLM  577
             PTV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYDPVFALGFVTVYD+LM
Sbjct  105   PTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQYDPVFALGFVTVYDQLM  164

Query  578   EGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESIL  757
             EGYP+ ED++AIF++YI ALNE+PEQYRADAQ++EEWAR+Q+GN LV+FSSR+GE+ESIL
Sbjct  165   EGYPSTEDRDAIFKSYITALNEDPEQYRADAQRMEEWARSQNGNLLVEFSSRDGEIESIL  224

Query  758   KDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYR  937
             KDISERA  K +F YSRFFA+GLFRLLELSNAT+PT+L+KLCAALN+NK+SVDRDLDVYR
Sbjct  225   KDISERAQGKGNFSYSRFFAVGLFRLLELSNATEPTVLDKLCAALNINKKSVDRDLDVYR  284

Query  938   NLLSKLVQAKELLKEYVAREKKKRGER-ESQKSNEAVTKCLG  1060
             NLLSKLVQAKELLKEY+ REKKKR ER E+ K NEAV K  G
Sbjct  285   NLLSKLVQAKELLKEYIEREKKKREERLETPKPNEAVAKFDG  326



>ref|XP_006592410.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like isoform 
X2 [Glycine max]
Length=236

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 193/208 (93%), Gaps = 1/208 (0%)
 Frame = +2

Query  431   RAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEA  610
             +AYKRPIPS+Y+TVLQELIVQQHLMRYK+SY+YD VFALGFVTVY++LMEGYP++ED++A
Sbjct  22    QAYKRPIPSIYNTVLQELIVQQHLMRYKRSYRYDAVFALGFVTVYEQLMEGYPSDEDRDA  81

Query  611   IFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILKDISERAGSKD  790
             IF+AYI+AL E+PEQYR DA+KLEEWAR+Q+ NSL++FSSREGEVE ILKDI+ERAG K 
Sbjct  82    IFQAYIQALKEDPEQYRVDAKKLEEWARSQNPNSLLEFSSREGEVEGILKDIAERAGGKG  141

Query  791   SFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKE  970
              F YSRFFAIGLFRLLEL+NA +PTILEKLCA LNVNK+SVDRDLDVYRNLLSKLVQAKE
Sbjct  142   DFSYSRFFAIGLFRLLELANAMEPTILEKLCAVLNVNKRSVDRDLDVYRNLLSKLVQAKE  201

Query  971   LLKEYVAREKKKRGER-ESQKSNEAVTK  1051
             LLKEYV REKKKR ER E QKSNEA+T+
Sbjct  202   LLKEYVDREKKKREERAEPQKSNEAITQ  229



>ref|XP_009412441.1| PREDICTED: protein THYLAKOID FORMATION1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=287

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 225/302 (75%), Gaps = 20/302 (7%)
 Frame = +2

Query  185   MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
             MA++ S+SF+    SP R+A     + A             T  +F    FR       S
Sbjct  1     MASIPSVSFA----SPCRQAAERRPTLAV------------TEASFALGGFRAGVPRLSS  44

Query  365   RMVVHCMSTDV---PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
             RMVV C++      PTVSETK NFL++YKRPIPS+Y+TVLQEL+VQQHLMRYK++YQY+ 
Sbjct  45    RMVVRCVAAASYVPPTVSETKFNFLKSYKRPIPSIYNTVLQELLVQQHLMRYKRTYQYEA  104

Query  536   VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
             V ALGFVTVY++LMEGYP  ED++AIF AYI+AL E+P+QYR+DA+KLEEWARAQ   SL
Sbjct  105   VSALGFVTVYEQLMEGYPDSEDRDAIFNAYIQALKEDPDQYRSDARKLEEWARAQTAVSL  164

Query  716   VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
             V+FSSREGE+E  LKDISER   K +F YSRFFAIGLFRLLEL+NAT+P  LEKLCAAL 
Sbjct  165   VEFSSREGEIEGTLKDISERVEGKGNFSYSRFFAIGLFRLLELANATEPAALEKLCAALK  224

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYV-AREKKKRGERESQKSNEAVTKCLGQYES  1072
             +NK+SVDRDLDVYRN+LSKLVQAKELLKEYV   +KK+  + ESQ ++E VTKC G +  
Sbjct  225   INKRSVDRDLDVYRNILSKLVQAKELLKEYVDREKKKREEKVESQNASEIVTKCTGDFHF  284

Query  1073  VA  1078
             V+
Sbjct  285   VS  286



>gb|KDO55789.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
Length=245

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 197/242 (81%), Gaps = 7/242 (3%)
 Frame = +2

Query  185  MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
            MA++TS++F++IGQ+  ++  N SS+ +   +     FRFRT+     + FR  +S S S
Sbjct  1    MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEG--FRFRTSLFCHCVRFR--ASSSSS  56

Query  365  RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
            RM++ CMST  DVP TV+ETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK++YQYDP
Sbjct  57   RMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDP  116

Query  536  VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
            VFALGFVTVYDRLMEGYP+EED+EAIF+AYI AL E+PEQYR DAQKLEEWAR Q  +SL
Sbjct  117  VFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSL  176

Query  716  VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALN  895
            V+F S+EGEVE +LKDI+ERA  K +F YSRFFA+GLFRLLEL+NAT+PT+LEK+ +  +
Sbjct  177  VEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKVISIRS  236

Query  896  VN  901
            +N
Sbjct  237  LN  238



>ref|XP_001774109.1| predicted protein [Physcomitrella patens]
 gb|EDQ61023.1| predicted protein [Physcomitrella patens]
Length=215

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              DVPTV++TK +F+++Y++PIPS+YS V+QEL+VQQHLMRY  +Y YDP+FALGFVTVYD
Sbjct  4     ADVPTVADTKLSFIKSYRKPIPSIYSNVIQELLVQQHLMRYNSTYVYDPIFALGFVTVYD  63

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE  748
             +LM+GYP +ED++AIF+AYI ALNE+PEQYR D++KLEEWA AQ G+ + DF+ ++GEVE
Sbjct  64    QLMDGYPNDEDRDAIFKAYISALNEDPEQYRKDSKKLEEWAAAQSGSGIADFAGKDGEVE  123

Query  749   SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLD  928
             + LKDI+ERA  K+ F YSRFFAIGLFRLLE + A+DP +LE L  ALNV+K+SVDRDLD
Sbjct  124   AALKDIAERAAGKEKFHYSRFFAIGLFRLLECAKASDPAVLETLSKALNVSKRSVDRDLD  183

Query  929   VYRNLLSKLVQAKELLKEYVAREKKKR  1009
             VYRNLLSKL Q KEL+KEYV R   +R
Sbjct  184   VYRNLLSKLAQGKELIKEYVDRWVIRR  210



>ref|XP_001771049.1| predicted protein [Physcomitrella patens]
 gb|EDQ64204.1| predicted protein [Physcomitrella patens]
Length=205

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +2

Query  392  DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
            DVPTVSETK +F+++Y++PIPS+YS V+QEL+VQQHLMRY  +Y YDP+FALGFVTVYD+
Sbjct  5    DVPTVSETKASFIKSYRKPIPSIYSNVIQELLVQQHLMRYNSTYTYDPIFALGFVTVYDQ  64

Query  572  LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVES  751
            LM+GYP   D+++IF AYI ALNE+P +YR DA+KLEEWA AQ  + + DF+SR+GEVE+
Sbjct  65   LMDGYPDATDRDSIFTAYINALNEDPVKYREDAKKLEEWASAQSASGITDFTSRDGEVEA  124

Query  752  ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDV  931
             LK I+ERAGSKD F YSRFFAIGLFRLLE + A+DP +LE L  ALNVNK+SVDRDLDV
Sbjct  125  TLKSIAERAGSKDKFHYSRFFAIGLFRLLECAKASDPAVLESLSKALNVNKRSVDRDLDV  184

Query  932  YRNLLSKLVQAKELLKEYVAR  994
            YRNLLSKL Q KEL+KEY  R
Sbjct  185  YRNLLSKLAQGKELIKEYNER  205



>gb|KDO55790.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
 gb|KDO55791.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
 gb|KDO55792.1| hypothetical protein CISIN_1g022333mg [Citrus sinensis]
Length=252

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 193/235 (82%), Gaps = 7/235 (3%)
 Frame = +2

Query  185  MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
            MA++TS++F++IGQ+  ++  N SS+ +   +     FRFRT+     + FR  +S S S
Sbjct  1    MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEG--FRFRTSLFCHCVRFR--ASSSSS  56

Query  365  RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
            RM++ CMST  DVP TV+ETK NFL+ YKRPIPS+Y+TVLQELIVQQHLMRYK++YQYDP
Sbjct  57   RMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDP  116

Query  536  VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
            VFALGFVTVYDRLMEGYP+EED+EAIF+AYI AL E+PEQYR DAQKLEEWAR Q  +SL
Sbjct  117  VFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSL  176

Query  716  VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKL  880
            V+F S+EGEVE +LKDI+ERA  K +F YSRFFA+GLFRLLEL+NAT+PT+LEK+
Sbjct  177  VEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKV  231



>ref|XP_002985488.1| hypothetical protein SELMODRAFT_122474, partial [Selaginella 
moellendorffii]
 ref|XP_002987083.1| hypothetical protein SELMODRAFT_125247, partial [Selaginella 
moellendorffii]
 gb|EFJ11926.1| hypothetical protein SELMODRAFT_125247, partial [Selaginella 
moellendorffii]
 gb|EFJ13362.1| hypothetical protein SELMODRAFT_122474, partial [Selaginella 
moellendorffii]
Length=206

 Score =   304 bits (779),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +2

Query  392  DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
            DVPTV++TK+ FL+A+++PIPS+Y+ VLQEL+VQQHLMRY  +Y+YD VFALGFVTVYD+
Sbjct  1    DVPTVADTKSAFLKAFRKPIPSIYNNVLQELLVQQHLMRYNATYKYDAVFALGFVTVYDQ  60

Query  572  LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVES  751
            LM+GYP  +D EAIF+AYI+AL E+P+QYR DA+KLEEWA +Q  +SL  F+S +G+VE 
Sbjct  61   LMDGYPNAQDSEAIFKAYIEALGEDPDQYRKDAKKLEEWASSQTASSLASFNSGDGDVEE  120

Query  752  ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDV  931
            +LKDI++RA  K SF YSRFFA+GLFRL+E +NA+DP +LEKLC ALNV+K SVDRDLDV
Sbjct  121  VLKDIAQRAAGKTSFHYSRFFAVGLFRLVERANASDPAVLEKLCNALNVSKMSVDRDLDV  180

Query  932  YRNLLSKLVQAKELLKEYVAR  994
            YRNLL+KL QAK+LLKEY+ R
Sbjct  181  YRNLLTKLSQAKDLLKEYIDR  201



>gb|KCW89478.1| hypothetical protein EUGRSUZ_A01774 [Eucalyptus grandis]
Length=255

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 190/240 (79%), Gaps = 8/240 (3%)
 Frame = +2

Query  188  AAVTSLSFSAIGQSPDRKAFNassssarcls----stsdaFRFRTNFAFDSLNFRTSSSG  355
            AAV SL FSAIGQS ++++  +  ++A   +    S  +  RFR++   D    RTS S 
Sbjct  3    AAVASLCFSAIGQSCEKRSLASLPATATATARGFGSNFEGIRFRSSVLSDYGGVRTSVST  62

Query  356  SGS--RMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSY  523
            S S  RMVV CM +  DVPTV+ETK NFL AYKRPIPS+Y+TVLQEL+VQQHLMRYKK Y
Sbjct  63   SNSSSRMVVRCMCSAVDVPTVAETKQNFLTAYKRPIPSIYNTVLQELLVQQHLMRYKKFY  122

Query  524  QYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQD  703
            +YDPVFALGFVTV+D+LMEGY ++ED+E IF+AYI+ALNE+PEQYR DAQKLEEWAR Q 
Sbjct  123  KYDPVFALGFVTVFDQLMEGYQSDEDRETIFQAYIRALNEDPEQYRVDAQKLEEWARNQS  182

Query  704  GNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLC  883
             +SLV FSSR GE+E  LKDI+ERAG K SF YSRFFA+GLFRLLEL+NAT+PT+L+K+C
Sbjct  183  SDSLVTFSSRGGEIEDKLKDIAERAGGKGSFSYSRFFAVGLFRLLELANATEPTVLDKVC  242



>gb|ACJ84665.1| unknown [Medicago truncatula]
 gb|AFK42848.1| unknown [Medicago truncatula]
Length=219

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  185  MAAVTS-LSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSG  361
            MAAVTS  SFS + QS  RK    SS+      S +  FRF  +  +  +     +S   
Sbjct  1    MAAVTSSFSFSTLTQSSQRKLTTLSSTRFFGSDSDAVRFRFSISLRYVGV---VRTSNFV  57

Query  362  SRMVVHCMST--DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
            S++VV C S+  D PTVSETK NFL+AYKRPIPS+Y++VLQELIVQQHLMRYKKSY+YDP
Sbjct  58   SKLVVRCSSSVSDPPTVSETKLNFLKAYKRPIPSIYNSVLQELIVQQHLMRYKKSYRYDP  117

Query  536  VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
            VFALGFVTVYD+LMEGYP++ED++AIF+AYI AL E+P QYR DAQKLEEWARAQ+  SL
Sbjct  118  VFALGFVTVYDQLMEGYPSDEDRDAIFQAYINALKEDPAQYRVDAQKLEEWARAQNATSL  177

Query  716  VDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLL  838
            ++FSSRE EVE  LKDI+ERAG    F YSRFFA+G F  L
Sbjct  178  IEFSSREREVEGTLKDIAERAGGNGDFSYSRFFAVGFFDFL  218



>tpg|DAA63111.1| TPA: hypothetical protein ZEAMMB73_220735 [Zea mays]
Length=207

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 145/159 (91%), Gaps = 3/159 (2%)
 Frame = +2

Query  380  CMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALG  550
            C++T  DVP TV+ETK NFL++YKRPIPS+YS VLQEL+VQQHLMRYKK+YQYD VFALG
Sbjct  47   CVATTGDVPPTVAETKLNFLKSYKRPIPSIYSAVLQELLVQQHLMRYKKTYQYDAVFALG  106

Query  551  FVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS  730
            FVTVYD+LMEGYP+ ED+++IF+AYI ALNE+P+QYRADA K+EEWAR+Q+G+SLVDFSS
Sbjct  107  FVTVYDQLMEGYPSNEDRDSIFKAYITALNEDPDQYRADALKMEEWARSQNGSSLVDFSS  166

Query  731  REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELS  847
            R+GE+E+ILKDISERA  K +F YSRFFA+GLFRLL+ +
Sbjct  167  RDGEIEAILKDISERAKGKGNFSYSRFFAVGLFRLLDFA  205



>ref|XP_005648137.1| photosystem II biogenesis protein Psp29 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23593.1| photosystem II biogenesis protein Psp29 [Coccomyxa subellipsoidea 
C-169]
Length=290

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 162/234 (69%), Gaps = 2/234 (1%)
 Frame = +2

Query  341   TSSSGSGSRMVVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKS  520
             T+S+ +   +VV     + PTV+ETK NF  A+ RPIP +YS V+QEL+VQ H+MRY KS
Sbjct  47    TNSTSARRSLVVRAGEWNPPTVAETKRNFYEAFSRPIPGIYSNVIQELLVQHHIMRYNKS  106

Query  521   YQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQ  700
             Y YD VF LGFV+V+D+++EG P E DK A+F AYI +L E  +QYR DA+K+E  A+  
Sbjct  107   YSYDEVFGLGFVSVFDQVLEGLP-EGDKGALFSAYIGSLGENGDQYRQDAEKVEALAKEL  165

Query  701   DGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKL  880
              G + +   +   E++  L  I+ER+ S+ +F Y++FFAIGLFRLLEL+ A DP  LE L
Sbjct  166   SGPAELKPDAEGSELQKKLASIAERS-SQGNFLYTKFFAIGLFRLLELTGAKDPKALEGL  224

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
              +A+ + ++SV RDL  Y+ +LSKL  AK+L+ E  AREKKK  ERE++K  +A
Sbjct  225   VSAMKIPQESVSRDLMTYKGVLSKLSAAKDLMNEMYAREKKKAAEREAEKKAKA  278



>dbj|BAJ90199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 139/184 (76%), Gaps = 20/184 (11%)
 Frame = +2

Query  185  MAAVTSLSFSAIGQSPDRKAFNassssarclsstsdaFRFRTNFAFDSLNFRTSSSGSGS  364
            MAA++SL F+A+ ++ D +   A+++ +                    LN R   +  GS
Sbjct  1    MAAISSLPFAALRRAADWRPSTATAAVSVSGGVM--------------LNAR---ARRGS  43

Query  365  RMVVHCMST--DVP-TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDP  535
            R VV C+ T  D+P TV++TK NFL++YKRPIPS+YSTVLQEL+VQQHLMRYK +YQYDP
Sbjct  44   RSVVRCVITAGDIPPTVADTKMNFLKSYKRPIPSIYSTVLQELLVQQHLMRYKSTYQYDP  103

Query  536  VFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL  715
            VFALGFVTVYD+LMEGYP+ ED++AIF++Y+ ALNE+PEQYRADAQ++EEWAR+Q+GN L
Sbjct  104  VFALGFVTVYDQLMEGYPSNEDRDAIFKSYVTALNEDPEQYRADAQRMEEWARSQNGNLL  163

Query  716  VDFS  727
            V+FS
Sbjct  164  VEFS  167



>gb|KFM25912.1| Protein THYLAKOID FORMATION1, chloroplastic [Auxenochlorella 
protothecoides]
Length=248

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 147/223 (66%), Gaps = 4/223 (2%)
 Frame = +2

Query  362   SRMVVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVF  541
             S    H      PTV++TK  FL  +KRP+P +YSTV+QEL+VQQHL R+  +Y Y+ + 
Sbjct  9     SAAATHEHHPIPPTVADTKAAFLEGFKRPLPGIYSTVIQELLVQQHLFRWNVTYSYNAIT  68

Query  542   ALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVD  721
             ALG V+++D+L+EG P   +++ IF A+IKAL E+P QYR DA++LEE A +  G   + 
Sbjct  69    ALGVVSIFDQLLEGLP---EQDPIFEAFIKALQEDPAQYRGDARRLEEAAGSLGGPENLK  125

Query  722   FSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVN  901
               +   E++  L   +E   S + F Y+RFFA+GLFRLLEL+ A  P  L  L +AL V 
Sbjct  126   PDAEGSEIQKTLAQTAEAIKSGN-FLYTRFFAVGLFRLLELAGAKGPKALSGLTSALGVP  184

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + V+ DL  Y+N+LSKL  AKE++KE++ REKKK  +R ++K
Sbjct  185   LERVNADLLTYKNVLSKLQAAKEIMKEFLEREKKKTAQRLAEK  227



>ref|XP_001693657.1| inositol phosphatase-like protein [Chlamydomonas reinhardtii]
 gb|EDP08911.1| inositol phosphatase-like protein [Chlamydomonas reinhardtii]
Length=266

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = +2

Query  398   PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLM  577
             PTV+ETK  FL  Y +PI S+YSTVLQEL+VQQH MRY K+YQY+P+FALGFV+VY++++
Sbjct  43    PTVAETKAKFLSGYNKPIASIYSTVLQELLVQQHFMRYSKNYQYNPIFALGFVSVYEQIL  102

Query  578   EGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESIL  757
             E    EE + AIF+AY+ AL E+ ++Y+ DA  LE+ A      SL    + +G      
Sbjct  103   ESLSAEE-RGAIFKAYVDALGEDADKYKRDASALEQAANGLTPESLT--PNADGNEVQKA  159

Query  758   KDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYR  937
                   A +  +F Y++F AIGLFRLLELS A +P+ LEKL  A+ V  ++V+RDL +Y+
Sbjct  160   LASISSASAAGAFSYNKFVAIGLFRLLELSGAKEPSALEKLVKAVGVKPEAVNRDLLMYK  219

Query  938   NLLSKLVQAKELLKEYVAREKKKRGERE  1021
              +LSKL  AKEL++E+V REK+K+ ER+
Sbjct  220   GVLSKLAAAKELMREFVEREKRKQAERD  247



>ref|XP_002957794.1| hypothetical protein VOLCADRAFT_107813 [Volvox carteri f. nagariensis]
 gb|EFJ41122.1| hypothetical protein VOLCADRAFT_107813 [Volvox carteri f. nagariensis]
Length=373

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 148/241 (61%), Gaps = 37/241 (15%)
 Frame = +2

Query  398   PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLM  577
             PTV+ETK  F   Y +PI S+YSTVLQEL+VQQH MRY K Y Y+ +FALGFV+VY++++
Sbjct  44    PTVAETKAKFFEGYSKPIASIYSTVLQELLVQQHFMRYSKDYVYNEIFALGFVSVYEQIL  103

Query  578   EGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDG-NSLVD-----------  721
             E  P  E ++AIF +Y+KAL E+PE Y+ D++++E+ A A  G ++LV            
Sbjct  104   ESLPQSE-RDAIFVSYVKALGEDPEAYKRDSERVEKAAGALSGPDALVPDAEGSDVQTSA  162

Query  722   ----FSSREGEVESILKDISERAGSKD--------------------SFRYSRFFAIGLF  829
                 +  R GE+    +  +   GS                      +F Y++F AIGLF
Sbjct  163   YIWAYHQRRGEMRMPWRTRTWGQGSSSLGVCSYGKALDAIKAASAADAFSYNKFVAIGLF  222

Query  830   RLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
             RLLEL+ A +P  LE+L  ++ +  ++V+RDL +Y+ +LSKL  AKE+++E+V REK++ 
Sbjct  223   RLLELTGAKEPAALERLVKSVGIKPEAVNRDLLMYKGVLSKLAAAKEMMREFVEREKRRG  282

Query  1010  G  1012
             G
Sbjct  283   G  283



>ref|WP_015118635.1| photosystem II biogenesis protein Psp29 [Rivularia sp. PCC 7116]
 ref|YP_007055609.1| photosystem II biogenesis protein Psp29 [Rivularia sp. PCC 7116]
 gb|AFY55062.1| photosystem II biogenesis protein Psp29 [Rivularia sp. PCC 7116]
Length=233

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 150/231 (65%), Gaps = 15/231 (6%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVSETK  F   + RPI ++Y  V++EL+V+ HL+     ++YDP++ALG VT +D
Sbjct  2     NNVRTVSETKRTFYSLHTRPINTIYRRVVEELMVEMHLLGVNADFKYDPIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEV  745
             R M+GY  EEDKE+I+ A IK++ E+P++YR DA++LE+ A++  G  LV D S R    
Sbjct  62    RFMQGYNPEEDKESIYNALIKSVEEDPQKYRHDAKRLEDLAKSTTGKDLVSDLSQRRLAN  121

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALN  895
             +S L+ + E   +  SF+YSR FAIGL+ LLE   ++DP +          L+ + A LN
Sbjct  122   DSELQGLLEGIANNSSFKYSRLFAIGLYTLLE---SSDPEMVKDEKLRNEALKTIAAGLN  178

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
             +++  + +DLD+YR+ L K+ QA  ++ + +A ++K+R +R +QKS   V+
Sbjct  179   LSEDKLSKDLDLYRSNLDKMAQAAIVMADMIAADRKRREQR-AQKSETKVS  228



>ref|XP_005849113.1| hypothetical protein CHLNCDRAFT_143677 [Chlorella variabilis]
 gb|EFN57011.1| hypothetical protein CHLNCDRAFT_143677 [Chlorella variabilis]
Length=273

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 140/201 (70%), Gaps = 7/201 (3%)
 Frame = +2

Query  398  PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLM  577
            PTV++ K  F  A+K+P+P++YSTV+QEL+VQQHL R+ K YQY+ V ALG V+++++++
Sbjct  51   PTVADAKLKFNGAFKKPLPAIYSTVVQELLVQQHLFRWNKQYQYNEVTALGIVSIFEQVL  110

Query  578  EGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESIL  757
             G P  E +EA+F A+I AL E+P+QYR DA  +EE AR   G S V   +   +V+  L
Sbjct  111  GGLPDAE-REAVFDAFINALQEDPKQYRKDAAAMEELAR---GKSEVAPDASGDKVQQAL  166

Query  758  KDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYR  937
              ++ + G    F Y++FFA+GLFRL+EL+ + DP  L  L  AL ++++ V+ DL  Y+
Sbjct  167  AAVAAKEGK---FLYTKFFAVGLFRLVELTGSKDPKSLTTLVKALGLSQERVNADLMTYK  223

Query  938  NLLSKLVQAKELLKEYVAREK  1000
             +LSKL  AKE++KE++AREK
Sbjct  224  GVLSKLEAAKEIMKEFMAREK  244



>emb|CEF97146.1| Photosystem II Psp29, biogenesis [Ostreococcus tauri]
Length=254

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 139/207 (67%), Gaps = 10/207 (5%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TV++TK  FL AY  PIPSV++TV+QEL+VQ H  +Y K  +Y+ + +LGFV+VYD+L E
Sbjct  42    TVADTKRKFLEAYPYPIPSVWATVVQELLVQGHFQKYNKKSEYNELASLGFVSVYDQLFE  101

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE-SIL  757
             G+P+EE+K  IF A++ AL+E+  + RADA+ L  +A + +G         EG  E +I 
Sbjct  102   GFPSEEEKGKIFNAFLGALDEDAVRTRADAETLGAFATSANGV--------EGLKENAIF  153

Query  758   KDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYR  937
               ++ ++ ++ +  Y+++ AIG+FR+LEL+ ATDP  LE L  A  ++   V  DL +Y+
Sbjct  154   AKLAAKS-AEGTLLYTKYIAIGMFRMLELAKATDPAALEALVTAGGLSMSKVSGDLSMYK  212

Query  938   NLLSKLVQAKELLKEYVAREKKKRGER  1018
              LLSKL  AKEL +E++ REK+K  ER
Sbjct  213   GLLSKLAAAKELQEEFLEREKRKTAER  239



>ref|XP_002501243.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62501.1| predicted protein [Micromonas sp. RCC299]
Length=260

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 133/210 (63%), Gaps = 8/210 (4%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             T+++TK  F+ +Y  PIPS++S  + EL+  QH +RY   Y Y  + +LGFV+VYD+L E
Sbjct  51    TLADTKRKFVESYPYPIPSIWSVAVNELLANQHFVRYSTRYSYSKLSSLGFVSVYDQLFE  110

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             G+P++E+K  IF  +++AL E+PE+ R DA +L ++A+   G   +  S    E++S   
Sbjct  111   GFPSDEEKAKIFDCFVEALGEDPEKCRKDAAELAKFAKEAGGVDALLASPVLAEIKS---  167

Query  761   DISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRN  940
                   G  + F YSR+ AIGLFR+LEL  AT+P  LEKL  A  +  + V+ DL +Y+ 
Sbjct  168   -----NGEANKFAYSRYDAIGLFRMLELGGATEPAALEKLADAAGLKLKKVNGDLGMYKG  222

Query  941   LLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             LLSKL  AKEL KE   REK+K  ER ++K
Sbjct  223   LLSKLAAAKELQKEIFEREKRKTAERLAKK  252



>ref|XP_001416959.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95252.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=203

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 139/211 (66%), Gaps = 8/211 (4%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  FL+AY  PIPSV+STV QEL+VQ H  +Y    +Y  + +LGFV+V+D+L E
Sbjct  1     TVSDTKAKFLQAYPYPIPSVWSTVTQELLVQGHFAKYNAKSEYSELASLGFVSVFDQLYE  60

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             G+P+E +K  IF A++ AL E+  + RADA+ L  +A +  G   VD  S       I  
Sbjct  61    GFPSETEKVKIFNAFLGALGEDAAKTRADAEALGAFAASAGG---VDGLS----ANPIFA  113

Query  761   DISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRN  940
              ++ ++ +++   Y+++ AIG+FR+LEL+ ATDP  LE L  A  ++ + V+ DL +Y+ 
Sbjct  114   TMAAKS-AENKLMYTKYIAIGIFRMLELAKATDPKALEALAQAGGLSFKKVNGDLAMYKG  172

Query  941   LLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             LLSKL  AKEL +E++ REK+K  ER ++K+
Sbjct  173   LLSKLASAKELQEEFLEREKRKTAERMAKKA  203



>ref|WP_015148891.1| photosystem II biogenesis protein Psp29 [Oscillatoria acuminata]
 ref|YP_007086170.1| photosystem II biogenesis protein Psp29 [Oscillatoria acuminata 
PCC 6304]
 gb|AFY82250.1| photosystem II biogenesis protein Psp29 [Oscillatoria acuminata 
PCC 6304]
Length=235

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 140/232 (60%), Gaps = 17/232 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + YDP++ALG VT +D
Sbjct  2     NNVRTVSDTKRAFYTIHTRPINSIYRRVVEELMVEMHLLSVNVDFNYDPIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR-----  733
             R M+GY  EEDK +IF    K L  +P++YR DAQ LEE A    G  +V   SR     
Sbjct  62    RFMQGYRPEEDKISIFNGICKGLEADPQKYRQDAQWLEEIASRHSGEEMVALLSRSAGPE  121

Query  734   -EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN-------ATDPTILEKLCAA  889
              EG+ + IL  I+    +K +F+YSR FA+GLF LLE ++        +    ++K+C A
Sbjct  122   MEGDFQGILGAIA----AKPNFKYSRLFAVGLFTLLEQADLELVKNEKSRQEAVQKICTA  177

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
             LN+    + +DLD+YR  L K++QA+ ++++ +A ++KKR +R  QK    V
Sbjct  178   LNLPVDKLSKDLDLYRTNLEKMIQARSVMEDILAADRKKREDRAKQKGAATV  229



>ref|WP_006631394.1| inositol phosphatase [Microcoleus vaginatus]
 gb|EGK90417.1| Protein thf1 [Microcoleus vaginatus FGP-2]
Length=237

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 135/222 (61%), Gaps = 17/222 (8%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI S+Y  V++EL+V+ HL+     +QYDP++ALG VT +DR M 
Sbjct  6     TVSDTKRSFYTIHTRPINSIYRRVVEELMVEMHLLSANADFQYDPIYALGVVTAFDRFML  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             GY  E D+ +IF A  K+L ++P++Y+ DAQ+LE  A    G  L+ +  R    E    
Sbjct  66    GYAPEADRVSIFNALCKSLEDDPDRYKQDAQRLESLADRLSGQELLSWLDRSTSFEDT-A  124

Query  761   DISERAG---SKDSFRYSRFFAIGLFRLLELSNATDPTILE----------KLCAALNVN  901
             D+    G   S   F+YSR FAIGLF LLE     DP +++          K+ AAL++ 
Sbjct  125   DLQASLGAIASNPQFKYSRLFAIGLFSLLE---KADPNLVKDQETRNDAIAKVSAALHLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
             +  V +DLD+YR+ L K+ QA+ +L++ +  E+KKR +RE++
Sbjct  182   EDKVSKDLDLYRSNLEKMAQARIVLQDVIQAERKKREKRETK  223



>gb|EHC09457.1| Protein thf1 [Fischerella sp. JSC-11]
Length=235

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 146/235 (62%), Gaps = 24/235 (10%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P+FALG VT +DR
Sbjct  3     NVRTVSDTKRTFHTLHTRPINTIYRRVVEELMVEMHLLAVNVDFSYNPIFALGVVTSFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------R  733
              M+GY  E DKE+IF A ++A+  +P+ YR DAQ+L+E A++     L+   S      R
Sbjct  63    FMQGYQPESDKESIFNALLRAIEADPQIYRQDAQRLQELAKSLPPQDLIAALSLQTQLNR  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLC  883
             + +++S L+ I     S   F+YSR FAIGLF LLELS   DP +          L+ + 
Sbjct  123   DTDLQSHLQAI----ASNPKFKYSRLFAIGLFSLLELS---DPELVKDEKQRTEALKSIA  175

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
             A L+++   +++DL++YR+ L K+ QA  ++ + ++ ++KKR +R SQ+S+  VT
Sbjct  176   AGLHISDDKLNKDLELYRSNLDKMAQALVVMADMLSADRKKREQR-SQQSSTTVT  229



>ref|WP_009785061.1| inositol phosphatase [Lyngbya sp. PCC 8106]
 gb|EAW36410.1| hypothetical protein L8106_23815 [Lyngbya sp. PCC 8106]
Length=241

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 139/221 (63%), Gaps = 13/221 (6%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              ++ TVS+TK  F   + RPI SVY  V++EL+V+ HL+     +QYDP++ALG V+ +D
Sbjct  2     NNIRTVSDTKRAFYNTHTRPINSVYRRVIEELMVEMHLLSVNVDFQYDPIYALGVVSAFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR---AQDGNSLVDFSSREG  739
             R M+GY  E DKE+IF   I AL ++P++YRA+AQ+L+E+A+    QD  S VD ++   
Sbjct  62    RFMQGYLPESDKESIFHGLINALQDDPQRYRAEAQRLQEFAQTLSVQDIVSWVDVAAN-S  120

Query  740   EVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN--------ATDPTILEKLCAALN  895
             EV + L+   ++  +   ++YSR  AIGLF L+E ++        AT  T L +L + LN
Sbjct  121   EVHNDLQSSFQKIATNPKYKYSRILAIGLFTLIEQADPQAMEDKEATQQT-LAQLASGLN  179

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
             +    + +DL++YR+ L KL QA+ ++ E    E+K+R +R
Sbjct  180   LPLDKLQKDLELYRSNLEKLKQARIVMDEMTQAERKRREQR  220



>ref|WP_023064575.1| photosystem II biogenesis protein Psp29 [Lyngbya aestuarii]
 gb|ERT09348.1| photosystem II biogenesis protein Psp29 [Lyngbya aestuarii BL 
J]
Length=241

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 141/220 (64%), Gaps = 13/220 (6%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + RPI SVY  V++EL+V+ HL+     +QYDP++ALG VT +DR
Sbjct  3     NIRTVSDTKRAFYSIHTRPINSVYRRVIEELMVEMHLLSVNVDFQYDPIYALGVVTAFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR---AQDGNSLVDFSSREGE  742
              M+GY  E DKE+IF A I AL ++P++YRA+AQ+L+E+A+    +D  S VD ++   E
Sbjct  63    FMQGYLPESDKESIFNALINALQDDPQRYRAEAQRLQEFAQTLSVEDIVSWVDDAAN-SE  121

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN--------ATDPTILEKLCAALNV  898
             V++ L+   ++  +   ++YSR  AIGLF L+E ++        AT  T L +L + LN+
Sbjct  122   VQNDLQGSFQKIATTPKYKYSRILAIGLFTLIEQADPQAMEDKEATQQT-LTQLASGLNL  180

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
                 + +DL++YR+ L KL QA+ ++ E    E+K+R +R
Sbjct  181   PLDKLQKDLELYRSNLEKLKQARIVMDEMTQAERKRREQR  220



>ref|WP_015175941.1| Protein thf1 [Oscillatoria nigro-viridis]
 ref|YP_007115054.1| Protein thf1 [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ06638.1| Protein thf1 [Oscillatoria nigro-viridis PCC 7112]
Length=237

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 134/222 (60%), Gaps = 17/222 (8%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI S+Y  V++EL+V+ HL+     +QYDP++ALG VT +DR M 
Sbjct  6     TVSDTKRSFYTIHTRPINSIYRRVVEELMVEMHLLSANADFQYDPIYALGVVTAFDRFML  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             GY  E D+ +IF A  K++ ++P++Y+ DAQ+LE  A    G  L+ +  R    E    
Sbjct  66    GYVPEADRVSIFNALCKSVEDDPDRYKQDAQRLESLADRLSGQELLSWLDRSTSFEDT-A  124

Query  761   DISERAG---SKDSFRYSRFFAIGLFRLLELSNATDPTILE----------KLCAALNVN  901
             D+    G   S   F+YSR FAIGLF LLE     DP +++          K+ A L++ 
Sbjct  125   DLQASLGAIASNPQFKYSRLFAIGLFSLLE---KADPNLVKDQETRNDAIAKVSAGLHLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
             +  V +DLD+YR+ L K+ QA+ +L++ +  E+KKR +RE++
Sbjct  182   EDKVSKDLDLYRSNLEKMAQARIVLQDVIQAERKKREKRETK  223



>ref|WP_012165139.1| inositol phosphatase [Acaryochloris marina]
 ref|YP_001519180.1| Thf1-like protein [Acaryochloris marina MBIC11017]
 sp|B0C3M8.1|THF1_ACAM1 RecName: Full=Protein Thf1 [Acaryochloris marina MBIC11017]
 gb|ABW29862.1| photosystem II biogenesis protein Psb29 [Acaryochloris marina 
MBIC11017]
Length=247

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 135/222 (61%), Gaps = 16/222 (7%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RP+ SVY  V++EL+V+ HL+R  + ++YDP+FALG  T +DR M+
Sbjct  6     TVSDTKRAFYSIHTRPVNSVYRRVVEELMVEMHLLRVNEDFRYDPIFALGVTTSFDRFMD  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF-----SSREGEV  745
             GY  E DK+AIF A  KA   +P Q + D Q+L E A+++    ++D+     +S   E+
Sbjct  66    GYQPENDKDAIFSAICKAQEADPVQMKKDGQRLTELAQSKSAQEMLDWITQAANSGGDEL  125

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELS--NATD-----PTILEKLCAALNVNK  904
             +  L++I++       F+YSR FAIGLF LLELS  N T         L  +C  LN+++
Sbjct  126   QWQLRNIAQNP----KFKYSRLFAIGLFTLLELSEGNITQDEESLAEFLPNICTVLNISE  181

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
               + +DL++YR  L K+ Q ++ + + +  +KK+R   +++K
Sbjct  182   SKLQKDLEIYRGNLDKIAQVRQAMDDILEAQKKRREADQAKK  223



>ref|WP_036265526.1| inositol phosphatase, partial [Mastigocoleus testarum]
Length=220

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 140/223 (63%), Gaps = 17/223 (8%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK +F   + RPI S+Y  V++EL+V+ HL      + Y+P++ALG VTV++
Sbjct  2     NNVRTVSDTKRSFYTLHTRPINSIYRRVVEELMVEMHLNSVNADFSYNPIYALGVVTVFE  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV------DFSS  730
             R M+GY  ++D E+IF A +KA+ EEP+ Y+ D+QKL+  A+      L+      ++S 
Sbjct  62    RFMKGYNPQKDTESIFNALVKAIEEEPQVYQQDSQKLQTLAKNLGYQGLIACLAQENYSE  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATD----PTILEKLCAA  889
             ++ E++++L+ IS    +   F+YSR FAIG+F LLE SN     D      +L+K+   
Sbjct  122   KDAELQALLESIS----TNSKFKYSRLFAIGIFSLLECSNPDLVKDEKQLAEVLQKIATG  177

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
             LN+++    +DL++YR+ L K+ Q   ++ + ++ ++KKR +R
Sbjct  178   LNISQDKFSKDLELYRSNLEKMQQTLIVMADILSADRKKREQR  220



>ref|WP_029315500.1| inositol phosphatase [Acaryochloris sp. CCMEE 5410]
Length=247

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 135/222 (61%), Gaps = 16/222 (7%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RP+ SVY  V++EL+V+ HL+R  + ++YDP+FALG  T +DR M+
Sbjct  6     TVSDTKRAFYSIHTRPVNSVYRRVVEELMVEMHLLRVNEDFRYDPIFALGVTTSFDRFMD  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF-----SSREGEV  745
             GY  E DK+AIF A  KA   +P Q + D Q+L E A+++    ++D+     +S   E+
Sbjct  66    GYQPENDKDAIFSAICKAQEADPVQMQKDGQRLTELAQSKSAQEMLDWITQAANSGGDEL  125

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELS--NATD-----PTILEKLCAALNVNK  904
             +  L++I++       F+YSR FAIGLF LLELS  N T         L  +C  LN+++
Sbjct  126   QWQLRNIAQNP----KFKYSRLFAIGLFTLLELSEGNITQDEESLAEFLPNICTVLNISE  181

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
               + +DL++YR  L K+ Q ++ + + +  +KK+R   +++K
Sbjct  182   SKLQKDLEIYRGNLDKIAQVRQAMDDILEAQKKRREADQAKK  223



>ref|WP_026794064.1| MULTISPECIES: inositol phosphatase [Planktothrix]
 gb|KEI65922.1| hypothetical protein A19Y_0756 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=232

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 134/222 (60%), Gaps = 9/222 (4%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              ++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + YDP++ALG VT +D
Sbjct  2     NNIRTVSDTKRTFYSLHTRPINSIYRRVVEELMVEMHLLSVNVDFSYDPIYALGVVTAFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF--SSREGE  742
             R M+GY    D+E+I+ A IKA  ++P++YR DA++L+  A+      L+    S  +G 
Sbjct  62    RFMQGYDPLSDQESIYHALIKAEQDDPQRYRGDAERLQALAQNLSIKDLIASLKSPNDGG  121

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN-------ATDPTILEKLCAALNVN  901
              +  L+   +R  S   F+YSR FAIGLF +LE ++       AT   IL +L   LN+ 
Sbjct  122   SDQELQGHFQRIISNSKFKYSRLFAIGLFTILEQADPKSIQDKATREEILGQLAEVLNLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
             +  + +DLD+YR+ L KL QA+ +++E    E+KKR  R +Q
Sbjct  182   QDKLLKDLDLYRSNLEKLAQARIMMEEMTQAERKKRENRANQ  223



>ref|XP_007511153.1| Thf1-like protein [Bathycoccus prasinos]
 emb|CCO66713.1| Thf1-like protein [Bathycoccus prasinos]
Length=222

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 135/219 (62%), Gaps = 22/219 (10%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TV++TK  F + Y  P+PS+++TVLQEL+V  H       YQ++ + +LGFV+V+D+L E
Sbjct  6     TVADTKAKFTKGYPYPLPSIWATVLQELLVGMHFTVTSSKYQHEEMRSLGFVSVFDQLFE  65

Query  581   GYPTEED--KEAIFRAYIKALNEEPEQYRADAQKLEEWARAQ---DG---NSLVDFSSRE  736
             GYPTE+   KE IF  +++AL E+ +++RADA+KL  +A  Q   DG   N +  F+S +
Sbjct  66    GYPTEDPNAKEKIFSTFMEALGEDSKKWRADAEKLSAFATEQTSIDGIIANPM--FASMK  123

Query  737   GEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQSVD  916
              +VES             S  Y +F AIG FR LE+S  T P  L+K+  A  V  + ++
Sbjct  124   SKVES------------KSLVYDKFIAIGFFRALEMSKQTSPENLKKISEASGVTLEKIN  171

Query  917   RDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
              DL +Y+++LS++  AKEL  E + RE++K  ER  +K+
Sbjct  172   GDLGLYKSVLSRMNAAKELQAEVLERERRKTAERMEKKA  210



>ref|WP_026148835.1| inositol phosphatase [Leptolyngbya boryana]
Length=228

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK +F   + RP+ S++  V++EL+V+ HL+     ++YDP +ALG VT +DR 
Sbjct  4     VRTVSDTKRSFYSLHTRPVNSIFRRVVEELMVEMHLLAVNTDFRYDPFYALGVVTTFDRF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
             M+GY  E DKE+IF A  KAL  +P+QYR DAQ+L   A +   +S++    +  +    
Sbjct  64    MQGYRPEADKESIFTALCKALEADPQQYRTDAQRLIATASSAAWDSML-IPDKANDYREA  122

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL----------EKLCAALNVNK  904
             L+ +     S   F+YSR FA+GL+ +LE   A+ P ++          +++C ALN+++
Sbjct  123   LQAV----ASNPKFKYSRLFAVGLYTILE---ASSPDVVKDTAKLNETFKQICQALNISE  175

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + + +DL++YR+ L K+ Q + ++ E +A ++KKR ERE  ++
Sbjct  176   EKIQKDLELYRSNLEKMNQMQVVIAEALAADRKKREEREQAQA  218



>ref|WP_029637574.1| inositol phosphatase [[Scytonema hofmanni] UTEX B 1581]
Length=235

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 143/233 (61%), Gaps = 23/233 (10%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYNRHTRPINTIYRRVVEELMVEIHLLSVNSDFSYNPIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------R  733
              M+GY  EEDKE+IF +  +A+ E+P++Y+ DA +L+  A++     L+ + S      R
Sbjct  63    FMQGYLPEEDKESIFNSLCQAIEEDPQRYKQDAHRLQALAQSYASKDLIGWLSQTTHLDR  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLC  883
             + +++  L+ I+  A    +F+YSR FAIGLF LLELS   DP +          L+ + 
Sbjct  123   DADLQEQLQAIANNA----NFKYSRLFAIGLFSLLELS---DPELVKDEKQRIEALKTVA  175

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
             + L+++   + +DLD+YR+ L K+ QA  ++ + +A ++KKR +R  Q + + 
Sbjct  176   SGLHLSDDKLTKDLDLYRSNLDKMAQALIVMADMLAADRKKREQRLQQSTTKV  228



>ref|WP_017717307.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=234

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/231 (38%), Positives = 134/231 (58%), Gaps = 17/231 (7%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     ++YDP++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYSTHTRPINSIYRRVVEELMVEMHLLSVNVDFRYDPIYALGVVTSFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN------SLVDFSSR  733
              M+ Y  EEDK +IF A  +AL +    YR DA+KLE +AR+          SL  F   
Sbjct  63    FMQAYVPEEDKLSIFNALCQALGDGSPPYRQDAEKLEAFARSLSPQELLAWLSLSSFHPE  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAAL  892
              G+++  L+ I    G    F+YSR F IGLF LLEL++             L K+CA L
Sbjct  123   AGDLQECLQSI----GHNSKFKYSRLFGIGLFTLLELASTELSKDEKQRNEALSKICAGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
             ++ ++ + +DL++Y + L K+ QA+ ++++ +  ++KKR ER   K   A 
Sbjct  179   HLPEEKLLKDLELYSSNLEKMAQARIVMEDILKADRKKREERAQAKGTAAT  229



>ref|WP_026786592.1| MULTISPECIES: inositol phosphatase [Planktothrix]
Length=232

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 134/222 (60%), Gaps = 9/222 (4%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              ++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + YDP++ALG VT +D
Sbjct  2     NNIRTVSDTKRTFYSLHTRPINSIYRRVVEELMVEMHLLSVNVDFSYDPIYALGVVTAFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF--SSREGE  742
             R M+GY    D+E+I+ A IKA  ++P++YR DA++L+  A+      L+    S  +G 
Sbjct  62    RFMQGYDPLSDQESIYHALIKAEQDDPQRYRGDAERLQALAQNLSIKDLIASLKSPNDGG  121

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN-------ATDPTILEKLCAALNVN  901
              +  L+   +R  +   F+YSR FAIGLF +LE ++       AT   IL +L   LN+ 
Sbjct  122   SDQELQGHFQRIINNSKFKYSRLFAIGLFTILEQADPKSIQDKATREEILGQLAEVLNLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
             +  + +DLD+YR+ L KL QA+ +++E    E+KKR  R +Q
Sbjct  182   QDKLLKDLDLYRSNLEKLAQARIMMEEMTQAERKKRENRANQ  223



>ref|WP_011321244.1| inositol phosphatase [Anabaena variabilis]
 ref|YP_325069.1| Thf1-like protein [Anabaena variabilis ATCC 29413]
 sp|Q3M4B2.1|THF1_ANAVT RecName: Full=Protein Thf1 [Anabaena variabilis ATCC 29413]
 gb|ABA24174.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=233

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 138/223 (62%), Gaps = 15/223 (7%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +DR M+
Sbjct  6     TVSDTKRTFYALHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYALGVVTTFDRFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE--SI  754
             GY  E DKE+IF A  +A+ +EP++YR DA++L+  A++   N LV + S+   ++  + 
Sbjct  66    GYQPERDKESIFSAICQAVEQEPQRYRQDAERLKAVAQSLPVNDLVAWLSQANHLQQDAD  125

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALNVNK  904
             L+   +   S  +F+YSR FAIGLF LLE SN   P +          L+ + A L+++ 
Sbjct  126   LQAQLQAIASNPNFKYSRLFAIGLFTLLEQSN---PDLVKDEKQRTEALKTIAAGLHLSD  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
               + +DL++YR+ L K+ QA  ++ + +  ++KKR +R+ Q S
Sbjct  183   DKLSKDLELYRSNLDKMTQALAVMADMLTADRKKREQRQQQAS  225



>ref|WP_010994822.1| inositol phosphatase [Nostoc sp. PCC 7120]
 ref|NP_484690.1| Thf1-like protein [Nostoc sp. PCC 7120]
 sp|Q8YZ41.1|THF1_NOSS1 RecName: Full=Protein Thf1 [Nostoc sp. PCC 7120]
 dbj|BAB72604.1| all0646 [Nostoc sp. PCC 7120]
Length=233

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 137/223 (61%), Gaps = 15/223 (7%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +DR ME
Sbjct  6     TVSDTKRTFYALHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYALGVVTTFDRFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE--SI  754
             GY  E DKE+IF A  +A+ +EP++YR DA++L+  A++   N LV + S+   ++  + 
Sbjct  66    GYQPERDKESIFSAICQAVEQEPQRYRQDAERLQAVAQSLPVNDLVAWLSQANHLQQDAD  125

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALNVNK  904
             L+   +   +  +F+YSR FAIGLF LLE SN   P +          L+ + A L+++ 
Sbjct  126   LQAQLQAIANNSNFKYSRLFAIGLFTLLEQSN---PDLVKDEKQRTEALKSIAAGLHLSD  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
                 +DL++YR+ L K+ QA  ++ + +  ++KKR +R+ Q S
Sbjct  183   DKFSKDLELYRSNLDKMTQALAVMADMLTADRKKREQRQQQAS  225



>ref|WP_009554533.1| photosystem II biogenesis protein Psp29 [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70161.1| photosystem II biogenesis protein Psp29 [Oscillatoriales cyanobacterium 
JSC-12]
Length=246

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 137/230 (60%), Gaps = 21/230 (9%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     Y Y+P++ALG VT ++
Sbjct  2     NNVRTVSDTKRAFYTIHTRPINSIYRRVVEELMVEMHLLSVNVDYSYNPIYALGVVTSFE  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF-----SSR  733
             R M+GY  E DK  IF A  +AL ++P +YR DAQ+L ++A+ +    +V +     +S 
Sbjct  62    RFMQGYRPENDKAPIFDAICQALQDDPNRYRHDAQRLNDFAKQKSAKDIVTWLEQAATSY  121

Query  734   EGEVESILKDISERA---GSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLC  883
              G+      D+ E+     +   F+YSR FAIGLF L E ++A           +L++ C
Sbjct  122   GGD------DLQEQVKAIANNPKFKYSRLFAIGLFTLFETADAEVVKKEGEREELLKQAC  175

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             AAL ++   V RDL++YR+ L K+ QA+ ++ + +A EKKKR  +++  +
Sbjct  176   AALRLSHDKVQRDLELYRSNLEKVAQAQAVMADMLAAEKKKREHKQNNST  225



>ref|WP_035986160.1| inositol phosphatase [Leptolyngbya sp. KIOST-1]
Length=254

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 141/242 (58%), Gaps = 24/242 (10%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+ K +F   + RPI S+Y  V+ EL+V+ HL+     + YDP++ALG VT +DR 
Sbjct  6     VRTVSDAKRDFYTHHTRPINSIYRRVVDELMVEMHLLSVNVDFAYDPIYALGIVTTFDRF  65

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
             M+GY  E DK++IF A  ++++  P+ YR DA+ L+    A  G SL D    +G+ E +
Sbjct  66    MQGYQPESDKDSIFNALCRSIHSTPDHYRGDAEALKA---AVSGMSLDDL---KGQFEHL  119

Query  755   ------LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP--------TILEKLCAAL  892
                   L+       +KD F+YSR F +GL+ L+E + A D          + + L + L
Sbjct  120   SEGGDGLRGTLAAVATKDKFKYSRPFGVGLYTLVETAAAEDALKEKDTVEALFKDLASKL  179

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYES  1072
             N+    + +D+++YR+ L K  QA+E++K+ +A ++KKR ER  QK+ EA  + +   ES
Sbjct  180   NIATDKLQKDVELYRSNLEKFAQAQEVMKDMLAADRKKREER--QKAAEAAAETIN--ES  235

Query  1073  VA  1078
             VA
Sbjct  236   VA  237



>ref|XP_003062325.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53144.1| predicted protein [Micromonas pusilla CCMP1545]
Length=222

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 118/194 (61%), Gaps = 10/194 (5%)
 Frame = +2

Query  338  RTSSSGSGSRMVVHCMSTDV--PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRY  511
            R +S    +R V    + D+   TV++TK  FL++Y  PIPS++S  LQEL+V QH +RY
Sbjct  22   RRASKARATRGVAVRAAVDLNEVTVADTKQKFLKSYPYPIPSIWSVALQELLVTQHFVRY  81

Query  512  KKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWA  691
             K Y Y  + +LGFV+VYD+L EG+P+EE+K  IF  ++KAL E+P   R DA +L  +A
Sbjct  82   SKKYSYSKLSSLGFVSVYDQLFEGFPSEEEKNTIFECFVKALEEDPATVRKDAAELASFA  141

Query  692  RAQDGNSLVDFSSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL  871
                G   V  S    +++S++ D          F YSR+ AIGLFRLLEL+ AT+P  L
Sbjct  142  EGASGVDGVLASPIFAQMKSLVAD--------GKFAYSRYDAIGLFRLLELAKATEPAAL  193

Query  872  EKLCAALNVNKQSV  913
            EKL  +  +  +S+
Sbjct  194  EKLAESSGLQARSI  207



>ref|WP_037217462.1| inositol phosphatase [Richelia intracellularis]
Length=235

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 143/236 (61%), Gaps = 24/236 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK +F   + RPI ++Y  V++EL+V+ HL+    ++ Y+P++ALG VT +D
Sbjct  2     NNVRTVSDTKRSFYTLHTRPINTIYRRVVEELMVEMHLLSVNVNFNYNPIYALGIVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------  730
             R M  Y  E+DKE+IF A IK++  +P  YR D Q+L+  A     + L+ + S      
Sbjct  62    RFMADYKPEQDKESIFHALIKSVEADPNVYRQDTQRLQSLASDLPVSDLIGWLSQSNPQE  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL--EKLC-------  883
             R+GE+++IL  I     +  +F+YSR FAIGL+ LLE   ++DP ++  EK C       
Sbjct  122   RDGELQNILAVI----ANNQNFKYSRLFAIGLYALLE---SSDPELVKDEKRCNDALSSI  174

Query  884   -AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
                L ++ + + +DL++YR+ L K+ QA  ++ + VA E+KKR +R  Q S+ + T
Sbjct  175   ANGLQISDEKLTKDLELYRSNLEKMSQAITVMADMVAAERKKREQR-GQASDSSAT  229



>ref|WP_015224959.1| photosystem II biogenesis protein Psp29 [Halothece sp. PCC 7418]
 ref|YP_007167295.1| photosystem II biogenesis protein Psp29 [Halothece sp. PCC 7418]
 gb|AFZ43081.1| photosystem II biogenesis protein Psp29 [Halothece sp. PCC 7418]
Length=243

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 130/214 (61%), Gaps = 17/214 (8%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             T+SETK  F   + RP+ S+Y  V++EL+V+ HL+     ++YDP +ALG VTV+D  M+
Sbjct  6     TLSETKRTFYTLHTRPLNSIYRRVIEELLVEMHLLTVNIDFKYDPFYALGVVTVFDTFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------REGE  742
             GY  E+DKE+IF A  KA+  +P+QYR DA+K++  A    G ++  +        + G+
Sbjct  66    GYQPEKDKESIFNAICKAVESDPQQYRQDAEKVKSIADQASGEAVTAWLCEAKPLDQAGD  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPT----ILEKLCAALNVN  901
             +  IL+ I E       F+YSR F IG++ +LE +N     D      +L   C ALN+ 
Sbjct  126   LNDILQGIRENP----RFKYSRLFIIGIYTVLEKANPEIVNDDKKREEVLNNCCQALNLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKK  1003
             K+ VD+DLD+YR+ L K+ QA+ +L++ V  ++K
Sbjct  182   KEKVDKDLDLYRSNLEKMEQARSVLEDVVRADRK  215



>ref|WP_039743748.1| inositol phosphatase [Hassallia byssoidea]
 gb|KIF35947.1| inositol phosphatase [Hassallia byssoidea VB512170]
Length=235

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 143/237 (60%), Gaps = 17/237 (7%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYNRHTRPINTIYRRVVEELMVEMHLLSVNADFSYNPIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVES  751
              M+GY  E+DKE+IF A  +A+ E+P++Y+ DA +L+  A++     L+ + S+    + 
Sbjct  63    FMQGYLPEQDKESIFNALCQAIEEDPQRYKQDAHRLQALAQSLPSKDLIGWLSQTTPTDR  122

Query  752   ILKDISER---AGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAAL  892
                D++E+     +  +F+YSR FAIGLF LLELS   DP +          L+ + + L
Sbjct  123   D-ADLAEQLLGIANNPNFKYSRLFAIGLFSLLELS---DPELVKDEKQRTEALKSVASGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQ  1063
             +++   + +DLD+YR+ L K+ QA  ++ + ++ ++KKR +R  Q + +     + +
Sbjct  179   HLSDDKLTKDLDLYRSNLDKMAQALVVMADMLSADRKKREQRLQQSTTKVTPPSINE  235



>ref|WP_011610915.1| inositol phosphatase [Trichodesmium erythraeum]
 ref|YP_721002.1| Thf1-like protein [Trichodesmium erythraeum IMS101]
 sp|Q116P5.1|THF1_TRIEI RecName: Full=Protein Thf1 [Trichodesmium erythraeum IMS101]
 gb|ABG50529.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=239

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 137/223 (61%), Gaps = 13/223 (6%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI S+Y+ V++EL+V+ HL+     Y Y+P +ALG VT +DR M+
Sbjct  6     TVSDTKKTFYHFHTRPINSIYNRVIEELLVEMHLISVNVDYSYNPFYALGVVTAFDRFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWA---RAQDGNSLVDFSSREGEVES  751
             GY  +EDK +IF A I+   E+P +YR+DA+ LE+ A    A D  S +  S      + 
Sbjct  66    GYSPQEDKTSIFNALIQGQEEDPNKYRSDAKGLEDLAGKISASDILSWICLSKNIDNTQY  125

Query  752   ILKDISERAGSKDS-FRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQ  907
             +  D+  RA S++S FRYSR FAIGLF LLE+ +             L+K+C +LN+ ++
Sbjct  126   LQDDL--RAISENSKFRYSRLFAIGLFTLLEIVDTELIKEQEKRTEALKKICQSLNLVEE  183

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
              + +D+D+Y + L ++ QA+  +++ +A  +KKR +R  +K N
Sbjct  184   KLLKDIDLYLSNLERVAQARSAMEDTLAAMRKKREKRSLEKVN  226



>emb|CDN11204.1| FIG00875504: hypothetical protein [Richelia intracellularis]
Length=256

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 143/236 (61%), Gaps = 24/236 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK +F   + RPI ++Y  V++EL+V+ HL+    ++ Y+P++ALG VT +D
Sbjct  23    NNVRTVSDTKRSFYTLHTRPINTIYRRVVEELMVEMHLLSVNVNFNYNPIYALGIVTTFD  82

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------  730
             R M  Y  E+DKE+IF A IK++  +P  YR D Q+L+  A     + L+ + S      
Sbjct  83    RFMADYKPEQDKESIFHALIKSVEADPNVYRQDTQRLQSLASDLPVSDLIGWLSQSNPQE  142

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL--EKLC-------  883
             R+GE+++IL  I     +  +F+YSR FAIGL+ LLE   ++DP ++  EK C       
Sbjct  143   RDGELQNILAVI----ANNQNFKYSRLFAIGLYALLE---SSDPELVKDEKRCNDALSSI  195

Query  884   -AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
                L ++ + + +DL++YR+ L K+ QA  ++ + VA E+KKR +R  Q S+ + T
Sbjct  196   ANGLQISDEKLTKDLELYRSNLEKMSQAITVMADMVAAERKKREQR-GQASDSSAT  250



>ref|WP_035735784.1| inositol phosphatase [Arthrospira platensis]
 gb|KDR58428.1| inositol phosphatase [Arthrospira platensis str. Paraca]
Length=243

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 128/226 (57%), Gaps = 9/226 (4%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     ++YDP++ALG VT +DR
Sbjct  3     NIRTVSDTKRAFYHIHTRPINSIYRRVVEELMVEMHLLSVNVDFKYDPIYALGVVTAFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFS--SREGEV  745
              M+GY  E DK +I+ A I A   +P QYRADA  LE  A +     L D +  ++E   
Sbjct  63    FMQGYTPETDKLSIWAALIGAQESDPNQYRADATALEAQAASLAVKDLTDKAKIAQESSG  122

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP-------TILEKLCAALNVNK  904
             +  L+       +   F+YSR  AIGL+ LLE S+AT         TIL     AL + K
Sbjct  123   DDPLQSCFHAIANNPKFKYSRLLAIGLYTLLEKSDATAAQDSEGLKTILSDFSEALRLPK  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
               + +DLD+YR  L K+ QA+ ++ E    E+KKR +R +Q    A
Sbjct  183   DKLVKDLDLYRTNLEKVAQARLMVDEMTQAERKKREQRAAQTQTAA  228



>ref|WP_026100273.1| inositol phosphatase [Microchaete sp. PCC 7126]
Length=235

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 146/231 (63%), Gaps = 23/231 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+ ++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYTLHTRPINTIYRRVVEELMVEMHLLSVNLDFSYNSIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF------SS  730
             R M+GY  E+D+E+IF A  +A+ +EP++YR DA++L+  A++   N LV +       +
Sbjct  62    RFMQGYQPEQDQESIFNALCQAVEQEPQRYRQDAERLQALAKSLPANDLVAWLGQTVQLN  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKL  880
             R+G++++ L+ I+    +  +F+YSR  A+G+F LLE   A+DP +          L+ +
Sbjct  122   RDGDLQAQLQAIA----NNPNFKYSRLLAVGIFTLLE---ASDPELVKDEKQRNQSLKTI  174

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
              A L+++ + +++DL++YR+ L K+ QA  ++ + ++ ++KKR +R  Q +
Sbjct  175   AAGLHLSDEKLNKDLELYRSNLDKIAQALVVMADVLSADRKKREQRRQQST  225



>ref|WP_015136573.1| photosystem II biogenesis protein Psp29 [Nostoc sp. PCC 7524]
 ref|YP_007073703.1| photosystem II biogenesis protein Psp29 [Nostoc sp. PCC 7524]
 gb|AFY46106.1| photosystem II biogenesis protein Psp29 [Nostoc sp. PCC 7524]
Length=235

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 141/230 (61%), Gaps = 23/230 (10%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYSLHTRPINTIYRRVVEELMVEMHLLSVNIDFTYNPIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------R  733
              M+GY  E DKE+IF A  +A+ +EP++YR DA++L+  A++   + LV + S      +
Sbjct  63    FMQGYRPERDKESIFHAICQAVEQEPQRYRQDAERLQNLAKSLPISDLVAWLSQTTHFNQ  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLC  883
             + ++++ L+ I     +  +F+YSR FAIGLF LLE S   DP +          L+ + 
Sbjct  123   DPDLQAQLQAI----ANNPNFKYSRLFAIGLFSLLEYS---DPDLVKDEKQRTEALKNIA  175

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
               L++    + +DLD+YR+ L K+ QA  ++ + ++ ++KKR +R+ Q S
Sbjct  176   NGLHLADDKLSKDLDLYRSNLDKMTQALTVIADMISADRKKREQRQQQSS  225



>ref|WP_015208593.1| photosystem II biogenesis protein Psp29 [Cylindrospermum stagnale]
 ref|YP_007148021.1| photosystem II biogenesis protein Psp29 [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ25341.1| photosystem II biogenesis protein Psp29 [Cylindrospermum stagnale 
PCC 7417]
Length=235

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 142/231 (61%), Gaps = 23/231 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYTLHTRPINTIYRRVVEELMVEMHLLSVNIDFSYNPIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF------SS  730
             R M+GY  E D+E+IF A I+A+ +EP++YR DA++L+  A+      L+ +      S 
Sbjct  62    RFMQGYQPERDQESIFNAIIQAVEQEPQRYRQDAERLQAVAQGLPEQDLIAWLSQTTHSD  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKL  880
             R+  +++ L+ I+  +    +F+YSR FAIGLF LLE+S+   P +          L+ +
Sbjct  122   RDANLQAQLQAIANNS----NFKYSRLFAIGLFSLLEVSS---PELVKDDKQRNEALKAI  174

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
                L+++   + +DL++YR+ L K+ QA  ++ + V+ ++KKR +R+ Q S
Sbjct  175   ATGLHLSDDKLSKDLELYRSNLDKMAQALIVMADMVSADRKKREQRKQQAS  225



>ref|WP_009631983.1| photosystem II biogenesis protein Psp29 [Synechocystis sp. PCC 
7509]
Length=241

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 143/224 (64%), Gaps = 15/224 (7%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT Y+R 
Sbjct  4     VRTVSDTKRAFYSTHTRPINTIYRRVVEELMVEMHLLSVNADFSYNPIYALGVVTSYERF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE--  748
             M+GY  E DK++IF+A  +A+N +P QYR DA++L  +A++     L+ + S E  ++  
Sbjct  64    MQGYQPERDKDSIFQALCQAINTDPHQYRQDAERLGSFAKSLSSQDLMQWLSSEKPIDGY  123

Query  749   SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL----------EKLCAALNV  898
             S L++  ++  +   F+YSR FAIG+F LLELS   DP ++          +++ ++L++
Sbjct  124   SDLQEQIKQIATNQKFKYSRLFAIGVFSLLELS---DPELVKDETKRVEAFKQISSSLHL  180

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              +  +++DL++YR  + K+ QA  ++++ +A E+KKR ++  ++
Sbjct  181   PEDKLNKDLELYRANVEKMNQALIVMEDMLAAERKKRQKKADEQ  224



>gb|KFB84293.1| inositol phosphatase [Calothrix sp. 336/3]
Length=235

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 142/231 (61%), Gaps = 17/231 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ LG  T ++
Sbjct  2     NNVRTVSDTKRTFYTLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYGLGVYTAFN  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------  730
             R M+GY  E DKE+IF A ++A  ++P++++ DA KL+E A++  GN L+ + S      
Sbjct  62    RFMQGYEPETDKESIFNALLRATEDDPQRFQQDAHKLQEIAQSLSGNDLIAWLSQKNSLD  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA---TDPT----ILEKLCAA  889
             R+ + ++ L+ I   AG+   F+YSR FAIGLF LLE ++     D       L+ +   
Sbjct  122   RDADFQAQLQAI---AGNP-KFKYSRLFAIGLFTLLEFADGELVKDEKKLNEALKTIATG  177

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
             LN++   +++DL++YR+ L K+ QA  ++ + +A ++KKR +R+ Q +  A
Sbjct  178   LNISDDKLNKDLELYRSNLDKMSQAMVVMADMLAADRKKREQRQQQANATA  228



>ref|WP_026097795.1| inositol phosphatase [Geitlerinema sp. PCC 7105]
Length=238

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 138/226 (61%), Gaps = 17/226 (8%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F R + RP+ S+Y  V++EL+V+ HL+     ++YDP++ALG VT +DR
Sbjct  3     NVRTVSDTKRAFYRLHMRPVNSIYRRVVEELMVEMHLLSVNVDFKYDPIYALGVVTAFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRAD----AQKLEEWARAQDGNSLVDFSSREG  739
             LM GY  E D+ +IF A  +A++++P++YR D       +E  +  +    L    SRE 
Sbjct  63    LMRGYQPERDRTSIFEALCRAIDDDPDRYRQDAAAAIAAVEPLSTEELTAILAQPESREA  122

Query  740   E--VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAAL  892
             +  V   L+ I     S+D+F+YSR FAIGLF ++E  +           ++LEK  AAL
Sbjct  123   DNPVAQQLQAI----ASRDNFKYSRLFAIGLFSVIERVDGELVKDKKKLSSLLEKASAAL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              ++   + +DL++YR+ L K+ QA+ ++ + +A E+KKR ERE+ K
Sbjct  179   QLSDDKLQKDLELYRSNLEKMEQAQSVMADILAAERKKRSERENAK  224



>ref|WP_026104408.1| inositol phosphatase [Anabaena sp. PCC 7108]
Length=235

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 144/235 (61%), Gaps = 24/235 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+ ++ALGFVT +D
Sbjct  2     NNVRTVSDTKRTFYSLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNSIYALGFVTSFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR-----  733
             R M+GY  E D+EAIF A  K++ ++P+ YR DA +L+  A++     L+ + S+     
Sbjct  62    RFMQGYQPERDQEAIFSALCKSVEQDPQLYRQDAARLQAVAQSLPAKDLIAWLSQTTHLD  121

Query  734   -EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKL  880
              +G++++ L+ I++      +F+YSR FAIGLF LLEL+   DP +          L+ +
Sbjct  122   VDGDLQAQLQGIADNP----NFKYSRLFAIGLFSLLELA---DPELVKDDKQRNEALKAI  174

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
                L++++  + +DLD+YR+ L K+ QA  ++ + +  ++KKR +R+ QKS   V
Sbjct  175   ANGLHLSEDKLSKDLDLYRSNLDKMAQALIVMADILTADRKKRDQRQ-QKSTTPV  228



>ref|WP_014274922.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005068070.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI89532.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=243

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 127/226 (56%), Gaps = 9/226 (4%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     ++YDP++ALG VT +DR
Sbjct  3     NIRTVSDTKRAFYHIHTRPINSIYRRVVEELMVEMHLLSVNVDFKYDPIYALGVVTAFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFS--SREGEV  745
              M+GY  E DK +I+ A I A   +P QYRADA  LE    +     L D +  ++E   
Sbjct  63    FMQGYIPEADKLSIWAALIGAQESDPNQYRADATALEAQVASLAVKDLTDKAKMAQESSG  122

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP-------TILEKLCAALNVNK  904
             +  L+       +   F+YSR  AIGL+ LLE S+AT         TIL     AL + K
Sbjct  123   DDPLQSCFHAIANNPKFKYSRLLAIGLYTLLEKSDATAAQDSEGLKTILSDFSEALRLPK  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
               + +DLD+YR  L K+ QA+ ++ E    E+KKR +R +Q    A
Sbjct  183   DKLVKDLDLYRTNLEKVAQARLMVDEMTQAERKKREQRAAQTQTAA  228



>ref|WP_008314478.1| photosystem II biogenesis protein Psp29 [Leptolyngbya sp. PCC 
6406]
Length=251

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 134/227 (59%), Gaps = 10/227 (4%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T+VPTVS+TK  F   + RPI SVY  V++EL+V+ HL+R  + + YDPV+ALG VT +D
Sbjct  2     TNVPTVSDTKRAFYSYHNRPIASVYRRVIEELMVEMHLLRVNEDFVYDPVYALGIVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKL--EEWARAQDGNSLVDFSSREGE  742
             R M GY  E D+ +IF A  +A     +QYR DA+ +  E   R+ D    +   SR  E
Sbjct  62    RFMAGYRPEADEASIFAALCQANAGTADQYRRDAEVMVAEVSGRSLDALKAI-LISRSAE  120

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCAALNVNKQS----  910
                +LK + +    +D F+YSR FAIGL+ L+E  +A      EKL   L    +S    
Sbjct  121   GADLLKGVLQGIADRDRFKYSRAFAIGLYTLIETVDAEILKDKEKLMELLKAVAESLPLS  180

Query  911   ---VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
                + +D+++YR+ L+K+ QAK ++ + +A ++KKR ER   K++ A
Sbjct  181   FDKLQKDVELYRSNLTKMEQAKIVMADILAADRKKREERAKAKADAA  227



>ref|WP_015113336.1| Protein thf1 [Nostoc sp. PCC 7107]
 ref|YP_007050271.1| Protein thf1 [Nostoc sp. PCC 7107]
 gb|AFY43121.1| Protein thf1 [Nostoc sp. PCC 7107]
Length=235

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 140/226 (62%), Gaps = 15/226 (7%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYSLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV--  745
              M+GY  E DKE+IF+A  +A+ +E ++YR DA++L+  A++   N L+ + S+   +  
Sbjct  63    FMQGYQPERDKESIFQAICQAVEQEVQRYRQDAERLQALAKSLAANDLIAWLSQTNHLNQ  122

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALN  895
             +  L+   +   +   F+Y+R FAIGLF LLE S   DP +          ++ + A L+
Sbjct  123   DPDLQSQLQAIANNSQFKYNRLFAIGLFSLLEQS---DPDLVKDEKQRTDAIKTIAAGLH  179

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             +++  + +DL++YR+ L K+ QA  ++ + ++ ++KKR +R+ Q +
Sbjct  180   LSEDKLSKDLELYRSNLEKMSQALVVMADMISADRKKREQRQQQST  225



>ref|WP_041035889.1| inositol phosphatase [Tolypothrix campylonemoides]
 gb|KIJ75712.1| inositol phosphatase [Tolypothrix campylonemoides VB511288]
Length=235

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 141/234 (60%), Gaps = 23/234 (10%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + YDP++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYNLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYDPIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF------SSR  733
              M+GY  E DKE+IF A ++A+ ++ ++Y+ DA++L+  A +   + L+ +      SSR
Sbjct  63    FMQGYQPERDKESIFHALLQAVEQDEQRYKQDAERLQALATSLSASELIAWLSQETPSSR  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLC  883
             + + +S L+ I     +   F+Y+R FAIGLF LLE S   DP +          L+ + 
Sbjct  123   DADFQSSLQAI----ANNPKFKYNRLFAIGLFTLLEQS---DPELVKDEKKRTEALKTIG  175

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
               L+++   +++DL++YR+ + K+ QA  ++ + ++ ++K+R +R  Q S  A 
Sbjct  176   NGLHISDDKLNKDLEIYRSNIDKMSQALTVMSDMLSADRKRREQRTQQSSTAAT  229



>ref|WP_015170179.1| photosystem II biogenesis protein Psp29 [Geitlerinema sp. PCC 
7407]
 ref|YP_007107663.1| photosystem II biogenesis protein Psp29 [Geitlerinema sp. PCC 
7407]
 gb|AFY64611.1| photosystem II biogenesis protein Psp29 [Geitlerinema sp. PCC 
7407]
Length=239

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 139/227 (61%), Gaps = 12/227 (5%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     ++YDP +ALG VT Y+R
Sbjct  3     NVRTVSDTKRAFYSMHTRPINSIYRRVVEELMVEMHLLSVNVDFRYDPFYALGVVTSYER  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSRE---GE  742
              M+GY  E+DK +IF +  +A   +P  YR DA++L E+ +      L+ + S E   G+
Sbjct  63    FMQGYRPEQDKTSIFESLCRANEGDPGHYRHDAERLAEFTKNLSAEELISWLSLETPRGD  122

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN-------ATDPTILEKLCAALNVN  901
              + + + + +   +   F+YSR FAIGLF L+E +N       A      EK+ AAL++ 
Sbjct  123   DQGLGESL-QAIANHSQFKYSRLFAIGLFTLVEQANPDLVKDEAQRTATFEKVVAALHLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE-SQKSNE  1039
                + +DL++YR+ L KL QA+ ++++ +  ++KKR ERE +QK++E
Sbjct  182   ADKLQKDLELYRSNLEKLTQARIVMEDILKADRKKREEREQAQKASE  228



>ref|WP_015227926.1| photosystem II biogenesis protein Psp29 [Dactylococcopsis salina]
 ref|YP_007170270.1| photosystem II biogenesis protein Psp29 [Dactylococcopsis salina 
PCC 8305]
 gb|AFZ48913.1| photosystem II biogenesis protein Psp29 [Dactylococcopsis salina 
PCC 8305]
Length=240

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 128/209 (61%), Gaps = 17/209 (8%)
 Frame = +2

Query  401  TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
            T+SETK  F   + RP+ S+Y  V++EL+V+ HL+     ++YDP++ALG  TV+D  M+
Sbjct  6    TLSETKRTFYTQHTRPLNSIYRRVIEELLVEMHLLSVNTDFKYDPIYALGVTTVFDTFMQ  65

Query  581  GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN----SLVDFSSREG--E  742
            GY  E++KE+IF A  +A+  +P++YR DA+KL+  A    G      L +    +G  E
Sbjct  66   GYQPEKEKESIFNAICQAVENDPQKYRQDAEKLKSIAANHSGEEVTACLSELKPLDGAEE  125

Query  743  VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPT----ILEKLCAALNVN  901
            +  +L++I   +     F+YSR F IGL+ +LE +N    TD      +L+K C  L + 
Sbjct  126  LTKVLQEIKNNS----RFKYSRLFIIGLYTILETANPDLVTDDKKREEVLQKCCQGLGLP  181

Query  902  KQSVDRDLDVYRNLLSKLVQAKELLKEYV  988
            K+ VD+DLD+YR+ L K+ QA+ +L++ +
Sbjct  182  KEKVDKDLDLYRSNLEKMEQARSVLEDAI  210



>ref|WP_026730990.1| inositol phosphatase [Fischerella sp. PCC 9605]
Length=235

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 141/225 (63%), Gaps = 10/225 (4%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI ++Y  V++ELIV+ HL+     + Y+P++ALG VT +DR M+
Sbjct  6     TVSDTKRAFHTLHTRPINTIYRRVVEELIVEMHLLSVNVDFSYNPIYALGVVTSFDRFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV--ESI  754
             GY  E+DKE+IF A ++A   +P+ YR DAQ+L++ A++     L+   S++ ++  ++ 
Sbjct  66    GYQPEQDKESIFNALLRATEADPQTYRQDAQRLQDIAKSLSTQDLIAALSQQTQLNRDAD  125

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQSV  913
             L+   +   +  +F+YSR FAIGLF LLE S+             L+ + A L+++   +
Sbjct  126   LQAHLQAIANNPNFKYSRLFAIGLFSLLEQSDQELVKDEKKRTEALKSIAAGLHLSDDKL  185

Query  914   DRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
             ++DL++Y + + K+ QA  ++ + ++ ++KKR +R +QKSN  VT
Sbjct  186   NKDLELYLSNVDKMSQALVVMADLLSADRKKREQR-NQKSNTTVT  229



>gb|KIJ82299.1| inositol phosphatase [Scytonema tolypothrichoides VB-61278]
Length=235

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 138/231 (60%), Gaps = 24/231 (10%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     Y YDP++ALG VT +DR M+
Sbjct  6     TVSDTKRTFYNLHTRPINTIYRRVVEELMVEMHLLSVNVDYSYDPIYALGVVTAFDRFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------REGE  742
             GY  E DKE+IF A ++A+ E+P++Y+ DAQ+L+  A +   + L  + S      R+ +
Sbjct  66    GYQPERDKESIFDALLQAVEEDPQRYKHDAQRLQALATSISASELTAWLSQQTPLDRDAD  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAAL  892
              +  L+ I     +   F+YSR FAIGLF LLE S   +P +          L+ +   L
Sbjct  126   FQGSLQAI----ANNQKFKYSRLFAIGLFSLLEYS---EPDLVKDEKKRNEALKTIAKGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
             N++   +++DL++Y + + K+ QA  ++ + +  ++KKR +R +Q+SN  V
Sbjct  179   NISDDKLNKDLEIYYSNIDKMSQALTVMSDMLLADRKKREQR-AQQSNTKV  228



>ref|WP_012411456.1| inositol phosphatase [Nostoc punctiforme]
 ref|YP_001868446.1| Thf1-like protein [Nostoc punctiforme PCC 73102]
 sp|B2J353.1|THF1_NOSP7 RecName: Full=Protein Thf1 [Nostoc punctiforme PCC 73102]
 gb|ACC83503.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=235

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 141/231 (61%), Gaps = 23/231 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYNLHTRPINTIYRRVVEELMVEMHLLSVNIDFSYNPIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVD------FSS  730
             R M+GY  E D+E+IF A  +A+ ++P+ YR DA++L+  A+      L+       +  
Sbjct  62    RFMQGYEPERDQESIFNALCRAIEQDPQHYRQDAERLQAIAKGLPVKDLIGWLGQTTYLD  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKL  880
             R+ ++++ L+ I+    +  +F+Y+R FAIG+F LLE S   DP +          L+ +
Sbjct  122   RDADLQAQLQAIA----NNPNFKYNRLFAIGVFSLLEQS---DPELVKDEKQLTEALKAI  174

Query  881   CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
              A L+V+   +++DL++YR+ L K+ QA  ++ + ++ ++KKR +R+ Q +
Sbjct  175   AAGLHVSDDKLNKDLELYRSNLDKMAQALVVMADMLSADRKKREQRKQQST  225



>ref|WP_015215758.1| Protein thf1 [Anabaena cylindrica]
 ref|YP_007158047.1| Protein thf1 [Anabaena cylindrica PCC 7122]
 gb|AFZ59137.1| Protein thf1 [Anabaena cylindrica PCC 7122]
Length=235

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 141/230 (61%), Gaps = 23/230 (10%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     Y Y+P++ALG VT +DR
Sbjct  3     NVRTVSDTKRTFYNLHTRPINTIYRRVVEELMVEMHLLSVNVDYSYNPIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------R  733
              M+GY  E D+E+IF A  +A+ ++ ++YR DA +L+  A++     L+ + S      +
Sbjct  63    FMQGYLPERDQESIFNALCQAVEQDQQRYRQDATRLQAIAQSLPVQDLIAWVSQTTHLDK  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLC  883
             + ++++ L+ I+       +F+YSR FAIGLF LLEL+   DP +          L+ + 
Sbjct  123   DADLQAQLQAIAHNP----NFKYSRLFAIGLFSLLELA---DPELVKDEKQRNEALKAIA  175

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
               L++++  + +DLD+YR+ L K+ QA  ++ + ++ ++KKR +R+ Q S
Sbjct  176   QGLHLSEDKLSKDLDLYRSNLDKMAQALIVMADILSADRKKRDQRQQQAS  225



>ref|WP_008049328.1| inositol phosphatase [Arthrospira sp. PCC 8005]
 emb|CCE15417.1| Putative thylakoid formation protein, Thf1-like [Arthrospira 
sp. PCC 8005]
 emb|CDM93980.1| Putative thylakoid formation protein, Thf1-like [Arthrospira 
sp. PCC 8005]
Length=243

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 127/221 (57%), Gaps = 9/221 (4%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     ++YDP++ALG VT +DR
Sbjct  3     NIRTVSDTKRAFYNIHTRPINSIYRRVVEELMVEMHLLSVNVDFKYDPIYALGVVTAFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFS--SREGEV  745
              M+GY  E DK +I+ A I A   +P QYRADA  LE  A       L + +  ++E   
Sbjct  63    FMQGYIPEADKLSIWAALIMAQESDPNQYRADATALEAQAATLSVKDLTERAKIAQESSG  122

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP-------TILEKLCAALNVNK  904
             +  L+       +   F+YSR FAIGL+ LLE S+ T          I+     AL + K
Sbjct  123   DDPLQSCFHAIANNPKFKYSRLFAIGLYTLLEKSDVTAAQDSEGLKNIIIDFSEALRLPK  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
               +++DLD+YR  L K+ QA+ +++E    E+KKR +R +Q
Sbjct  183   DKLEKDLDLYRTNLEKVAQARLMVEEMTQAERKKREQRAAQ  223



>ref|XP_005702855.1| thylakoid protein [Galdieria sulphuraria]
 gb|EME26335.1| thylakoid protein [Galdieria sulphuraria]
Length=316

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 130/217 (60%), Gaps = 3/217 (1%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TV+ET ++FL+ ++ PIPS+Y T++QEL+V  HL R    +QYDPVFALG+  V    
Sbjct  84    VRTVAETISDFLKHFRHPIPSIYRTIVQELLVTTHLARVAVGFQYDPVFALGYQMVTQVF  143

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
              + YP  E+KE +F +  KAL  + E+ + DA  LEEW R++    ++  +  EG  +  
Sbjct  144   FKSYPKVEEKEKLFDSMCKALLLDYERMKKDASVLEEWTRSRTEREIL-LAIEEGG-DDP  201

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSN-ATDPTILEKLCAALNVNKQSVDRDLDV  931
             L ++       D F YSR F +GL R++EL     +    +K  +AL+++   +++DLD 
Sbjct  202   LANLLHSIAQNDGFVYSRLFGLGLVRMMELCGEEANSERCQKWASALHISSLKLEQDLDT  261

Query  932   YRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
             Y+  L +L QA++L  E  AR+KKK  E+ ++K+  A
Sbjct  262   YQQSLERLKQAEQLFAELEARQKKKLAEKLAEKAKRA  298



>ref|WP_015161455.1| photosystem II biogenesis protein Psp29 [Chamaesiphon minutus]
 ref|YP_007098878.1| photosystem II biogenesis protein Psp29 [Chamaesiphon minutus 
PCC 6605]
 gb|AFY95351.1| photosystem II biogenesis protein Psp29 [Chamaesiphon minutus 
PCC 6605]
Length=234

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 132/231 (57%), Gaps = 23/231 (10%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK NF   + RPI S+Y  V++EL+V+ HL+     + YDP++ALG V+ +DR M 
Sbjct  6     TVSDTKRNFYSQHTRPINSIYRRVVEELMVEMHLLSTNVDFAYDPIYALGVVSSFDRFMT  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSRE------GE  742
              Y  E DK++IF A  +++    +QYR DA  +EE+AR+  G+ ++D+ +         +
Sbjct  66    SYRPEADKQSIFVALCESMGGNAQQYRTDATAVEEFARSMQGSDIIDWIAHPTADGMGAQ  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILE----------KLCAAL  892
             + + L+ I+    S   F+YSR F IGLF +LE +    P +L+          ++  AL
Sbjct  126   LATTLQSIA----SNPKFKYSRLFGIGLFTILEQAA---PDLLKDEKKREAAVLQIAEAL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
             ++ K    +DLD YR+ L KLVQ + ++ +    E+KKR +R   K   +V
Sbjct  179   HLPKDKAQKDLDTYRSNLDKLVQMEAVMADLAEAERKKREKRAQAKVEASV  229



>gb|ERN42112.1| photosystem II biogenesis protein Psp29 [Rubidibacter lacunae 
KORDI 51-2]
Length=259

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 135/233 (58%), Gaps = 15/233 (6%)
 Frame = +2

Query  371   VVHCMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALG  550
             +  C    + TVS+TK +F   + RPI SVY  V++EL+V+ HL+     ++YDP++ALG
Sbjct  4     IGDCFVNTIRTVSDTKRSFYTLHARPINSVYRRVVEELMVEMHLLSVNTDFRYDPLYALG  63

Query  551   FVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF--  724
               T +DR M GY   EDK++IF A  +A+  +P+Q R+DA +      + DG+++  +  
Sbjct  64    ITTAFDRFMLGYTPAEDKDSIFGAICRAVECDPQQVRSDADRARALTESTDGDAVSAWLR  123

Query  725   SSREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LE  874
             + R  + + IL D+     +   F+YSR FAIGL+  L    A D  +          LE
Sbjct  124   TERTFDGDDILNDLPGAIANNPRFKYSRLFAIGLYAFL---TAADTALIEDEDRRRAALE  180

Query  875   KLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + C AL++ ++  ++DLD+YR+ L K+ QA+  +++ +   +K+R  R+ +++
Sbjct  181   QACEALSLPREKFEKDLDLYRSNLEKMEQARLAIEDALLSSRKQRERRQQERA  233



>emb|CBN56193.1| Protein thf1 [ [[Oscillatoria] sp. PCC 6506]
Length=267

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 138/222 (62%), Gaps = 23/222 (10%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI S+Y  V++EL+V+ HL+     ++Y+P++ALG VT ++R M+
Sbjct  36    TVSDTKRSFYTIHTRPINSIYRRVVEELMVEMHLLSVNVDFRYNPIYALGVVTAFERFMQ  95

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS---------R  733
             GY  E+DK +IF    +AL ++P++Y+ DA++LE  A      S++D  S          
Sbjct  96    GYLPEQDKVSIFNGLCQALGDDPQRYQQDARRLEGLASRV---SILDLLSWLEGSTSFED  152

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDP----TILEKLCAAL  892
              G++++ +  I+    +   F+YSR FAIGLF LLE+ +     DP      + K+CAAL
Sbjct  153   TGDLQASITAIA----TNSKFKYSRLFAIGLFALLEIVDPDLVKDPEARVQAIAKVCAAL  208

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
             ++ ++ V +DLD+YR+ L K+ QA+ +L + +  ++KKR +R
Sbjct  209   HLPEEKVTKDLDLYRSNLEKIAQARIVLADVLQADRKKREKR  250



>ref|WP_015130001.1| Protein thf1 [Calothrix sp. PCC 7507]
 ref|YP_007067028.1| Protein thf1 [Calothrix sp. PCC 7507]
 gb|AFY34194.1| Protein thf1 [Calothrix sp. PCC 7507]
Length=235

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 137/225 (61%), Gaps = 15/225 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+ ++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYNLHTRPINTIYRRVVEELMVEMHLLSVNIDFSYNSIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV-  745
             R M+GY  E D+E+IF A   A+ +EP++YR DA++L   A++   N L+ + S+   + 
Sbjct  62    RFMQGYLPERDQESIFNALCHAVEQEPQRYRQDAERLRVLAKSLPANDLIAWLSQTTHLD  121

Query  746   -ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAAL  892
              ++ L+   +   +  +F+YSR  AIGLF LLELS   DP +          L+ +   L
Sbjct  122   QDADLQAQLQAIANNPNFKYSRLLAIGLFTLLELS---DPELVKDEKQRNEALKAIATGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
              ++ + +++DL++YR+ L K+ QA  ++ + ++ ++KKR +R+ Q
Sbjct  179   QLSDEKLNKDLELYRSNLDKIAQALIVMADVLSADRKKREQRKQQ  223



>ref|WP_039727320.1| inositol phosphatase [Lyngbya confervoides]
 gb|KIF15299.1| inositol phosphatase [Aphanocapsa montana BDHKU210001]
 gb|KIF40213.1| inositol phosphatase [Lyngbya confervoides BDU141951]
Length=262

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 127/230 (55%), Gaps = 22/230 (10%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             ++V TVS+TK  F   + RP+ SVY  V++EL+V+ HL+     + YDP++ALG VT YD
Sbjct  2     SNVRTVSDTKRAFYENFDRPVTSVYRRVIEELMVEMHLLSVSGDFVYDPIYALGIVTTYD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE  748
               MEGY  E D E IF A  K++   PEQYR DAQ         +G SL D  S  G + 
Sbjct  62    TFMEGYRPEGDVEPIFVALCKSVESTPEQYRNDAQ---HALSTVEGMSLDDLKSLLGNLS  118

Query  749   --------SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLCA------  886
                     +ILK ++ER    D F+YSR F IG + L    +A      E L A      
Sbjct  119   EANAEGLATILKGVAER----DRFKYSRAFGIGFYTLTAKIDADLIQDKESLMAFMKEAA  174

Query  887   -ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
              AL ++   + +D+++YR+ L K+VQAK L+ E +  E+KKR ER   K+
Sbjct  175   EALGISFDKLQKDIELYRSNLDKMVQAKALMAEVLEAERKKREERAQAKA  224



>ref|WP_040655274.1| inositol phosphatase [Rubidibacter lacunae]
Length=251

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 133/225 (59%), Gaps = 15/225 (7%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS+TK +F   + RPI SVY  V++EL+V+ HL+     ++YDP++ALG  T +DR 
Sbjct  4     IRTVSDTKRSFYTLHARPINSVYRRVVEELMVEMHLLSVNTDFRYDPLYALGITTAFDRF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF--SSREGEVE  748
             M GY   EDK++IF A  +A+  +P+Q R+DA +      + DG+++  +  + R  + +
Sbjct  64    MLGYTPAEDKDSIFGAICRAVECDPQQVRSDADRARALTESTDGDAVSAWLRTERTFDGD  123

Query  749   SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALNV  898
              IL D+     +   F+YSR FAIGL+  L    A D  +          LE+ C AL++
Sbjct  124   DILNDLPGAIANNPRFKYSRLFAIGLYAFL---TAADTALIEDEDRRRAALEQACEALSL  180

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
              ++  ++DLD+YR+ L K+ QA+  +++ +   +K+R  R+ +++
Sbjct  181   PREKFEKDLDLYRSNLEKMEQARLAIEDALLSSRKQRERRQQERA  225



>ref|WP_015190899.1| Protein thf1 [Gloeocapsa sp. PCC 7428]
 ref|YP_007130192.1| Protein thf1 [Gloeocapsa sp. PCC 7428]
 gb|AFZ33032.1| Protein thf1 [Gloeocapsa sp. PCC 7428]
Length=251

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 134/226 (59%), Gaps = 15/226 (7%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F  ++ RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT ++R
Sbjct  3     NVRTVSDTKRAFYTSHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNPIYALGVVTAFER  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVES  751
              M+GY  E DKE+IF A  +A+  +P++YR DA++L  +A+      L+ +   E   E 
Sbjct  63    FMQGYQPERDKESIFNALCQAVESDPQRYRQDAERLGLFAKNTSTPELIAWLRGETHKEE  122

Query  752   I--LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALN  895
             +  L+   +       F+YSR FAIG+F LLELS   DP +          L+ + A LN
Sbjct  123   VGDLQQQIQAIAHNPHFKYSRLFAIGVFGLLELS---DPALVKDEKQRVDALKSIAATLN  179

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             +++  +++DL++YR  + K+ QA   + + ++ ++KKR ++   K 
Sbjct  180   ISEDKLNKDLELYRANVDKMEQALATIADILSADRKKRQQQTPDKG  225



>ref|WP_015201976.1| Protein thf1 [Crinalium epipsammum]
 ref|YP_007141364.1| Protein thf1 [Crinalium epipsammum PCC 9333]
 gb|AFZ11854.1| Protein thf1 [Crinalium epipsammum PCC 9333]
Length=243

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 134/223 (60%), Gaps = 15/223 (7%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI S+Y  V++EL+V+ HL+     + Y P++ALG VT Y++ M+
Sbjct  6     TVSDTKRDFYNNHTRPINSIYRRVVEELMVEMHLLSVNVDFAYHPIYALGVVTSYEKFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI--  754
             GY  E D+++IF A + A+ E+ ++Y+ DA++L+  A    G  L+D+      V+    
Sbjct  66    GYRPERDRDSIFDALVGAVGEDSQRYKQDAEQLKALAGRLSGKELIDWIVSPTAVDGAGS  125

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALNVNK  904
             L D      +   F+YSR FAIGL+ LLE+S   DP++          L ++  +L++  
Sbjct  126   LPDQMRAIANNPQFKYSRLFAIGLYTLLEVS---DPSLVKDEKERLDALNQVGQSLHLPT  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + + +DLD+YR+ L K+ Q +  +K+ +  ++KKR +R+ +KS
Sbjct  183   EKLHKDLDLYRSNLEKMAQVQIAMKDALEADRKKREKRDQEKS  225



>ref|WP_015157124.1| photosystem II biogenesis protein Psp29 [Chroococcidiopsis thermalis]
 ref|YP_007094455.1| photosystem II biogenesis protein Psp29 [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY90586.1| photosystem II biogenesis protein Psp29 [Chroococcidiopsis thermalis 
PCC 7203]
Length=250

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 132/225 (59%), Gaps = 9/225 (4%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK NF   + RPI ++Y  V++EL+V+ HL+     ++YDP++ALG VT ++R M+
Sbjct  6     TVSDTKRNFYNQHTRPINTIYRRVVEELMVEMHLLSVNADFRYDPIYALGVVTAFERFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI--  754
             GY  E DKE IF A  +++ + P++YR DA +L +  +      L D+   +  ++    
Sbjct  66    GYQPERDKEPIFEALCQSIEDNPQRYRQDADRLRQLLQNVSAQQLFDWIDGKASLQGAED  125

Query  755   LKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQSV  913
             L+   +       F+YSR FAIG+F LLEL++A            L+++  AL+V +  +
Sbjct  126   LQAQMQAIAQNSKFKYSRLFAIGVFTLLELADAELVKDEKQRVEALKQVATALHVPEDKL  185

Query  914   DRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
             ++DL++YR+ L K+ QA   + + ++ +++KR +R  +K     T
Sbjct  186   NKDLELYRSNLDKIEQALITMADILSADRRKRQQRLQEKEAGVAT  230



>ref|WP_013191519.1| inositol phosphatase [Trichormus azollae]
 ref|YP_003721626.1| photosystem II biogenesis protein Psp29 ['Nostoc azollae' 0708]
 gb|ADI64503.1| photosystem II biogenesis protein Psp29 ['Nostoc azollae' 0708]
Length=235

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 143/228 (63%), Gaps = 18/228 (8%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     ++Y+ ++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYNLHTRPINTIYRRVVEELMVEMHLLSVNVDFRYNSIYALGVVTAFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------  730
             R M+GY  E+D+ +IF A I+A+ ++P++YR DA +L+  A++     L+ + S      
Sbjct  62    RFMQGYQPEQDQASIFNAIIQAVEQDPQRYRQDAARLQVVAQSLLTKDLISWLSQTTYLD  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAA  889
             ++ ++++ L+ I+  A     F+YSR FAIGLF LLE+ ++            L+ +   
Sbjct  122   QDRDLQAQLQAIANNA----EFKYSRLFAIGLFSLLEMVDSELVKDEKQRNQALKAIAQG  177

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             L+++++ + +DL++YR+ L KL QA  ++ + +A ++KKR +R+ QKS
Sbjct  178   LHLSEEKLTKDLELYRSNLDKLAQALIVMADMLAADRKKRDQRQ-QKS  224



>ref|WP_015201078.1| Protein thf1 [Calothrix parietina]
 ref|YP_007140444.1| Protein thf1 [Calothrix sp. PCC 6303]
 gb|AFZ04472.1| Protein thf1 [Calothrix sp. PCC 6303]
Length=235

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 135/234 (58%), Gaps = 21/234 (9%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG  T ++R
Sbjct  3     NVRTVSDTKKTFYSIHTRPINTIYRRVVEELMVEMHLLSVNTDFTYNPIYALGVATAFER  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR------  733
              M+GY  E+DKE +F A  +++  + ++ + +A  L++ A +     L+   SR      
Sbjct  63    FMQGYDPEKDKEQLFHALCQSVEIDTQKIKQEAHSLKDVAASMSVGDLISCLSRAKRFDN  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI---------LEKLCA  886
              GE+++ L  I     S   F+YSR FAIGLF LLE   A+  T+         L  +  
Sbjct  123   AGELQNQLDAI----ASNPKFKYSRLFAIGLFSLLEA--ASPETVKDEKQRNDALVSIAK  176

Query  887   ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
              LN+++  + +DLD+YR+ L K+ QA  ++ + +A ++KKR +R  QKS+ A T
Sbjct  177   GLNISEDKLSKDLDLYRSNLDKMAQAMVVMADMLAADRKKREQRAQQKSSVAAT  230



>ref|WP_015166017.1| Protein thf1 [Pseudanabaena sp. PCC 7367]
 ref|YP_007103489.1| Protein thf1 [Pseudanabaena sp. PCC 7367]
 gb|AFY71061.1| Protein thf1 [Pseudanabaena sp. PCC 7367]
Length=260

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 134/229 (59%), Gaps = 16/229 (7%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+ K +F +A+ RPI SVY  V+ EL+V+ HL+   +++ YDPVFALG +T YDR 
Sbjct  4     VRTVSDAKRDFFQAFPRPINSVYRRVVDELLVEMHLLTVNQTFAYDPVFALGAITAYDRF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREG--EVE  748
             M GY  E +++ I  A   A++   EQ R DA  L E A     +     +S E    +E
Sbjct  64    MLGYEPESERDRILPAICGAVHLNAEQMRHDASSLAELAMRSPIDVKQFLTSLETTENLE  123

Query  749   SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPT----------ILEKLCAALNV  898
              +   I   A ++  F+YSR FAIGLF LLE +   DP           +++++  ALN+
Sbjct  124   PLTGTIRAIAANQ-KFKYSRLFAIGLFTLLETA---DPNTMSDNDKRQELIKQVGDALNL  179

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
               + + +DLD+YR+ L K+ QA++++K+ V  E+KK+ +RE+   ++A 
Sbjct  180   GSEKLIKDLDLYRSNLEKVEQARQMMKDLVEAERKKKEQRENPPKSDAA  228



>ref|WP_008178223.1| inositol phosphatase [Moorea producens]
 gb|EGJ35458.1| photosystem II biogenesis protein Psp29 [Moorea producens 3L]
Length=257

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 127/211 (60%), Gaps = 17/211 (8%)
 Frame = +2

Query  395  VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
            V TVS+TK +F   + RPI S+Y  V++EL+V+ HL+     + YDP++ LG VT +DR 
Sbjct  4    VRTVSDTKRDFYTYHTRPINSIYRRVVEELMVEMHLLSVNVDFNYDPIYGLGVVTCFDRF  63

Query  575  MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR------E  736
            M+ Y  E DKE+IF A  +A+  E +QY+ DAQ+L+    +  G  L+ + S        
Sbjct  64   MQSYQPENDKESIFNALCQAVGGEAQQYQEDAQRLKTSVDSMSGQDLISWLSSPTSENGS  123

Query  737  GEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPTILEK----LCAALN  895
            G++ + +  I++ +     F+YSR FAIGLF LLE ++   A D   LE+    + + LN
Sbjct  124  GDLATTIAAIAQNS----QFKYSRLFAIGLFSLLEQTDSELAQDQKQLEEVINNISSGLN  179

Query  896  VNKQSVDRDLDVYRNLLSKLVQAKELLKEYV  988
            +  + + +DL++YR+ L K+ QA+ ++++ +
Sbjct  180  LPSEKLQKDLELYRSNLEKMAQARVVIEDAI  210



>ref|WP_012630488.1| inositol phosphatase [Cyanothece sp. PCC 7425]
 ref|YP_002485820.1| Thf1-like protein [Cyanothece sp. PCC 7425]
 sp|B8HQ62.1|THF1_CYAP4 RecName: Full=Protein Thf1 [Cyanothece sp. PCC 7425]
 gb|ACL47459.1| photosystem II biogenesis protein Psp29 [Cyanothece sp. PCC 7425]
Length=236

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 128/213 (60%), Gaps = 8/213 (4%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI S+Y  V++EL+V+ HL+R  +++ YDPVFALG VT ++R M+
Sbjct  6     TVSDTKRAFYHNHARPINSIYRRVVEELLVEIHLLRVNQTFVYDPVFALGVVTTFERFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             GY    D+ +IF A   A   +P+Q + DAQ+L    R Q   SL+D+ S    +    +
Sbjct  66    GYHPPADQTSIFNAICLAQELDPQQVQQDAQELLGRVRGQSLESLLDWISTAASLGGDEQ  125

Query  761   DISERA-GSKDSFRYSRFFAIGLFRLLELS-------NATDPTILEKLCAALNVNKQSVD  916
                 RA  S  +F+YSR FA+GLF LLE +        A    +L+++   +++  + + 
Sbjct  126   QNRLRAIASNPTFKYSRLFAVGLFTLLEQAEPELGKDEARLLQVLQQVGEVMHLPVEKMQ  185

Query  917   RDLDVYRNLLSKLVQAKELLKEYVAREKKKRGE  1015
             +DL+ YR+ L K+ QA++ L++ VA E+K+R +
Sbjct  186   KDLEQYRSNLEKMTQARKTLEDIVAAERKRRQQ  218



>ref|WP_039715196.1| inositol phosphatase [Scytonema millei]
 gb|KIF17639.1| inositol phosphatase [Scytonema millei VB511283]
Length=250

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 138/223 (62%), Gaps = 17/223 (8%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK NF   + RPI ++Y   ++EL+V+ HL+     ++YDP++ALG VT ++R M+
Sbjct  6     TVSDTKRNFYNQHTRPINTIYRRXVEELMVEMHLLSVNADFRYDPIYALGVVTAFERFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF----SSREG--E  742
             GY  E DKE IF A  +++ + P++YR DA +L +  +      L D+    +S +G  +
Sbjct  66    GYQPERDKEPIFEALCQSIEDNPQRYRQDADRLRQLLQNVSAQQLFDWIEGKASLQGAED  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVN  901
             +++ ++ I++ +     F+YSR FAIG+F LLEL++A            L+++  AL+V 
Sbjct  126   LQAQMQAIAQNS----KFKYSRLFAIGVFTLLELADAELVKDEKQRVEALKQVATALHVP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             +  +++DL++YR+ L K+ QA   + + ++ +++KR +R  +K
Sbjct  182   EDKLNKDLELYRSNLDKIEQALITMADILSADRRKRQQRLQEK  224



>ref|WP_015185178.1| photosystem II biogenesis protein Psp29 [Microcoleus sp. PCC 
7113]
 ref|YP_007124451.1| photosystem II biogenesis protein Psp29 [Microcoleus sp. PCC 
7113]
 gb|AFZ21045.1| photosystem II biogenesis protein Psp29 [Microcoleus sp. PCC 
7113]
Length=241

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 136/237 (57%), Gaps = 18/237 (8%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RP+ S++  V++EL+V+ HL+     + Y+P++ALG VT ++R ME
Sbjct  6     TVSDTKRDFYNHHTRPVNSIFRRVVEELMVEMHLLSVNVDFHYEPIYALGVVTSFNRFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSRE------GE  742
             GY  E DK +IF A   ++   PEQY+ DAQ LE  A    G  LV + S        G+
Sbjct  66    GYRPERDKASIFDALCHSVGNNPEQYKQDAQWLESMAERVTGEELVSWLSAPRPQDTLGD  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT-------DPTILEKLCAALNVN  901
             + + +  I+E       F+YSR FAIGL+ LLE +++            L+K+   L++ 
Sbjct  126   LYAAVAAIAENP----KFKYSRLFAIGLYTLLEKADSELVQDEKRRTEALKKISDGLHLP  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKCLGQYES  1072
             ++ + +DL++YR+ L K+ Q + ++++ +  ++KKR E+  Q  N+A T      ES
Sbjct  182   EEKLQKDLELYRSNLQKMEQVRIVIEDAIQADRKKR-EKRIQDQNKAATSSSDSQES  237



>ref|WP_026093255.1| inositol phosphatase [Calothrix sp. PCC 7103]
Length=225

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 127/226 (56%), Gaps = 15/226 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RP+ ++Y  V++EL+V+ HL+     + Y+ ++ LG VT +D
Sbjct  2     NNVRTVSDTKRTFYSLHTRPVNTIYRRVVEELMVEMHLLSVNVDFSYNSIYTLGVVTAFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE  748
             R M+GY  E DK +IF A  +A+    +QY  DA +L   A++   N LV + S+   +E
Sbjct  62    RFMQGYQPESDKASIFHALCQAVEANQDQYHQDAARLLNVAKSLPVNDLVGWLSQTNRLE  121

Query  749   --SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAAL  892
               + L+   +       F+Y+R FAIG+F LLE   A+DP +          L  +   L
Sbjct  122   NDTQLQAELDAIAHNPKFKYNRLFAIGIFTLLE---ASDPEVVKDEKRRTEALNSIAKGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             N++   +++DL++YR+ L K+ QA  ++ + +  ++KKR ER   K
Sbjct  179   NISDDKLNKDLELYRSNLDKMTQAMAVMADMLQADRKKREERAKAK  224



>ref|WP_011242326.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_170723.1| Thf1-like protein [Synechococcus elongatus PCC 6301]
 ref|YP_400572.1| Thf1-like protein [Synechococcus elongatus PCC 7942]
 dbj|BAD78203.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB57585.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
Length=280

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T VPTVS++K  F  AY RPI  +Y  V++EL+V+ HL+    S+ YDP+FALG VT +D
Sbjct  28    TSVPTVSDSKRAFYAAYPRPINPLYRRVVEELLVEIHLLSVNTSFVYDPLFALGVVTAFD  87

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSRE---G  739
               M  Y   E    +F A  +A+ + PEQYR DA  + E  R    +++  + +     G
Sbjct  88    SFMSSYRPIEAVGPLFTALTQAVRQNPEQYRHDANAIAEQVRGVGSDTIRQWLTEAEALG  147

Query  740   EVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPTILEKLCAAL----NV  898
                 +++   +    +  F+YSR FAIGLF LLE +      DP  L+    A+    ++
Sbjct  148   NAPELVRSSFQAIAGRSEFKYSRLFAIGLFSLLETAAPDLVQDPEALKTTVTAIAERFHL  207

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE  1021
                 + +DLD+YR+ L K+ QA+  ++E +  +++KR +RE
Sbjct  208   PSDKLQKDLDLYRSNLEKMEQARITMEEAIQADRRKREQRE  248



>ref|WP_008228834.1| hypothetical protein [Richelia intracellularis]
 emb|CCH65460.1| hypothetical protein RINTHM_9990 [Richelia intracellularis HM01]
Length=235

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 137/232 (59%), Gaps = 20/232 (9%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+P++ALG VT ++R 
Sbjct  4     VRTVSDTKRAFYSLHTRPIKTIYRRVVEELMVEIHLLSVNIDFHYNPIYALGIVTTFERF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------RE  736
             M GY  + +KE+IF A I+++  +P  YR D Q+L   A     + L+ + +      ++
Sbjct  64    MMGYKPQHEKESIFHALIQSVGADPNIYRQDTQRLRSLAIDLPVSDLIGWLNQTSPLDKD  123

Query  737   GEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEKLC--------AAL  892
              +++  L+  +   G    F+YSR F IGL+ LLELS++ +    EKLC          L
Sbjct  124   EKIQETLQAFANNQG----FKYSRLFGIGLYTLLELSDS-ELVKHEKLCNDALKTISNGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
              +++  + RDL++YR+ L K+ QA  ++ + VA E++KR E+ +Q  +E++T
Sbjct  179   KISEDKLIRDLELYRSNLEKMSQAITVMADMVAAERRKR-EQPTQVLDESIT  229



>ref|WP_040009938.1| inositol phosphatase [Cylindrospermopsis raciborskii]
Length=234

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 132/225 (59%), Gaps = 17/225 (8%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+ ++ALG VT +DR M+
Sbjct  6     TVSDTKRTFYSRHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNSIYALGVVTTFDRFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------REGE  742
             GY   ED  +IF A I A+ ++P+ YR DA KL+  A +     L+ + S      ++  
Sbjct  66    GYQPSEDLVSIFNAIICAVEQDPQVYRQDAAKLKAIANSFSVKDLIAWCSQTTPLDQDAN  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPT----ILEKLCAALNVN  901
             +++ L+ I++      +F+YSR  AIGLF LLELS+     D T     +  +   L ++
Sbjct  126   LQAELQAIAQNP----NFKYSRLLAIGLFSLLELSDPEFVKDETQRNQTIAVIAQGLKLS  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
             +  +++DLD+YR+ L K+ QA  ++ + +A ++KKR +R+    N
Sbjct  182   EDKLNKDLDLYRSNLDKMEQALIVMADMLAADRKKRDQRQQNSGN  226



>ref|WP_039755956.1| inositol phosphatase [Synechococcus sp. UTEX 2973]
 sp|Q5N664.2|THF1_SYNP6 RecName: Full=Protein Thf1 [Synechococcus elongatus PCC 6301]
 sp|Q31MY4.2|THF1_SYNE7 RecName: Full=Protein Thf1 [Synechococcus elongatus PCC 7942]
 gb|AJD57928.1| inositol phosphatase [Synechococcus sp. UTEX 2973]
Length=254

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T VPTVS++K  F  AY RPI  +Y  V++EL+V+ HL+    S+ YDP+FALG VT +D
Sbjct  2     TSVPTVSDSKRAFYAAYPRPINPLYRRVVEELLVEIHLLSVNTSFVYDPLFALGVVTAFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSRE---G  739
               M  Y   E    +F A  +A+ + PEQYR DA  + E  R    +++  + +     G
Sbjct  62    SFMSSYRPIEAVGPLFTALTQAVRQNPEQYRHDANAIAEQVRGVGSDTIRQWLTEAEALG  121

Query  740   EVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPTILEKLCAAL----NV  898
                 +++   +    +  F+YSR FAIGLF LLE +      DP  L+    A+    ++
Sbjct  122   NAPELVRSSFQAIAGRSEFKYSRLFAIGLFSLLETAAPDLVQDPEALKTTVTAIAERFHL  181

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE  1021
                 + +DLD+YR+ L K+ QA+  ++E +  +++KR +RE
Sbjct  182   PSDKLQKDLDLYRSNLEKMEQARITMEEAIQADRRKREQRE  222



>ref|WP_040554058.1| inositol phosphatase [Raphidiopsis brookii]
Length=235

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 132/228 (58%), Gaps = 23/228 (10%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+ ++ALG VT +DR M+
Sbjct  6     TVSDTKRTFYSRHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNSIYALGVVTTFDRFMQ  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS------REGE  742
             GY   ED  +IF A I A+ ++P+ YR DA KL+  A +     L+ + S      ++  
Sbjct  66    GYQPSEDLVSIFNAIICAVEQDPQVYRQDAAKLKAIANSFSVKDLIAWCSQTTPLDQDAN  125

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEK----------LCAAL  892
             +++ L+ I++      +F+YSR  AIGLF LLELS   DP  ++           +   L
Sbjct  126   LQAELQAIAQNP----NFKYSRLLAIGLFSLLELS---DPEFVKDETERNQAIAVIAQGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
              +++  +++DLD+YR+ L K+ QA  ++ + +A ++KKR +R+    N
Sbjct  179   KLSEDKLNKDLDLYRSNLDKMEQALIVMADMLAADRKKRDQRQQNSGN  226



>ref|WP_015079355.1| photosystem II biogenesis protein Psp29 [Anabaena sp. 90]
 ref|YP_006996006.1| photosystem II biogenesis protein Psp29 [Anabaena sp. 90]
 gb|AFW94193.1| photosystem II biogenesis protein Psp29 [Anabaena sp. 90]
Length=223

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 129/219 (59%), Gaps = 15/219 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + YD ++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYTLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYDAIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV-  745
             R M+GY  E+DKE+IFRA  +A+ ++P+ YR DA +L+  A +     L+   S+   + 
Sbjct  62    RFMDGYQPEQDKESIFRAICQAVEQDPQSYRQDASRLQALAASLPAKDLIASLSQASPLN  121

Query  746   -ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEK----------LCAAL  892
              ++ L+   E   +  +F+YSR F +GLF LL  S   DP +++K          +   L
Sbjct  122   QDADLQKQLEAVAANSNFKYSRLFGVGLFALLVQS---DPELVKKDEQRAEALKAISNGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
             ++++  + +DL++Y + L K+ QA  ++ + +  ++KKR
Sbjct  179   HISEDKLIKDLELYSSNLEKMAQALIVMADILTADRKKR  217



>ref|WP_017299677.1| hypothetical protein [Nodosilinea nodulosa]
Length=250

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 124/219 (57%), Gaps = 20/219 (9%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+ K +F   + RPI S+Y  V+ EL+V+ HL+     + YDP++ALG VT +DR 
Sbjct  6     VRTVSDAKRDFYSHHTRPINSIYRRVVDELMVEMHLLSVNVDFAYDPIYALGIVTTFDRF  65

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
             MEGY  E DK +IF A  +++N  PE YR DA  ++    +  G SL D    +G+ E++
Sbjct  66    MEGYQPENDKASIFNALCRSINSTPEHYRGDADAVK---NSVSGMSLDDL---KGQFENL  119

Query  755   ------LKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP--------TILEKLCAAL  892
                   L+       +K+ F+YSR F IGL+ L+E     +          + + L   L
Sbjct  120   EHGGEGLRGTLASVANKEKFKYSRPFGIGLYTLVEAVAPAEALKEKDAVEALFKDLADKL  179

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
             +++   + +D+++YR+ L K  QA+E++K+ +  ++KKR
Sbjct  180   SISPDKLQKDVELYRSNLEKFAQAQEVMKDMLIADRKKR  218



>ref|WP_016871386.1| MULTISPECIES: inositol phosphatase [Fischerella]
Length=202

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 125/204 (61%), Gaps = 24/204 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P+FALG VT +DR M+GY  E DKE+IF A ++A+  +P+ YR 
Sbjct  1     MVEMHLLAVNVDFSYNPIFALGVVTSFDRFMQGYQPESDKESIFNALLRAIEADPQIYRQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+E A++     L+   S      R+ +++S L+ I     S   F+YSR FAIGL
Sbjct  61    DAQRLQELAKSLPPQDLIAALSLQTQLNRDTDLQSHLQAI----ASNPKFKYSRLFAIGL  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLELS   DP +          L+ + A L+++   +++DL++YR+ L K+ QA  ++
Sbjct  117   FSLLELS---DPELVKDEKQRTEALKSIAAGLHISDDKLNKDLELYRSNLDKMAQALVVM  173

Query  977   KEYVAREKKKRGERESQKSNEAVT  1048
              + ++ ++KKR +R SQ+S+  VT
Sbjct  174   ADMLSADRKKREQR-SQQSSTTVT  196



>ref|WP_035996920.1| inositol phosphatase [Leptolyngbya sp. JSC-1]
Length=237

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 126/214 (59%), Gaps = 20/214 (9%)
 Frame = +2

Query  383  MSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTV  562
            MS++V TVSETK  F   + RPI S+Y  V+ EL+V+ HL+     Y+YDP++ LG VT 
Sbjct  1    MSSNVRTVSETKRAFYTLHTRPINSIYRRVVDELMVEMHLLSVNADYRYDPIYGLGVVTA  60

Query  563  YDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGE  742
            +DR M+GY  E DK +IF A  +AL ++ ++YR DA++L+  A A   ++   F S+  +
Sbjct  61   FDRFMQGYRPEADKASIFNALCQALQDDAQKYRRDAEQLQAEAAATSADT---FLSQVKQ  117

Query  743  VE----SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKL  880
            +       L D         SF+YSR FAIGL+ LLEL    DP++          L+ L
Sbjct  118  LNMAPAGALYDALRGVAGNSSFKYSRLFAIGLYTLLEL---MDPSLVKDESKRNQALQTL  174

Query  881  CAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKE  982
              ALN++   + +DL++YR+ L K+ QA+ +L +
Sbjct  175  SEALNLSGDKMQKDLELYRSNLDKIAQAQIVLDD  208



>ref|WP_015957104.1| inositol monophosphatase [Cyanothece sp. PCC 7424]
 ref|YP_002380393.1| Thf1-like protein [Cyanothece sp. PCC 7424]
 sp|B7KI38.1|THF1_CYAP7 RecName: Full=Protein Thf1 [Cyanothece sp. PCC 7424]
 gb|ACK73525.1| photosystem II biogenesis protein Psp29 [Cyanothece sp. PCC 7424]
Length=226

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 134/226 (59%), Gaps = 24/226 (11%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS++K +F   + RPI SVY  V++EL+V+ HL+     +QYDPV+ALG VT + R 
Sbjct  4     VRTVSDSKRDFYTKHTRPINSVYRRVVEELMVEMHLLSVNSDFQYDPVYALGVVTSFQRF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-------DFSSR  733
             M+GY  + DKE+IF A  +++  +P+QYR DA+++ E A+      L+       D SS 
Sbjct  64    MQGYRPDADKESIFNALCQSVGGDPQQYRQDAERMIESAKQLSAQQLLFNLESASDSSSG  123

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL----------EKLC  883
             E ++   L  I+    +   ++Y+R FAIG++ +L     TDP +L          +++ 
Sbjct  124   ENQILQTLIGIA----NAPKYKYTRLFAIGIYTILA---ETDPEMLKNTEKREEVVKQIA  176

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERE  1021
               L++ ++ + +DLD+YR+ L K+ Q   +++E +  ++KKR +++
Sbjct  177   KVLHLPEEKMQKDLDLYRSNLEKMDQLLTVIEEALQADRKKREQQK  222



>ref|WP_028090006.1| inositol phosphatase [Dolichospermum circinale]
Length=235

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 134/225 (60%), Gaps = 17/225 (8%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + YD ++ALG VT +DR
Sbjct  3     NVRTVSDTKKTFYTLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYDGIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR---AQD---GNSLVDFSSR  733
              M GY  E+D+E+IF+A   A+ ++P +YR DA +L+  A     QD   G S     ++
Sbjct  63    FMAGYQPEQDQESIFQAICHAVEQDPHRYRQDASRLQALAAKVPVQDLIAGLSQATLLNQ  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN---ATDPT----ILEKLCAAL  892
             + +++  L+ I+    +  +F+YSR FAIGLF LL  S      D T     L+ +   L
Sbjct  123   DADLQRQLEAIA----ANSNFKYSRLFAIGLFALLAESAPALVKDDTQRTEALKTIAKGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQ  1027
             ++++  + +DL++Y + L K+ QA  ++ + ++ ++KKR +R+ Q
Sbjct  179   HLSEDKLIKDLELYSSNLEKMAQALIVMADILSADRKKRDQRQQQ  223



>ref|WP_026222227.1| inositol phosphatase [filamentous cyanobacterium ESFC-1]
Length=246

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 128/224 (57%), Gaps = 15/224 (7%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK  F   + RPI SVY  V++EL+V+ HL+     ++Y+P++ALG VT +DR 
Sbjct  4     VRTVSDTKRKFYSHHTRPINSVYRRVVEELMVETHLLTVNVHFRYNPIYALGVVTTFDRF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR--EGEVE  748
             M+GY  E D E IF+A   +++ +P QYR DA  L   A+      L  + S        
Sbjct  64    MQGYRPERDIEPIFQALCTSVDSDPAQYRQDANALSAIAQNLSVQQLTAWDSELMSNPDA  123

Query  749   SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP----------TILEKLCAALNV  898
             ++L +  +     ++F+YSR FAIGL+ L+E     DP           +L++L  +L +
Sbjct  124   TLLYEALKEVALSENFKYSRLFAIGLYTLVE---KVDPEMIKDEKKRQPVLQELSESLKL  180

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             +   V +DLD+YR+ L K++Q +  +++ +  ++KKR ER  +K
Sbjct  181   SFDKVQKDLDLYRSNLEKMLQVQAAIEDALNADRKKRLERSLEK  224



>ref|WP_017714683.1| hypothetical protein [Prochlorothrix hollandica]
Length=261

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 126/220 (57%), Gaps = 23/220 (10%)
 Frame = +2

Query  398   PTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLM  577
             PT+S+TK  F  A+ RPI S+Y  VL+EL+V+ HL+    ++ YD ++ALG VT +DR M
Sbjct  5     PTLSDTKRAFYAAHTRPINSIYRRVLEELMVEMHLLGVNATFTYDSIYALGVVTTFDRFM  64

Query  578   EGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF---------SS  730
             EGY  E D+++IF A   A+  + + YR DA+ +     A DG S  D           S
Sbjct  65    EGYRPEADRDSIFSALCGAVGSDVQTYRRDAEAI---LAATDGLSPDDLLALFNLSADGS  121

Query  731   REGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLE-----LSNATDPT--ILEKLCAA  889
               G + S+L  +S+RA     F+YSR FAIGLF L+E         TD    + +K+  +
Sbjct  122   IGGSLRSVLAQLSDRA----KFKYSRLFAIGLFSLVEKVAPDWIKDTDKQGELWDKVSVS  177

Query  890   LNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
             L +  + + +D+++Y++ L KL QA+ LL E    E+KKR
Sbjct  178   LVLPLEKLKKDVELYQSNLEKLGQAQLLLAEMTEAERKKR  217



>ref|WP_036534113.1| inositol phosphatase [Neosynechococcus sphagnicola]
 gb|KGF72322.1| inositol phosphatase [Neosynechococcus sphagnicola sy1]
Length=236

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 17/229 (7%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     ++YDP++ALG VT ++R 
Sbjct  4     VRTVSDTKRAFYNIHTRPINAIYRRVVEELMVEMHLLSVNVDFRYDPIYALGVVTAFERF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSS--REGEVE  748
              +GY    D+ +IF A   +L   P+QY+ DA +L +      G SL D ++  ++ ++ 
Sbjct  64    TQGYLPAPDQPSIFNALCGSLGANPQQYQQDANRLRQ---VMTGLSLEDLTAWFQQTQIP  120

Query  749   SILKDIS---ERAGSKDSFRYSRFFAIGLFRLLELSNATDPT-------ILEKLCAALNV  898
               ++D+    +       F+YSR F IGLF +LEL +            IL +L  AL++
Sbjct  121   PGVEDVQGQLQAIAENSRFKYSRLFGIGLFSILELVSPDTAKEELQATLILNQLSEALHL  180

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
                 + +DL++YR+ L K+ QA+ +L++ +  E+KKR +RE  K  EAV
Sbjct  181   PGDKLQKDLELYRSNLEKISQARIVLEDVLQAERKKREQREQAK--EAV  227



>ref|WP_031291698.1| inositol phosphatase [Leptolyngbya sp. Heron Island J]
Length=244

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 130/223 (58%), Gaps = 8/223 (4%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + Y+P++ALG VT +D
Sbjct  2     TNLRTVSDTKRAFYNHHSRPINSLYRRVVEELMVEMHLLSVNVDFVYNPLYALGVVTSFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL-VDFSSREGEV  745
             R M GY  E+DKE+IF A  KA+  + +QYR DA+ L+        N L    S+ +   
Sbjct  62    RFMVGYEPEQDKESIFAAICKAVEGDSQQYRQDAEALKADLANLSLNDLNTQLSNAKAAS  121

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN--ATDPT-----ILEKLCAALNVNK  904
              S L++      ++ S +Y+R  A+GL+ L E  +  A D       +L+     L +  
Sbjct  122   GSNLQNKLHMVANQASAKYTRLMAVGLYTLFETVDVAALDDKDKREEMLKTAAEMLALPA  181

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + VD+DL++YR+ L K+ QA+E++K+ +  E+KKR +R   K+
Sbjct  182   EKVDKDLELYRSNLDKMAQAQEVMKDILEAERKKREQRAQAKA  224



>gb|ESA38273.1| photosystem ii bioproteinsis protein psp29 [Leptolyngbya sp. 
Heron Island J]
Length=253

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 130/223 (58%), Gaps = 8/223 (4%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + Y+P++ALG VT +D
Sbjct  11    TNLRTVSDTKRAFYNHHSRPINSLYRRVVEELMVEMHLLSVNVDFVYNPLYALGVVTSFD  70

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSL-VDFSSREGEV  745
             R M GY  E+DKE+IF A  KA+  + +QYR DA+ L+        N L    S+ +   
Sbjct  71    RFMVGYEPEQDKESIFAAICKAVEGDSQQYRQDAEALKADLANLSLNDLNTQLSNAKAAS  130

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN--ATDPT-----ILEKLCAALNVNK  904
              S L++      ++ S +Y+R  A+GL+ L E  +  A D       +L+     L +  
Sbjct  131   GSNLQNKLHMVANQASAKYTRLMAVGLYTLFETVDVAALDDKDKREEMLKTAAEMLALPA  190

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + VD+DL++YR+ L K+ QA+E++K+ +  E+KKR +R   K+
Sbjct  191   EKVDKDLELYRSNLDKMAQAQEVMKDILEAERKKREQRAQAKA  233



>ref|WP_008200624.1| inositol monophosphatase [Microcystis sp. T1-4]
 emb|CCI32051.1| Protein thf1 [Microcystis sp. T1-4]
Length=233

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 130/221 (59%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    ++    ++
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNQALGGDN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSLINAPKFKYSRLFAIGLYTILAEAQPDMIKEKEKREP-ILQKFSEILHLSGE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_013325147.1| inositol monophosphatase [Cyanothece sp. PCC 7822]
 ref|YP_003890384.1| photosystem II biogenesis protein Psp29 [Cyanothece sp. PCC 7822]
 gb|ADN17109.1| photosystem II biogenesis protein Psp29 [Cyanothece sp. PCC 7822]
Length=233

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 138/230 (60%), Gaps = 21/230 (9%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  4     VRTVSDSKRDFYSKHTRPINSVYRRVVEELLVETHLLSVNSDFHYDPIYALGVVTSFEQF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR---AQDGNSLVDFSS---RE  736
             M+GY  E DKE+IF A  +++  +P+QYR DAQ +   A+   AQD  S +  SS    +
Sbjct  64    MQGYRPETDKESIFNALCQSVGGDPQQYRGDAQSILSTAKQLSAQDLLSKLQSSSIAYPQ  123

Query  737   GEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTIL----------EKLCA  886
             G+   I++ +   A +   F+Y+R FAIG++ +L     TDP +L          +++  
Sbjct  124   GD-NKIIETLVAIANAP-KFKYTRLFAIGIYTIL---AETDPELLKDQQKRHEVIKQIAE  178

Query  887   ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
              L++ ++ + +DLD+YR+ L K+ Q   +++E +  ++KKR +R+  K+ 
Sbjct  179   ILHLPEEKMQKDLDLYRSNLEKMEQLLTVIEEALQADRKKREQRDQAKTQ  228



>ref|WP_015136201.1| Protein thf1 [Leptolyngbya sp. PCC 7376]
 ref|YP_007073323.1| Protein thf1 [Leptolyngbya sp. PCC 7376]
 gb|AFY40489.1| Protein thf1 [Leptolyngbya sp. PCC 7376]
Length=246

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 128/229 (56%), Gaps = 19/229 (8%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+ K +F   + RPI S++  V++EL+V+ HL+     ++YDP +ALG VT Y+R 
Sbjct  4     VRTVSDAKRDFYGQHTRPINSIFRRVVEELLVEMHLVSVNVDFRYDPFYALGIVTSYERF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF----SSREGE  742
             M+GY  E DK +IF+A  +A+    E Y+ DA  L E A+   G  LVD     ++ EG 
Sbjct  64    MQGYRPESDKISIFQAMCQAVGGSAEFYKNDATALVELAKRCSGQQLVDCFRQDNAPEGA  123

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEK----------LCAAL  892
              E   K   E   +   F+YSR FAIGL+  L      +P +LE           L  A+
Sbjct  124   GELWAK--VEAIAANKKFKYSRLFAIGLYTFL---GEAEPALLEDADKRDEMLATLTEAM  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNE  1039
             N+  + + +DLD+YR+ L K+ Q   ++++ +  E+K+R + E++ + E
Sbjct  179   NLPGEKMKKDLDLYRSNLEKMTQVLAVIEDALVAERKRREKAEAETTTE  227



>ref|WP_027400742.1| inositol phosphatase [Aphanizomenon flos-aquae]
 gb|KHG40722.1| inositol phosphatase [Aphanizomenon flos-aquae 2012/KM/D3]
Length=223

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 127/221 (57%), Gaps = 9/221 (4%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
              +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + Y+ ++ALG VT +D
Sbjct  2     NNVRTVSDTKRTFYTLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYNAIYALGVVTTFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV-  745
               M+GY  E+DKE+IFRA  +A+ ++P++YR DA +L+  A +     L+   SR   + 
Sbjct  62    SFMDGYQPEQDKESIFRAICQAVEQDPQRYRQDASRLQALAVSLPVKDLIAGLSRANSLD  121

Query  746   -ESILKDISERAGSKDSFRYSRFFAIGLFRLLELS-------NATDPTILEKLCAALNVN  901
              +  L+   E   +  +F+YSR F +GLF LL  S       +      L+ +   LN++
Sbjct  122   QDGDLQQQLEAVATNSNFKYSRLFGVGLFALLVQSDHELMKDDKQKSEALKAIANGLNIS  181

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERES  1024
             +  + +DL++Y + L K+ QA  ++ + +  ++KKR   +S
Sbjct  182   EDKLIKDLELYSSNLEKMAQALIVMADILTADRKKRDALKS  222



>gb|KIE11052.1| inositol phosphatase [Tolypothrix bouteillei VB521301]
Length=194

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 124/200 (62%), Gaps = 23/200 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P++ALG VT ++R M+GY  E DKE+IF A ++AL E+P++YR 
Sbjct  1     MVEMHLLSVNVDFGYEPIYALGVVTAFERFMQGYQPERDKESIFNALVRALEEDPQRYRQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+  A++   + L+ + S      R+ E++S L++IS+       F+Y+R FAIG+
Sbjct  61    DAQRLQSVAKSLPPSELIAWLSQQTHLDRDAELQSSLQEISKNPA----FKYNRLFAIGV  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLELS   DP +          L+K+   L+++   + +DL++YR+ L K+ QA  ++
Sbjct  117   FSLLELS---DPELVKDQKQLTEALKKIADGLHLSDDKLSKDLEIYRSNLDKVTQALAVM  173

Query  977   KEYVAREKKKRGERESQKSN  1036
              + ++ ++K+R +R  Q S 
Sbjct  174   SDLLSADRKRREQRSQQSST  193



>ref|WP_024969803.1| inositol phosphatase [Microcystis aeruginosa]
Length=233

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRHDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_002732851.1| photosystem II biogenesis protein Psp29 [Microcystis aeruginosa]
 gb|ELP56129.1| photosystem II biogenesis protein Psp29 [Microcystis aeruginosa 
TAIHU98]
Length=228

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  4     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  64    MEGYRPGEDKPNIFNALCQAVNGNPEVYRHDAENMIAIAKETNIDSLLSQLQNPALGGNN  123

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  124   QLSDSLVSVINAAKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  182

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  183   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  223



>ref|WP_002791587.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI29709.1| Protein thf1 [Microcystis aeruginosa PCC 9808]
Length=233

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRHDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAAKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_004160330.1| Protein thf1 [Microcystis aeruginosa]
 emb|CCI15466.1| Protein thf1 [Microcystis aeruginosa PCC 9806]
Length=233

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 129/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDMIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR+ L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRSNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_002767805.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI02237.1| Protein thf1 [Microcystis aeruginosa PCC 9443]
Length=233

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_004161335.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI19831.1| Protein thf1 [Microcystis aeruginosa PCC 9807]
Length=233

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDMIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_015192780.1| Protein thf1 [Stanieria cyanosphaera]
 ref|YP_007132075.1| Protein thf1 [Stanieria cyanosphaera PCC 7437]
 gb|AFZ35109.1| Protein thf1 [Stanieria cyanosphaera PCC 7437]
Length=238

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 137/232 (59%), Gaps = 18/232 (8%)
 Frame = +2

Query  362   SRMVVHCMSTD-VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPV  538
             + + V   +TD + TVS+ K +F + + RPI SVY  V++EL+V+ HL+     ++ DP+
Sbjct  2     NEIAVGNKTTDNIRTVSDAKRDFYQHHTRPINSVYRRVVEELLVEMHLLSVNVDFKSDPI  61

Query  539   FALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV  718
             + LG VT ++RLM+GY  E+DKE+IF A  +A+ E+PE+ RA A  L   A+ +    LV
Sbjct  62    YYLGVVTSFERLMQGYRPEQDKESIFNALCRAVGEDPERNRAQAGSLLNLAKNKSPQELV  121

Query  719   DFSSREGEVES---ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP---------  862
              + S    +E+   I++ I   A S   F+YSR FAIGL+ LLE S   DP         
Sbjct  122   AWLSEPTPLENYHDIIEPIKAIA-SNPHFKYSRLFAIGLYTLLEES---DPEILKDVSKR  177

Query  863   -TILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGE  1015
               ILE +   L++  + +++DL++YR+ L K+ Q   ++++ +   +K++ +
Sbjct  178   NEILESIATQLHLPGEKMNKDLELYRSNLEKMEQLLSVIEDVLQAGRKQKNQ  229



>ref|WP_036021484.1| inositol phosphatase [Leptolyngbya sp. PCC 7375]
Length=249

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 136/228 (60%), Gaps = 16/228 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + Y+P++ALG +T +D
Sbjct  2     TNLRTVSDTKRAFYNYHSRPINSLYRRVIEELMVEMHLLSVNVDFVYNPLYALGVITSFD  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN-SLVDFSSREGEV  745
             R M GY  E+DKE+I  A  +A+  +P+QYR DA+ L    ++   N SL D +++    
Sbjct  62    RFMVGYEPEQDKESILSAICQAVEGDPQQYRQDAEAL----KSDLANLSLSDLNTQLASA  117

Query  746   ESI----LKDISERAGSKDSFRYSRFFAIGLFRLLE---LSNATDPT----ILEKLCAAL  892
             ++     L++      ++ S +Y+R  A+GL+ L E   +S+  D      +L+     L
Sbjct  118   KTTDGNGLQNKLHVVATQASAKYTRLMAVGLYTLFETVDISSLEDKDSREEMLKTAAEML  177

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
              +  + VD+DL++YR+ L K+ QA+E++K+ +  E+KKR +R   K++
Sbjct  178   ALPAEKVDKDLELYRSNLDKMAQAQEVMKDILEAERKKREQRAQAKAD  225



>emb|CAO88510.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS44832.1| photosystem II biogenesis protein Psp29 [Microcystis aeruginosa 
DIANCHI905]
Length=228

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  4     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  64    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENIIAIAKETNIDSLLSQLQNPALGGNN  123

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  124   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  182

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  183   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  223



>ref|WP_016515471.1| Thf1-like protein [Microcystis aeruginosa]
 gb|EPF19369.1| Thf1-like protein [Microcystis aeruginosa SPC777]
 gb|EPF22112.1| Thf1-like protein [Microcystis aeruginosa SPC777]
Length=233

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENIIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|XP_003078204.1| inositol phosphatase-like protein (ISS) [Ostreococcus tauri]
Length=657

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +2

Query  458  VYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKAL  637
            V++TV+QEL+VQ H  +Y K  +Y+ + +LGFV+VYD+L EG+P+EE+K  IF A++ AL
Sbjct  79   VWATVVQELLVQGHFQKYNKKSEYNELASLGFVSVYDQLFEGFPSEEEKGKIFNAFLGAL  138

Query  638  NEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE-SILKDISERAGSKDSFRYSRFF  814
            +E+  + RADA+ L  +A + +G         EG  E +I   ++ ++ ++ +  Y+++ 
Sbjct  139  DEDAVRTRADAETLGAFATSANGV--------EGLKENAIFAKLAAKS-AEGTLLYTKYI  189

Query  815  AIGLFRLLELSNATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKE  982
            AIG+FR+LEL+ ATDP  LE L  A  ++   V  DL +Y+ LLSKL  AKEL +E
Sbjct  190  AIGMFRMLELAKATDPAALEALVTAGGLSMSKVSGDLSMYKGLLSKLAAAKELQEE  245



>ref|WP_004163909.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCI36111.1| Protein thf1 [Microcystis aeruginosa PCC 9701]
Length=233

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 126/220 (57%), Gaps = 8/220 (4%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQS  910
              L D      +   F+YSR FAIGL+ +L  +             IL+K    L+++ + 
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDMIKEKEKREQILQKFSEILHLSSEK  188

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  189   LQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_002754204.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCH92698.1| Protein thf1 [Microcystis aeruginosa PCC 9432]
 emb|CCI07461.1| Protein thf1 [Microcystis aeruginosa PCC 7941]
Length=233

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENIIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT--------DPTILEKLCAALNVNKQ  907
              L D      +   F+YSR FAIGL+ +L  +           +P IL+K    L+++ +
Sbjct  129   QLSDSLVSVINAAKFKYSRLFAIGLYTILAEAQPDIIKEKEKREP-ILQKFSEILHLSSE  187

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  188   KLQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>dbj|GAL93135.1| hypothetical protein N44_01822 [Microcystis aeruginosa NIES-44]
Length=233

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 126/220 (57%), Gaps = 8/220 (4%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    ++     +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNQALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQS  910
              L D      +   F+YSR FAIGL+ +L  +             IL+K    L ++ + 
Sbjct  129   QLSDSLVSLINAPKFKYSRLFAIGLYTILAEAQPDMIKEKEKREQILQKFSEILRLSSEK  188

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  189   LQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>gb|EKV03409.1| photosystem II biogenesis protein Psp29 [Leptolyngbya sp. PCC 
7375]
Length=258

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 136/228 (60%), Gaps = 16/228 (7%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T++ TVS+TK  F   + RPI S+Y  V++EL+V+ HL+     + Y+P++ALG +T +D
Sbjct  11    TNLRTVSDTKRAFYNYHSRPINSLYRRVIEELMVEMHLLSVNVDFVYNPLYALGVITSFD  70

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGN-SLVDFSSREGEV  745
             R M GY  E+DKE+I  A  +A+  +P+QYR DA+ L    ++   N SL D +++    
Sbjct  71    RFMVGYEPEQDKESILSAICQAVEGDPQQYRQDAEAL----KSDLANLSLSDLNTQLASA  126

Query  746   ESI----LKDISERAGSKDSFRYSRFFAIGLFRLLE---LSNATDPT----ILEKLCAAL  892
             ++     L++      ++ S +Y+R  A+GL+ L E   +S+  D      +L+     L
Sbjct  127   KTTDGNGLQNKLHVVATQASAKYTRLMAVGLYTLFETVDISSLEDKDSREEMLKTAAEML  186

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
              +  + VD+DL++YR+ L K+ QA+E++K+ +  E+KKR +R   K++
Sbjct  187   ALPAEKVDKDLELYRSNLDKMAQAQEVMKDILEAERKKREQRAQAKAD  234



>ref|WP_017310934.1| inositol phosphatase [Fischerella sp. PCC 9339]
Length=202

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 125/204 (61%), Gaps = 24/204 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P+FALG VT +DR M+GY  E DKE+IF A ++++  +P+ Y+ 
Sbjct  1     MVEMHLLAVNIDFSYNPIFALGVVTCFDRFMQGYEPESDKESIFNALLRSIEADPQIYKQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+E A++     L+   S      R+ +++S L+ I     S   F+YSR FAIGL
Sbjct  61    DAQRLQEIAKSLPPQDLIAALSQQTQLNRDADLQSHLQAI----ASNPKFKYSRLFAIGL  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLELS   DP +          L+ + A L+++   +++DL++YR+ L K+ QA  ++
Sbjct  117   FSLLELS---DPELVKDEKQRTEALKSISAGLHLSDDKLNKDLELYRSNLDKMTQALVVM  173

Query  977   KEYVAREKKKRGERESQKSNEAVT  1048
              + ++ ++KKR +R SQ+S+  +T
Sbjct  174   ADMLSADRKKREQR-SQQSSTTLT  196



>ref|WP_012306361.1| MULTISPECIES: inositol monophosphatase [Synechococcus]
 ref|YP_001733993.1| Thf1-like protein [Synechococcus sp. PCC 7002]
 sp|B1XHY6.1|THF1_SYNP2 RecName: Full=Protein Thf1 [Synechococcus sp. PCC 7002]
 gb|ACA98737.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=254

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 129/221 (58%), Gaps = 19/221 (9%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             + V TVS+TK +F   + RPI S++  V++EL+V+ HL+     ++YDP +ALG VT ++
Sbjct  2     SQVRTVSDTKRDFYTHHTRPINSIFRRVVEELLVEMHLLSVNADFRYDPFYALGVVTSFE  61

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR----E  736
             R M+GY  E DK +IF++  +A+  +  +Y+ DA  L E A+   G  L++   +    E
Sbjct  62    RFMQGYRPEADKVSIFQSMCQAIGGDANRYKEDAMALVELAKRCSGTQLIECFRQDVPPE  121

Query  737   GEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTILEK----------LCA  886
             G  E  L +  E     D F+YSR FAIG++  L     ++P +LE           + A
Sbjct  122   GAQE--LWEKIEAIAKNDHFKYSRLFAIGVYTFL---GESEPQLLEDTEKRDEMLTTVTA  176

Query  887   ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
              LN+ ++ + +DLD+YR+ L K+ Q  E+L++ +A E+++R
Sbjct  177   GLNLPEEKMKKDLDLYRSNLEKMNQVLEVLEDALAVERQRR  217



>ref|WP_012267057.1| inositol monophosphatase [Microcystis aeruginosa]
 ref|YP_001659455.1| Thf1-like protein [Microcystis aeruginosa NIES-843]
 dbj|BAG04263.1| Psb29 Photosystem II sub-stoichiometric subunit [Microcystis 
aeruginosa NIES-843]
Length=233

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 125/220 (57%), Gaps = 8/220 (4%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNPALGANN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQS  910
              L D      +   F+YSR FAIGL+ +L  +             IL+K    L ++ + 
Sbjct  129   QLSDSLVSLINAPKFKYSRLFAIGLYTILAEAQPDIIKEKEKREQILQKFSEILRLSSEK  188

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  189   LQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_006511842.1| photosystem II biogenesis protein Psp29 [Xenococcus sp. PCC 7305]
 gb|ELS01070.1| photosystem II biogenesis protein Psp29 [Xenococcus sp. PCC 7305]
Length=270

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 131/220 (60%), Gaps = 11/220 (5%)
 Frame = +2

Query  389   TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             T++ TVS+TK +F   Y +PI SVY  +++EL+V+ HL+     ++ DP+F LG V+ ++
Sbjct  8     TNLKTVSDTKRSFYNNYNKPINSVYRRIVEELLVEMHLLSVNADFKSDPIFYLGVVSCFE  67

Query  569   RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV-  745
             RLM+GY  ++DK AIF A  +A++ +PE YRA A  L   A+ + G  L+ +      + 
Sbjct  68    RLMQGYQPDQDKGAIFNALCRAVDGDPESYRAQAGNLLAIAKEKSGEELIAWLGEPTAIA  127

Query  746   --ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-----TDP--TILEKLCAALNV  898
               E+I + I   A + + F+YSR F IGL+ LLE ++A     +D    I E +   L++
Sbjct  128   GAENIAETIKSIAANAN-FKYSRPFGIGLYTLLEEADAKLLEDSDKRNEIFENIAKTLSL  186

Query  899   NKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGER  1018
                 + +DL++YR+ L K+ Q  + +++ +   +K+R +R
Sbjct  187   PGDKMKKDLELYRSNLEKMEQVLKAIEDALQASRKQREKR  226



>ref|WP_002761048.1| inositol monophosphatase [Microcystis aeruginosa]
 emb|CCH98181.1| Protein thf1 [Microcystis aeruginosa PCC 9717]
 emb|CCI29632.1| Protein thf1 [Microcystis aeruginosa PCC 9809]
Length=233

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 125/220 (57%), Gaps = 8/220 (4%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K +F   + RPI SVY  V++EL+V+ HL+     + YDP++ALG VT +++ 
Sbjct  9     IRTVSDSKRDFYTRHTRPINSVYRRVVEELLVEMHLLSVNVDFHYDPIYALGVVTSFEKF  68

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLV-DFSSREGEVES  751
             MEGY   EDK  IF A  +A+N  PE YR DA+ +   A+  + +SL+    +      +
Sbjct  69    MEGYRPGEDKPNIFNALCQAVNGNPEVYRRDAENMIAIAKETNIDSLLSQLQNPALGGNN  128

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQS  910
              L D      +   F+YSR FAIGL+ +L  +             IL+K    L ++ + 
Sbjct  129   QLSDSLVSVINAPKFKYSRLFAIGLYTILAEAQPDMIKEKEKREQILQKFSEILRLSSEK  188

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             + +DLDVYR  L K+ Q  +++++ +  EKKKR ++E +K
Sbjct  189   LQKDLDVYRGNLDKMDQLLKVIEDALEAEKKKRQQKEQEK  228



>ref|WP_006456152.1| inositol monophosphatase [Synechococcus sp. PCC 7335]
 gb|EDX86386.1| photosystem II biogenesis protein Psp29 [Synechococcus sp. PCC 
7335]
Length=250

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 128/211 (61%), Gaps = 12/211 (6%)
 Frame = +2

Query  389  TDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYD  568
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + YD ++ALG V+ YD
Sbjct  2    NNVRTVSDTKRAFYSQHTRPINAIYRRVVEELMVEAHLLLVNADFNYDSIYALGVVSTYD  61

Query  569  RLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDG----NSLVDFSSRE  736
            R M+GY    D++ I+RA ++A   +P+QYR DA++L   A++        S++D +  E
Sbjct  62   RFMQGYEPAGDRDNIYRAILQANEADPDQYRRDAEELLGVAKSLPSIDAFKSILDEAKTE  121

Query  737  GEVESILKDISERAGSKDSFRYSRFFAIGLFRLLE-----LSNATD--PTILEKLCAALN  895
               +++  ++  +A S   F+YSR FAIGL+ ++E     + N  D    ++ ++ + + 
Sbjct  122  SGSDTLKANL-HKAISNPKFKYSRLFAIGLYNVIESIDADMLNDKDKRDALMAEIASTIG  180

Query  896  VNKQSVDRDLDVYRNLLSKLVQAKELLKEYV  988
            +N+  + +D+D+YR  L K+ QA+E++K+ +
Sbjct  181  LNEDLLKKDIDLYRGNLEKMAQAQEVMKDMI  211



>ref|WP_016868313.1| inositol phosphatase [Fischerella muscicola]
Length=202

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 118/197 (60%), Gaps = 23/197 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P+FALG VT +DR M+GY  E DKE+IF A ++A+  +P+ YR 
Sbjct  1     MVEMHLLAVNVDFSYNPIFALGVVTSFDRFMQGYQPESDKESIFNALLRAIEADPQIYRQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+E A++     L+   S      R+ +++S L+ I     S   F+YSR FAIGL
Sbjct  61    DAQRLQELAKSLPPQDLIAALSLQTQLNRDADLQSHLQAI----ASNPKFKYSRLFAIGL  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLELS   DP +          L+ +   L+++   +++DL++YR+ L K+ QA  ++
Sbjct  117   FSLLELS---DPELVKDEKRRTEALKSIATGLHISDDKLNKDLELYRSNLDKMAQALVVM  173

Query  977   KEYVAREKKKRGERESQ  1027
              + ++ ++KKR +R  Q
Sbjct  174   ADMLSADRKKREQRSQQ  190



>ref|WP_016859299.1| inositol phosphatase [Fischerella muscicola]
Length=202

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 124/200 (62%), Gaps = 16/200 (8%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P+FALG VT +DR M+GY  E DKE+IF A ++++  +P+ Y+ 
Sbjct  1     MVEMHLLAVNIDFSYNPIFALGVVTCFDRFMQGYEPESDKESIFNALLRSIEADPQIYQQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSSREGEV--ESILKDISERAGSKDSFRYSRFFAIGLFRLL  838
             DAQ+L+E A++     L+   S++ ++  ++ L+   +   S   F+YSR FAIGLF LL
Sbjct  61    DAQRLQEIAKSLPPQDLIAALSQQTQLNQDADLQSHLQAIASNPKFKYSRLFAIGLFSLL  120

Query  839   ELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYV  988
             ELS   DP +          L+ +   L+++   +++DL++YR+ L K+ QA  ++ + +
Sbjct  121   ELS---DPELVKDEKQRTEALKSISVGLHLSDDKLNKDLELYRSNLDKMTQALVVMADML  177

Query  989   AREKKKRGERESQKSNEAVT  1048
             + ++KKR +R SQ+S+  VT
Sbjct  178   SADRKKREQR-SQQSSTTVT  196



>ref|WP_017303638.1| hypothetical protein [Spirulina subsalsa]
Length=238

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 129/226 (57%), Gaps = 10/226 (4%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK NF   + RPI S+Y  V++EL+V+ HL+    ++ YDP++ LG  + Y+R 
Sbjct  4     VRTVSDTKQNFYTHHTRPINSIYRRVVEELMVEMHLLSVNVNFGYDPIYGLGVASSYERF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGE---V  745
             M  Y  E D+ +IF A  +A+  +P+QY  DA  L   A     + L++++S  G     
Sbjct  64    MSSYKPEADRVSIFEALCRAVETDPQQYHQDAATLLGLAEKISLDQLLNWTSSLGSYDGA  123

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLE-LSNATDPT------ILEKLCAALNVNK  904
             + +   ++  A  +  F+YSR FAIGL+ L+E +S AT         +L+ L   L +  
Sbjct  124   QPLYNALNAIASPERKFKYSRLFAIGLYALIEKISPATAQDHKKLNEVLQSLGEGLRLPI  183

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEA  1042
               + +DL++Y+  L K+ QAK +L++ +  ++KKR +R  +K+  A
Sbjct  184   DKLQKDLELYQGNLEKMEQAKRVLQDALEADRKKRLKRALEKTQGA  229



>gb|EKD11393.1| Thf1-like protein [Arthrospira platensis C1]
Length=215

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 112/195 (57%), Gaps = 9/195 (5%)
 Frame = +2

Query  470   VLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEP  649
             +++EL+V+ HL+     ++YDP++ALG VT +DR M+GY  E DK +I+ A I A   +P
Sbjct  1     MVEELMVEMHLLSVNVDFKYDPIYALGVVTAFDRFMQGYIPEADKLSIWAALIMAQESDP  60

Query  650   EQYRADAQKLEEWARAQDGNSLVDFS--SREGEVESILKDISERAGSKDSFRYSRFFAIG  823
              QYRADA  LE  A       L + +  ++E   +  L+       +   F+YSR FAIG
Sbjct  61    NQYRADATALEAQAATLSVKDLTERAKIAQESSGDDPLQSCFHAIANNPKFKYSRLFAIG  120

Query  824   LFRLLELSNATDP-------TILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKE  982
             L+ LLE S+ T         TIL     AL + K  +++DLD+YR  L K+ QA+ +++E
Sbjct  121   LYTLLEKSDVTAAQDSEGLKTILSDFSEALRLPKDKLEKDLDLYRTNLEKVAQARLMVEE  180

Query  983   YVAREKKKRGERESQ  1027
                 E+KKR +R +Q
Sbjct  181   MTQAERKKREQRAAQ  195



>ref|WP_040936134.1| inositol phosphatase, partial [Prochloron didemni]
Length=237

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 135/227 (59%), Gaps = 13/227 (6%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI SVY  V++EL+V+ HL+     ++ DP++ LG VT +DR ME
Sbjct  6     TVSDTKRDFYARHTRPINSVYGRVVEELLVEMHLLSVNVDFRSDPIYYLGVVTSFDRFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF----SSREGEVE  748
             GY  E+DK++IF A  +++     +YR +A KL  +A+ + G  L+ +    +  +G ++
Sbjct  66    GYEPEKDKDSIFAALCQSVGGNAREYRNEAAKLTTFAQERSGEELITWLASPTPTQG-MK  124

Query  749   SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQ  907
             S+ K + E   +   F+YSR FAIGL+ LLE +++       +     +++  AL++  +
Sbjct  125   SLSKSLQEITNNP-KFKYSRLFAIGLYTLLEQADSELVKEEESRDRSFKQIAEALHLPLE  183

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
              +++DL++YR  L K+ Q   +L++ +  ++KK+ ER   K  E  T
Sbjct  184   KLNKDLELYRGNLEKMTQMLTVLQDTLEADRKKQQERSLAKEPETKT  230



>sp|P0C1D1.1|THF1_SYNJB RecName: Full=Protein Thf1 [Synechococcus sp. JA-2-3B'a(2-13)]
Length=239

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 127/223 (57%), Gaps = 11/223 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V T+S TK  F  AY RPI +VY  V++EL+V+ HL     ++ YDP FALG VT+YD L
Sbjct  4     VRTLSATKAAFFSAYPRPINAVYRRVVEELLVELHLTTVNSTFVYDPFFALGLVTLYDGL  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
             ME Y   E +EAIF A  KAL+ +PE  R +A+ L E   + D    +D    + E E +
Sbjct  64    MEAYHPPEQREAIFNALCKALHLKPEVLRKNARDLLELMGSGDPRQRLDLLCLKPEAEDV  123

Query  755   --LKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT---DPT-----ILEKLCAALNVNK  904
               LK I ER  ++  + YSR  A+GL+   E+   +   +P       LE + + L  + 
Sbjct  124   GGLKAILERM-TQPPYAYSRVLAVGLYTAYEVVAKSLYEEPEERTRRFLENVVSKLPFST  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + V +DL++YR+ L ++ QA+ +++E V   ++++  R+S  S
Sbjct  183   ERVRKDLELYRSSLDRMKQARAVVEEMVKAARRQQERRQSAAS  225



>ref|WP_012594487.1| inositol monophosphatase [Cyanothece sp. PCC 8801]
 ref|YP_002371369.1| Thf1-like protein [Cyanothece sp. PCC 8801]
 sp|B7K277.1|THF1_CYAP8 RecName: Full=Protein Thf1 [Cyanothece sp. PCC 8801]
 gb|ACK65213.1| photosystem II biogenesis protein Psp29 [Cyanothece sp. PCC 8801]
Length=235

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 123/215 (57%), Gaps = 10/215 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS+TK +F   + RPI S+Y   ++EL+V+ HL+     ++YDP++ALG V  + + 
Sbjct  4     IRTVSDTKRDFYNHHTRPINSIYRRFIEELLVEMHLLCVNIDFRYDPIYALGVVASFQQF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF--SSREGE-V  745
             M+GY  EEDK +IF A  +A+  + E+YR +AQ L    +    + L+    S+R GE  
Sbjct  64    MQGYRPEEDKNSIFSALCQAVGGDGEKYRHEAQTLLNQVKGMSVSDLIAMGNSARTGEPG  123

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLL-----ELSNATDP--TILEKLCAALNVNK  904
             E +L +  +       F+YSR FAIGL+ ++     +L    D       +LC  LN++ 
Sbjct  124   EGMLYNTLQAIAKNPQFKYSRLFAIGLYTMVMEIDADLLKEQDKRNETFSQLCNGLNLSS  183

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
               + +DLD+YR+ + K+ Q   ++++ +  E+KKR
Sbjct  184   DKLQKDLDLYRSNVDKMGQLLAVIEDALEAERKKR  218



>ref|WP_040944787.1| inositol phosphatase [Prochloron didemni]
Length=241

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 133/226 (59%), Gaps = 11/226 (5%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI SVY  V++EL+V+ HL+     ++ DP++ LG VT +DR ME
Sbjct  6     TVSDTKRDFYARHTRPINSVYGRVVEELLVEMHLLSVNVDFRNDPIYYLGVVTSFDRFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE---S  751
             GY  E+DK++IF A  +++     +YR +A KL  +A+ + G  L+ + +    ++   S
Sbjct  66    GYEPEKDKDSIFAALCQSVGGNAREYRNEAAKLTTFAQERSGEELITWLASPTPIQGMKS  125

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQS  910
             + K + E   +   F+YSR FAIGL+ LLE +++       +     +++  AL++  + 
Sbjct  126   LSKSLQEITNNP-KFKYSRLFAIGLYSLLEQADSELVKEEESRDRSFKQIAEALHLPLEK  184

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
             +++DL++YR  L K+ Q   +L++ +  ++KK+ ER   K  E  T
Sbjct  185   LNKDLELYRGNLEKMTQMLTVLQDTLEADRKKQQERSLAKEPETKT  230



>ref|WP_015783503.1| inositol monophosphatase [Cyanothece sp. PCC 8802]
 ref|YP_003136937.1| Thf1-like protein [Cyanothece sp. PCC 8802]
 gb|ACV00102.1| photosystem II biogenesis protein Psp29 [Cyanothece sp. PCC 8802]
Length=235

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 124/215 (58%), Gaps = 10/215 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS+TK +F   + RPI S+Y   ++EL+V+ HL+     ++YDP++ALG V  + + 
Sbjct  4     IRTVSDTKRDFYTHHTRPINSIYRRFIEELLVEMHLLCVNIDFRYDPIYALGVVASFQQF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF--SSREGE-V  745
             M+GY  EEDK +IF A  +A+  + E+YR +AQ L    +    + L+    S+R GE  
Sbjct  64    MQGYRPEEDKNSIFSALCQAVGGDGEKYRHEAQTLLNQVKGMSVSDLIAMGNSARTGEPG  123

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLL-----ELSNATDP--TILEKLCAALNVNK  904
             E +L +  +   +   F+YSR FAIGL+ ++     +L    D       +LC  LN++ 
Sbjct  124   EGMLFNTLQAIANNPQFKYSRLFAIGLYTMVMEIDADLLKEQDKRNETFSQLCNGLNLSS  183

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
               + +DLD+YR+ + K+ Q   ++++ +  E+KKR
Sbjct  184   DKLQKDLDLYRSNVDKMGQLLAVIEDALEAERKKR  218



>ref|WP_028083521.1| inositol phosphatase [Dolichospermum circinale]
Length=235

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 128/218 (59%), Gaps = 17/218 (8%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             +V TVS+TK  F   + RPI ++Y  V++EL+V+ HL+     + YD ++ALG VT +DR
Sbjct  3     NVRTVSDTKKTFYTLHTRPINTIYRRVVEELMVEMHLLSVNVDFSYDGIYALGVVTTFDR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR---AQD---GNSLVDFSSR  733
              M GY  E+D+E+IF+A   A+ ++P +YR DA +L+  A     QD   G S     ++
Sbjct  63    FMAGYQPEQDQESIFQAICHAVEQDPHRYRQDASRLQALAANVPVQDLIAGLSQATLLNQ  122

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELS-------NATDPTILEKLCAAL  892
             + +++  L+ I+    +  +F+YSR FAIGLF LL  S       N      L+ +   L
Sbjct  123   DADLQRQLEAIA----ANSNFKYSRLFAIGLFALLAESDPAFVKDNTQRTEALKTIAKGL  178

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKK  1006
             ++++  + +DL++Y + L K+ QA  ++ + ++ ++KK
Sbjct  179   HLSEDKLIKDLELYSSNLEKMAQALIVMADILSADRKK  216



>ref|WP_040934895.1| inositol phosphatase [Prochloron didemni]
Length=241

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 133/226 (59%), Gaps = 11/226 (5%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK +F   + RPI SVY  V++EL+V+ HL+     ++ DP++ LG VT +DR ME
Sbjct  6     TVSDTKRDFYARHTRPINSVYGRVVEELLVEMHLLSVNVDFRSDPIYYLGVVTSFDRFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVE---S  751
             GY  E+DK++IF A  +++     +YR +A KL  +A+ + G  L+ + +    ++   S
Sbjct  66    GYEPEKDKDSIFAALCQSVGGNAREYRNEAAKLTTFAQERSGEELIAWLASPTPIQGMKS  125

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNA-------TDPTILEKLCAALNVNKQS  910
             + K + E   +   F+YSR FAIGL+ LLE +++       +     +++  AL++  + 
Sbjct  126   LSKSLQEITNNP-KFKYSRLFAIGLYSLLEQADSELVKEEESRDRSFKQIAEALHLPLEK  184

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVT  1048
             +++DL++YR  L K+ Q   +L++ +  ++KK+ ER   K  E  T
Sbjct  185   LNKDLELYRGNLEKMTQMLTVLQDTLEADRKKQQERSLAKEPETKT  230



>ref|WP_015144955.1| photosystem II biogenesis protein Psp29 [Pleurocapsa minor]
 ref|YP_007082213.1| photosystem II biogenesis protein Psp29 [Pleurocapsa sp. PCC 
7327]
 gb|AFY78656.1| photosystem II biogenesis protein Psp29 [Pleurocapsa sp. PCC 
7327]
Length=241

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 133/234 (57%), Gaps = 15/234 (6%)
 Frame = +2

Query  380   CMSTDVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVT  559
             C+   V TVS+ K +F   + RPI S+Y   ++ELIV+ HL+     ++YD ++ALG VT
Sbjct  4     CLVDKVRTVSDAKRDFYTHHTRPINSIYRRFVEELIVEMHLLSVNTDFRYDAIYALGVVT  63

Query  560   VYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVD--FSSR  733
              ++R M+GY  E+DK +IF A  +A     EQYR +A ++   A+      L+    SS 
Sbjct  64    AFERFMQGYQPEQDKSSIFAALCQATGGNWEQYRQEAGEILAQAKQMSVQELIAKINSST  123

Query  734   EGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLC  883
                 E+ L +  +   ++ +++YSR FAIGL+ LL      DP I          L+++ 
Sbjct  124   PTGGENRLVETLQAIANRSNYKYSRLFAIGLYTLLA---EADPDILRDPEKRDRTLKEVT  180

Query  884   AALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
              AL+++ + + +DLD+YR+ L K+ Q  ++L+E +  E+KKR +++ ++    +
Sbjct  181   EALHLSPEKLQKDLDLYRSNLDKMDQLLKVLEEALEAERKKRQQQKPEQGTAQI  234



>ref|WP_019503989.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=238

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 129/220 (59%), Gaps = 11/220 (5%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS++K  F  +Y RPI SVY  V++EL+V+ HL+     ++ DP++ LG VT ++RLM+
Sbjct  3     TVSDSKRAFYASYPRPINSVYRRVIEELLVEMHLLSVNADFKLDPIYYLGIVTSFERLMQ  62

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSR---EGEVES  751
             GY  E DKE IF A   + + +PE Y++ A  L   A+ +  + LVD+ S    E +   
Sbjct  63    GYQPESDKEQIFNALCTSTDSDPETYKSQAGALLSIAKDKSTDELVDWLSNPTAENDSSH  122

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSN-------ATDPTILEKLCAALNVNKQS  910
             I++ I   A + D+F+YSR FAIG++ LLE  +            +L+ +     ++ + 
Sbjct  123   IVEPIKAIA-TNDNFKYSRPFAIGIYTLLEECDHELVQDQEKRNQVLDTIAENFGISGEK  181

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
             + +DL++YR+ L K+ +  +++++ +   +KKR +R  +K
Sbjct  182   MKKDLELYRSNLEKMGELLKVIEDVLEASRKKRAKRAEEK  221



>ref|WP_017315549.1| hypothetical protein [Mastigocladopsis repens]
Length=202

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 118/197 (60%), Gaps = 23/197 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + YDP++ALG VT +DR M+GY  E DKE+IF A + A+ E+ E+Y+ 
Sbjct  1     MVEMHLLSVNVDFSYDPIYALGVVTTFDRFMQGYQPERDKESIFNALLHAVEEDQERYKQ  60

Query  665   DAQKLEEWARAQDGNSLVDF------SSREGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+  A +   + L+ +      SSR+ + +  L+ I+       +F+YSR FAIGL
Sbjct  61    DAQRLQALATSLSASELIAWLSQETLSSRDADFQGSLQAIANNG----TFKYSRLFAIGL  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLE S   DP +          L+++   L+++   +++DL++YR+ + K+ QA  ++
Sbjct  117   FSLLEQS---DPELVKDEKKRTEALKRIATGLHMSDDKLNKDLEIYRSNIDKMSQALTVM  173

Query  977   KEYVAREKKKRGERESQ  1027
              + V+ E+K+R +R  Q
Sbjct  174   SDMVSAERKRREQRTQQ  190



>ref|WP_009629378.1| Protein thf1 [Pseudanabaena biceps]
 gb|ELS30564.1| Protein thf1 [Pseudanabaena biceps PCC 7429]
Length=240

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 130/236 (55%), Gaps = 24/236 (10%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TVS+TK +F  A+ +P+  VY  V+ EL+V+ HL++  +++ YD +FALGFVT +DR 
Sbjct  4     VRTVSDTKKDFYLAFPKPVNQVYRRVVDELLVEIHLLKVNQTFVYDAIFALGFVTTFDRF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWAR---------AQDGNSLVDFS  727
               GY  E D+ A+F A   AL  + ++ R DA  L + A            + +S +   
Sbjct  64    TAGYKPETDRFAVFHALCAALQFDSDRIRQDAATLSDLATRSPNDIKTLLTNLDSGISLE  123

Query  728   SREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLLELSN-------ATDPTILEKLCA  886
                G+++ I         +K++F+YSR   +GL+ LLE+S+       A    +++ +  
Sbjct  124   PLSGQLQII--------STKENFKYSRLLGVGLYALLEISDPEEIADSAKREELIKLVGE  175

Query  887   ALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKC  1054
              L      + +D+D+YR+ L K+ QA++++ + V  E+KKR ++E+  S+   T+ 
Sbjct  176   TLKFGSDRLLKDVDLYRSNLDKIEQARQMIADMVEAERKKRSQKEAALSSAKATEV  231



>ref|WP_011430990.1| hypothetical protein [Synechococcus sp. JA-3-3Ab]
 ref|YP_475579.1| Thf1-like protein [Synechococcus sp. JA-3-3Ab]
 sp|Q2JSQ3.1|THF1_SYNJA RecName: Full=Protein Thf1 [Synechococcus sp. JA-3-3Ab]
 gb|ABD00316.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=239

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 124/223 (56%), Gaps = 11/223 (5%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V T+S TK  F  AY RPI + Y  V++EL+V+ HL     ++ YDP FALG VT+YD L
Sbjct  4     VRTLSATKAAFFSAYPRPINAAYRRVVEELLVELHLTTVNSAFVYDPFFALGLVTLYDSL  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
             ME Y   E +EAIF A  KAL+ +PE  R +A+ L E  R+ D     +    + E E +
Sbjct  64    MEAYHPPEQREAIFNALCKALHLKPEVLRKNARDLLELMRSGDPVQRYNLLCLKPEAEDV  123

Query  755   --LKDISERAGSKDSFRYSRFFAIGLFRLLELSNAT---DPT-----ILEKLCAALNVNK  904
               LK I +R  ++  + YSR  A+GL+   E    +   +P       LE +   L  + 
Sbjct  124   GGLKAILQRM-TQPPYAYSRVLAVGLYTAYEAVATSLYKEPEERTRHFLEDVIGNLPFSP  182

Query  905   QSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKS  1033
             + V +DL++YR+ L +L QA+ +++E V   ++++  R+S  S
Sbjct  183   ERVKKDLELYRSNLDRLKQARAIVEEMVKAARRQQERRQSTAS  225



>ref|WP_006196164.1| inositol phosphatase [Nodularia spumigena]
 gb|EAW45567.1| hypothetical protein N9414_22068 [Nodularia spumigena CCY9414]
 gb|AHJ29912.1| hypothetical protein NSP_36010 [Nodularia spumigena CCY9414]
Length=200

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 125/203 (62%), Gaps = 23/203 (11%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P++ALG VT +DR M+GY  E+D+E+IF+A  +A+ +EP++YR 
Sbjct  1     MVEMHLLSVNSGFSYNPIYALGVVTSFDRFMQGYLPEQDQESIFQALCQAVEQEPQRYRE  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DA++L+  A+    N L+ + S      R+ ++++ L+ I+  +     F+YSR FA+GL
Sbjct  61    DAKRLQALAKDLPVNDLIAWLSQTTHLDRDPDLQAQLQAIAHNS----EFKYSRLFAVGL  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLE S   DP +          L+ + A L+++ + +++DL++Y + L K+ QA  ++
Sbjct  117   FTLLEQS---DPELVKDEKQRTEALKTIAAGLHLSDEKLNKDLELYSSNLEKMAQALVVM  173

Query  977   KEYVAREKKKRGERESQKSNEAV  1045
              + ++ ++KKR +R+ Q +   V
Sbjct  174   ADMLSADRKKREQRQQQTTTPVV  196



>ref|WP_017740537.1| hypothetical protein [Scytonema hofmanni]
Length=194

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 122/199 (61%), Gaps = 23/199 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P++ALG VT ++R M+GY  E D+E+IF A ++AL E+P++YR 
Sbjct  1     MVEMHLLSVNVDFGYEPIYALGVVTAFERFMQGYQPERDQESIFNALVRALEEDPQRYRQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+  A+    + L+ + S      R+ +++S L+ IS+      +F+Y+R FAIG+
Sbjct  61    DAQRLQSVAKNLPPSELIAWLSQQTHLDRDADLQSSLQAISKNP----NFKYNRLFAIGV  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLELS   DP +          L+ +   L+++   + +DL+VYR+ L K+ QA  ++
Sbjct  117   FSLLELS---DPELVKDQKQLTEALKTIADGLHLSDDKLSKDLEVYRSNLDKVSQALAVM  173

Query  977   KEYVAREKKKRGERESQKS  1033
              + ++ ++K+R +R  Q S
Sbjct  174   SDLLSADRKRREQRSQQSS  192



>ref|WP_023174142.1| Thf1 [Gloeobacter kilaueensis]
 ref|YP_008712642.1| Thf1 [Gloeobacter kilaueensis JS1]
 gb|AGY58935.1| Thf1 [Gloeobacter kilaueensis JS1]
Length=228

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 127/223 (57%), Gaps = 11/223 (5%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+ K  F  AY RP+ S+Y  V+ EL+V+ HL+   + ++YDP+FA+G +T Y   ME
Sbjct  6     TVSDAKRAFFAAYPRPLNSIYRRVIDELLVEVHLLVANQDFRYDPLFAVGLLTTYQAFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI-L  757
             GY   + +EAI RA+  A+    +Q +ADA + +  A       +++  + + E  S  L
Sbjct  66    GYSPADQREAILRAFCTAVELNYDQLQADAAQWQSLAGELPAQDVLEVMAGKREATSDRL  125

Query  758   KDISE-RAG--SKDSFRYSRFFAIGLFRLLE-------LSNATDPTILEKLCAALNVNKQ  907
             K +S+  AG      F+YSR F +GL  +L+       LS       L+++CA L ++  
Sbjct  126   KAVSDVLAGIVHNSRFKYSRLFVLGLASILDQLGRAVPLSEKERLERLQQICAYLKLDYS  185

Query  908   SVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSN  1036
              V RDLD ++++L ++ ++KE++ E V  +++KR ER   +S 
Sbjct  186   RVKRDLDFFQSVLERIKRSKEVIDELVQSDRRKREERAVSQSG  228



>ref|WP_006668039.1| MULTISPECIES: inositol phosphatase [Arthrospira]
 gb|EDZ96819.1| Thf1-like protein [Arthrospira maxima CS-328]
Length=210

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 107/190 (56%), Gaps = 9/190 (5%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     ++YDP++ALG VT +DR M+GY  E DK +I+ A I A   +P QYRA
Sbjct  1     MVEMHLLSVNVDFKYDPIYALGVVTAFDRFMQGYIPEADKLSIWAALIMAQESDPNQYRA  60

Query  665   DAQKLEEWARAQDGNSLVDFS--SREGEVESILKDISERAGSKDSFRYSRFFAIGLFRLL  838
             DA  LE  A       L + +  ++E   +  L+       +   F+YSR FAIGL+ LL
Sbjct  61    DATALEAQAATLSVKDLTERAKIAQESSGDDPLQSCFHAIANNPKFKYSRLFAIGLYTLL  120

Query  839   ELSNATDP-------TILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVARE  997
             E S+ T         TIL     AL + K  +++DLD+YR  L K+ QA+ +++E    E
Sbjct  121   EKSDVTAAQDSEGLKTILSDFSEALRLPKDKLEKDLDLYRTNLEKVAQARLMVEEMTQAE  180

Query  998   KKKRGERESQ  1027
             +KKR +R +Q
Sbjct  181   RKKREQRAAQ  190



>ref|WP_024124360.1| photosystem II biogenesis protein Psp29 [Thermosynechococcus 
sp. NK55a]
 ref|YP_008899462.1| photosystem II biogenesis protein Psp29 [Thermosynechococcus 
sp. NK55a]
 gb|AHB87949.1| photosystem II biogenesis protein Psp29 [Thermosynechococcus 
sp. NK55a]
Length=222

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 121/212 (57%), Gaps = 12/212 (6%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F  AY RPI S+Y   ++EL+V+ HL+R    ++Y P+FALG VT +D+ ME
Sbjct  6     TVSDTKRAFYAAYTRPIHSIYRRFIEELLVEIHLLRVNVDFRYSPLFALGVVTAFDQFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             GY  E D   IF A   A    P+Q + DA   +++        L + +S  G+  + L 
Sbjct  66    GYQPEGDGNRIFHALCVAEEMNPQQLKEDAASWQQYQGRPLSQILGELNS--GQPSAPLN  123

Query  761   DISERAGSKDSFRYSRFFAIGLFRLL-ELSNATDPT---ILEKLCAALNVNKQSVDRDLD  928
              ++  AG     +YSR  A+GL+  L EL+         IL++L   + +  + V RDL+
Sbjct  124   SLNH-AG-----KYSRLHAVGLYAFLQELAGELTVNLNEILDQLAPVIQLPIEKVKRDLE  177

Query  929   VYRNLLSKLVQAKELLKEYVAREKKKRGERES  1024
             +YR+ L K+ QA+ L++E V +E+K+R ++ S
Sbjct  178   LYRSNLDKINQARSLMRELVEQERKRRAQQTS  209



>ref|WP_035154467.1| inositol phosphatase [Calothrix sp. 336/3]
Length=202

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 119/194 (61%), Gaps = 17/194 (9%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P++ LG  T ++R M+GY  E DKE+IF A ++A  ++P++++ 
Sbjct  1     MVEMHLLSVNVDFSYNPIYGLGVYTAFNRFMQGYEPETDKESIFNALLRATEDDPQRFQQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DA KL+E A++  GN L+ + S      R+ + ++ L+ I   AG+   F+YSR FAIGL
Sbjct  61    DAHKLQEIAQSLSGNDLIAWLSQKNSLDRDADFQAQLQAI---AGNP-KFKYSRLFAIGL  116

Query  827   FRLLELSNA---TDPT----ILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEY  985
             F LLE ++     D       L+ +   LN++   +++DL++YR+ L K+ QA  ++ + 
Sbjct  117   FTLLEFADGELVKDEKKLNEALKTIATGLNISDDKLNKDLELYRSNLDKMSQAMVVMADM  176

Query  986   VAREKKKRGERESQ  1027
             +A ++KKR +R+ Q
Sbjct  177   LAADRKKREQRQQQ  190



>ref|WP_011056976.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_681924.1| Thf1-like protein [Thermosynechococcus elongatus BP-1]
 sp|Q8DJT8.1|THF1_THEEB RecName: Full=Protein Thf1 [Thermosynechococcus elongatus BP-1]
 dbj|BAC08686.1| tlr1134 [Thermosynechococcus elongatus BP-1]
Length=222

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 123/213 (58%), Gaps = 14/213 (7%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK  F  A+ RPI S+Y   ++EL+V+ HL+R    ++Y P+FALG VT +D+ ME
Sbjct  6     TVSDTKRAFYAAHTRPIHSIYRRFIEELLVEIHLLRVNVDFRYSPLFALGVVTAFDQFME  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESILK  760
             GY  E D++ IF A   A    P+Q + DA   +++        L + +S  G+  + L 
Sbjct  66    GYQPEGDRDRIFHALCVAEEMNPQQLKEDAASWQQYQGRPLSQILDELNS--GQPSAPLN  123

Query  761   DISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI-----LEKLCAALNVNKQSVDRDL  925
              ++       + +YSR  A+GL+  L+   A + TI     L++L   + +  + V RDL
Sbjct  124   SLNH------TGKYSRLHAVGLYAFLQ-ELAGEVTIHLNETLDQLAPVIPLPIEKVKRDL  176

Query  926   DVYRNLLSKLVQAKELLKEYVAREKKKRGERES  1024
             ++YR+ L K+ QA+ L+KE V +E+K+R ++ S
Sbjct  177   ELYRSNLDKINQARSLMKELVEQERKRRAQQTS  209



>ref|WP_008275933.1| inositol monophosphatase [Cyanothece sp. CCY0110]
 gb|EAZ90924.1| hypothetical protein CY0110_21090 [Cyanothece sp. CCY0110]
Length=246

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 128/230 (56%), Gaps = 18/230 (8%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + RPI S+Y   ++EL+V+ HL+     ++YDP++ALG VT ++R
Sbjct  3     NIRTVSDTKRKFYGYHTRPINSIYRRFVEELLVEMHLLSVNVDFKYDPIYALGVVTSFER  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGE--V  745
              M+GY  E DK +IF A  +A++   EQY  +A+ L   A+   G S+ +F  + G+   
Sbjct  63    FMQGYRPESDKASIFNALCQAVDGNSEQYHQEAEALINEAK---GLSMTEFKDKLGQEGG  119

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALN  895
             + IL            F+YSR F +GL+ LL      DP +          ++++  AL 
Sbjct  120   DGILWGTCNAIAQNPKFKYSRLFGVGLYTLL---MEIDPELVKEEEKRNQTIKEVSEALQ  176

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
              +   + +DLD+YR+ L K+ Q   ++++ +  ++KKR  ++ +K+ E V
Sbjct  177   FSSDKLQKDLDLYRSNLDKMQQLLTVIEDTLEADRKKRMSQKLEKTPEVV  226



>ref|WP_036482552.1| inositol phosphatase [Myxosarcina sp. GI1]
Length=229

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 132/223 (59%), Gaps = 13/223 (6%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             + TVS++K  F   + RPI SVY  V++EL+V+ HL+     +  DP++ LG VT ++RL
Sbjct  1     MKTVSDSKRAFYNHHTRPINSVYRRVIEELLVEMHLLSVNADFNSDPIYYLGVVTSFERL  60

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF----SSREGE  742
             M+GY  E+DK++IF A  K+ + +PE Y+  A  L   A+ +    L+++     S+EG 
Sbjct  61    MQGYQPEKDKQSIFNALCKSTDGDPEVYKEQAGSLLSLAQGKTLEELIEWLGNPQSQEG-  119

Query  743   VESILKDISERAGSKDSFRYSRFFAIGLFRLLELS-------NATDPTILEKLCAALNVN  901
              E+I++ I   A +++ F+YSR F IGL+ LLE +       +      L+ L   LN+ 
Sbjct  120   GENIVEPIQAIAKNQN-FKYSRPFGIGLYTLLEEADLELIKDDKKRNETLDTLAEKLNLP  178

Query  902   KQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              + + +DL++YR+ L K+ Q  +++++ +   +K+R  RE +K
Sbjct  179   AEKLKKDLELYRSNLEKMEQLLKVIEDVLQAGRKQRERREQEK  221



>ref|WP_015169823.1| photosystem II biogenesis protein Psp29 [Synechococcus sp. PCC 
7502]
 ref|YP_007107307.1| photosystem II biogenesis protein Psp29 [Synechococcus sp. PCC 
7502]
 gb|AFY75172.1| photosystem II biogenesis protein Psp29 [Synechococcus sp. PCC 
7502]
Length=226

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 122/210 (58%), Gaps = 16/210 (8%)
 Frame = +2

Query  395  VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
            V TV++ K +F +A+ +P+ S+Y  V+ EL+V+ HL+R  +++ YD +FALG  T +DR 
Sbjct  4    VRTVADAKHDFYKAFSKPVNSIYRRVVDELLVEVHLLRVSQNFGYDSIFALGLATAFDRF  63

Query  575  MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSRE--GEVE  748
            M GY  E D E IF+   +AL  +P+Q R ++  L E ++         F++ E   +++
Sbjct  64   MAGYQPESDLEPIFKGLCQALLFDPDQIRQESAHLIELSKQFPAEVKSLFTTLEAGADLD  123

Query  749  SILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDP----------TILEKLCAALNV  898
            +++  I   A +   F+YSR FA+G+F LLE     DP           ++ ++   L +
Sbjct  124  TLMGQIRAIA-TNPKFKYSRLFAVGVFILLE---TADPEAIADQDKRQALITQVGDTLKI  179

Query  899  NKQSVDRDLDVYRNLLSKLVQAKELLKEYV  988
            N + + +DLD+YR+ L K+ Q ++++++ V
Sbjct  180  NSERLLKDLDLYRSNLEKIQQGRQMMEDMV  209



>ref|WP_009546529.1| MULTISPECIES: inositol monophosphatase [Cyanothece]
 ref|YP_001801858.1| Thf1-like protein [Cyanothece sp. ATCC 51142]
 sp|B1WNF0.1|THF1_CYAA5 RecName: Full=Protein Thf1 [Cyanothece sp. ATCC 51142]
 gb|ACB49792.1| photosystem II 22 kD protein [Cyanothece sp. ATCC 51142]
Length=242

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 125/225 (56%), Gaps = 18/225 (8%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + RPI S+Y   ++EL+V+ HL+     ++YDP++ALG VT ++R
Sbjct  3     NIRTVSDTKRKFYGYHTRPINSIYRRFVEELLVEMHLLSVNVDFKYDPIYALGVVTSFER  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGE--V  745
              M+GY  E DK +IF A  +A++   EQY  +A+ L   A+   G S+ +F  + G+   
Sbjct  63    FMQGYSPESDKTSIFNALCQAVDGNSEQYHQEAEALINEAK---GLSITEFKEKLGQEGG  119

Query  746   ESILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATDPTI----------LEKLCAALN  895
             + IL            F+YSR F +GL+ LL      DP +          ++++  AL 
Sbjct  120   DGILWGTCGAIAQNPKFKYSRLFGVGLYTLL---MEIDPDLVKEEDKRNQTIKEVSDALQ  176

Query  896   VNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQK  1030
              +   + +DLD+YR+ L K+ Q   ++++ +  ++KKR  ++ +K
Sbjct  177   FSSDKLQKDLDLYRSNLDKMQQLLTVIEDTLEADRKKRASQKLEK  221



>ref|WP_011935822.1| inositol phosphatase [Synechococcus sp. RCC307]
 ref|YP_001227661.1| Thf1-like protein [Synechococcus sp. RCC307]
 emb|CAK28308.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
Length=237

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 126/226 (56%), Gaps = 9/226 (4%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TV+++K  F  AY   IP +Y  V+ EL+V+ HL+  +  +Q D +FA+G   V+D LM+
Sbjct  8     TVADSKRRFYAAYPHVIPGLYRRVVDELLVELHLLAGQAGFQADSLFAMGLTQVFDNLMQ  67

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGE-VESIL  757
             G+   E ++ +F A       + +Q R DA++L E         +  +  ++G+    +L
Sbjct  68    GFKPAERQKELFAAICSGAGLKADQLRKDAKQLREHLVPHGEAEIKSWIEQQGQGAPDVL  127

Query  758   KDISERAGSKDSFRYSRFFAIGLFRLLE-LSNA--TDPTILE----KLCAALNVNKQSVD  916
             K + ++AG  D F YSR  A+GL  LL+ LS     DP  L+    +L  ++ + K  + 
Sbjct  128   KHVLQQAGRSD-FHYSRLHAVGLMGLLQDLSGGDDQDPQALQERAHQLGHSMGLQKDKLQ  186

Query  917   RDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAVTKC  1054
             +D+ +Y + L K+ QA ELL+E VA E++KR +R+ + ++ A  + 
Sbjct  187   KDMGLYASNLEKMSQAVELLEETVAAERRKREQRQGEPASAATGQV  232



>ref|WP_026722507.1| inositol phosphatase [Fischerella sp. PCC 9431]
Length=202

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 117/197 (59%), Gaps = 23/197 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     + Y+P+FALG VT +DR M GY  E +KE+IF A ++++  +P+ Y+ 
Sbjct  1     MVEMHLLAVNIDFSYNPIFALGVVTCFDRFMLGYQPESEKESIFNALLRSIEADPQIYKQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS------REGEVESILKDISERAGSKDSFRYSRFFAIGL  826
             DAQ+L+E A+      L+   S      R+ +++S L+ I     S   F+YSR FAIGL
Sbjct  61    DAQRLQEIAKNLPPQDLIAALSQQTEFNRDADLQSHLQAI----ASNPKFKYSRLFAIGL  116

Query  827   FRLLELSNATDPTI----------LEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             F LLELS   DP +          L+ +   L+++ + +++DL++YR+ L K+ QA  ++
Sbjct  117   FSLLELS---DPELVKDEKQRTEALKSIANGLHLSDEKLNKDLELYRSNLDKMTQALVVM  173

Query  977   KEYVAREKKKRGERESQ  1027
              + ++ ++KKR +R  Q
Sbjct  174   ADMLSADRKKREQRSQQ  190



>ref|WP_019487189.1| MULTISPECIES: inositol phosphatase [Kamptonema]
Length=204

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 118/194 (61%), Gaps = 23/194 (12%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL+     ++Y+P++ALG VT ++R M+GY  E+DK +IF    +AL ++P++Y+ 
Sbjct  1     MVEMHLLSVNVDFRYNPIYALGVVTAFERFMQGYLPEQDKVSIFNGLCQALGDDPQRYQQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSS---------REGEVESILKDISERAGSKDSFRYSRFFA  817
             DA++LE  A      S++D  S           G++++ +  I+    +   F+YSR FA
Sbjct  61    DARRLEGLASRV---SILDLLSWLEGSTSFEDTGDLQASITAIA----TNSKFKYSRLFA  113

Query  818   IGLFRLLELSN---ATDP----TILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELL  976
             IGLF LLE+ +     DP      + K+CAAL++ ++ V +DLD+YR+ L K+ QA+ +L
Sbjct  114   IGLFALLEIVDPDLVKDPEARVQAIAKVCAALHLPEEKVTKDLDLYRSNLEKIAQARIVL  173

Query  977   KEYVAREKKKRGER  1018
              + +  ++KKR +R
Sbjct  174   ADVLQADRKKREKR  187



>ref|WP_016877846.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=202

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 121/199 (61%), Gaps = 15/199 (8%)
 Frame = +2

Query  485   IVQQHLMRYKKSYQYDPVFALGFVTVYDRLMEGYPTEEDKEAIFRAYIKALNEEPEQYRA  664
             +V+ HL++    ++Y+P++ALG VT +DR M+GY  E DKE+IF A ++A+  +P+ Y+ 
Sbjct  1     MVEMHLLQVNVDFRYNPIYALGVVTSFDRFMQGYQPELDKESIFNALLRAVEADPQIYKQ  60

Query  665   DAQKLEEWARAQDGNSLVDFSSREGEVESILKDI----SERAGSKDS-FRYSRFFAIGLF  829
             DAQ+L+  A +     L+ + S++ +++   +D+    S +A + D+ F+YSR FAIGLF
Sbjct  61    DAQRLQNLATSLPTQDLIAWLSQQNQLD---RDVDFQASLQAIANDANFKYSRLFAIGLF  117

Query  830   RLLELS-------NATDPTILEKLCAALNVNKQSVDRDLDVYRNLLSKLVQAKELLKEYV  988
              LLELS              ++ + A L+++   +++DL++Y + L K+ QA  ++ + +
Sbjct  118   SLLELSEKEMVKDEKKRTEAIKTIAAGLHLSDDKLNKDLELYLSNLDKMTQALVVMADLL  177

Query  989   AREKKKRGERESQKSNEAV  1045
             + ++KKR +R  Q    A 
Sbjct  178   SADRKKREQRTQQSGTTAT  196



>ref|WP_017292756.1| hypothetical protein [Geminocystis herdmanii]
Length=222

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 119/213 (56%), Gaps = 11/213 (5%)
 Frame = +2

Query  401   TVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRLME  580
             TVS+TK NF + + RPI S+Y  V++EL+V+ HL+     ++ DP++ LG    + + M 
Sbjct  6     TVSDTKRNFYQHHNRPINSIYRRVVEELMVEMHLLSVNVDFRSDPIYYLGVCQSFTQFMN  65

Query  581   GYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDF---SSREGEVES  751
             GY  E DKE+IFRA  +++N  P++YR  +  L  +A  +    L+++    + +  +E+
Sbjct  66    GYMPESDKESIFRALCQSINNNPDEYRQKSDSLLNFATQKSPQELINWLLHPTNDNGLEA  125

Query  752   ILKDISERAGSKDSFRYSRFFAIGLFRLLELSNATD-------PTILEKLCAALNVNKQS  910
             +  D    A     F+YSR FAIG + LLE S+A           +++ L   LN+    
Sbjct  126   V-ADHWRYALDNPKFKYSRLFAIGFYTLLEKSDAEIVKNEEKFAELIKPLTDKLNLPIDK  184

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKR  1009
             + +DL++YR+ + K+ Q   +L + +   KKKR
Sbjct  185   LKKDLELYRSNIEKMSQMLIVLADTLEASKKKR  217



>ref|WP_038026633.1| hypothetical protein, partial [Synechococcus sp. PCC 7336]
Length=227

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 119/215 (55%), Gaps = 8/215 (4%)
 Frame = +2

Query  395   VPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDRL  574
             V TV+ TKT F + Y+RPI S+Y + ++E + + HL+    S+ Y+P FALG   V+++ 
Sbjct  4     VRTVAATKTAFQQGYQRPINSIYRSFVEEFLTELHLVTVNSSFSYNPFFALGMTKVFEQF  63

Query  575   MEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEVESI  754
              +GY  E + + IF A  ++L  +P   R DA KL E   + D +  V     +  VE I
Sbjct  64    TQGYTPEAEPDKIFDALCQSLQLKPSVIRHDAAKLLELLESSDSDRAVSVLQLQAGVEDI  123

Query  755   --LKDISERAGSKDSFRYSRFFAIGLFRLLE-----LSNATDPT-ILEKLCAALNVNKQS  910
               +  I E+    + F YSR F +GL+   E     L +    T +   L   LN++K+ 
Sbjct  124   GGIAGILEKIRDDEKFHYSRTFLLGLYIAFETVAGHLGDRDRRTELFVDLTQTLNLSKER  183

Query  911   VDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGE  1015
             V++DLD+YR+ +SKL QA+ L+++     ++++ +
Sbjct  184   VEKDLDLYRSNISKLEQAQALMRDLAEAARRQKTQ  218



>ref|WP_007304401.1| inositol monophosphatase [Crocosphaera watsonii]
 gb|EAM51763.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
 emb|CCQ60588.1| hypothetical protein CWATWH0401_4059 [Crocosphaera watsonii WH 
0401]
 emb|CCQ48811.1| FIG00562041: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ70333.1| hypothetical protein CWATWH0402_2206 [Crocosphaera watsonii WH 
0402]
Length=245

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 126/231 (55%), Gaps = 16/231 (7%)
 Frame = +2

Query  392   DVPTVSETKTNFLRAYKRPIPSVYSTVLQELIVQQHLMRYKKSYQYDPVFALGFVTVYDR  571
             ++ TVS+TK  F   + +PI S+Y   ++EL+V+ HL+     + YDP++ALG VT + R
Sbjct  3     NIRTVSDTKRKFYGYHTQPINSIYRRFVEELLVEMHLLSVNIDFSYDPIYALGVVTSFQR  62

Query  572   LMEGYPTEEDKEAIFRAYIKALNEEPEQYRADAQKLEEWARAQDGNSLVDFSSREGEV--  745
              M+GY  E DK +IF A  +A++   E+Y  +A+ +   A+   G S+VDF  +   V  
Sbjct  63    FMQGYSPESDKPSIFNALCQAVDGSSEKYHQEAEAILNEAK---GLSIVDFKDKLTHVTD  119

Query  746   ----ESILKDISERAGSKDSFRYSRFFAIGLFRLLE------LSNATDPT-ILEKLCAAL  892
                 E +L        +   F+YSR  AIGL+ LL       L +    T  ++++  AL
Sbjct  120   NQVGEGVLWGTFGAIAANPKFKYSRLLAIGLYTLLMEIDSDLLKDEEKRTETIKEVSEAL  179

Query  893   NVNKQSVDRDLDVYRNLLSKLVQAKELLKEYVAREKKKRGERESQKSNEAV  1045
               + + + +DLD+YR+ L K+ Q   ++++ +  ++KKR   E + S E V
Sbjct  180   KFSPEKLRKDLDLYRSNLDKMQQLLTVIEDSLEADRKKRASTEGKTSAEVV  230



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3723430368294