BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78133_g1_i1 len=1298 path=[1300:0-1297]

Length=1298
                                                                      Score     E

ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 569   0.0      
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 562   0.0      
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            550   0.0      
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 548   0.0      
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       530   0.0      
emb|CDX73424.1|  BnaC08g25790D                                          528   0.0      
emb|CDY56961.1|  BnaA09g55030D                                          526   0.0      
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    525   0.0      
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             523   0.0      
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 523   0.0      
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                519   7e-180   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             517   5e-179   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             515   2e-178   
emb|CDO99795.1|  unnamed protein product                                514   2e-177   
gb|AEQ54770.1|  cysteine proteinase CP1                                 513   3e-177   
ref|NP_567010.5|  Papain family cysteine protease                       509   3e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             509   4e-176   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             508   3e-175   
ref|XP_010103534.1|  putative cysteine proteinase A494                  507   3e-175   
ref|NP_001236888.1|  cysteine proteinase precursor                      507   5e-175   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 506   6e-175   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 506   9e-175   
ref|XP_002533377.1|  cysteine protease, putative                        502   4e-173   Ricinus communis
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             499   1e-172   Populus trichocarpa [western balsam poplar]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 500   2e-172   
ref|XP_007010012.1|  Papain family cysteine protease                    499   5e-172   
emb|CAB41090.1|  cysteine proteinase precursor-like protein             498   8e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 499   8e-172   Vitis vinifera
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 498   1e-171   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 498   1e-171   
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            497   2e-171   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 493   6e-170   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 493   2e-169   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   491   4e-169   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     489   6e-169   Vitis vinifera
gb|KEH43476.1|  papain family cysteine protease                         491   9e-169   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         491   1e-168   
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       489   4e-168   
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            489   5e-168   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            490   6e-168   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            490   7e-168   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       488   9e-168   
ref|XP_004307346.1|  PREDICTED: cysteine proteinase 15A-like            486   9e-167   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           481   7e-165   Glycine max [soybeans]
gb|EPS63354.1|  hypothetical protein M569_11429                         479   2e-164   
emb|CAB16316.1|  cysteine proteinase precursor                          479   4e-164   Vicia sativa [spring vetch]
emb|CAB17077.1|  cysteine proteinase precursor                          478   2e-163   Phaseolus vulgaris [French bean]
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             479   3e-163   
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 468   5e-160   
gb|ADE76932.1|  unknown                                                 458   2e-155   
ref|XP_001761980.1|  predicted protein                                  441   2e-149   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          439   6e-149   
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              436   3e-147   
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             433   7e-147   
gb|KHG08355.1|  Cysteinease 1                                           433   3e-146   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          432   1e-145   Sorghum bicolor [broomcorn]
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   428   3e-144   
emb|CAQ00102.1|  papain-like cysteine proteinase                        428   4e-144   Hordeum vulgare subsp. vulgare [barley]
dbj|BAF46302.1|  cysteine proteinase precursor                          428   4e-144   Ipomoea nil [qian niu]
ref|NP_001059639.1|  Os07g0480900                                       427   2e-143   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD10859.1|  cysteine protease                                      425   5e-143   Tripolium pannonicum [sea starwort]
gb|ABK24688.1|  unknown                                                 425   6e-143   Picea sitchensis
gb|ABK21238.1|  unknown                                                 425   6e-143   Picea sitchensis
ref|XP_001781954.1|  predicted protein                                  424   9e-143   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         422   9e-142   
gb|ACN40679.1|  unknown                                                 421   1e-141   Picea sitchensis
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          420   4e-141   
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          418   3e-140   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              418   4e-140   
gb|AAB67878.1|  pre-pro-cysteine proteinase                             417   7e-140   Vicia faba [broad bean]
ref|XP_010105270.1|  Cysteine proteinase 15A                            417   8e-140   
gb|AAO11786.1|  pre-pro cysteine proteinase                             416   9e-140   Vicia faba [broad bean]
ref|XP_003589348.1|  Cysteine proteinase                                417   9e-140   
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             416   2e-139   
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    416   2e-139   Pisum sativum [garden pea]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          415   4e-139   
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 414   8e-139   
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            414   1e-138   
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 414   1e-138   Solanum melongena [aubergine]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            414   1e-138   
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                414   2e-138   
gb|EPS70818.1|  cysteine proteinase                                     413   2e-138   
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          414   2e-138   
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 412   3e-138   Sandersonia aurantiaca [Chinese-lantern lily]
emb|CAA82995.1|  cysteine proteinase                                    412   4e-138   Vicia sativa [spring vetch]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 412   6e-138   
dbj|BAG16515.1|  putative cysteine proteinase                           412   7e-138   Capsicum chinense [bonnet pepper]
ref|XP_002510469.1|  cysteine protease, putative                        411   1e-137   Ricinus communis
gb|ACX54787.2|  cysteine protease                                       411   1e-137   
gb|AAQ81938.1|  cysteine proteinase precursor                           411   2e-137   Ipomoea batatas [batate]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                411   2e-137   
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            410   3e-137   
gb|ABF46642.1|  papain-like cysteine proteinase                         410   4e-137   Pachysandra terminalis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                410   4e-137   
ref|XP_004290288.1|  PREDICTED: cysteine proteinase RD19a-like          410   4e-137   
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            409   8e-137   
dbj|BAJ53178.1|  JHL18I08.12                                            409   8e-137   
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         409   9e-137   
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            409   1e-136   
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              409   2e-136   
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             408   2e-136   Populus trichocarpa [western balsam poplar]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         408   3e-136   
ref|XP_007017672.1|  Papain family cysteine protease                    409   3e-136   
gb|EEC82027.1|  hypothetical protein OsI_25996                          419   3e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     406   8e-136   
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              407   9e-136   
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              406   1e-135   
gb|AIB06025.1|  CP3                                                     406   2e-135   
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          406   2e-135   Sorghum bicolor [broomcorn]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               405   2e-135   
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          405   3e-135   
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              405   3e-135   
ref|NP_001046828.1|  Os02g0469600                                       405   3e-135   Oryza sativa Japonica Group [Japonica rice]
gb|KHN00877.1|  Cysteine proteinase 15A                                 404   3e-135   
gb|ABK96580.1|  unknown                                                 405   4e-135   Populus trichocarpa x Populus deltoides
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          405   4e-135   
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             404   5e-135   
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          405   5e-135   
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               404   6e-135   
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    405   7e-135   
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              404   8e-135   
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          404   1e-134   
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    404   1e-134   Ipomoea batatas [batate]
gb|ABK94801.1|  unknown                                                 403   1e-134   Populus trichocarpa [western balsam poplar]
emb|CDP07452.1|  unnamed protein product                                404   2e-134   
ref|XP_007042077.1|  Papain family cysteine protease                    404   2e-134   
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          403   2e-134   
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            403   2e-134   
ref|XP_002512963.1|  cysteine protease, putative                        403   2e-134   Ricinus communis
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            402   3e-134   
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          403   3e-134   
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   403   3e-134   
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 403   4e-134   
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          402   4e-134   
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               402   4e-134   
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     402   4e-134   Ipomoea batatas [batate]
gb|AAZ32411.1|  cysteine proteinase glycinain type                      402   4e-134   Nicotiana benthamiana
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   402   5e-134   
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          402   5e-134   
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             402   5e-134   
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     402   5e-134   Ipomoea batatas [batate]
gb|AIB06024.1|  CP2                                                     402   5e-134   
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            402   6e-134   
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 402   6e-134   
emb|CAA78403.1|  pre-pro-cysteine proteinase                            401   9e-134   Solanum lycopersicum
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              402   9e-134   
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             401   9e-134   
gb|EMT16425.1|  Cysteine proteinase 1                                   402   9e-134   
gb|KHG15253.1|  Cysteinease RD19a -like protein                         401   1e-133   
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              401   2e-133   
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    400   2e-133   Ipomoea batatas [batate]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              400   2e-133   
gb|AAK07731.1|  CPR2-like cysteine proteinase                           400   2e-133   Nicotiana tabacum [American tobacco]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              401   3e-133   
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            400   4e-133   
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 400   4e-133   Populus trichocarpa [western balsam poplar]
emb|CAE54306.1|  putative papain-like cysteine proteinase               400   5e-133   Gossypium hirsutum [American cotton]
dbj|BAF03553.1|  cysteine proteinase CP2                                399   5e-133   Phaseolus vulgaris [French bean]
emb|CBI31400.3|  unnamed protein product                                395   7e-133   
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          399   7e-133   
emb|CAB17075.1|  cysteine proteinase precursor                          398   1e-132   Phaseolus vulgaris [French bean]
gb|ABK24153.1|  unknown                                                 399   1e-132   Picea sitchensis
emb|CDP20652.1|  unnamed protein product                                399   1e-132   
ref|NP_001267989.1|  cysteine protease precursor                        399   2e-132   
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               398   2e-132   
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             398   2e-132   
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               397   3e-132   Vitis vinifera
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    397   3e-132   Ipomoea batatas [batate]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    397   3e-132   Zea mays [maize]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       397   3e-132   
gb|ACF86683.1|  unknown                                                 397   3e-132   Zea mays [maize]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          397   3e-132   
dbj|BAF98584.1|  CM0216.500.nc                                          397   5e-132   Lotus japonicus
ref|XP_003606998.1|  Cysteine proteinase                                397   5e-132   
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            397   6e-132   
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     397   7e-132   
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             397   7e-132   
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    396   8e-132   Nicotiana tabacum [American tobacco]
dbj|BAA92495.1|  cysteine protease                                      396   8e-132   Vigna mungo [urad dal]
gb|ACI04578.1|  cysteine protease-like protein                          395   8e-132   Robinia pseudoacacia [black locust]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             396   9e-132   
gb|AJA74415.1|  cysteine protease                                       396   1e-131   
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       396   1e-131   
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             395   1e-131   
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 396   1e-131   Vitis vinifera
ref|NP_565512.1|  Papain family cysteine protease                       395   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          395   2e-131   
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          395   2e-131   
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               395   2e-131   
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 395   3e-131   Vitis vinifera
gb|ABQ10201.1|  cysteine protease Cp3                                   395   4e-131   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              395   4e-131   
gb|ACM80348.1|  cysteine proteinase                                     394   5e-131   Solanum lycopersicum
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    394   5e-131   
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            394   7e-131   
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              395   7e-131   
gb|KHN22211.1|  Cysteine proteinase 15A                                 394   1e-130   
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               393   1e-130   Vitis vinifera
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            393   1e-130   
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         393   2e-130   Lotus japonicus
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       393   2e-130   
gb|AAK27969.1|AF242373_1  cysteine protease                             393   2e-130   Ipomoea batatas [batate]
dbj|BAD43619.1|  putative cysteine proteinase                           393   2e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15894.1|  BnaA04g12170D                                          393   2e-130   
gb|KHN45894.1|  Cysteine proteinase RD19a                               393   2e-130   
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             393   2e-130   Populus trichocarpa [western balsam poplar]
emb|CDY34441.1|  BnaC01g21920D                                          392   3e-130   
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             392   3e-130   
dbj|BAF98585.1|  CM0216.510.nc                                          392   4e-130   Lotus japonicus
gb|EPS65881.1|  cysteine proteinase                                     391   4e-130   
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         391   5e-130   Lotus japonicus
emb|CAQ00101.1|  papain-like cysteine proteinase                        392   6e-130   Hordeum vulgare subsp. vulgare [barley]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            392   8e-130   
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          391   1e-129   
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             390   1e-129   
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               390   1e-129   
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          390   2e-129   
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 390   2e-129   Populus trichocarpa [western balsam poplar]
gb|EMT10192.1|  Cysteine proteinase 1                                   390   3e-129   
gb|ABK92536.1|  unknown                                                 390   3e-129   Populus trichocarpa [western balsam poplar]
gb|AAX19661.1|  cysteine proteinase                                     390   4e-129   Populus tomentosa [Chinese white poplar]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               389   4e-129   
gb|ACK57563.1|  cysteine protease-like protein                          389   5e-129   Arachis hypogaea [goober]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    389   5e-129   Nicotiana tabacum [American tobacco]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               389   5e-129   
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       389   5e-129   Brassica oleracea
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               389   5e-129   
emb|CAA52403.1|  putative thiol protease                                387   7e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            389   8e-129   
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          389   9e-129   
gb|KHN25410.1|  Cysteine proteinase RD19a                               389   1e-128   
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          389   1e-128   
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            388   1e-128   
emb|CDY41960.1|  BnaA01g05320D                                          388   1e-128   
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          389   1e-128   
emb|CAD40319.2|  OSJNBb0054B09.3                                        389   1e-128   Oryza sativa Japonica Group [Japonica rice]
ref|NP_568052.1|  cysteine proteinase RD19a                             387   2e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KHN39817.1|  Cysteine proteinase RD19a                               385   4e-128   
gb|KHG24064.1|  Cysteinease RD19a -like protein                         387   5e-128   
gb|AAW21813.1|  cysteine protease                                       387   5e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          386   6e-128   
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             386   7e-128   
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          386   8e-128   
emb|CDY71205.1|  BnaCnng71840D                                          386   1e-127   
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               385   1e-127   
gb|AAM65162.1|  cysteine proteinase RD19A                               385   1e-127   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99593.1|  BnaC04g33500D                                          384   2e-127   
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             384   8e-127   
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             381   6e-126   
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  380   1e-125   
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             380   2e-125   
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              379   3e-125   
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          380   2e-124   
gb|EMS53996.1|  Cysteine proteinase 1                                   379   3e-124   
gb|AAR92156.1|  putative cysteine protease 3                            374   3e-124   Iris x hollandica [Dutch iris]
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               379   3e-124   
dbj|BAC41322.1|  hypothetical protein                                   375   9e-124   Lotus japonicus
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          378   2e-123   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          375   3e-123   
emb|CDY09707.1|  BnaC07g33540D                                          374   8e-123   
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          373   1e-122   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               373   2e-122   
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             372   5e-122   
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          371   5e-122   
emb|CDX90537.1|  BnaA03g42440D                                          370   1e-121   
gb|KHN37802.1|  Cysteine proteinase 1                                   369   2e-121   
gb|AAB16996.1|  thiol protease isoform B                                365   3e-120   Glycine max [soybeans]
ref|NP_567489.1|  papain family cysteine protease                       365   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          360   4e-119   
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    358   7e-117   
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          350   1e-115   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               356   1e-115   
gb|EEE60725.1|  hypothetical protein OsJ_14236                          354   2e-115   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93546.1|  hypothetical protein OsI_15336                          353   4e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       353   5e-115   
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            349   1e-114   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    345   3e-112   
gb|AAU81589.1|  cysteine proteinase                                     331   6e-108   Petunia x hybrida [garden petunia]
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)              328   3e-106   
emb|CAH59428.1|  cysteine protease 2                                    323   4e-105   
gb|EEE67161.1|  hypothetical protein OsJ_24244                          324   2e-104   
ref|XP_007510080.1|  unknown                                            328   2e-103   
ref|XP_003057227.1|  predicted protein                                  312   2e-99    
ref|NP_001052440.1|  Os04g0311400                                       310   5e-98    
ref|XP_001419933.1|  predicted protein                                  306   6e-98    
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056             303   8e-96    
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661              302   3e-95    
emb|CAB53397.1|  cysteine protease                                      292   3e-93    
gb|AES89347.2|  papain family cysteine protease                         295   1e-92    
ref|XP_003607150.1|  Cysteine proteinase                                295   1e-92    
gb|KEH30505.1|  papain family cysteine protease                         294   2e-92    
ref|XP_002681317.1|  cysteine protease                                  294   5e-92    
ref|XP_003607110.1|  Cysteine proteinase                                291   4e-91    
emb|CDY13816.1|  BnaA09g43180D                                          287   2e-90    
ref|XP_002672864.1|  predicted protein                                  288   9e-90    
ref|XP_002505924.1|  cysteine endopeptidase                             286   1e-89    
gb|AAB16997.1|  thiol protease isoform A                                286   1e-89    
gb|KDO84721.1|  hypothetical protein CISIN_1g017548mg                   284   7e-89    
ref|XP_635417.1|  cysteine proteinase 1                                 284   2e-88    
emb|CAA26255.1|  cysteine proteinase I precursor                        284   3e-88    
ref|XP_007160703.1|  hypothetical protein PHAVU_001G009900g             281   7e-88    
gb|AAB01769.1|  cysteine proteinase homolog                             282   1e-87    
gb|AFM37363.1|  cathepsin F1                                            283   2e-86    
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660               277   9e-86    
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...    281   1e-85    
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                        278   2e-84    
ref|XP_002674919.1|  predicted protein                                  274   2e-84    
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...    277   3e-84    
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                        275   6e-84    
ref|XP_002734978.1|  PREDICTED: cathepsin F-like                        271   3e-83    
gb|AAM44058.1|AF510740_1  cathepsin L1                                  268   1e-82    
gb|AAW25775.1|  SJCHGC00511 protein                                     271   4e-82    
ref|XP_635374.1|  cysteine protease                                     268   4e-82    
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein            271   4e-82    
ref|NP_505215.2|  Protein TAG-196                                       272   4e-82    
dbj|GAM25572.1|  hypothetical protein SAMD00019534_087470               268   5e-82    
ref|XP_003115597.1|  CRE-TAG-196 protein                                271   1e-81    
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752              266   1e-81    
emb|CAX69889.1|  Temporarily Assigned Gene name                         270   1e-81    
sp|Q26534.1|CATL_SCHMA  RecName: Full=Cathepsin L; AltName: Full=...    266   2e-81    
emb|CBY11269.1|  unnamed protein product                                267   2e-81    
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708       280   2e-81    
gb|EGI66903.1|  Putative cysteine proteinase                            278   2e-81    
gb|AFQ01139.1|  cathepsin F-like protease                               271   3e-81    
gb|KGB33519.1|  Cathepsin L                                             265   3e-81    
emb|CCD77197.1|  cathepsin F (C01 family)                               267   8e-81    
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    278   1e-80    
gb|ERL92611.1|  hypothetical protein D910_09924                         268   1e-80    
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                      268   1e-80    
ref|NP_001106423.1|  cathepsin F precursor                              268   1e-80    
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                      268   1e-80    
gb|KFM67613.1|  putative cysteine proteinase                            266   3e-80    
gb|EKC42097.1|  Cathepsin F                                             273   4e-80    
emb|CCD77199.1|  cathepsin F (C01 family)                               266   4e-80    
emb|CCD77198.1|  cathepsin F (C01 family)                               266   5e-80    
emb|CBY31096.1|  unnamed protein product                                263   6e-80    
dbj|GAM21447.1|  hypothetical protein SAMD00019534_046220               261   8e-80    
gb|AAY81947.1|  cysteine protease 9                                     260   2e-79    
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896    276   2e-79    
gb|EFN80374.1|  Putative cysteine proteinase CG12163                    276   2e-79    
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                        265   3e-79    
gb|ELK24293.1|  Cathepsin F                                             263   3e-79    
gb|AAY81944.1|  cysteine protease 6                                     259   4e-79    
ref|XP_008577225.1|  PREDICTED: cathepsin F                             266   4e-79    
gb|ACN10907.1|  Cathepsin F precursor                                   264   5e-79    
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956             258   6e-79    
gb|AAY81946.1|  cysteine protease 8                                     259   8e-79    
ref|XP_001634814.1|  predicted protein                                  257   9e-79    
gb|KDR17524.1|  Putative cysteine proteinase                            277   1e-78    
ref|XP_002117255.1|  hypothetical protein TRIADDRAFT_61245              259   1e-78    
ref|NP_001133678.1|  Cathepsin F precursor                              263   2e-78    
gb|AII16490.1|  cathepsin F                                             257   2e-78    
ref|XP_006771750.1|  PREDICTED: cathepsin F                             261   2e-78    
ref|XP_002427787.1|  Cathepsin F precursor, putative                    261   2e-78    
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                    262   2e-78    
gb|EMS59778.1|  Cysteine proteinase 15A                                 253   2e-78    
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620    271   2e-78    
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...    262   3e-78    
gb|ABA01328.1|  secreted cathepsin F                                    258   4e-78    
gb|ABC48936.1|  cathepsin F like protease                               261   4e-78    
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163    269   4e-78    
ref|XP_004351999.1|  cysteine protease                                  258   5e-78    
gb|AAW28151.1|  westerpain-1                                            256   6e-78    
ref|XP_003774144.1|  PREDICTED: cathepsin F                             260   8e-78    
ref|XP_006129733.1|  PREDICTED: cathepsin F-like                        257   9e-78    
ref|XP_006101673.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        261   1e-77    
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163    267   2e-77    
gb|AAW28152.1|  westerpain-10                                           255   2e-77    
emb|CDQ79130.1|  unnamed protein product                                260   2e-77    
gb|AAY81942.1|  cysteine protease 3                                     254   3e-77    
ref|XP_010896687.1|  PREDICTED: cathepsin F                             259   3e-77    
ref|XP_003378245.1|  cathepsin F                                        256   3e-77    
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...    262   4e-77    
gb|ELK13294.1|  Cathepsin F                                             258   4e-77    
ref|XP_008145119.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        259   6e-77    
ref|XP_006911111.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        259   7e-77    
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                    261   8e-77    
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                    261   9e-77    
gb|EFN65613.1|  Putative cysteine proteinase CG12163                    267   1e-76    
ref|XP_006782128.1|  PREDICTED: cathepsin F-like                        257   1e-76    
gb|EFA83712.1|  cysteine proteinase 1                                   258   1e-76    
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287    268   2e-76    
ref|XP_791714.3|  PREDICTED: putative cysteine proteinase CG12163...    256   2e-76    
ref|XP_005305555.1|  PREDICTED: cathepsin F                             253   2e-76    
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...    264   2e-76    
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...    263   3e-76    
ref|XP_004563245.1|  PREDICTED: cathepsin F-like                        256   4e-76    
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...    264   4e-76    
gb|ENN81374.1|  hypothetical protein YQE_02191                          270   4e-76    
ref|XP_007502727.1|  PREDICTED: cathepsin F                             256   4e-76    
gb|AEQ94152.1|  drought-inducible cysteine proteinase                   249   5e-76    
gb|AAY81948.1|  cysteine protease 11                                    251   6e-76    
gb|AAY81943.1|  cysteine protease 5                                     251   7e-76    
ref|XP_003451852.1|  PREDICTED: cathepsin F-like                        256   7e-76    
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649    266   9e-76    
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              246   1e-75    
ref|XP_010765827.1|  PREDICTED: cathepsin W                             257   1e-75    
ref|XP_005157210.1|  PREDICTED: cathepsin F isoform X1                  254   3e-75    
ref|XP_001029851.1|  Papain family cysteine protease containing p...    249   3e-75    
ref|XP_008479908.1|  PREDICTED: putative cysteine proteinase CG12163    249   4e-75    
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                        250   4e-75    
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor                268   7e-75    
ref|XP_005699987.1|  PREDICTED: cathepsin F isoform X2                  249   8e-75    
dbj|BAF94154.1|  cathepsin F-like cysteine protease                     260   8e-75    
ref|XP_006044419.1|  PREDICTED: cathepsin F isoform X2                  253   8e-75    
ref|XP_005699986.1|  PREDICTED: cathepsin F isoform X1                  249   9e-75    
gb|ACN56478.1|  cathepsin F                                             253   1e-74    
emb|CEF63690.1|  Cathepsin F                                            249   1e-74    
ref|XP_005968922.1|  PREDICTED: cathepsin F                             250   1e-74    
ref|XP_006044418.1|  PREDICTED: cathepsin F isoform X1                  252   1e-74    
gb|AAI65744.1|  Ctsf protein                                            252   2e-74    
ref|XP_004073613.1|  PREDICTED: cathepsin F-like                        252   2e-74    
gb|ACC86111.1|  cathepsin F                                             252   2e-74    
ref|NP_001071036.1|  cathepsin F precursor                              252   2e-74    
gb|AAR27011.1|  cysteine protease                                       246   2e-74    
ref|NP_649521.1|  CG12163, isoform B                                    252   3e-74    
ref|XP_007246457.1|  PREDICTED: cathepsin F-like                        251   3e-74    
ref|XP_008280429.1|  PREDICTED: cathepsin W isoform X1                  251   3e-74    
ref|XP_005101893.1|  PREDICTED: cathepsin F-like isoform X1             252   3e-74    
ref|XP_005101894.1|  PREDICTED: cathepsin F-like isoform X2             252   4e-74    
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                       249   4e-74    
ref|XP_003375070.1|  viral cathepsin                                    251   5e-74    
ref|XP_003436276.1|  AGAP002879-PC                                      260   5e-74    
ref|XP_005654721.1|  PREDICTED: cathepsin F-like isoform X2             250   6e-74    
ref|XP_003736743.1|  GA27408, isoform B                                 251   6e-74    
ref|XP_008271777.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        251   8e-74    
ref|XP_008280430.1|  PREDICTED: cathepsin W isoform X2                  250   8e-74    
ref|NP_001068884.1|  cathepsin F precursor                              250   9e-74    
gb|AAY81945.1|  cysteine protease 7                                     246   1e-73    
ref|XP_003122543.2|  PREDICTED: cathepsin F isoform X1                  251   1e-73    
ref|XP_004019753.1|  PREDICTED: cathepsin F isoform 1                   249   1e-73    
emb|CDP90584.1|  Protein BM-TAG-196                                     249   1e-73    
ref|XP_010754224.1|  PREDICTED: cathepsin F                             250   1e-73    
ref|XP_005903598.1|  PREDICTED: cathepsin F isoform X1                  250   1e-73    
ref|XP_002056575.1|  GJ11017                                            253   2e-73    
ref|XP_002096026.1|  GE25302                                            253   2e-73    
ref|XP_004019754.1|  PREDICTED: cathepsin F isoform 2                   249   2e-73    
ref|XP_001978897.1|  GG11133                                            253   2e-73    
ref|XP_004383745.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        249   2e-73    
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288             241   3e-73    
ref|XP_002000409.1|  GI10216                                            252   3e-73    
ref|XP_004596891.1|  PREDICTED: cathepsin F                             248   3e-73    
ref|XP_003436277.1|  AGAP002879-PB                                      262   3e-73    
ref|XP_312034.5|  AGAP002879-PA                                         262   3e-73    
ref|XP_002038380.1|  GM10654                                            252   4e-73    
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                    248   5e-73    
gb|AAH04054.2|  Ctsf protein                                            244   6e-73    
gb|AIC36736.1|  cathepsin F                                             248   6e-73    
ref|XP_002017233.1|  GL22196                                            252   6e-73    
ref|NP_730901.1|  CG12163, isoform A                                    252   6e-73    
ref|XP_001994049.1|  GH22731                                            252   6e-73    
gb|AAU81591.1|  cysteine proteinase                                     239   7e-73    
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        248   8e-73    
ref|XP_004463677.1|  PREDICTED: cathepsin F                             242   1e-72    
ref|XP_002137768.1|  GA27408, isoform A                                 251   1e-72    
ref|XP_007171073.1|  PREDICTED: cathepsin F isoform X1                  243   2e-72    
ref|XP_006044420.1|  PREDICTED: cathepsin F isoform X3                  246   2e-72    
ref|XP_005598385.1|  PREDICTED: cathepsin F                             244   3e-72    
gb|AAC78839.1|  cathepsin F                                             241   4e-72    
pdb|4PI3|A  Chain A, Crystal Structure Analysis Of Cruzain Bound ...    241   4e-72    
ref|XP_006179549.1|  PREDICTED: cathepsin F                             242   5e-72    
ref|XP_010597319.1|  PREDICTED: cathepsin F                             245   5e-72    
gb|AAC78838.1|  cathepsin F                                             241   6e-72    
ref|XP_004336939.1|  Cysteine proteinase 5, putative                    241   6e-72    
ref|NP_001029282.1|  cathepsin F precursor                              245   6e-72    
ref|XP_003142769.1|  ctsf protein                                       244   7e-72    
ref|XP_002927853.1|  PREDICTED: cathepsin F-like                        243   8e-72    
ref|XP_002073772.1|  GK14287                                            249   8e-72    
gb|EZA58965.1|  Putative cysteine proteinase                            253   1e-71    
ref|XP_007115106.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        245   1e-71    
emb|CAB42884.1|  cathepsin F                                            244   1e-71    
ref|XP_005333611.1|  PREDICTED: cathepsin F                             243   1e-71    
dbj|BAN20819.1|  cysteine-type endopeptidase                            251   1e-71    
ref|NP_063914.1|  cathepsin F precursor                                 244   1e-71    
ref|XP_007942912.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        244   1e-71    
gb|EDL33073.1|  cathepsin F, isoform CRA_a                              243   2e-71    
gb|AAG28508.1|AF197480_1  cathepsin F                                   244   2e-71    
gb|EJY58173.1|  AAEL017153-PA                                           254   2e-71    
ref|XP_006210811.1|  PREDICTED: cathepsin F                             242   2e-71    
gb|EFO21301.2|  ctsf protein                                            244   2e-71    
gb|AAB93494.1|  pre-procathepsin L                                      239   2e-71    
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                       240   2e-71    
ref|XP_005227094.1|  PREDICTED: cathepsin F isoform X1                  244   2e-71    
ref|XP_008531628.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        244   2e-71    
gb|EAW74547.1|  cathepsin F, isoform CRA_a                              241   3e-71    
ref|XP_006171430.1|  PREDICTED: cathepsin F                             243   3e-71    
ref|XP_004437729.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        244   3e-71    
ref|XP_001955780.1|  GF16067                                            247   4e-71    
prf||2117247B  Cys protease:ISOTYPE=2                                   243   4e-71 
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                  237   5e-71    
ref|XP_008707386.1|  PREDICTED: cathepsin F                             241   5e-71    
ref|XP_004278023.1|  PREDICTED: cathepsin F isoform 2                   243   6e-71    
ref|XP_007461994.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        243   7e-71    
emb|CAG46481.1|  CTSF                                                   238   8e-71    
ref|XP_008048262.1|  PREDICTED: cathepsin F                             241   8e-71    
ref|XP_004618609.1|  PREDICTED: cathepsin F                             239   9e-71    
gb|AFK47617.1|  unknown                                                 235   1e-70    
ref|XP_008952375.1|  PREDICTED: cathepsin F                             239   1e-70    
gb|AAG35357.1|AF314929_1  cruzipain                                     242   1e-70    
gb|AHE15351.1|  cathepsin F                                             237   1e-70    



>ref|XP_009617441.1| PREDICTED: cysteine proteinase 15A [Nicotiana tomentosiformis]
Length=387

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 315/381 (83%), Gaps = 14/381 (4%)
 Frame = +3

Query  84    GGGLMYAQLLAVLTCAH--LAFASSAS---QGLNIRQVTDDE-IPAAG-------ENLLG  224
             G GL YA  + +LTCA   L F  +A+   +   IRQVTDD+  P           NLLG
Sbjct  6     GLGLTYALSVTILTCAFSVLPFQHAAAIIPEAFKIRQVTDDQNYPTTTASAVNHHHNLLG  65

Query  225   TATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTP  404
             TATE RFKSF+QE+ KEY T EEY++RLGVFAKNL++AAEHQ LDPTAVHGVT+FSDLT 
Sbjct  66    TATEHRFKSFIQEYSKEYTTREEYIHRLGVFAKNLLKAAEHQALDPTAVHGVTQFSDLTE  125

Query  405   NEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWA  584
              EFEKMYMGV  V GR + L  +  AP L+V GLPE+FDWR+KGAVTEVKMQG+CGSCWA
Sbjct  126   EEFEKMYMGVKGV-GRTTSLLRQGHAPPLEVKGLPESFDWREKGAVTEVKMQGTCGSCWA  184

Query  585   FSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIES  764
             FSTTG+IEGANFIATGKLLNLSEQQLVDCDHTCDIKDK ACD GCSGGLMTNAY+YLIE+
Sbjct  185   FSTTGSIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKKACDSGCSGGLMTNAYKYLIEA  244

Query  765   GGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVY  944
             GGIEEE SYPYTGK GDC+F  +KVAVKV NFTN+P DE Q+AAYLVNHGPLAVG+NAV+
Sbjct  245   GGIEEEDSYPYTGKRGDCKFNPDKVAVKVSNFTNIPIDEQQIAAYLVNHGPLAVGLNAVF  304

Query  945   MHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYF  1124
             M TY+GGVSCPLIC K+ +NHGVLLVGYG KGFSILRL  +PYWIIKNSWGK WGE GY+
Sbjct  305   MQTYIGGVSCPLICGKRWINHGVLLVGYGSKGFSILRLSNQPYWIIKNSWGKRWGEHGYY  364

Query  1125  RMCRGHGMCGISNMVSAVMTR  1187
             ++CRGHGMCG++ MVSAVMT+
Sbjct  365   KLCRGHGMCGMNTMVSAVMTQ  385



>ref|XP_009789260.1| PREDICTED: cysteine proteinase 15A [Nicotiana sylvestris]
Length=388

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 318/384 (83%), Gaps = 17/384 (4%)
 Frame = +3

Query  84    GGGL--MYAQLLAVLTCAH--LAFASSAS---QGLNIRQV-TDDE-IPAAG-------EN  215
             GGGL   YA  + +LTCA   L+F  +A+   +   IRQV TDD+  P           N
Sbjct  4     GGGLSLTYALSVTILTCAFFLLSFQHAAAIIPEDFKIRQVITDDQNYPTTTASAVNHQHN  63

Query  216   LLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSD  395
             LLGTATE +FKSF+QE+ KEY T EEY++RLGVFA+NL++AAEHQ LDPTAVHGVT+FSD
Sbjct  64    LLGTATEHKFKSFIQEYSKEYTTREEYIHRLGVFARNLLKAAEHQALDPTAVHGVTQFSD  123

Query  396   LTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGS  575
             LT  EFE+MYMGV KV  RA+ L G+  AP L+V GLPE+FDWR+KGAVTEVKMQG+CGS
Sbjct  124   LTEEEFERMYMGV-KVVDRATSLLGQGHAPPLEVKGLPESFDWREKGAVTEVKMQGTCGS  182

Query  576   CWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYL  755
             CWAFSTTG+IEGANFIATGKLLNLSEQQLVDCDHTCDIKDK ACD GCSGGLMTNAY+YL
Sbjct  183   CWAFSTTGSIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKKACDSGCSGGLMTNAYKYL  242

Query  756   IESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGIN  935
             +E+GGIEEE SYPYTGK GDC+F  +KV VKV NFTN+P DE Q+AAYLVNHGPLAVG+N
Sbjct  243   VEAGGIEEEDSYPYTGKRGDCKFNPDKVVVKVSNFTNIPIDEQQIAAYLVNHGPLAVGLN  302

Query  936   AVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEE  1115
             AV+M TY+GGVSCPLIC K+ +NHGVLLVGYG KGFSILRL  +PYWIIKNSWGK WGE 
Sbjct  303   AVFMQTYIGGVSCPLICGKRWINHGVLLVGYGSKGFSILRLSNQPYWIIKNSWGKRWGEH  362

Query  1116  GYFRMCRGHGMCGISNMVSAVMTR  1187
             GY+++CRGHGMCG++ MVSAVMT+
Sbjct  363   GYYKLCRGHGMCGMNTMVSAVMTQ  386



>ref|XP_006361690.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=386

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/382 (69%), Positives = 313/382 (82%), Gaps = 15/382 (4%)
 Frame = +3

Query  84    GGGLMYAQLLAVLTCA-------HLAFASSASQGLNIRQVTDDEIPA------AGENLLG  224
             GGGL YA  + +LTCA       H + A++  +   IRQVTDD+ P       +  +LLG
Sbjct  4     GGGLTYALGVTILTCAFSLLPFHHTSVAAAIPEEFKIRQVTDDQNPTTTAHGGSNHHLLG  63

Query  225   TATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTP  404
             T  E RFKSF+QE+ KEY+T EEY++RLGVF KNL++AAEHQ LDPTAVHGVT+FSDLT 
Sbjct  64    TPAEHRFKSFIQEYNKEYSTREEYIHRLGVFVKNLLKAAEHQALDPTAVHGVTQFSDLTS  123

Query  405   NEFEKMYMGVLKVPGRASLLGG-KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCW  581
              EFE+MYMGV K   R+SLLG   + AP ++V  LP++FDWR+KGAVT+VKMQGSCGSCW
Sbjct  124   EEFERMYMGV-KGGDRSSLLGEVGSHAPPMEVKDLPKSFDWREKGAVTDVKMQGSCGSCW  182

Query  582   AFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIE  761
             AFSTTG+IEGANFIATGKLLNLSEQQLVDCD+TCD KDK ACD GC GGLMTNAY+YLIE
Sbjct  183   AFSTTGSIEGANFIATGKLLNLSEQQLVDCDNTCDKKDKKACDSGCRGGLMTNAYKYLIE  242

Query  762   SGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAV  941
             +GGIEEE SYPY+GK G+C+F  +KVAVKV NFTN+P DE Q+AAYLVNHGPLAVG+NAV
Sbjct  243   AGGIEEEDSYPYSGKRGECKFSPDKVAVKVSNFTNIPIDEQQIAAYLVNHGPLAVGLNAV  302

Query  942   YMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGY  1121
             +M TY+GGVSCPLIC K+ +NHGVLLVGYG KGFSILRL  +PYW IKNSWGK WGE GY
Sbjct  303   FMQTYIGGVSCPLICGKRWVNHGVLLVGYGSKGFSILRLSNQPYWEIKNSWGKRWGENGY  362

Query  1122  FRMCRGHGMCGISNMVSAVMTR  1187
             +++CRGHGMCG++ MVSAVMT+
Sbjct  363   YKLCRGHGMCGMNTMVSAVMTQ  384



>ref|XP_004250044.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=386

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/382 (70%), Positives = 309/382 (81%), Gaps = 15/382 (4%)
 Frame = +3

Query  84    GGGLMYAQLLAVLTCA-------HLAFASSASQGLNIRQVTDDEIPA------AGENLLG  224
             GGGL YA  + +LTCA       H + A++  +   IRQVTD   P       +  +LLG
Sbjct  4     GGGLTYALSVTILTCAFSLLPFHHTSAAAAVPEEFKIRQVTDGRNPTTTAHGGSNHHLLG  63

Query  225   TATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTP  404
             T  E RFKSF+QE+ KEY+T EEYV+RLGVF KNL+RAAEHQ LDPTAVHGVT+FSDLT 
Sbjct  64    TPAEHRFKSFIQEYNKEYSTREEYVHRLGVFVKNLLRAAEHQALDPTAVHGVTQFSDLTS  123

Query  405   NEFEKMYMGVLKVPGRASLLGG-KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCW  581
              EFE+MYMGV K   R SLL    + AP ++V  LP +FDWR+KGAVT+VKMQGSCGSCW
Sbjct  124   EEFERMYMGV-KGGDRTSLLREFGSHAPPMEVKDLPNSFDWREKGAVTDVKMQGSCGSCW  182

Query  582   AFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIE  761
             AFSTTG+IEGANFIATGKLLNLSEQQLVDCD+TCD KD+ ACD GC GGLMTNAY+YLIE
Sbjct  183   AFSTTGSIEGANFIATGKLLNLSEQQLVDCDNTCDKKDRKACDSGCRGGLMTNAYKYLIE  242

Query  762   SGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAV  941
             +GGIEEE SYPYTGK G+C+F  +KVAVKV NFTN+P DE Q+AAYLVNHGPLAVG+NAV
Sbjct  243   AGGIEEEDSYPYTGKRGECKFSPDKVAVKVSNFTNIPIDEQQIAAYLVNHGPLAVGLNAV  302

Query  942   YMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGY  1121
             +M TY+GGVSCPLIC K+ +NHGVLLVGYG KGFSILRL  +PYWIIKNSWGK WGE GY
Sbjct  303   FMQTYIGGVSCPLICGKRWVNHGVLLVGYGSKGFSILRLSNQPYWIIKNSWGKRWGENGY  362

Query  1122  FRMCRGHGMCGISNMVSAVMTR  1187
             +++CRGHGMCG++ MVSAVMT+
Sbjct  363   YKLCRGHGMCGMNTMVSAVMTQ  384



>ref|XP_009116190.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=364

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/370 (68%), Positives = 307/370 (83%), Gaps = 9/370 (2%)
 Frame = +3

Query  96    MYAQLLA-VLTC-AHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA VLTC A     + + + L IRQVT+D +P    NLLGT TE +F+ FM ++G
Sbjct  1     MVAKTLALVLTCTAIFCHVAVSLEDLTIRQVTEDRLP----NLLGTHTERKFRVFMSDYG  56

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP-  446
             K Y+T EEY++RLG+FAKN+++AAEHQ++DPTAVHGVT+FSDLT  EF++MY GV+ V  
Sbjct  57    KSYSTREEYIHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVVDVDR  116

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
             G   ++G  AEAP+LD+ GLP+ FDWR+KGAVTEVK QG+CGSCWAFSTTGA+EGANF++
Sbjct  117   GHGGVVG--AEAPQLDIKGLPKDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGANFVS  174

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKL++LSEQQLVDCD  CD KDK ACD+GC GGLMTNAYEYL ++GG+EEE SYPYTGK
Sbjct  175   TGKLVSLSEQQLVDCDKACDPKDKKACDNGCGGGLMTNAYEYLEKAGGLEEEKSYPYTGK  234

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+ +KVAVKV NFTN+P DEDQ+ A LV HGPL+VGINAV+M TY+GGVSCPLIC
Sbjct  235   RGHCKFDPKKVAVKVLNFTNIPLDEDQITARLVQHGPLSVGINAVFMQTYIGGVSCPLIC  294

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SKKRLNHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WG+ GY+++CRGH MCGI++M
Sbjct  295   SKKRLNHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGDNGYYKLCRGHDMCGINSM  354

Query  1167  VSAVMTRPGS  1196
              SAV+T+  S
Sbjct  355   ASAVLTQVSS  364



>emb|CDX73424.1| BnaC08g25790D [Brassica napus]
Length=364

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/370 (68%), Positives = 308/370 (83%), Gaps = 9/370 (2%)
 Frame = +3

Query  96    MYAQLLA-VLTC-AHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA VLTC A     + + + L IRQVT+D +P    NLLGT TE +F+ FM ++G
Sbjct  1     MLAKTLALVLTCTAIFCHVAVSLEDLTIRQVTEDRLP----NLLGTHTERKFRVFMSDYG  56

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP-  446
             K Y+T EEY++RLG+FAKN+++AAEHQ++DPTAVHGVT+FSDLT +EF++MY GV+ V  
Sbjct  57    KSYSTREEYIHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEDEFKRMYNGVVDVDR  116

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
             G   ++G  AEAP+L++ GLP+ FDWR+KGAVTEVK QG+CGSCWAFSTTGA+EGANF++
Sbjct  117   GHGGVVG--AEAPKLEIKGLPKDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGANFVS  174

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKL++LSEQQLVDCD  CD KDK ACD+GC GGLMTNAYEYL ++GG+EEE SYPYTGK
Sbjct  175   TGKLVSLSEQQLVDCDKACDPKDKKACDNGCGGGLMTNAYEYLEKAGGLEEEKSYPYTGK  234

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+ +KVAVK+ NFTN+P DEDQ+ A LV HGPL+VGINAV+M TY+GGVSCPLIC
Sbjct  235   RGHCKFDPKKVAVKIVNFTNIPLDEDQITARLVQHGPLSVGINAVFMQTYIGGVSCPLIC  294

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SKKRLNHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WG+ GY+++CRGH MCGI++M
Sbjct  295   SKKRLNHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGDNGYYKLCRGHDMCGINSM  354

Query  1167  VSAVMTRPGS  1196
              SAV+T+  S
Sbjct  355   ASAVLTQVSS  364



>emb|CDY56961.1| BnaA09g55030D [Brassica napus]
Length=364

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/362 (68%), Positives = 301/362 (83%), Gaps = 8/362 (2%)
 Frame = +3

Query  117   VLTC-AHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEE  293
             VLTC A     + + + L IRQVT+D +P    NLLGT TE +F+ FM ++GK Y+T EE
Sbjct  9     VLTCTAIFCHVAVSLEDLTIRQVTEDRLP----NLLGTHTERKFRVFMSDYGKSYSTREE  64

Query  294   YVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP-GRASLLGG  470
             Y++RLG+FAKN+++AAEHQ++DPTAVHGVT+FSDLT  EF++MY GV+ V  G   ++G 
Sbjct  65    YIHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVVDVDRGHGGVVG-  123

Query  471   KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLS  650
               EAP+LD+ GLP+ FDWR+KGAVTEVK QG+CGSCWAFSTTGA+EGANF++TGKL++LS
Sbjct  124   -VEAPQLDIKGLPKDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGANFVSTGKLVSLS  182

Query  651   EQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFES  830
             EQQLVDCD  CD KDK ACD+GC GGLMTNAYEYL ++GG+EEE SYPYTGK G C+F+ 
Sbjct  183   EQQLVDCDKACDPKDKKACDNGCGGGLMTNAYEYLEKAGGLEEEKSYPYTGKRGHCKFDP  242

Query  831   EKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHG  1010
             +KVAVKV NFTN+P DEDQ+ A LV HGPL+VGINAV+M TY+GGVSCPLICSKKRLNHG
Sbjct  243   KKVAVKVVNFTNIPLDEDQITARLVQHGPLSVGINAVFMQTYIGGVSCPLICSKKRLNHG  302

Query  1011  VLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             VLLVGYG KGFSILRL  KPYWIIKNSWGK WG+ GY+++CRGH MCGI++M SAV+T+ 
Sbjct  303   VLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGDNGYYKLCRGHDMCGINSMASAVLTQV  362

Query  1191  GS  1196
              S
Sbjct  363   SS  364



>gb|KFK34737.1| hypothetical protein AALP_AA5G186400 [Arabis alpina]
Length=369

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/370 (66%), Positives = 300/370 (81%), Gaps = 4/370 (1%)
 Frame = +3

Query  96    MYAQLLAVL-TCAHLAF--ASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEH  266
             M A+ LA+L TC H  F   + + + L IRQVTDD       NLLGT TE +F+ FM ++
Sbjct  1     MVAKTLALLITCTHFFFCHVTGSLEDLTIRQVTDDRQRVL-PNLLGTHTETKFRVFMSDY  59

Query  267   GKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP  446
             GK Y+T EEYV+RLG+FA+N+++AAEHQ++DPTAVHGVTRFSDLT  EF+KMY GV  V 
Sbjct  60    GKSYSTREEYVHRLGIFARNVLKAAEHQMMDPTAVHGVTRFSDLTEKEFKKMYTGVADVS  119

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
                 +   + EAP L+V GLPE FDWR+KGAVTE+K QG CGSCWAFSTTGA+EGA+F++
Sbjct  120   HGGGVGAVRMEAPMLEVEGLPEDFDWREKGAVTEIKDQGKCGSCWAFSTTGAVEGAHFVS  179

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TG+L++LSEQQLVDCD  CD KDK ACDDGC GGLMTNAYEYL+E+GG+EEE SYPYTGK
Sbjct  180   TGELVSLSEQQLVDCDKACDPKDKKACDDGCGGGLMTNAYEYLMEAGGLEEEKSYPYTGK  239

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+  ++AVKV NFTN+P DE+Q+ A LV HGPLAVG+NAV+M TY+GGVSCPLIC
Sbjct  240   RGHCKFDPNEIAVKVVNFTNIPLDENQITANLVQHGPLAVGVNAVFMQTYIGGVSCPLIC  299

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+++NHGVLLVGYG KGFS+LRL  KPYWIIKNSWGK WGE GY+++CRGH MCGI++M
Sbjct  300   SKRKVNHGVLLVGYGSKGFSLLRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDMCGINSM  359

Query  1167  VSAVMTRPGS  1196
             VSAV T+  S
Sbjct  360   VSAVATKVSS  369



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/370 (68%), Positives = 303/370 (82%), Gaps = 6/370 (2%)
 Frame = +3

Query  96    MYAQLLA-VLTCAHLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA ++TCA   F + AS   + IRQVTDD       NLLGT TE +F+ FM + G
Sbjct  1     MVAKALAQLITCAIFFFHAVASVDDITIRQVTDDG-RQVRPNLLGTHTESKFRVFMSDFG  59

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP-  446
             K Y+T EEYV+RLG+FAKN+++AAEHQ++DPTAVHGVT+FSDLT +EF++MY GV  V  
Sbjct  60    KSYSTREEYVHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEDEFKRMYTGVADVDR  119

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
             G    +G  AEAP +DV GLP+ FDWR+KG VTEVK QG+CGSCWAFSTTGA EGA+F++
Sbjct  120   GHGVTVG--AEAPMVDVEGLPDDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVS  177

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKLL+LSEQQLVDCD  CD KDK ACDDGC GGLMTNAYEYL+E+GG+EEE SYPYTGK
Sbjct  178   TGKLLSLSEQQLVDCDKACDPKDKKACDDGCGGGLMTNAYEYLMEAGGLEEEKSYPYTGK  237

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+ +KVAVKV NFT +P DE+Q+AA LV HGPLAVG+NAV+M TY+GGVSCPLIC
Sbjct  238   RGQCKFDPDKVAVKVVNFTTIPLDENQIAANLVQHGPLAVGLNAVFMQTYIGGVSCPLIC  297

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+++NHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WGE+GY+++CRGH +CGI++M
Sbjct  298   SKRKINHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSM  357

Query  1167  VSAVMTRPGS  1196
             VSAV TR  S
Sbjct  358   VSAVATRVSS  367



>ref|XP_010534431.1| PREDICTED: cysteine proteinase 15A [Tarenaya hassleriana]
Length=379

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/362 (68%), Positives = 299/362 (83%), Gaps = 6/362 (2%)
 Frame = +3

Query  117   VLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEY  296
             +L    ++  +S  + L IRQVT+D      + L+GT TE RF++FM E+GK Y T EEY
Sbjct  20    ILVTDGVSCVASDHEDLAIRQVTEDH----RKTLVGTHTESRFRAFMSEYGKSYETREEY  75

Query  297   VYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV-PGRASLLGGK  473
             V+RLGVFA+N++RAAEHQ++DPTAVHGVT+FSDLT  EFE+M+ GVL    G   +    
Sbjct  76    VHRLGVFARNVLRAAEHQMMDPTAVHGVTQFSDLTEEEFERMFTGVLAADEGGVGVQEAA  135

Query  474   AEAPRL-DVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLS  650
             AE   + ++ GLPE FDWR+KGAVT+VKMQG+CGSCWAFSTTGAIEGANF++TGKLLNLS
Sbjct  136   AEDVEMAEIDGLPEDFDWREKGAVTDVKMQGACGSCWAFSTTGAIEGANFVSTGKLLNLS  195

Query  651   EQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFES  830
             EQQLVDCDH CD KDK ACDDGC GGLMTNAY+Y++E+GG+EEE+SYPYTGK G CRF++
Sbjct  196   EQQLVDCDHACDTKDKKACDDGCGGGLMTNAYKYVMEAGGLEEESSYPYTGKRGRCRFDA  255

Query  831   EKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHG  1010
              KVAV++ NFT +P DE+Q+AA LV HGPLAVG+NAVYM TY+GGVSCPLICSK+RLNHG
Sbjct  256   GKVAVRLANFTTIPLDENQIAANLVRHGPLAVGLNAVYMQTYIGGVSCPLICSKRRLNHG  315

Query  1011  VLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             VLLVGYG KGFSILRLG +PYWIIKNSWGK WGE GY+++CRGHG+CG++ MVSAV+T+ 
Sbjct  316   VLLVGYGSKGFSILRLGNRPYWIIKNSWGKTWGENGYYKLCRGHGICGVNAMVSAVVTQV  375

Query  1191  GS  1196
              S
Sbjct  376   SS  377



>gb|EYU39642.1| hypothetical protein MIMGU_mgv1a008552mg [Erythranthe guttata]
Length=370

 Score =   519 bits (1336),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 253/374 (68%), Positives = 300/374 (80%), Gaps = 10/374 (3%)
 Frame = +3

Query  78    IAGGGLMYAQL----LAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRF  245
             + GGGL YA +    L +LTCA    A+   +   I QVT +        LLGTA E +F
Sbjct  1     MKGGGLTYAVVTGTALILLTCA---LATLEEEQEVILQVTGNHHHHH---LLGTAAEHQF  54

Query  246   KSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMY  425
              SF+QE+GK+Y T  EY++RLG+FAKNL+RAAEHQ +DPTAVHGVT+FSDL+  EFE MY
Sbjct  55    NSFIQEYGKDYPTRAEYLHRLGIFAKNLLRAAEHQAMDPTAVHGVTQFSDLSQEEFEGMY  114

Query  426   MGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAI  605
             MGV      A     +  A  ++V  LPE+FDWR+KGAV++VKMQG+CGSCWAFSTTGAI
Sbjct  115   MGVKGGAAAAPSENEEVVAAEMEVGDLPESFDWREKGAVSDVKMQGTCGSCWAFSTTGAI  174

Query  606   EGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEA  785
             EGANFIATGKLLNLSEQQLVDCDH CD  +K ACDDGCSGGLMTNAY+YLIE+GGIEEE 
Sbjct  175   EGANFIATGKLLNLSEQQLVDCDHACDATEKKACDDGCSGGLMTNAYKYLIEAGGIEEED  234

Query  786   SYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGG  965
             +YPYTGK G+C+F+SEKVAVKV NF  +P +E+Q+AAYLVNHGPLAVG+NAV+M TY+GG
Sbjct  235   AYPYTGKRGECKFKSEKVAVKVSNFITIPIEENQIAAYLVNHGPLAVGLNAVFMQTYIGG  294

Query  966   VSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHG  1145
             VSCPLIC KK +NHGVLLVGYG +G+SILR   KPYWIIKNSWGK WGE+GY+R+CRGHG
Sbjct  295   VSCPLICGKKWINHGVLLVGYGSRGYSILRFKNKPYWIIKNSWGKRWGEKGYYRLCRGHG  354

Query  1146  MCGISNMVSAVMTR  1187
             MCGI+ MVSAVMT+
Sbjct  355   MCGINTMVSAVMTK  368



>ref|XP_006436511.1| hypothetical protein CICLE_v10031865mg [Citrus clementina]
 ref|XP_006485655.1| PREDICTED: cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR49751.1| hypothetical protein CICLE_v10031865mg [Citrus clementina]
Length=373

 Score =   517 bits (1331),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 251/379 (66%), Positives = 302/379 (80%), Gaps = 18/379 (5%)
 Frame = +3

Query  96    MYAQLLAVLTCA----HLAFASSASQGL-----NIRQVTDDEIPAAGENLLGTATEVRFK  248
             M A     LTCA     L +A + S  L      IRQVTD+     G  LLG+ATE  FK
Sbjct  1     MAATQSPALTCAIGVTLLTYALTLSSALVPQNPTIRQVTDN----PGHLLLGSATENNFK  56

Query  249   SFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYM  428
              FMQ++ K YAT E+YV+RLG+FAKN+IRAAEHQ+LDPTAVHGVT FSDL+  EFE MY 
Sbjct  57    IFMQKYEKSYATREDYVHRLGIFAKNMIRAAEHQLLDPTAVHGVTPFSDLSEEEFESMYT  116

Query  429   GVLKVPGRASLLGGKAEAPR---LDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTG  599
             G+   P    + GG  E+     +++ GLPE FDWRDKGAVTEVKMQG+CGSCWAFSTTG
Sbjct  117   GMKGGP--PEMDGGGLESSSVKMMEIDGLPENFDWRDKGAVTEVKMQGACGSCWAFSTTG  174

Query  600   AIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEE  779
             A+EGANFIATG LL+LSEQQLVDCDH+CDIK+K  CD+GCSGGLMTNAY+YLI +GG+EE
Sbjct  175   AVEGANFIATGNLLSLSEQQLVDCDHSCDIKEKGTCDNGCSGGLMTNAYKYLIAAGGLEE  234

Query  780   EASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYM  959
             E+SYPY GK G C+F+SEK+AV+V NFTN+P DE+Q+AA+LV+HGPLA+G+NA++M TY+
Sbjct  235   ESSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYI  294

Query  960   GGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG  1139
             GGVSCPLIC KK LNHGVLLVGYG KGFSILRLG +P+WIIKNSWGK WG+ GY+R+CRG
Sbjct  295   GGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPFWIIKNSWGKQWGDHGYYRLCRG  354

Query  1140  HGMCGISNMVSAVMTRPGS  1196
              GMCG++ MVSAV+T+  S
Sbjct  355   RGMCGMNTMVSAVVTQASS  373



>ref|XP_006403513.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
 gb|ESQ44966.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
Length=367

 Score =   515 bits (1327),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 254/371 (68%), Positives = 303/371 (82%), Gaps = 8/371 (2%)
 Frame = +3

Query  96    MYAQLLAV-LTCAHLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA+ +TCA      +AS + L IRQVTDD +     NLLGT TE +F+ FM ++G
Sbjct  1     MVAKTLALFITCAIFYCHGAASLEDLTIRQVTDDRL----SNLLGTHTETKFRVFMSDYG  56

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K Y+T EEYV+RLG+FAKN+++AAEHQ+LDPTAVHGVTRFSDLT  EF +MY GV+ V  
Sbjct  57    KSYSTREEYVHRLGIFAKNVLKAAEHQMLDPTAVHGVTRFSDLTEEEFTRMYTGVVGVVD  116

Query  450   RASLLGGK--AEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
                  GG   AEAP ++V GLP  FDWR+KGAVTEVK QG+CGSCWAFSTTGA+EGA+F+
Sbjct  117   VGGRRGGTVGAEAPMVEVEGLPTDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGAHFV  176

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             +TG+L++LSEQQLVDCD  CD KDK ACDDGC GGLMTNAYEYL E+GG+EEE SYPYTG
Sbjct  177   STGELVSLSEQQLVDCDKACDPKDKKACDDGCGGGLMTNAYEYLKEAGGLEEEKSYPYTG  236

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
             K G C+F+  KVAVKV NFTN+P DEDQ+ A LV HGPLAVG+NAV+M TY+GGVSCPLI
Sbjct  237   KRGHCKFDPNKVAVKVVNFTNIPLDEDQITANLVQHGPLAVGLNAVFMQTYIGGVSCPLI  296

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CSKK++NHGVLLVGYG KGFSILRLG KPYWIIKNSWGK WG+ GY+++CRGH MCGI++
Sbjct  297   CSKKKINHGVLLVGYGSKGFSILRLGNKPYWIIKNSWGKKWGDGGYYKLCRGHDMCGINS  356

Query  1164  MVSAVMTRPGS  1196
             MVSAV+T+  S
Sbjct  357   MVSAVVTQVSS  367



>emb|CDO99795.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   514 bits (1323),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 302/393 (77%), Gaps = 23/393 (6%)
 Frame = +3

Query  78    IAGGGLMYAQLLAV--LTCAHLAFAS-------SASQGLNIRQVTDDE-------IPAAG  209
             +  GGLM    LA+  L+CA ++  +            L IRQVTD+          +A 
Sbjct  3     MTSGGLMLTCTLAITLLSCALISSTTFQHEIQYRVQDPLMIRQVTDNHHHRHHPGRSSAN  62

Query  210   ENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRF  389
               LLGT TEV FKSF++E+ K Y+THEEYV+RLG+FAKNLI+AAEHQ +DP+A+HGVT+F
Sbjct  63    HRLLGTTTEVHFKSFVEEYEKTYSTHEEYVHRLGIFAKNLIKAAEHQAMDPSAIHGVTQF  122

Query  390   SDLTPNEFEKMYMGVLKVPGR--ASLLGG-----KAEAPRLDVSGLPETFDWRDKGAVTE  548
             SDLT  EFE  YMG+    G    + LG       A    +DVS LPE+FDWR+KGAVTE
Sbjct  123   SDLTEEEFEATYMGLKGGAGVGGTTQLGKDDGDESAAEVMMDVSDLPESFDWREKGAVTE  182

Query  549   VKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGG  728
             VK QG CGSCWAFSTTGAIEGANFIATGKLL+LSEQQLVDCDH CD+K+K  CDDGCSGG
Sbjct  183   VKTQGRCGSCWAFSTTGAIEGANFIATGKLLSLSEQQLVDCDHMCDLKEKDDCDDGCSGG  242

Query  729   LMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVN  908
             LMT A+ YLIE+GGIEEE +YPYTGK G+C+F  EKVAVKV NFT +P DE Q+AA +V+
Sbjct  243   LMTTAFNYLIEAGGIEEEVTYPYTGKRGECKFNPEKVAVKVRNFTKIPEDESQIAANVVH  302

Query  909   HGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKN  1088
             +GPLA+G+NAV+M TY+GGVSCPLIC KKR+NHGVLLVGYG +GFSILRLG+ PYWIIKN
Sbjct  303   NGPLAIGLNAVFMQTYIGGVSCPLICDKKRINHGVLLVGYGSRGFSILRLGYNPYWIIKN  362

Query  1089  SWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             SWGK WGE GY+R+CRGH MCG+S MVSAV+T+
Sbjct  363   SWGKRWGEHGYYRLCRGHNMCGMSTMVSAVVTQ  395



>gb|AEQ54770.1| cysteine proteinase CP1 [Coffea canephora]
Length=397

 Score =   513 bits (1322),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 302/393 (77%), Gaps = 23/393 (6%)
 Frame = +3

Query  78    IAGGGLMYAQLLAV--LTCAHLAFAS-------SASQGLNIRQVTDDE-------IPAAG  209
             +  GGLM    LA+  L+CA ++  +            L IRQVTD+          +A 
Sbjct  3     MTSGGLMLTCTLAITLLSCALISSTTFQHEIQYRVQDPLMIRQVTDNHHHRHHPGRSSAN  62

Query  210   ENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRF  389
               LLGT TEV FKSF++E+ K Y+THEEYV+RLG+FAKNLI+AAEHQ +DP+A+HGVT+F
Sbjct  63    HRLLGTTTEVHFKSFVEEYEKTYSTHEEYVHRLGIFAKNLIKAAEHQAMDPSAIHGVTQF  122

Query  390   SDLTPNEFEKMYMGVLKVPGR--ASLLGG-----KAEAPRLDVSGLPETFDWRDKGAVTE  548
             SDLT  EFE  YMG+    G    + LG       A    +DVS LPE+FDWR+KGAVTE
Sbjct  123   SDLTEEEFEATYMGLKGGAGVGGTTQLGKDDGDESAAEVMMDVSDLPESFDWREKGAVTE  182

Query  549   VKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGG  728
             VK QG CGSCWAFSTTGAIEGANFIATGKLL+LSEQQLVDCDH CD+K+K  CDDGCSGG
Sbjct  183   VKTQGRCGSCWAFSTTGAIEGANFIATGKLLSLSEQQLVDCDHMCDLKEKDDCDDGCSGG  242

Query  729   LMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVN  908
             LMT A+ YLIE+GGIEEE +YPYTGK G+C+F  EKVAVKV NF  +P DE Q+AA +V+
Sbjct  243   LMTTAFNYLIEAGGIEEEVTYPYTGKRGECKFNPEKVAVKVRNFAKIPEDESQIAANVVH  302

Query  909   HGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKN  1088
             +GPLA+G+NAV+M TY+GGVSCPLIC KKR+NHGVLLVGYG +GFSILRLG+KPYWIIKN
Sbjct  303   NGPLAIGLNAVFMQTYIGGVSCPLICDKKRINHGVLLVGYGSRGFSILRLGYKPYWIIKN  362

Query  1089  SWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             SWGK WGE GY+R+CRGH MCG+S MVSAV+T+
Sbjct  363   SWGKRWGEHGYYRLCRGHNMCGMSTMVSAVVTQ  395



>ref|NP_567010.5| Papain family cysteine protease [Arabidopsis thaliana]
 gb|AAL49820.1| putative cysteine proteinase [Arabidopsis thaliana]
 gb|AEE79316.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=367

 Score =   509 bits (1312),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 248/370 (67%), Positives = 300/370 (81%), Gaps = 6/370 (2%)
 Frame = +3

Query  96    MYAQLLA-VLTCAHLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA ++TC  L     AS + L IRQVT D       NLLGT TE +F+ FM ++G
Sbjct  1     MVAKALAQLITCIILFCHVVASVEDLTIRQVTADN-RRIRPNLLGTHTESKFRLFMSDYG  59

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K Y+T EEY++RLG+FAKN+++AAEHQ++DP+AVHGVT+FSDLT  EF++MY GV  V G
Sbjct  60    KNYSTREEYIHRLGIFAKNVLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMYTGVADVGG  119

Query  450   -RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
              R   +G  AEAP ++V GLPE FDWR+KG VTEVK QG+CGSCWAFSTTGA EGA+F++
Sbjct  120   SRGGTVG--AEAPMVEVDGLPEDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVS  177

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKLL+LSEQQLVDCD  CD KDK ACD+GC GGLMTNAYEYL+E+GG+EEE SYPYTGK
Sbjct  178   TGKLLSLSEQQLVDCDQACDPKDKKACDNGCGGGLMTNAYEYLMEAGGLEEERSYPYTGK  237

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+ EKVAV+V NFT +P DE+Q+AA LV HGPLAVG+NAV+M TY+GGVSCPLIC
Sbjct  238   RGHCKFDPEKVAVRVLNFTTIPLDENQIAANLVRHGPLAVGLNAVFMQTYIGGVSCPLIC  297

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+ +NHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WGE GY+++CRGH +CGI++M
Sbjct  298   SKRNVNHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINSM  357

Query  1167  VSAVMTRPGS  1196
             VSAV T+  S
Sbjct  358   VSAVATQVSS  367



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   509 bits (1312),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 247/371 (67%), Positives = 299/371 (81%), Gaps = 7/371 (2%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFAS--SASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA L    + F    ++ + L IRQVT DE      NLLGT TE +F+ FM ++G
Sbjct  1     MVAKALAQLITCIIFFCHVVASVEDLTIRQVTADE-RRVRPNLLGTHTESKFRVFMSDYG  59

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K Y+T EEY++RLG+FAKN+++AAEHQ++DPTAVHGVT+FSDLT  EF++MY GV  V G
Sbjct  60    KNYSTREEYIHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVADVGG  119

Query  450   -RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
              R   +G  AEAP ++V GLPE FDWR+KG VTEVK QG+CGSCWAFSTTGA EGA+F++
Sbjct  120   SRGHAVG--AEAPMVEVDGLPEDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVS  177

Query  627   TGKLLNLSEQQLVDCDH-TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             TGKLL+LSEQQLVDCD   CD KDK ACD+GC GGLMTNAYEYL+E+GG+EEE SYPYTG
Sbjct  178   TGKLLSLSEQQLVDCDQAVCDPKDKKACDNGCGGGLMTNAYEYLMEAGGLEEERSYPYTG  237

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
             K G C+F+ EKVAV+V NFT +P DEDQ+AA LV  GPLAVG+NAV+M TY+GGVSCPLI
Sbjct  238   KRGHCKFDPEKVAVRVVNFTTIPLDEDQIAANLVRQGPLAVGLNAVFMQTYIGGVSCPLI  297

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CSK+++NHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WGE GY+++CRGH +CGI++
Sbjct  298   CSKRKVNHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINS  357

Query  1164  MVSAVMTRPGS  1196
             MVSAV T+  S
Sbjct  358   MVSAVATQVSS  368



>ref|XP_007218137.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
 gb|EMJ19336.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
Length=377

 Score =   508 bits (1307),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 246/364 (68%), Positives = 299/364 (82%), Gaps = 12/364 (3%)
 Frame = +3

Query  111   LAVLTCA---HLAFA-SSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             +AVLTCA    L+FA   A+Q   I QVTD+  P     LLGT  E  F+ F++++GK+Y
Sbjct  17    VAVLTCALISTLSFALHDAAQDPIIHQVTDNHRP-----LLGT--ERSFQMFIEKYGKKY  69

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             +T +EY++RLG+FAKN++RAAEHQ LDPTAVHGVT FSDL+  EFE+MY G+  VP  +S
Sbjct  70    STRKEYMHRLGIFAKNMVRAAEHQALDPTAVHGVTPFSDLSEEEFERMYTGMRAVPPASS  129

Query  459   LLGGKAEAPR-LDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGK  635
               G    AP  +DV  LPE FDWR+KGAVTEVKMQG CGSCWAFSTTGAIEGANFIATGK
Sbjct  130   NDGVSDSAPPVMDVGDLPENFDWREKGAVTEVKMQGGCGSCWAFSTTGAIEGANFIATGK  189

Query  636   LLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD  815
             LL+LSEQQLVDCD+TCD KDK+ACD GC GGLMTNAYEYLIE+GG+EEE++YPYTG+ G+
Sbjct  190   LLSLSEQQLVDCDNTCDAKDKTACDSGCGGGLMTNAYEYLIEAGGLEEESTYPYTGRRGE  249

Query  816   CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKK  995
             C+F  +KVAVKV NF+ +P DEDQ+AA LV+HGPLA+G+NA++M TY+GGVSCPLIC +K
Sbjct  250   CKFNLDKVAVKVANFSTIPIDEDQIAANLVHHGPLAIGLNAMFMQTYIGGVSCPLICFRK  309

Query  996   RLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSA  1175
              +NHGVLLVGYG KG+SILRL  KPYWIIKNSWG+ WGE GY+ +CRGH MCG+++MVSA
Sbjct  310   WVNHGVLLVGYGAKGYSILRLRNKPYWIIKNSWGEQWGENGYYHLCRGHAMCGMNSMVSA  369

Query  1176  VMTR  1187
             V+TR
Sbjct  370   VVTR  373



>ref|XP_010103534.1| putative cysteine proteinase A494 [Morus notabilis]
 gb|EXB96194.1| putative cysteine proteinase A494 [Morus notabilis]
Length=372

 Score =   507 bits (1306),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 245/371 (66%), Positives = 295/371 (80%), Gaps = 6/371 (2%)
 Frame = +3

Query  87    GGLMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPA-AGENLLGTATEVRFKSFMQE  263
             GGL  A + A LTCA     +   Q   I QVTDD  P  +G  LLGT  E +FK FM++
Sbjct  2     GGLTCAVVAAALTCALTLTMALGYQDPVIHQVTDDLHPKFSGNELLGT--EKKFKIFMEK  59

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
             +GK Y + EEYV RLG+FA+N++RAAEHQ LDPTAVHGVT FSDL+  EFE MY G    
Sbjct  60    YGKTYGSREEYVRRLGIFARNMLRAAEHQALDPTAVHGVTPFSDLSEEEFESMYTGFRGG  119

Query  444   PGRASLLGGKAEAPRLDVSG---LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGA  614
             PG        + A   +V G   LPE+FDWR+KGAVT+VKMQGSCGSCWAFSTTGA+EGA
Sbjct  120   PGFGHGNVANSAAAAAEVDGGGHLPESFDWREKGAVTDVKMQGSCGSCWAFSTTGAVEGA  179

Query  615   NFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYP  794
             NFIATGKLLNLSEQQLVDCDHTCD  +K ACD+GC GGLMTNAY+YL+E+GG+EEE+SYP
Sbjct  180   NFIATGKLLNLSEQQLVDCDHTCDATEKDACDNGCGGGLMTNAYKYLMEAGGLEEESSYP  239

Query  795   YTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSC  974
             YTGK G+C+F  +KVAVKV NFTN+P DE+Q+AA LV+HGPL+VG+NAV+M TY+GGVSC
Sbjct  240   YTGKKGECKFNPDKVAVKVANFTNIPIDENQIAANLVHHGPLSVGLNAVFMQTYIGGVSC  299

Query  975   PLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCG  1154
             PLIC K+ +NHGVLLVG+  +G+SILR G+KPYWIIKNSWGK WGE GY+++CRGHGMCG
Sbjct  300   PLICGKRWVNHGVLLVGFSSRGYSILRFGYKPYWIIKNSWGKQWGENGYYKLCRGHGMCG  359

Query  1155  ISNMVSAVMTR  1187
             ++ MVSAV+T+
Sbjct  360   MNTMVSAVLTQ  370



>ref|NP_001236888.1| cysteine proteinase precursor [Glycine max]
 emb|CAA83673.1| cysteine proteinase [Glycine max]
 gb|ADK24076.1| cysteine proteinase [Glycine max]
 gb|ADK24077.1| cysteine proteinase [Glycine max]
 prf||2111244A Cys protease
Length=380

 Score =   507 bits (1305),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 239/367 (65%), Positives = 297/367 (81%), Gaps = 8/367 (2%)
 Frame = +3

Query  84    GGGLMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQE  263
             G  LM    +++  CA      SA+ G    Q    ++      LL   TE +FK FM+ 
Sbjct  6     GHALMCLARVSLFLCA---LTLSAAHGSTTVQDIARKLKLGDNELL--RTEKKFKVFMEN  60

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLK-  440
             +G+ Y+T EEY+ RLG+FA+N++RAAEHQ LDPTAVHGVT+FSDLT +EFEK+Y GV   
Sbjct  61    YGRSYSTEEEYLRRLGIFAQNMVRAAEHQALDPTAVHGVTQFSDLTEDEFEKLYTGVNGG  120

Query  441   VPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANF  620
              P   +  GG A  P L+V GLPE FDWR+KGAVTEVK+QG CGSCWAFSTTG+IEGANF
Sbjct  121   FPSSNNAAGGIA--PPLEVDGLPENFDWREKGAVTEVKLQGRCGSCWAFSTTGSIEGANF  178

Query  621   IATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYT  800
             +ATGKL++LSEQQL+DCD+ CDI +K++CD+GC+GGLMTNAY YL+ESGG+EEE+SYPYT
Sbjct  179   LATGKLVSLSEQQLLDCDNKCDITEKTSCDNGCNGGLMTNAYNYLLESGGLEEESSYPYT  238

Query  801   GKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
             G+ G+C+F+ EK+AVK+ NFTN+PADE+Q+AAYLV +GPLA+G+NA++M TY+GGVSCPL
Sbjct  239   GERGECKFDPEKIAVKITNFTNIPADENQIAAYLVKNGPLAMGVNAIFMQTYIGGVSCPL  298

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICSKKRLNHGVLLVGYG KGFSILRLG KPYWIIKNSWG+ WGE+GY+++CRGHGMCGI+
Sbjct  299   ICSKKRLNHGVLLVGYGAKGFSILRLGNKPYWIIKNSWGEKWGEDGYYKLCRGHGMCGIN  358

Query  1161  NMVSAVM  1181
              MVSA M
Sbjct  359   TMVSAAM  365



>ref|XP_008233261.1| PREDICTED: cysteine proteinase 15A [Prunus mume]
Length=377

 Score =   506 bits (1304),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 246/364 (68%), Positives = 298/364 (82%), Gaps = 12/364 (3%)
 Frame = +3

Query  111   LAVLTCA---HLAFA-SSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             +AVLTCA    L+FA   ASQ   I QVTD+  P     LLGT  E  F+ F++++GK+Y
Sbjct  17    VAVLTCALISTLSFALHDASQDPIIHQVTDNHRP-----LLGT--ERSFQMFIEKYGKKY  69

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             +T +EY++RLG+FAKN++RAAEHQ LDPTAVHGVT FSDL+  EFE+MY G+  VP  +S
Sbjct  70    STQKEYMHRLGIFAKNMVRAAEHQALDPTAVHGVTPFSDLSEEEFERMYTGMRAVPPASS  129

Query  459   LLGGKAEAPR-LDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGK  635
               G    AP  +DVS LP+ FDWR+KGAVTEVKMQG CGSCWAFSTTGAIEGANFIATGK
Sbjct  130   NDGVSDSAPPVMDVSDLPKNFDWREKGAVTEVKMQGGCGSCWAFSTTGAIEGANFIATGK  189

Query  636   LLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD  815
             LL+LSEQQLVDCD TCD KDK+ACD GC GGLMTNAYEYLIE+GG+EEE++YPYTG+ G+
Sbjct  190   LLSLSEQQLVDCDSTCDAKDKTACDSGCGGGLMTNAYEYLIEAGGLEEESTYPYTGRRGE  249

Query  816   CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKK  995
             C+F  +KVAVKV NF+ +P DEDQ+AA LV+ GPLA+G+NA++M TY+GGVSCPLIC +K
Sbjct  250   CKFYPDKVAVKVANFSTIPIDEDQIAANLVHRGPLAIGLNAMFMQTYIGGVSCPLICFRK  309

Query  996   RLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSA  1175
              +NHGVLLVGYG KG+SILRL  KPYWIIKNSWG+ WGE GY+ +CRGH MCG+++MVSA
Sbjct  310   WVNHGVLLVGYGAKGYSILRLRNKPYWIIKNSWGEQWGENGYYHLCRGHAMCGMNSMVSA  369

Query  1176  VMTR  1187
             V+TR
Sbjct  370   VVTR  373



>ref|XP_011024366.1| PREDICTED: cysteine proteinase 15A [Populus euphratica]
Length=380

 Score =   506 bits (1304),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 285/349 (82%), Gaps = 11/349 (3%)
 Frame = +3

Query  159   QGLNIRQVTDD------EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFA  320
             Q   I QVTD+      +    G NLLGT  E +FK F++EH KEYAT EEYV+R G+F 
Sbjct  35    QDPTILQVTDNPTLNNRKFMKNGLNLLGT--EEKFKMFIKEHNKEYATREEYVHRFGIFG  92

Query  321   KNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVS  500
             +NLIRA EHQ LDPTA+HGVT F DLT  EFE+MY GVL   G  ++   K     +D S
Sbjct  93    ENLIRAVEHQALDPTAIHGVTPFMDLTEEEFERMYAGVL---GGGTVPVEKGSVSFMDAS  149

Query  501   GLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHT  680
             GLP++FDWR+KGAVT+VKMQGSCGSCWAFSTTG++EGANFIATGKLLNLSEQQLVDCD  
Sbjct  150   GLPDSFDWREKGAVTDVKMQGSCGSCWAFSTTGSVEGANFIATGKLLNLSEQQLVDCDRV  209

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNF  860
             CD  DK++CDDGC GGLMTNAY YLIE+GG++EE+SYPYTGK G+C+F+ EK+AVKV NF
Sbjct  210   CDKTDKASCDDGCGGGLMTNAYRYLIEAGGLQEESSYPYTGKSGECKFDPEKIAVKVANF  269

Query  861   TNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKG  1040
             TN+  DE+Q+AA LV+HGPLA+G+NA++M TY+GGVSCPLIC KK LNHGVLLVGYG +G
Sbjct  270   TNISVDENQIAANLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGARG  329

Query  1041  FSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             +SILR G+KPYWIIKNSWGK WGE+GY+R+CRGHGMCG+  MVSAV+T+
Sbjct  330   YSILRFGYKPYWIIKNSWGKHWGEKGYYRLCRGHGMCGMDKMVSAVVTK  378



>ref|XP_002533377.1| cysteine protease, putative [Ricinus communis]
 gb|EEF29008.1| cysteine protease, putative [Ricinus communis]
Length=381

 Score =   502 bits (1293),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 240/344 (70%), Positives = 283/344 (82%), Gaps = 3/344 (1%)
 Frame = +3

Query  159   QGLNIRQVTDD-EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIR  335
             Q   I QVTDD  +  +    LGT TE  FK FM ++ KEY T EEY++RLGVFAKNLIR
Sbjct  38    QDPTILQVTDDPSVTLSNRKFLGTNTEENFKMFMIKYDKEYDTREEYMHRLGVFAKNLIR  97

Query  336   AAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPET  515
             AAEHQ+LDPTAVHG+T F DLT  EFE+MY     V G A    G      L+ +GLP +
Sbjct  98    AAEHQVLDPTAVHGITPFMDLTEEEFERMY--TGVVGGGAVGAEGVTATSFLETAGLPSS  155

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWR KGAVT+VKMQG+CGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCD  CDIK+
Sbjct  156   FDWRKKGAVTDVKMQGACGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDRVCDIKE  215

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPA  875
             K+ACDDGC GGLMTNAY YLIE+GG+E+E SYPYTGK G C+F+ +K+AV+V NFT++P 
Sbjct  216   KTACDDGCGGGLMTNAYRYLIEAGGLEDEISYPYTGKPGKCKFDEKKIAVRVVNFTSIPI  275

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE+Q+AA+LV+HGPLA+G+NAV+M TY+GGVSCPLIC KK +NHGVLLVGYG KGFSILR
Sbjct  276   DENQIAAHLVHHGPLAIGLNAVFMQTYIGGVSCPLICGKKWINHGVLLVGYGAKGFSILR  335

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             LG+KPYWIIKNSWGK WGEEGY+R+C+G+GMCG+  MVSAV+T+
Sbjct  336   LGYKPYWIIKNSWGKRWGEEGYYRICKGYGMCGMDRMVSAVVTQ  379



>ref|XP_002316398.1| hypothetical protein POPTR_0010s23510g [Populus trichocarpa]
 gb|EEF02569.1| hypothetical protein POPTR_0010s23510g [Populus trichocarpa]
Length=327

 Score =   499 bits (1284),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 277/327 (85%), Gaps = 5/327 (2%)
 Frame = +3

Query  207   GENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTR  386
             G NLLGT  E +FK F++EH KEYAT EEYV+R G+F KNLIRA EHQ LDPTA+HGVT 
Sbjct  4     GLNLLGT--EEKFKMFIKEHNKEYATREEYVHRFGIFGKNLIRAVEHQALDPTAIHGVTP  61

Query  387   FSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGS  566
             F DLT  EFE+MY GVL   G  ++   K     +D SGLP++FDWR+KGAVT+VK+QGS
Sbjct  62    FMDLTEEEFERMYAGVL---GGGTVPVEKGSVSFMDASGLPDSFDWREKGAVTDVKIQGS  118

Query  567   CGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAY  746
             CGSCWAFSTTG++EGANFIATGKLLNLSEQQLVDCD  CD  DK++CDDGC GGLMTNAY
Sbjct  119   CGSCWAFSTTGSVEGANFIATGKLLNLSEQQLVDCDRVCDKTDKASCDDGCGGGLMTNAY  178

Query  747   EYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAV  926
              YLIE+GG++EE+SYPYTGK G+C+F+ EK+AVKV NFT++  DE+Q+AA LV+HGPLA+
Sbjct  179   RYLIEAGGLQEESSYPYTGKSGECKFDPEKIAVKVANFTSIAVDENQIAANLVHHGPLAI  238

Query  927   GINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDW  1106
             G+NA++M TY+GGVSCPLIC KK LNHGVLLVGYG +G+SILR G+KPYWIIKNSWG  W
Sbjct  239   GLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGARGYSILRFGYKPYWIIKNSWGNHW  298

Query  1107  GEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             GE+GY+R+CRGHGMCG++ MVSAV+T+
Sbjct  299   GEKGYYRLCRGHGMCGMNKMVSAVVTK  325



>ref|XP_008362714.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=372

 Score =   500 bits (1288),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 241/366 (66%), Positives = 295/366 (81%), Gaps = 14/366 (4%)
 Frame = +3

Query  108   LLAVLTCA--HLAFA-SSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             ++AVLTCA   L+ A    S  L I QVTD+     G       TE  F+ F++++GK+Y
Sbjct  15    VVAVLTCALSTLSLALHDTSXDLIIHQVTDNHHFLPG-------TERNFQMFIEQYGKKY  67

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             +T +EY++RLG+FAKN+IRAAEHQ+LDPTAVHGVT FSDL+  EFE+MY G++ VP    
Sbjct  68    STRKEYMHRLGIFAKNMIRAAEHQVLDPTAVHGVTPFSDLSEEEFERMYTGMIGVPQNGG  127

Query  459   LLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
                  +  P +DV  LPE FDWRD+GAVTEVKMQG CGSCWAFSTTG+IEGA++IATGKL
Sbjct  128   X--SNSAPPVMDVGDLPENFDWRDRGAVTEVKMQGGCGSCWAFSTTGSIEGAHYIATGKL  185

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
             LNLSEQQLVDCD TCD K+K ACD GC GGLMTNAY+YLIESGG+EEE +YPYTGK G+C
Sbjct  186   LNLSEQQLVDCDSTCDPKEKDACDSGCGGGLMTNAYKYLIESGGLEEENAYPYTGKRGEC  245

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+ +KVAV+V NFT +P DEDQ+AA LV+HGPLA+G+NA++M TY+GGVSCPLIC KK 
Sbjct  246   KFDQDKVAVRVANFTTIPVDEDQIAANLVHHGPLAIGLNAMFMQTYIGGVSCPLICFKKW  305

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +NHGVLLVGYG KG+SILRL  KPYWIIKNSWG+ WGE+GY+R+CRGH MCG+++MVSAV
Sbjct  306   VNHGVLLVGYGAKGYSILRLRNKPYWIIKNSWGERWGEQGYYRLCRGHAMCGMNSMVSAV  365

Query  1179  M--TRP  1190
             +  TRP
Sbjct  366   VTSTRP  371



>ref|XP_007010012.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY18822.1| Papain family cysteine protease [Theobroma cacao]
Length=382

 Score =   499 bits (1286),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/378 (62%), Positives = 296/378 (78%), Gaps = 8/378 (2%)
 Frame = +3

Query  63    NLSSRIAGGGLMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVR  242
              L+   A   L+++ +L++  C  L   +   Q   I QVTD+ IP              
Sbjct  8     TLTCTTAIAALIFSLILSL--CLAL---TEIPQEPTILQVTDNLIPTLNRKFSRNYVHKE  62

Query  243   FKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKM  422
             F+ F++++GK Y+T EEY++RLG+FAKNLIRAAEHQ+LDPTAVHGVT+FSDL+  EFE++
Sbjct  63    FQVFVEKYGKNYSTTEEYMHRLGIFAKNLIRAAEHQVLDPTAVHGVTQFSDLSEEEFERL  122

Query  423   YMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
             Y GV   +       + G  +EA  ++V GLPE+FDWR+KGAVTEVKMQG+CGSCWAFST
Sbjct  123   YTGVKGGMAAAAPRMMDGVGSEAEMVEVDGLPESFDWREKGAVTEVKMQGACGSCWAFST  182

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             TGAIEGANF+ATGKLL+LSEQQLVDCD  CDIKDK+ACD+GCSGGLMTNAY+YLIESGG+
Sbjct  183   TGAIEGANFVATGKLLSLSEQQLVDCDQMCDIKDKTACDNGCSGGLMTNAYKYLIESGGL  242

Query  774   EEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHT  953
             ++E SYPYTG+  DC+F+ +KVAVKV NFT +P DE+Q+AA LV  GPLAVG+NA +M T
Sbjct  243   QDENSYPYTGRREDCKFKPDKVAVKVVNFTKIPIDENQIAANLVIRGPLAVGLNAFFMQT  302

Query  954   YMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMC  1133
             Y+GGVSCP+IC K+ +NHGVLLVGYG KGFSIL+ G++PYWIIKNSWGK WGE GY+R+C
Sbjct  303   YIGGVSCPIICGKRWINHGVLLVGYGAKGFSILKFGYQPYWIIKNSWGKRWGEHGYYRLC  362

Query  1134  RGHGMCGISNMVSAVMTR  1187
             RGH MCG++ MVSAV T+
Sbjct  363   RGHAMCGMNTMVSAVATK  380



>emb|CAB41090.1| cysteine proteinase precursor-like protein [Arabidopsis thaliana]
Length=363

 Score =   498 bits (1282),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 245/370 (66%), Positives = 297/370 (80%), Gaps = 10/370 (3%)
 Frame = +3

Query  96    MYAQLLA-VLTCAHLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             M A+ LA ++TC  L     AS + L IRQVT D       NLLGT TE +F+ FM ++G
Sbjct  1     MVAKALAQLITCIILFCHVVASVEDLTIRQVTADN-RRIRPNLLGTHTESKFRLFMSDYG  59

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K Y+T EEY++RLG+FAKN+++AAEHQ++DP+AVHGVT+FSDLT  EF++MY GV  V G
Sbjct  60    KNYSTREEYIHRLGIFAKNVLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMYTGVADVGG  119

Query  450   -RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
              R   +G  AEAP ++V GLPE FDWR+KG VTEVK QG+CGSCWAFSTTGA EGA+F++
Sbjct  120   SRGGTVG--AEAPMVEVDGLPEDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVS  177

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKLL+LSEQQLVDCD      DK ACD+GC GGLMTNAYEYL+E+GG+EEE SYPYTGK
Sbjct  178   TGKLLSLSEQQLVDCDQA----DKKACDNGCGGGLMTNAYEYLMEAGGLEEERSYPYTGK  233

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+ EKVAV+V NFT +P DE+Q+AA LV HGPLAVG+NAV+M TY+GGVSCPLIC
Sbjct  234   RGHCKFDPEKVAVRVLNFTTIPLDENQIAANLVRHGPLAVGLNAVFMQTYIGGVSCPLIC  293

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+ +NHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WGE GY+++CRGH +CGI++M
Sbjct  294   SKRNVNHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINSM  353

Query  1167  VSAVMTRPGS  1196
             VSAV T+  S
Sbjct  354   VSAVATQVSS  363



>ref|XP_002266821.1| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
Length=375

 Score =   499 bits (1284),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 235/343 (69%), Positives = 290/343 (85%), Gaps = 8/343 (2%)
 Frame = +3

Query  168   NIRQVTD--DEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAA  341
             NI QVTD         + +LGT  E  F+ FM+++GKEY++ EEYV+RLG+FAKN++RAA
Sbjct  36    NIVQVTDGHSHRKFGVDGVLGTEKE--FRMFMEKYGKEYSSREEYVHRLGIFAKNMVRAA  93

Query  342   EHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAE-APRLDVSGLPETF  518
             EHQ LDPTA+HGVT FSDL+  EFE+M+ GV+   GR  + GG AE A  L+V GLPE+F
Sbjct  94    EHQALDPTALHGVTPFSDLSEEEFERMFTGVV---GRPHMKGGVAETAAALEVDGLPESF  150

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWR+KGAVTEVKMQG+CGSCWAFSTTGA+EGA+FI+T KLL LSEQQLVDCDH CDI+DK
Sbjct  151   DWREKGAVTEVKMQGTCGSCWAFSTTGAVEGAHFISTKKLLTLSEQQLVDCDHMCDIRDK  210

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPAD  878
             +ACD GC GGLMTNAY+YLIE+GG+EEE+SYPYTGK G+C+F+ ++VAV+V NFT +P +
Sbjct  211   TACDSGCEGGLMTNAYKYLIEAGGLEEESSYPYTGKHGECKFKPDRVAVRVVNFTEVPIN  270

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E+Q+AA LV HGPLAVG+NA++M TY+GGVSCPLIC K+ +NHGVLLVGYG KG+SILR 
Sbjct  271   ENQIAANLVCHGPLAVGLNAIFMQTYIGGVSCPLICPKRWINHGVLLVGYGAKGYSILRF  330

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             G+KPYWIIKNSWGK WGE GY+R+CRGHGMCG++ MVSAV+T+
Sbjct  331   GYKPYWIIKNSWGKRWGEHGYYRLCRGHGMCGMNTMVSAVVTQ  373



>ref|XP_010243268.1| PREDICTED: cysteine proteinase 15A [Nelumbo nucifera]
Length=370

 Score =   498 bits (1283),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/368 (64%), Positives = 291/368 (79%), Gaps = 5/368 (1%)
 Frame = +3

Query  87    GGLMYAQLLAVLTCAHL--AFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQ  260
             G L +   +  LTC     A    + +   I QVTDD             TE +F+SF+ 
Sbjct  4     GALTFTVGVVALTCTLTVSAVLGGSIEEPRIFQVTDDPTSRKFGGDWHLGTERKFQSFVN  63

Query  261   EHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLK  440
             ++GK+Y+T EEY+YRLGVFAKN+IRAAE+Q LDPTAVHGVT+FSDLT +EFE+++ G   
Sbjct  64    KYGKKYSTREEYLYRLGVFAKNIIRAAENQALDPTAVHGVTKFSDLTEDEFERLFTGFR-  122

Query  441   VPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANF  620
               G +      A AP ++V  LP  FDWR KGAVT+VKMQG+CG+CWAFSTTGA+EGANF
Sbjct  123   --GGSPFNDVSATAPTMEVKRLPRNFDWRKKGAVTDVKMQGTCGACWAFSTTGAVEGANF  180

Query  621   IATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYT  800
             IATGKL++LSEQQLVDCDH CD  D+++CD GC GGLMTNAY+YL+E+GG+EEE +YPYT
Sbjct  181   IATGKLVSLSEQQLVDCDHMCDKTDRTSCDSGCGGGLMTNAYKYLMEAGGLEEEETYPYT  240

Query  801   GKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
             GK G+C+F  EKVAV+V NFTN+P DE+Q+AA+LV+HGPLAVG+NA +M TY+GGVSCPL
Sbjct  241   GKPGECKFNPEKVAVRVVNFTNIPLDENQIAAHLVHHGPLAVGLNAAFMQTYIGGVSCPL  300

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             IC KK LNHGVLLVGYG KGFSILRLG++PYWIIKNSWGK+WGE+GY+R+CRGHG+CGI+
Sbjct  301   ICPKKWLNHGVLLVGYGAKGFSILRLGYRPYWIIKNSWGKEWGEQGYYRLCRGHGVCGIN  360

Query  1161  NMVSAVMT  1184
              MVS+V T
Sbjct  361   TMVSSVAT  368



>ref|XP_010688493.1| PREDICTED: cysteine proteinase 15A [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   498 bits (1283),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/374 (63%), Positives = 286/374 (76%), Gaps = 12/374 (3%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKE  275
             ++  L+  +      F +  S   N    + + I    EN      E +F SF++E+GKE
Sbjct  6     LFGVLILWIATTSFMFVTLVS-AENYTSFSHNNIYQVTENRKLVGAERKFVSFIKEYGKE  64

Query  276   YATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRA  455
             Y T EEYV RL +FA+NL+RAAEHQ LDPTAVHGVT F DL+P EFE  + G+   P R+
Sbjct  65    YNTKEEYVRRLAIFARNLVRAAEHQALDPTAVHGVTPFMDLSPEEFETRFTGLR--PSRS  122

Query  456   SLLGG---------KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIE  608
                 G         + EAPRLDV GLP++FDWR+KGAVT+VKMQG+CGSCWAFSTTGA+E
Sbjct  123   GRGAGDGFMNSEGLRPEAPRLDVRGLPKSFDWREKGAVTDVKMQGTCGSCWAFSTTGALE  182

Query  609   GANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEAS  788
             GANFIATGKLLNLSEQQLVDCDH CD+  K  CD+GC GGLMTNAY YL+E+GG+EEE S
Sbjct  183   GANFIATGKLLNLSEQQLVDCDHKCDVNKKHECDNGCHGGLMTNAYNYLMEAGGLEEEDS  242

Query  789   YPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGV  968
             YPY+GK G C+F+ +KVAVKV NFT +P DE+Q+AAYLV+ GPLAVG+NAV+M TY+GGV
Sbjct  243   YPYSGKQGKCQFDPDKVAVKVANFTTIPIDEEQIAAYLVHQGPLAVGLNAVFMQTYIGGV  302

Query  969   SCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGM  1148
             SCPLIC K+ +NHGVLLVGYG KG+SILR G+KPYWIIKNSWG  WGE GY+++CRGHGM
Sbjct  303   SCPLICGKRWINHGVLLVGYGAKGYSILRFGYKPYWIIKNSWGTKWGENGYYKLCRGHGM  362

Query  1149  CGISNMVSAVMTRP  1190
             CGI+ MVSAV+T+P
Sbjct  363   CGINTMVSAVVTQP  376



>ref|XP_010504326.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=363

 Score =   497 bits (1280),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 241/371 (65%), Positives = 294/371 (79%), Gaps = 12/371 (3%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAF---ASSASQGLNIRQVTDD-EIPAAGENLLGTATEVRFKSFMQE  263
             M A+ LA L    + F    +S    + IRQVTD         NLLGT TE +F+ FM +
Sbjct  1     MVAKALAQLITCTIFFCHVVASIDDMITIRQVTDGGRRVRPTLNLLGTHTESKFQVFMSD  60

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
             +GK Y+T EEYV+RLG+FAKN+++AAEHQ++DPTAVHGVT+FSDLT +EF++MY GV  V
Sbjct  61    YGKSYSTREEYVHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEDEFKRMYTGVADV  120

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
               R S +   AEAP +DV GLP+ FDWR+KG VTEVK QG+CGSCWAFSTTGA EGA+F+
Sbjct  121   D-RGSGVTVGAEAPMVDVEGLPDDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFV  179

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             +TGKLL+LSEQQLVDCD       K+ CD+GC GGLMTNAYEYL+E+GG+EEE SYPYTG
Sbjct  180   STGKLLSLSEQQLVDCD-------KAVCDNGCGGGLMTNAYEYLMEAGGLEEEKSYPYTG  232

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
             K G C+F+  KVAVKV NFT +P DE+Q+AA LV HGPLAVG+NAV+M TY+GGVSCPLI
Sbjct  233   KKGQCKFDPAKVAVKVANFTTIPLDENQIAANLVRHGPLAVGLNAVFMQTYIGGVSCPLI  292

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CSK+++NHGVLLVGYG KGFSILRL  KPYWIIKNSWGK WGE+GY+++CRGH +CGI++
Sbjct  293   CSKRKINHGVLLVGYGSKGFSILRLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINS  352

Query  1164  MVSAVMTRPGS  1196
             MVSAV T+  S
Sbjct  353   MVSAVATQVSS  363



>ref|XP_011094506.1| PREDICTED: cysteine proteinase 15A [Sesamum indicum]
Length=366

 Score =   493 bits (1270),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 250/373 (67%), Positives = 295/373 (79%), Gaps = 12/373 (3%)
 Frame = +3

Query  78    IAGGGLMYAQLLAVLTCAHLAFA---SSASQGLNIRQVTDDEIPAAGENLLGTATEVRFK  248
             + GGGL+YA  +  +            S    + I QVT++    A  +LLGTA E+RFK
Sbjct  1     MKGGGLVYAVGVGSVLALLTCALALHESPQDDVKILQVTENY--HANHHLLGTAAELRFK  58

Query  249   SFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYM  428
                    KEY T  EY++RLG+FAKNLIRAAEHQ +DPTAVHGVT+FSDL+  EFE MYM
Sbjct  59    -------KEYPTRAEYLHRLGIFAKNLIRAAEHQAIDPTAVHGVTQFSDLSEEEFEGMYM  111

Query  429   GVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIE  608
             GV    G A    G A A  LDV  LPE+FDWR++GAVT+VKMQG+CGSCWAFSTTGAIE
Sbjct  112   GVKGGGGAAPWENGVAAAEELDVGSLPESFDWREEGAVTDVKMQGTCGSCWAFSTTGAIE  171

Query  609   GANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEAS  788
             GANFIATGKLLNLSEQQLVDCDH CD K++ ACDDGC GGLMTNAY+YLIE+GGIEEE S
Sbjct  172   GANFIATGKLLNLSEQQLVDCDHACDAKERRACDDGCMGGLMTNAYKYLIEAGGIEEEES  231

Query  789   YPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGV  968
             YPYTGK G+C+F  EKVAV+V NFT +P +E+Q+AA+LV HGPLAVG+NAV+M TY+GGV
Sbjct  232   YPYTGKRGECKFRPEKVAVRVANFTTIPINENQIAAHLVRHGPLAVGLNAVFMQTYIGGV  291

Query  969   SCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGM  1148
             SCPLIC K+ +NHGVLLVGYG +G+SILRLG+KPYWIIKNSWGK WGE GY+R+CRGHGM
Sbjct  292   SCPLICGKRWVNHGVLLVGYGSRGYSILRLGYKPYWIIKNSWGKRWGEHGYYRLCRGHGM  351

Query  1149  CGISNMVSAVMTR  1187
             CG++ MVSAVMT+
Sbjct  352   CGMNTMVSAVMTQ  364



>ref|XP_008446834.1| PREDICTED: cysteine proteinase 15A [Cucumis melo]
Length=371

 Score =   493 bits (1268),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 232/341 (68%), Positives = 280/341 (82%), Gaps = 6/341 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             +RQVTD EI     N L   +E +F  FM+++GK Y T +EY++RLG+F KNLIRAAEHQ
Sbjct  34    LRQVTDGEI----FNNLPAGSERKFAMFMEKYGKSYPTRKEYLHRLGIFVKNLIRAAEHQ  89

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKAEAPRLDVSGLPETFDW  524
              LDPTAVHGVT+FSDL+  EFE+M+MGV    G A L  +    E    +V GLPE FDW
Sbjct  90    ALDPTAVHGVTQFSDLSEEEFERMFMGVRGGAGGAGLPEMNQAVEVSAEEVKGLPERFDW  149

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAVT VKMQG+CGSCWAFST GA+EGANFIATGKLLNLSEQQLVDCDHTCD  DK+A
Sbjct  150   REKGAVTGVKMQGTCGSCWAFSTCGAVEGANFIATGKLLNLSEQQLVDCDHTCDPTDKTA  209

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADED  884
             C++GC+GGLMTNAY+YLI+SGG+EEE+SYPYTG+ G C F+S+K+AVKV NFT +P DE+
Sbjct  210   CNNGCNGGLMTNAYKYLIQSGGLEEESSYPYTGRSGQCNFQSDKIAVKVSNFTTIPIDEN  269

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             Q+AA+LV  GPLAVG+NAV+M TY+GGVSCPLIC K+ +NHGVL+VGYG +GFSILR   
Sbjct  270   QIAAHLVRSGPLAVGLNAVFMQTYIGGVSCPLICGKRFVNHGVLMVGYGDEGFSILRFRK  329

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
              PYWIIKNSWG+ WGE GY+R+CRGHGMCGI+ MVSAV+T+
Sbjct  330   LPYWIIKNSWGERWGEHGYYRLCRGHGMCGINTMVSAVVTQ  370



>ref|XP_010034320.1| PREDICTED: cysteine proteinase 1 [Eucalyptus grandis]
 gb|KCW51545.1| hypothetical protein EUGRSUZ_J01054 [Eucalyptus grandis]
Length=367

 Score =   491 bits (1265),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 269/322 (84%), Gaps = 3/322 (1%)
 Frame = +3

Query  231   TEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNE  410
             TE RF  FM+++GK Y+T EEY  RLG+FA NL RAAEHQ LDPTAVHGVT FSDL+P E
Sbjct  44    TERRFHIFMRKYGKSYSTREEYARRLGIFAGNLARAAEHQALDPTAVHGVTPFSDLSPEE  103

Query  411   FEKMYMGVLKVPGRASLLG---GKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCW  581
             FE +Y GV    G           A A   +V+GLPE+FDWR+KGAVTEVKMQG CGSCW
Sbjct  104   FEMLYTGVRGGGGSLGSSSNGVASAVATEEEVNGLPESFDWREKGAVTEVKMQGVCGSCW  163

Query  582   AFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIE  761
             AFSTTGA+EGANFIATGKLLNLSEQQLVDCD TCD+ DK+ACD GC GGLMTNAY YLIE
Sbjct  164   AFSTTGAVEGANFIATGKLLNLSEQQLVDCDSTCDLSDKTACDSGCHGGLMTNAYRYLIE  223

Query  762   SGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAV  941
             +GG+EEE+SYPYTGK G+C+FES+K+AV+V NFT +P DEDQ+AA+LV HGPLAVG+NAV
Sbjct  224   AGGLEEESSYPYTGKRGECKFESDKIAVRVVNFTTIPIDEDQIAAHLVKHGPLAVGLNAV  283

Query  942   YMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGY  1121
             +M TY+GGVSCP+IC K+ +NHGVLLVGYG KGFSI+RLG +PYWIIKNSWGK WGE GY
Sbjct  284   FMQTYIGGVSCPIICGKRWVNHGVLLVGYGAKGFSIIRLGNRPYWIIKNSWGKRWGEHGY  343

Query  1122  FRMCRGHGMCGISNMVSAVMTR  1187
             +R+CRG GMCG++ MVSAV+TR
Sbjct  344   YRLCRGQGMCGMNTMVSAVVTR  365



>emb|CAN64491.1| hypothetical protein VITISV_015725 [Vitis vinifera]
Length=321

 Score =   489 bits (1259),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 275/319 (86%), Gaps = 4/319 (1%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F+ FM+++GKEY++ EEYV+RLG+FAKN++RAAEHQ LDP A+HGVT FSDL+  EF
Sbjct  4     EKEFRMFMEKYGKEYSSREEYVHRLGIFAKNMVRAAEHQALDPXALHGVTPFSDLSEEEF  63

Query  414   EKMYMGVLKVPGRASLLGGKAE-APRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFS  590
             E+M+ GV+   GR  + GG AE A  L+V GLPE+FDWR+KGAVTEVKMQG+CGSCWAFS
Sbjct  64    ERMFTGVV---GRPHMKGGVAETAAALEVDGLPESFDWREKGAVTEVKMQGTCGSCWAFS  120

Query  591   TTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGG  770
             TTGA+EGA+FI+T KLL LSEQQLVDCDH CDI+DK ACD GC GGLMTNAY+YLIE+GG
Sbjct  121   TTGAVEGAHFISTKKLLTLSEQQLVDCDHMCDIRDKXACDSGCEGGLMTNAYKYLIEAGG  180

Query  771   IEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             +EEE+SYPYTGK G+C+F+ ++VAV+V NFT +P +E+Q+AA LV HGPLAVG+NA +M 
Sbjct  181   LEEESSYPYTGKHGECKFKPDRVAVRVVNFTEVPIBENQIAANLVCHGPLAVGLNAXFMQ  240

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCPLIC K+ +NHGVLLVGYG KG+SILR G+KPYWIIKNSWG  WGE GY+R+
Sbjct  241   TYIGGVSCPLICPKRWINHGVLLVGYGAKGYSILRFGYKPYWIIKNSWGXRWGEHGYYRL  300

Query  1131  CRGHGMCGISNMVSAVMTR  1187
             CRGHGMCG++ MVSAV+T+
Sbjct  301   CRGHGMCGMNTMVSAVVTQ  319



>gb|KEH43476.1| papain family cysteine protease [Medicago truncatula]
Length=381

 Score =   491 bits (1264),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 273/324 (84%), Gaps = 5/324 (2%)
 Frame = +3

Query  231   TEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNE  410
             TE +FK FMQ++ K Y+T EEY+ RLG+FAKNL++A EHQ LDPTA+HGVT+FSDL+  E
Sbjct  52    TEKKFKVFMQDYSKSYSTREEYLLRLGIFAKNLVKAVEHQALDPTAIHGVTQFSDLSDEE  111

Query  411   FEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFS  590
             FE+ Y GV    G  S  G    AP LDV GLPE FDWR+KGAVT VKMQG+CGSCWAFS
Sbjct  112   FERFYTGVRG--GFPSSNGVGEVAPPLDVEGLPENFDWREKGAVTGVKMQGTCGSCWAFS  169

Query  591   TTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGG  770
             TTG+IEGANF+ATGKLL+LSEQQLVDCD  CDI DK++CD+GC+GGLMTNAY YL+E+GG
Sbjct  170   TTGSIEGANFLATGKLLSLSEQQLVDCDSKCDITDKTSCDNGCNGGLMTNAYNYLLEAGG  229

Query  771   IEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             +EEE +YPYTG  G+C+F+ +K+AVK+ NFTN+P DE+Q+AAYLVNHGPLA+G+NAV+M 
Sbjct  230   LEEENAYPYTGGKGECKFDPKKIAVKITNFTNIPVDENQIAAYLVNHGPLAMGVNAVFMQ  289

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCPLICSK+ LNHGVLLVGY  +GFSILRL  KPYWIIKNSWG+ WGE+GY+++
Sbjct  290   TYIGGVSCPLICSKRMLNHGVLLVGYNSQGFSILRLRKKPYWIIKNSWGERWGEKGYYKL  349

Query  1131  CRGHGMCGISNMVSAVM---TRPG  1193
             CRGHGMCG++ MVSA M   T+P 
Sbjct  350   CRGHGMCGMNTMVSAAMVAQTQPA  373



>gb|KDP30486.1| hypothetical protein JCGZ_16165 [Jatropha curcas]
Length=383

 Score =   491 bits (1263),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 239/363 (66%), Positives = 287/363 (79%), Gaps = 7/363 (2%)
 Frame = +3

Query  105   QLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGEN--LLGTATEVRFKSFMQEHGKEY  278
             Q+++  T A      +A Q  NI QVTD+      ++  LLGT  E  FK FM+++ KEY
Sbjct  24    QVVSATTTASFG-GDAALQDPNILQVTDNPNRKFLKDGGLLGT--EENFKIFMKKYNKEY  80

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
              + EEY++RLGVFAKN+IRA EHQ+LDPTA+HGVT F DLT  EFEKMY     V G   
Sbjct  81    GSREEYMHRLGVFAKNMIRAVEHQVLDPTAIHGVTPFMDLTEEEFEKMY--TGVVGGGRV  138

Query  459   LLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
                       L+  GLPE FDWR KGAVT+VKMQG+CGSCWAFSTTGAIEGANFIATGKL
Sbjct  139   GFVEDVTTSFLETRGLPENFDWRKKGAVTDVKMQGACGSCWAFSTTGAIEGANFIATGKL  198

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
             LNLSEQQLVDCD+ CD+ DK+ACD GC GGLMTNAY YL+E+GG+EEE+SYPYTGK G+C
Sbjct  199   LNLSEQQLVDCDNKCDMVDKTACDSGCGGGLMTNAYRYLMEAGGLEEESSYPYTGKRGEC  258

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+ EK+AV+V NFTN+  +EDQ+AA+LV++GPLAVG+NA++M TY+GGVSCPLIC KK 
Sbjct  259   KFDKEKIAVRVANFTNIAINEDQIAAHLVHYGPLAVGLNAIFMQTYIGGVSCPLICGKKW  318

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +NHGVLLVGYG KGFSILRL  KPYWIIKNSWG  WGEEGY+R+CRGHGMCG++ MVSAV
Sbjct  319   INHGVLLVGYGAKGFSILRLSNKPYWIIKNSWGTQWGEEGYYRVCRGHGMCGMNRMVSAV  378

Query  1179  MTR  1187
             +T+
Sbjct  379   VTQ  381



>ref|XP_008802783.1| PREDICTED: probable cysteine proteinase A494 [Phoenix dactylifera]
Length=389

 Score =   489 bits (1260),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 231/347 (67%), Positives = 280/347 (81%), Gaps = 5/347 (1%)
 Frame = +3

Query  138   AFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVF  317
             A AS   +   IR VTD     AG   +G ATE+RF++FM+ +GKEY + EEY  RLGVF
Sbjct  39    AGASDPLEDPKIRPVTD----LAGHRRVG-ATELRFRAFMRRYGKEYGSLEEYGRRLGVF  93

Query  318   AKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDV  497
             AKNL RAAEHQ LDPTAVHG+T FSDLT  EFE+ +MG+     +         APR++V
Sbjct  94    AKNLARAAEHQALDPTAVHGITPFSDLTEEEFERAFMGMAAKDDKGGASVEYPTAPRMEV  153

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
              GLP +FDWR+KGAVT+VK QGSCGSCWAFSTTGA+EGANFIATGKLL+LSEQQL+DCDH
Sbjct  154   DGLPSSFDWREKGAVTDVKKQGSCGSCWAFSTTGAVEGANFIATGKLLSLSEQQLIDCDH  213

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGN  857
             TCD  +K AC++GC+GGLMTN+Y+YL+++GG++E+ SYPYTGK G+CRF   KVAV+V N
Sbjct  214   TCDTVEKDACNNGCNGGLMTNSYKYLMQAGGLQEDKSYPYTGKQGECRFNKSKVAVRVTN  273

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             FTN+P DEDQ+ A LV+HGPLAVG+NA +M TY+ GVSCPLIC K+ LNHGVLLVGYG +
Sbjct  274   FTNIPLDEDQIMANLVHHGPLAVGLNAAFMQTYVRGVSCPLICFKRWLNHGVLLVGYGAR  333

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             GFSILRLG++PYWIIKNSWGK WGE GY+R+CRGH +CGI +MVSAV
Sbjct  334   GFSILRLGYRPYWIIKNSWGKHWGENGYYRLCRGHNICGIDSMVSAV  380



>ref|XP_004496226.1| PREDICTED: cysteine proteinase 15A-like [Cicer arietinum]
Length=387

 Score =   489 bits (1260),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 273/324 (84%), Gaps = 4/324 (1%)
 Frame = +3

Query  231   TEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNE  410
             TE +FK FM+++ K Y+T EEY+ RLG+FA+N+++AAEHQ+LDPTA+HG+T+FSDL+  E
Sbjct  56    TEKKFKVFMEDYSKRYSTREEYLLRLGIFARNMVKAAEHQVLDPTAIHGITQFSDLSEEE  115

Query  411   FEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFS  590
             FE+ Y GV      AS   G+  AP LDV GLPE FDWR+KGAVT VKMQG CGSCWAFS
Sbjct  116   FERFYTGVKGGGLLASNAAGEV-APPLDVEGLPENFDWREKGAVTGVKMQGKCGSCWAFS  174

Query  591   TTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGG  770
             TTG++EGANF+ATGKLL+LSEQQLVDCD+ CDI +K++CD+GC GGLMTNAY YLIE+GG
Sbjct  175   TTGSVEGANFLATGKLLSLSEQQLVDCDNKCDITEKTSCDNGCYGGLMTNAYNYLIEAGG  234

Query  771   IEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             +EEE SYPYTG  G+C+F+ EKVAV++ NFTN+P DE+Q+AAYLV HGPLA+G+NA++M 
Sbjct  235   LEEETSYPYTGDRGECKFDPEKVAVRITNFTNIPVDENQIAAYLVKHGPLAMGVNAIFMQ  294

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCPLICSK+ LNHGVLLVGY  KGFSILR   KPYWIIKNSWG+ WGE+GY+++
Sbjct  295   TYIGGVSCPLICSKRMLNHGVLLVGYNSKGFSILRFRKKPYWIIKNSWGERWGEKGYYKL  354

Query  1131  CRGHGMCGISNMVSAVM---TRPG  1193
             CRGHGMCG++ MVSA M   T+P 
Sbjct  355   CRGHGMCGMNTMVSAAMVAQTQPA  378



>ref|XP_004157559.1| PREDICTED: cysteine proteinase 15A-like [Cucumis sativus]
Length=406

 Score =   490 bits (1261),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 244/396 (62%), Positives = 295/396 (74%), Gaps = 16/396 (4%)
 Frame = +3

Query  33    DKAAGPPE*TNLSSRIAGGGLMYAQLLAVLTCA-HLAFASSASQGLN--------IRQVT  185
             DKA   P  T   +R      M   +  +L CA  LA   SA             +RQVT
Sbjct  15    DKARKAPLPTG-KTRTRSKNKMATAVTLLLACAISLALLISAIPSATALRRDPEFLRQVT  73

Query  186   DDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPT  365
             D EI     N L   +E +F  FM+++GK Y T +EY++R G+F KNLIRAAEHQ LDPT
Sbjct  74    DGEI----FNNLPAGSERKFVMFMEKYGKSYPTRKEYLHRFGIFVKNLIRAAEHQALDPT  129

Query  366   AVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKAEAPRLDVSGLPETFDWRDKGA  539
             AVHGVT+FSDL+  EFE+M+MGV    G   L  +    E    +V GLPE FDWRDKGA
Sbjct  130   AVHGVTQFSDLSEEEFERMFMGVRGGAGGEGLPEMNQAVEVTAEEVKGLPERFDWRDKGA  189

Query  540   VTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGC  719
             VTEVKMQG+CGSCWAFST GA+EGANFIATG LLNLSEQQLVDCDHTCD  DK+AC++GC
Sbjct  190   VTEVKMQGTCGSCWAFSTCGAVEGANFIATGNLLNLSEQQLVDCDHTCDPTDKTACNNGC  249

Query  720   SGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAY  899
             +GGLMTNAY+YLI+SGG+EEE+SYPYTG+ G C F+S+K+AVKV NFT +P DE+Q+AA+
Sbjct  250   NGGLMTNAYKYLIQSGGLEEESSYPYTGRSGQCNFQSDKIAVKVSNFTTIPIDENQIAAH  309

Query  900   LVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWI  1079
             LV  GPLAVG+NAV+M TY+GGVSCPLIC K+ +NHGVL+VGYG +GFSILR    PYW+
Sbjct  310   LVRSGPLAVGLNAVFMQTYIGGVSCPLICGKRFVNHGVLMVGYGDEGFSILRFRKLPYWV  369

Query  1080  IKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             IKNSWG+ WGE GY+R+CRGHGMCGI+ MVSAV+T+
Sbjct  370   IKNSWGERWGEHGYYRLCRGHGMCGINTMVSAVVTQ  405



>ref|XP_004142497.1| PREDICTED: cysteine proteinase 15A-like [Cucumis sativus]
 gb|KGN52244.1| hypothetical protein Csa_5G622590 [Cucumis sativus]
Length=406

 Score =   490 bits (1261),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 244/396 (62%), Positives = 295/396 (74%), Gaps = 16/396 (4%)
 Frame = +3

Query  33    DKAAGPPE*TNLSSRIAGGGLMYAQLLAVLTCA-HLAFASSASQGLN--------IRQVT  185
             DKA   P  T   +R      M   +  +L CA  LA   SA             +RQVT
Sbjct  15    DKARKAPLPTG-KTRTRSKNKMATAVTLLLACAISLALLISAIPSATALRRDPEFLRQVT  73

Query  186   DDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPT  365
             D EI     N L   +E +F  FM+++GK Y T +EY++R G+F KNLIRAAEHQ LDPT
Sbjct  74    DGEI----FNNLPAGSERKFVMFMEKYGKSYPTRKEYLHRFGIFVKNLIRAAEHQALDPT  129

Query  366   AVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKAEAPRLDVSGLPETFDWRDKGA  539
             AVHGVT+FSDL+  EFE+M+MGV    G   L  +    E    +V GLPE FDWRDKGA
Sbjct  130   AVHGVTQFSDLSEEEFERMFMGVRGGAGGEGLPEMNQAVEVTAEEVKGLPERFDWRDKGA  189

Query  540   VTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGC  719
             VTEVKMQG+CGSCWAFST GA+EGANFIATG LLNLSEQQLVDCDHTCD  DK+AC++GC
Sbjct  190   VTEVKMQGTCGSCWAFSTCGAVEGANFIATGNLLNLSEQQLVDCDHTCDPTDKTACNNGC  249

Query  720   SGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAY  899
             +GGLMTNAY+YLI+SGG+EEE+SYPYTG+ G C F+S+K+AVKV NFT +P DE+Q+AA+
Sbjct  250   NGGLMTNAYKYLIQSGGLEEESSYPYTGRSGQCNFQSDKIAVKVSNFTTIPIDENQIAAH  309

Query  900   LVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWI  1079
             LV  GPLAVG+NAV+M TY+GGVSCPLIC K+ +NHGVL+VGYG +GFSILR    PYW+
Sbjct  310   LVRSGPLAVGLNAVFMQTYIGGVSCPLICGKRFVNHGVLMVGYGDEGFSILRFRKLPYWV  369

Query  1080  IKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTR  1187
             IKNSWG+ WGE GY+R+CRGHGMCGI+ MVSAV+T+
Sbjct  370   IKNSWGERWGEHGYYRLCRGHGMCGINTMVSAVVTQ  405



>ref|XP_010918606.1| PREDICTED: probable cysteine proteinase A494 [Elaeis guineensis]
Length=376

 Score =   488 bits (1257),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 233/362 (64%), Positives = 284/362 (78%), Gaps = 10/362 (3%)
 Frame = +3

Query  102   AQLLAVLTCAHLAFASSASQGL---NIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGK  272
             A L AVL    L+F+  AS  +    IR VTD     AG   +G ATE RF++FM+ +GK
Sbjct  13    AVLAAVLYL--LSFSPGASDPIEDPKIRPVTD----LAGHRRVG-ATERRFRAFMRRYGK  65

Query  273   EYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGR  452
             EY + EEY +RLGVFA+NL RAAEHQ LDPTAVHG+T FSDLT  EFE+ ++G++    +
Sbjct  66    EYGSREEYGHRLGVFARNLARAAEHQALDPTAVHGITPFSDLTAEEFERAFLGIVAKDDK  125

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
                      APR++V GLP  FDWR KGAVT+VKMQGSCGSCWAFSTTGA+EGANFIATG
Sbjct  126   GGASAESPTAPRMEVDGLPSNFDWRKKGAVTDVKMQGSCGSCWAFSTTGAVEGANFIATG  185

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             KLL+LSEQQLVDCDHTCD  +K AC++GCSGGLMTN+Y+YL+++GG+EEE SYPY GK G
Sbjct  186   KLLSLSEQQLVDCDHTCDAVEKDACNNGCSGGLMTNSYKYLMQAGGLEEEKSYPYMGKQG  245

Query  813   DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSK  992
             +CRF    VAV++ NFTN P DEDQ+ A LV+HGPLAVG+NA +M TY+ G+SCPLIC +
Sbjct  246   ECRFNKSLVAVRITNFTNKPLDEDQIMANLVHHGPLAVGLNAAFMQTYVRGISCPLICFR  305

Query  993   KRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVS  1172
             + +NHGVLLVGYG +GFSILRLG++PYWIIKNSWGK WGE GY+R+CR H +CGI +MVS
Sbjct  306   RWINHGVLLVGYGARGFSILRLGYRPYWIIKNSWGKRWGENGYYRLCRDHNICGIDSMVS  365

Query  1173  AV  1178
             AV
Sbjct  366   AV  367



>ref|XP_004307346.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=376

 Score =   486 bits (1250),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 241/361 (67%), Positives = 287/361 (80%), Gaps = 9/361 (2%)
 Frame = +3

Query  111   LAVLTCA-HLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYAT  284
             +AVL CA  L  A   S Q   I QVTD +       LLGT  E  FK FM+++GK+Y T
Sbjct  17    VAVLICALTLCVALDVSPQDPIIHQVTDHDT----NKLLGTEKE--FKIFMEKYGKKYPT  70

Query  285   HEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLL  464
              +EY++RLGVFAKN+IRAAEHQ LDPTAVHGVT FSDL   EF++MY GV   PG  +  
Sbjct  71    MKEYMHRLGVFAKNMIRAAEHQALDPTAVHGVTPFSDLEEEEFKRMYTGVRGAPGLTNGG  130

Query  465   GGK-AEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLL  641
             GG  +    LDVSGLPE+FDWR+KGAVTEVKMQG CGSCWAFSTTGAIEGANFIATGKL+
Sbjct  131   GGAGSTVELLDVSGLPESFDWREKGAVTEVKMQGGCGSCWAFSTTGAIEGANFIATGKLV  190

Query  642   NLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCR  821
             +LSEQQLVDCDH CD K+K ACD GC GGLMTNAY+YL+E+GG+++E SYPYTGK G+C+
Sbjct  191   SLSEQQLVDCDHQCDAKEKDACDRGCGGGLMTNAYKYLMEAGGLQDEVSYPYTGKKGECK  250

Query  822   FESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRL  1001
             F  EKVAV+V NFT +P DE+Q+AA LV++GPLA+G+NA++M TY+GGVSCPL+C KK +
Sbjct  251   FNPEKVAVRVTNFTTIPLDENQIAANLVHNGPLAIGLNAMFMQTYIGGVSCPLVCFKKWV  310

Query  1002  NHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             NHG  LVGYG+ GFSILRL  KPYWIIKNSW   WGE GY+R+CRGHGMCG++ MVSAV+
Sbjct  311   NHGGSLVGYGESGFSILRLSNKPYWIIKNSWSAKWGEHGYYRLCRGHGMCGMNTMVSAVV  370

Query  1182  T  1184
             T
Sbjct  371   T  371



>gb|AAD46920.1|AF167986_1 putative cysteine proteinase GmPM33 [Glycine max]
Length=363

 Score =   481 bits (1237),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 228/366 (62%), Positives = 286/366 (78%), Gaps = 23/366 (6%)
 Frame = +3

Query  84    GGGLMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQE  263
             G  LM    +++  CA      SA+ G    Q    ++      LL   TE +FK FM+ 
Sbjct  6     GHALMCLARVSLFLCA---LTLSAAHGSTTVQDIARKLKLGDNELL--RTEKKFKVFMEN  60

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
             +G+ Y+T EEY+ RLG+FA+N++RAAEHQ LDPTAVHGVT+FS                +
Sbjct  61    YGRSYSTEEEYLRRLGIFAQNMVRAAEHQALDPTAVHGVTQFS----------------L  104

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P   +  GG A  P L+V GLPE FDWR+KGAVTEVK+QG CGSCWAFSTTG+IEGANF+
Sbjct  105   PVSNNAAGGIA--PPLEVDGLPENFDWREKGAVTEVKLQGRCGSCWAFSTTGSIEGANFL  162

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKL++LS+QQL+DCD+ CDI +K++CD+GC+GGLMTNAY YL+ESGG+EEE+SYPYTG
Sbjct  163   ATGKLVSLSDQQLLDCDNKCDITEKTSCDNGCNGGLMTNAYNYLLESGGLEEESSYPYTG  222

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
             + G+C+F+ EK+AVK+ NFTN+PADE+Q+AAYLV +GPLA+G+NA++M TY+GGVSCPLI
Sbjct  223   ERGECKFDPEKIAVKITNFTNIPADENQIAAYLVKNGPLAMGVNAIFMQTYIGGVSCPLI  282

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CSKKRLNHGVLLVGYG KGFSILRLG KPYWIIKNSWG+ WGE+GY+++CRGHGMCGI+ 
Sbjct  283   CSKKRLNHGVLLVGYGAKGFSILRLGNKPYWIIKNSWGEKWGEDGYYKLCRGHGMCGINT  342

Query  1164  MVSAVM  1181
             MVSA M
Sbjct  343   MVSAAM  348



>gb|EPS63354.1| hypothetical protein M569_11429, partial [Genlisea aurea]
Length=352

 Score =   479 bits (1233),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/361 (63%), Positives = 281/361 (78%), Gaps = 19/361 (5%)
 Frame = +3

Query  120   LTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYV  299
               C    FA        I QVT          ++  A E+RF +F++E+GK Y T +EY+
Sbjct  2     FACLSCCFAGRHESDPIILQVTTQG------GVVDPAAELRFNTFIREYGKVYPTPKEYL  55

Query  300   YRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAE  479
             +RLG+FA NLIRAAEHQ LDPTAVHGVT+FSDL+  EFE  Y+G+          GG A+
Sbjct  56    HRLGIFAGNLIRAAEHQALDPTAVHGVTQFSDLSEEEFENAYLGLKSA-------GGGAD  108

Query  480   APRLDVS------GLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLL  641
             +PR + +       LPE+FDWR+KGAVT+VKMQG+CGSCWAF+TTGAIEGANFIATGKLL
Sbjct  109   SPRQNAAVEDDGGDLPESFDWREKGAVTDVKMQGACGSCWAFTTTGAIEGANFIATGKLL  168

Query  642   NLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCR  821
             NLSEQQLVDCDH+CD   K+ACD+GCSGGLMTNAY+YL+ESGGIEEE SYPYTG+ G C+
Sbjct  169   NLSEQQLVDCDHSCDATKKTACDNGCSGGLMTNAYKYLMESGGIEEERSYPYTGRRGPCK  228

Query  822   FESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRL  1001
             F+ +K+AVKV NF+ +P DEDQ+AA+LV  GPLAVG+NA++M +Y+ GVSCPLIC +K +
Sbjct  229   FKPDKIAVKVANFSTVPIDEDQIAAHLVRRGPLAVGLNAIFMQSYIRGVSCPLICGEKWV  288

Query  1002  NHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             NHGVLLVGY  +G+SILRLG+KPYWI+KNSWG+ WGE GY+R+CRGH MCG++ MVSAV+
Sbjct  289   NHGVLLVGYASRGYSILRLGYKPYWIMKNSWGRRWGESGYYRLCRGHAMCGMNTMVSAVV  348

Query  1182  T  1184
             T
Sbjct  349   T  349



>emb|CAB16316.1| cysteine proteinase precursor [Vicia sativa]
Length=379

 Score =   479 bits (1233),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 225/357 (63%), Positives = 285/357 (80%), Gaps = 7/357 (2%)
 Frame = +3

Query  111   LAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHE  290
             +A+  CA L  +SS      I+ V   ++     +LL   TE +FK FM+++ K+Y+T E
Sbjct  15    VAIFLCA-LTLSSSLHHETLIQDVAR-KLELKDNDLL--TTEKKFKLFMKDYSKKYSTTE  70

Query  291   EYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGG  470
             EY+ RLG+FAKN+++AAEHQ LDPTA+HGVT+FSDL+  EFE+ Y G       ++  GG
Sbjct  71    EYLLRLGIFAKNMVKAAEHQALDPTAIHGVTQFSDLSEEEFERFYTGFKGGFPSSNAAGG  130

Query  471   KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLS  650
              A  P LDV G PE FDWR+KGAVT +K QG CGSCWAF+TTG+IEGANF+ATGKL++LS
Sbjct  131   VA--PPLDVKGFPENFDWREKGAVTGIKTQGKCGSCWAFTTTGSIEGANFLATGKLVSLS  188

Query  651   EQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFES  830
             EQQLVDCD+ CDI  K++CD+GC+GGLMT AY+YL+E+GG+EEE SYPYTG  G+C+F+ 
Sbjct  189   EQQLVDCDNKCDIT-KTSCDNGCNGGLMTTAYDYLMEAGGLEEETSYPYTGAQGECKFDP  247

Query  831   EKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHG  1010
              KVAV+V NFTN+PADE+Q+AAYLVNHGPLA+ +NAV+M TY+GGVSCPLICSK+RLNHG
Sbjct  248   NKVAVRVSNFTNIPADENQIAAYLVNHGPLAIAVNAVFMQTYVGGVSCPLICSKRRLNHG  307

Query  1011  VLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             VLLVGY  +GFSILRL  KPYW IKNSWG+ WGE+GY+++CRGHGMCG++ MVSA M
Sbjct  308   VLLVGYNAEGFSILRLRKKPYWTIKNSWGEQWGEKGYYKLCRGHGMCGMNTMVSAAM  364



>emb|CAB17077.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=377

 Score =   478 bits (1229),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 233/366 (64%), Positives = 283/366 (77%), Gaps = 7/366 (2%)
 Frame = +3

Query  96    MYAQLLAVLTC-AHLAFASSASQGLNIRQVTDDEIPAA---GENLLGTATEVRFKSFMQE  263
             M A+    LTC A ++    A    + RQ T  +I       +N L   TE +F  FM+ 
Sbjct  1     MVAKRGHALTCFARISLVLFALTLSSARQTTVHDIAKKLKLQDNQL-LRTEKKFNVFMEN  59

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
             +GK+Y+T EEY+ RL +FA N++RA E+Q LDPTA+HGVT+FSDLT +EF++ Y GV   
Sbjct  60    YGKKYSTREEYLQRLEIFAGNMLRAPENQALDPTAIHGVTQFSDLTEDEFQRHYTGV--N  117

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
              G     G +  AP L V GLPE FDWR+KGAVTEVKMQG CGSCWAFSTTG+IEGANFI
Sbjct  118   GGFPWNNGVRDVAPPLKVDGLPEDFDWREKGAVTEVKMQGKCGSCWAFSTTGSIEGANFI  177

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKLLNLSEQQLVDCD  CDI + + CD+GC GGLMTNAY+YL++SGG+EEE+SYPYTG
Sbjct  178   ATGKLLNLSEQQLVDCDSQCDITESTTCDNGCMGGLMTNAYKYLLQSGGLEEESSYPYTG  237

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
               G+C+F+  KVAV++ NFTN+P DE+Q+AAYLV HGPLAVG+NA++M TY+GGVSCPLI
Sbjct  238   AKGECKFDPGKVAVRITNFTNIPVDENQIAAYLVKHGPLAVGLNAIFMQTYIGGVSCPLI  297

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CSKK LNHGVLLVGY  KGFSILRLG KPYWIIKNSWGK WG +GY+++CRGHGMCG++ 
Sbjct  298   CSKKWLNHGVLLVGYRAKGFSILRLGNKPYWIIKNSWGKRWGVDGYYKLCRGHGMCGMNT  357

Query  1164  MVSAVM  1181
             MVS  M
Sbjct  358   MVSTAM  363



>ref|XP_007143764.1| hypothetical protein PHAVU_007G099600g [Phaseolus vulgaris]
 gb|ESW15758.1| hypothetical protein PHAVU_007G099600g [Phaseolus vulgaris]
Length=449

 Score =   479 bits (1234),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 234/366 (64%), Positives = 284/366 (78%), Gaps = 7/366 (2%)
 Frame = +3

Query  96    MYAQLLAVLTC-AHLAFASSASQGLNIRQVTDDEIPAA---GENLLGTATEVRFKSFMQE  263
             M A+    LTC A ++    A    + RQ T  +I       +N L   TE +F  FM+ 
Sbjct  73    MVAKRGHALTCFARISLVLFALTLSSARQTTVHDIAKKLKLQDNQL-LRTEKKFNVFMEN  131

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
             +GK+Y+T EEY+ RL +FA N++RAAE+Q LDPTA+HGVT+FSDLT +EF++ Y GV   
Sbjct  132   YGKKYSTREEYLQRLEIFAGNMLRAAENQALDPTAIHGVTQFSDLTEDEFQRHYTGV--N  189

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
              G     G +  AP L V GLPE FDWR+KGAVTEVKMQG CGSCWAFSTTG+IEGANFI
Sbjct  190   GGFPWNNGVRDVAPPLKVDGLPEDFDWREKGAVTEVKMQGKCGSCWAFSTTGSIEGANFI  249

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKLLNLSEQQLVDCD  CDI + + CD+GC GGLMTNAY+YL++SGG+EEE+SYPYTG
Sbjct  250   ATGKLLNLSEQQLVDCDSQCDITESTTCDNGCMGGLMTNAYKYLLQSGGLEEESSYPYTG  309

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
               G+C+F+  KVAV++ NFTN+P DE+Q+AAYLV HGPLAVG+NA++M TY+GGVSCPLI
Sbjct  310   AKGECKFDPGKVAVRITNFTNIPVDENQIAAYLVKHGPLAVGLNAIFMQTYIGGVSCPLI  369

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CSKK LNHGVLLVGY  KGFSILRLG KPYWIIKNSWGK WG +GY+++CRGHGMCG++ 
Sbjct  370   CSKKWLNHGVLLVGYRAKGFSILRLGNKPYWIIKNSWGKRWGVDGYYKLCRGHGMCGMNT  429

Query  1164  MVSAVM  1181
             MVS  M
Sbjct  430   MVSTAM  435



>ref|XP_009404192.1| PREDICTED: cysteine proteinase 15A [Musa acuminata subsp. malaccensis]
Length=361

 Score =   468 bits (1204),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/364 (62%), Positives = 279/364 (77%), Gaps = 10/364 (3%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKE  275
             M  ++LAVL    L F+  A  G +     D EI    ++    +TE RF++F++  GKE
Sbjct  1     MGLRVLAVLLFL-LTFSDGALHGSD-----DPEIVQVTQSRRLGSTERRFRAFLRTFGKE  54

Query  276   YATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRA  455
             Y T EEY  RLGVFA+NL RAAEHQ LDPTAVHGVT FSDLT  EFE  + G L    +A
Sbjct  55    YRTREEYARRLGVFARNLARAAEHQALDPTAVHGVTPFSDLTEEEFETAFTG-LSAQDKA  113

Query  456   SLLGGKAEAPR---LDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
                G  AE P    ++V GLP +FDWR+KGAVT+VKMQG CGSCWAFSTTG +EGAN++A
Sbjct  114   GWPGRGAEFPTAAAMEVGGLPSSFDWRNKGAVTDVKMQGVCGSCWAFSTTGTVEGANYVA  173

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKL++LSEQQL+DCDHTCD  +K  C++GCSGGLMTNAY YL++SGG+EEE SYPYTGK
Sbjct  174   TGKLVSLSEQQLIDCDHTCDAVEKDECNNGCSGGLMTNAYNYLMQSGGLEEEKSYPYTGK  233

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G+C+F+  K+AV V NFT +P DE+Q+ A LV+ GPLAVG+NA +M TY+ GVSCPLIC
Sbjct  234   QGECKFDKNKIAVSVTNFTVIPLDEEQIIANLVHRGPLAVGLNAAFMQTYVRGVSCPLIC  293

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
              ++ +NHGVLLVGYG +G+SILRLG++PYWIIKNSWGK WGE+GY+R+CRGH +CGI +M
Sbjct  294   PRRWINHGVLLVGYGARGYSILRLGYRPYWIIKNSWGKQWGEQGYYRLCRGHNICGIDSM  353

Query  1167  VSAV  1178
             VSAV
Sbjct  354   VSAV  357



>gb|ADE76932.1| unknown [Picea sitchensis]
Length=403

 Score =   458 bits (1179),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/343 (64%), Positives = 263/343 (77%), Gaps = 5/343 (1%)
 Frame = +3

Query  153   ASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
              S+G  I QVT+       E+LL   ++  F  F+ EHGK Y+T EEYV RL +F KNL+
Sbjct  63    VSEGGFIAQVTEK---FNREHLLNLRSKTLFDKFIVEHGKVYSTIEEYVRRLRIFEKNLL  119

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPE  512
             +AAE+Q LDPTAVHG+T FSDLT  EFE  Y G+L V  R  L+  K  A  L V  LP 
Sbjct  120   KAAENQALDPTAVHGITPFSDLTEYEFESRYTGLLGV--RQGLVNEKQTAEILPVDDLPA  177

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
              FDWR+KGAVTEVK QG+CGSCWAFSTTG +EGANF+ATGKLLNLSEQQL+DCDH CD  
Sbjct  178   NFDWREKGAVTEVKTQGNCGSCWAFSTTGVVEGANFLATGKLLNLSEQQLIDCDHKCDPL  237

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLP  872
             +  ACD+GC GGLMTNAY YL+E+GGIEE  +YPYTG  GDC+F  +  AVK  NFT + 
Sbjct  238   NTKACDNGCHGGLMTNAYNYLMEAGGIEEAKNYPYTGVQGDCKFNPDLAAVKAINFTTVN  297

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE Q+AA LV HGPLAVG+NA +M TY+GGVSCPLICSK+ +NHGVLLVGYG KGF++L
Sbjct  298   LDEKQIAANLVKHGPLAVGLNAAFMQTYIGGVSCPLICSKRFINHGVLLVGYGHKGFALL  357

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             RLG++PYWIIKNSWGK WGE GY+++CRGHG CG++ MVSAV+
Sbjct  358   RLGYRPYWIIKNSWGKRWGEHGYYKLCRGHGECGMNKMVSAVI  400



>ref|XP_001761980.1| predicted protein [Physcomitrella patens]
 gb|EDQ73084.1| predicted protein [Physcomitrella patens]
Length=369

 Score =   441 bits (1135),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 262/360 (73%), Gaps = 7/360 (2%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTA---TEVRFKSFMQEHGKEY  278
             L+ ++      FA+S   G  IR+VTDD +          A    E RF+SFM++ GK Y
Sbjct  8     LVGIVVLGFAGFAASLPTGDTIREVTDDALSNGSVEQFAHALIGAEKRFESFMKDFGKVY  67

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
              + EEY +R GVF  NL++A +HQ LDPTA HGVT FSDLT  EF   Y+G+     R S
Sbjct  68    HSVEEYEHRFGVFKSNLLKALKHQALDPTASHGVTMFSDLTEEEFTSKYLGL----KRPS  123

Query  459   LLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
             +L    +AP L    LP  FDWR+KGAV  VK QG CGSCWAFSTTGA+EGA+F+ +GKL
Sbjct  124   VLSSAPQAPPLPTEDLPPNFDWREKGAVGPVKDQGGCGSCWAFSTTGAVEGAHFLNSGKL  183

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
             ++LSEQQLVDCDH CD ++  ACD GC+GG MTNAY+Y+  +GG+E E+ YPY G+ G C
Sbjct  184   VSLSEQQLVDCDHQCDREEADACDAGCNGGFMTNAYQYVEAAGGLELESDYPYEGRDGKC  243

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+S KVAVKV NFTN+P DEDQ+AAYL+  GPLA+GINA +M TY+ GVSCP+ C+K+ 
Sbjct  244   KFDSNKVAVKVSNFTNIPVDEDQVAAYLIKSGPLAIGINAEFMQTYIAGVSCPIFCNKRN  303

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L+HGVLLVGY ++GF+  RL +KPYWIIKNSWG +WG+ GY+++CRGHG CG++ MVSAV
Sbjct  304   LDHGVLLVGYAERGFAPARLAYKPYWIIKNSWGPNWGDNGYYKICRGHGECGLNTMVSAV  363



>ref|XP_006850211.1| hypothetical protein AMTR_s00022p00251800 [Amborella trichopoda]
 gb|ERN11792.1| hypothetical protein AMTR_s00022p00251800 [Amborella trichopoda]
Length=350

 Score =   439 bits (1130),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 250/317 (79%), Gaps = 4/317 (1%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F  FM ++GK+Y + EEY++RLGVF  N+ RAA +Q+LDP AVHGVT FSDL+  EF
Sbjct  35    EESFVMFMNKYGKKYGSREEYIHRLGVFLSNMKRAAMNQVLDPFAVHGVTPFSDLSQEEF  94

Query  414   EKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
             E  Y G+L      SL      AP+L V GLP  FDWR+KGAVT VKMQG+CG+CWAFST
Sbjct  95    EAFYTGILPSYSSNSL----PTAPQLPVDGLPPDFDWREKGAVTHVKMQGACGACWAFST  150

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             TGA+EGA FI++GKL+NLSEQQLVDCDH CD++ ++ CDDGC GGLMTNA+EY+ E+GG+
Sbjct  151   TGAMEGAYFISSGKLVNLSEQQLVDCDHMCDVESRTDCDDGCKGGLMTNAFEYVREAGGL  210

Query  774   EEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHT  953
             E+E SYPY G  G+C+FE EK AV V NF+ +  DEDQ++A LV +GP+AVG+NA ++ T
Sbjct  211   EDENSYPYVGTRGECKFEREKAAVGVLNFSKISMDEDQISANLVRNGPIAVGVNAAFLQT  270

Query  954   YMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMC  1133
             Y+GGVSCPLICSK+ +NHGVLLVGYG KGF+ LRLG +P+WIIKNSW   WGE GY+R+C
Sbjct  271   YIGGVSCPLICSKRHVNHGVLLVGYGAKGFAPLRLGNRPFWIIKNSWSDRWGEHGYYRLC  330

Query  1134  RGHGMCGISNMVSAVMT  1184
             +GHGMCGI  M SAV+T
Sbjct  331   KGHGMCGIHTMASAVVT  347



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score =   436 bits (1121),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 209/343 (61%), Positives = 259/343 (76%), Gaps = 13/343 (4%)
 Frame = +3

Query  171   IRQVTD---DEIPA---AGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
             IR+VTD   DE      A + LL    E  FKSF+   GK YAT E Y +RL VF  NL+
Sbjct  30    IREVTDTARDESNGRLDAAKALLDV--ETHFKSFIARFGKAYATAEAYAHRLKVFEANLV  87

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPE  512
             RA  HQ LDP+AVHG+T+FSDLT  EF++ ++G L+VP R   L    +AP L  + LPE
Sbjct  88    RAVSHQALDPSAVHGITQFSDLTEEEFKQQFLG-LRVPSR---LREANKAPVLPTNDLPE  143

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
              FDWR+ GAVTEVK QG+CGSCWAFSTTGAIEGA+F+ TGKL++LSEQQLVDCDH+CD  
Sbjct  144   DFDWREHGAVTEVKNQGACGSCWAFSTTGAIEGAHFLETGKLISLSEQQLVDCDHSCDPT  203

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK-GGDCRFESEKVAVKVGNFTNL  869
             DK +CD GC+GGLMTNAY+Y+++SGG+E E  YPYTG   G C+F + K+   V NF+ +
Sbjct  204   DKVSCDAGCNGGLMTNAYDYVMKSGGLETETDYPYTGNSNGKCQFNANKIVASVANFSTV  263

Query  870   PADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSI  1049
               DEDQ+AA LV HGPLA+GINAV+M TY+GGVSCP+ICSK  ++HGVLLVGYG KG++ 
Sbjct  264   SLDEDQIAANLVKHGPLAIGINAVFMQTYIGGVSCPIICSKHHIDHGVLLVGYGAKGYAP  323

Query  1050  LRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +R   KPYWIIKNSWG  WGE+GY+++CRGHGMCG++ MVS V
Sbjct  324   IRFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTV  366



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score =   433 bits (1114),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 247/316 (78%), Gaps = 5/316 (2%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  FKSF+   GK YAT E Y +RL VF  NL+RA  HQ LDP+AVHG+T+FSDLT  EF
Sbjct  18    ETHFKSFIARFGKAYATAEAYAHRLKVFEANLVRAVSHQALDPSAVHGITQFSDLTEEEF  77

Query  414   EKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
             ++ ++G L+VP R   L    +AP L  + LPE FDWR+ GAVTEVK QG+CGSCWAFST
Sbjct  78    KQQFLG-LRVPSR---LREANKAPVLPTNDLPEDFDWREHGAVTEVKNQGACGSCWAFST  133

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             TGAIEGA+F+ TGKL++LSEQQLVDCDH+CD  DK +CD GC+GGLMTNAY+Y+++SGG+
Sbjct  134   TGAIEGAHFLETGKLISLSEQQLVDCDHSCDPTDKVSCDAGCNGGLMTNAYDYVMKSGGL  193

Query  774   EEEASYPYTGK-GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             E E  YPYTG   G C+F + K+   V NF+ +  DEDQ+AA LV HGPLA+GINAV+M 
Sbjct  194   ETETDYPYTGNSNGKCQFNANKIVASVANFSTVSLDEDQIAANLVKHGPLAIGINAVFMQ  253

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCP+ICSK  ++HGVLLVGYG KG++ +R   KPYWIIKNSWG  WGE+GY+++
Sbjct  254   TYIGGVSCPIICSKHHIDHGVLLVGYGAKGYAPIRFTEKPYWIIKNSWGATWGEQGYYKI  313

Query  1131  CRGHGMCGISNMVSAV  1178
             CRGHGMCG++ MVS V
Sbjct  314   CRGHGMCGMNTMVSTV  329



>gb|KHG08355.1| Cysteinease 1 [Gossypium arboreum]
Length=357

 Score =   433 bits (1113),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/368 (60%), Positives = 264/368 (72%), Gaps = 37/368 (10%)
 Frame = +3

Query  105   QLLAVLTCAHLAFAS-SASQGLNIRQVTDD-EIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             Q+L        +FA     Q   I QVT++ +IP             +F+ FM+ +GK Y
Sbjct  18    QILTFSLIFSFSFALLETPQEPTIHQVTENSDIPTLKTKFSRNHVHKQFRVFMETYGKNY  77

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             +T EEY++RLG+FAKNL+RAAEHQ+LDP AVHGVT+FSDL+  EFE +Y G  K P  A+
Sbjct  78    STREEYMHRLGIFAKNLVRAAEHQLLDPMAVHGVTQFSDLSEEEFESLYTG-FKGPSVAA  136

Query  459   LL-----GGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
              L     GG+AEA  L+V GLPE+FDWR+KGAVTEVKMQG+CGSCWAFSTTGAIEGANFI
Sbjct  137   PLLRDGVGGEAEA--LEVDGLPESFDWREKGAVTEVKMQGTCGSCWAFSTTGAIEGANFI  194

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKLLNLSEQQLVDCDH                            +GG+ EE  YPYTG
Sbjct  195   ATGKLLNLSEQQLVDCDHM---------------------------TGGLMEENVYPYTG  227

Query  804   KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
             +  +C+F  EKVAV+V NFTN+P DE+Q+AA LV  GPLAVG+NA++M TY+GGVSCP+I
Sbjct  228   ERNECKFNPEKVAVEVVNFTNIPIDENQIAANLVLRGPLAVGLNAIFMQTYIGGVSCPII  287

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             C K+ +NHGVLLVGYG KGFSILRLG +PYWIIKNSWGK WGE GY+R+CRGH MCGI+ 
Sbjct  288   CGKRWINHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKRWGEHGYYRLCRGHSMCGINT  347

Query  1164  MVSAVMTR  1187
             MVSAV T+
Sbjct  348   MVSAVATQ  355



>ref|XP_002460693.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
 gb|EER97214.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
Length=373

 Score =   432 bits (1111),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 257/347 (74%), Gaps = 7/347 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD     AG   LG   E +F +F++ HG+ Y+  EEY  RL VFA NL RAA HQ
Sbjct  25    IRQVTDGRRSRAGAGALGLLPEAQFAAFVRRHGRRYSGPEEYARRLRVFAANLARAAAHQ  84

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG----RASLLGGKAEAP--RLDVSGLPE  512
              LDPTA HGVT FSDLT  EFE    GV    G    R  + G  A  P  + +VS LP 
Sbjct  85    ALDPTARHGVTPFSDLTREEFEARLTGVRAGAGGDVQRLVMSGAPAAPPASQEEVSRLPA  144

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
             +FDWRDKGAVT VKMQG+CGSCWAFSTTGA+EGANF+ATGKLL LSEQQLVDCDHTC   
Sbjct  145   SFDWRDKGAVTGVKMQGACGSCWAFSTTGAVEGANFLATGKLLELSEQQLVDCDHTCSAV  204

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLP  872
              ++ C++GC+GGLMTNAY YL++SGG+ E+ +YPYTG  G CRF+  K AV+V NFT +P
Sbjct  205   AQNECNNGCAGGLMTNAYAYLMKSGGLMEQRAYPYTGAPGPCRFDPAKAAVRVANFTAVP  264

Query  873   A-DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSI  1049
             A DE Q+ A LV  GPLAVG+NA +M TY+GGVSCPL+C +  +NHGVLLVGYG +GF+ 
Sbjct  265   AGDEAQIRAALVRRGPLAVGLNAAFMQTYVGGVSCPLLCPRAWVNHGVLLVGYGARGFAA  324

Query  1050  LRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             LRLG++PYWIIKNSWG+ WGE+GY+R+CRG  +CG+ +MVSAV   P
Sbjct  325   LRLGYRPYWIIKNSWGERWGEQGYYRLCRGSNVCGVDSMVSAVAVAP  371



>ref|XP_003560213.1| PREDICTED: cysteine proteinase 1 [Brachypodium distachyon]
Length=373

 Score =   428 bits (1101),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 218/351 (62%), Positives = 263/351 (75%), Gaps = 7/351 (2%)
 Frame = +3

Query  144   ASSASQGLNIRQVTDDEIPAAGENL-LGTATEVRFKSFMQEHGKEYAT-HEEYVYRLGVF  317
             A+ AS    IRQVTD+  PAA      G   E +F +F++ HGKEY+   EEY  RL VF
Sbjct  20    AAGASGDDVIRQVTDNGAPAARRPPSPGLLPEAKFAAFVRRHGKEYSGGAEEYARRLRVF  79

Query  318   AKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDV  497
             A NL RAA HQ LDP A HGVT FSDLTP EF+    G L+  G  + +   A A   ++
Sbjct  80    AANLARAAAHQALDPGARHGVTPFSDLTPEEFQARLTG-LQQQGTNNNMPAAARATAEEL  138

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
             + LP +FDWR KGAVTEVKMQG CGSCWAFSTTGA+EGA+F+ATGKLLNLSEQQLVDCDH
Sbjct  139   ATLPASFDWRAKGAVTEVKMQGMCGSCWAFSTTGAVEGAHFVATGKLLNLSEQQLVDCDH  198

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGN  857
             TCD   K+ CD GCSGGLMTNAY YLI +GG+ E+A+YPYTG  G CRF++ KVAV+V +
Sbjct  199   TCDAVAKNECDSGCSGGLMTNAYTYLIRAGGLMEQAAYPYTGAQGTCRFDANKVAVRVTS  258

Query  858   FTNLPA-DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGK  1034
             FT +P  DEDQ+ A LV  GPLAVG+NA +M TY+GGVSCPL+C +K +NHGVLLVGYG 
Sbjct  259   FTAVPPDDEDQIRASLVRAGPLAVGLNAAFMQTYLGGVSCPLLCPRKLINHGVLLVGYGA  318

Query  1035  KGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG---HGMCGISNMVSAV  1178
             +G + LRLG++PYWIIKNSWGK+WGE GY+R+CRG     +CG+ +MVSAV
Sbjct  319   RGLAPLRLGYRPYWIIKNSWGKEWGEGGYYRLCRGARNRNVCGVDSMVSAV  369



>emb|CAQ00102.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   428 bits (1100),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 215/343 (63%), Positives = 255/343 (74%), Gaps = 6/343 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD    A    LL    E +F +F++ HGKEY+  EEY  RL VFA N+ RAA HQ
Sbjct  29    IRQVTDSGHGAGHPGLL---PEAQFAAFVRRHGKEYSGPEEYARRLRVFAANVARAAAHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVL---KVPGRASLLGGKAEAPRLDVSGLPETFD  521
              LDP A HGVT FSDLT  EFE    G++    V   A  +   A A   +V+ LP +FD
Sbjct  86    ALDPGARHGVTPFSDLTREEFEARLTGLVGAGDVLRSARRMPAAAPATEEEVAALPASFD  145

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRDKGAVT+VKMQG CGSCWAFSTTGA+EGANF+ATGKLL+LSEQQLVDCDHTCD   K+
Sbjct  146   WRDKGAVTDVKMQGVCGSCWAFSTTGAVEGANFVATGKLLDLSEQQLVDCDHTCDAVAKT  205

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
              C+ GCSGGLMTNAY YL+ SGG+ E+A+YPYTG  G CRF+  KVAV+V NFT +P DE
Sbjct  206   ECNSGCSGGLMTNAYRYLMSSGGLMEQAAYPYTGAQGPCRFDRGKVAVRVANFTAVPLDE  265

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQM A LV  GPLAVG+NA +M TY+GGVSCPLIC +  +NHGVLLVGYG +GFS LRLG
Sbjct  266   DQMRAALVRGGPLAVGLNAAFMQTYVGGVSCPLICPRAMVNHGVLLVGYGARGFSALRLG  325

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             ++PYW+IKNSWG  WGE GY+++CRG  +CG+ +MVSAV   P
Sbjct  326   YRPYWLIKNSWGAQWGEGGYYKLCRGRNVCGVDSMVSAVAVAP  368



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   428 bits (1100),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 203/339 (60%), Positives = 252/339 (74%), Gaps = 8/339 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D     GE+      +  F  F  ++GK YAT EE+ YRL VF  NL RA  HQ
Sbjct  28    IRQVVSD-----GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  82

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG--RASLLGGKAEAPR-LDVSGLPETFD  521
             +LDP+AVHGVT+FSDLTP EF + ++G+ K     R   L   A A   L  S LP  FD
Sbjct  83    LLDPSAVHGVTKFSDLTPKEFRRTFLGIRKSSSGKRKLKLPADAHAAEILPTSDLPSDFD  142

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAVT VK QGSCGSCW+FSTTGA+EGANF+ATG+L++LSEQQLVDCDH CD ++  
Sbjct  143   WRDYGAVTGVKDQGSCGSCWSFSTTGALEGANFLATGELVSLSEQQLVDCDHLCDPEEAG  202

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             ACD GC+GGLMT AYEY+++SGG+E+E  YPYTGK G C+F+  K+A  V NF+ +  DE
Sbjct  203   ACDSGCNGGLMTTAYEYVLQSGGLEKEKDYPYTGKDGTCKFDKSKIAAAVANFSVVSLDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV HGPL+VGINAV+M TY+GGVSCP ICSK+ L+HGVLLVGYG  G++ +R  
Sbjct  263   DQIAANLVKHGPLSVGINAVFMQTYIGGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFK  322

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWI+KNSWG++WGEEGY+++CRG+ +CGI +MVS V
Sbjct  323   DKPYWIVKNSWGENWGEEGYYKICRGNNICGIDSMVSTV  361



>ref|NP_001059639.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAC45132.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF21553.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAG88694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score =   427 bits (1097),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 256/350 (73%), Gaps = 15/350 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD      G    G   E +F +F++ HG+EY+  EEY  RL VFA NL RAA HQ
Sbjct  29    IRQVTD-----GGYWPPGLLPEAQFAAFVRRHGREYSGPEEYARRLRVFAANLARAAAHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG---RASLLGGKAEAPRLDVSGLPETFD  521
              LDPTA HGVT FSDLT  EFE    G+    G   R   +   A A   +VSGLP +FD
Sbjct  84    ALDPTARHGVTPFSDLTREEFEARLTGLAADVGDDVRRRPMPSAAPATEEEVSGLPASFD  143

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD+GAVT+VKMQG+CGSCWAFSTTGA+EGANF+ATG LL+LSEQQLVDCDHTCD + K+
Sbjct  144   WRDRGAVTDVKMQGACGSCWAFSTTGAVEGANFLATGNLLDLSEQQLVDCDHTCDAEKKT  203

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNL--PA  875
              CD GC GGLMTNAY YL+ SGG+ E+++YPYTG  G CRF++ +VAV+V NFT +  P 
Sbjct  204   ECDSGCGGGLMTNAYAYLMSSGGLMEQSAYPYTGAQGTCRFDANRVAVRVANFTVVAPPG  263

Query  876   DED-----QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKG  1040
               D     QM A LV HGPLAVG+NA YM TY+GGVSCPL+C +  +NHGVLLVGYG++G
Sbjct  264   GNDGDGDAQMRAALVRHGPLAVGLNAAYMQTYVGGVSCPLVCPRAWVNHGVLLVGYGERG  323

Query  1041  FSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             F+ LRLG +PYWIIKNSWGK WGE+GY+R+CRG  +CG+  MVSAV   P
Sbjct  324   FAALRLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDTMVSAVAVAP  373



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   425 bits (1092),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 198/342 (58%), Positives = 257/342 (75%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVT-DDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEH  347
             IRQV  +DE     + LL    E  FK F  + G+ Y T EE+ YRL VF  NL RA  H
Sbjct  27    IRQVVQNDETEIESDPLLDP--EHHFKLFKNKFGRTYDTEEEHEYRLTVFKSNLRRAKRH  84

Query  348   QILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             Q+LDPTA HGVT+FSDLTP+EF K Y+G+   LK+P  A+      +AP L  S LP+ F
Sbjct  85    QVLDPTAKHGVTKFSDLTPSEFRKKYLGLKSKLKLPADAN------KAPILPTSNLPQDF  138

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRDKGAVT VK QGSCGSCW+FSTTGA+EG++F+ TG+L++LSEQQLVDCDH CD  + 
Sbjct  139   DWRDKGAVTPVKNQGSCGSCWSFSTTGALEGSHFLQTGELVSLSEQQLVDCDHECDPAEY  198

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPAD  878
             ++CD GC+GGLM NA+EY++++GG+++EA YPYTG+ G C+F+  K+A  V NF+ +  D
Sbjct  199   NSCDSGCNGGLMNNAFEYILKAGGLQKEADYPYTGRDGTCKFDKSKIAASVANFSVVSTD  258

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV +GPLA+GINA +M TY+G VSCP ICSK +++HGVLLVGYG  G++ LR 
Sbjct  259   EDQIAANLVTNGPLAIGINAAWMQTYIGQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRF  318

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMT  1184
               KPYWIIKNSWG+DWGE+GY+++C G+  CG+  MVSAV++
Sbjct  319   KEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGMDTMVSAVVS  360



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   425 bits (1092),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 261/364 (72%), Gaps = 14/364 (4%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--IRQVTDD-----EIPAAGENLLGTATEVRFKSFMQEH  266
             L +      + F SSA++  +  IRQVTD+     +I  A   L     EV F+ F++ +
Sbjct  7     LFSAFCIFSVIFLSSATKPDDDLIRQVTDEVVSDPQILDARSALFNA--EVHFRHFIRRY  64

Query  267   GKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP  446
             GK+Y+  EE+ +R GVF  NL+RA EHQ LDP A HGVT+FSDLT  EF   Y+G+    
Sbjct  65    GKKYSGPEEHEHRFGVFKSNLLRALEHQKLDPRASHGVTKFSDLTQEEFRHQYLGL----  120

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
              RA  L    +AP L  + LPE FDWR+KGAVTEVK QGSCGSCWAFSTTGA+EGANF+ 
Sbjct  121   -RAPPLRDAHDAPILPTNDLPEDFDWREKGAVTEVKNQGSCGSCWAFSTTGALEGANFLK  179

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TG+L++LSEQQLVDCDH CD  D  +CD GC+GGLMT+AY+Y ++SGG+E+E  YPYTGK
Sbjct  180   TGELVSLSEQQLVDCDHECDPSDARSCDSGCNGGLMTSAYQYALKSGGLEKEEDYPYTGK  239

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C F   K+   V NF+ +  DE Q+AA LV +GPL+VGINA +M TY+GGVSCP +C
Sbjct  240   DGTCSFNKNKIVAHVSNFSVVSIDEGQIAANLVKNGPLSVGINAAFMQTYVGGVSCPYVC  299

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+ L+HGVLLVGYG   F+ +R+  KPYW+IKNSWG +WGE GY+++CRGH +CGI+NM
Sbjct  300   SKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNM  359

Query  1167  VSAV  1178
             VS V
Sbjct  360   VSTV  363



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   425 bits (1092),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 261/364 (72%), Gaps = 14/364 (4%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--IRQVTDD-----EIPAAGENLLGTATEVRFKSFMQEH  266
             L +      + F SSA++  +  IRQVTD+     +I  A   L     EV F+ F++ +
Sbjct  7     LFSAFCIFSVIFLSSATRPDDDLIRQVTDEVVSDPQILDARSALFNA--EVHFRHFIRRY  64

Query  267   GKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP  446
             GK+Y+  EE+ +R GVF  NL+RA EHQ LDP A HGVT+FSDLT  EF   Y+G+    
Sbjct  65    GKKYSGPEEHEHRFGVFKSNLLRALEHQKLDPRASHGVTKFSDLTQEEFRHQYLGL----  120

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
              RA  L    +AP L  + LPE FDWR+KGAVTEVK QGSCGSCWAFSTTGA+EGANF+ 
Sbjct  121   -RAPPLRDAHDAPILPTNDLPEDFDWREKGAVTEVKNQGSCGSCWAFSTTGALEGANFLK  179

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TG+L++LSEQQLVDCDH CD  D  +CD GC+GGLMT+AY+Y ++SGG+E+E  YPYTGK
Sbjct  180   TGELVSLSEQQLVDCDHECDPSDARSCDSGCNGGLMTSAYQYALKSGGLEKEEDYPYTGK  239

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C F   K+   V NF+ +  DE Q+AA LV +GPL+VGINA +M TY+GGVSCP +C
Sbjct  240   DGTCSFNKNKIVAHVSNFSVVSIDEGQIAANLVKNGPLSVGINAAFMQTYVGGVSCPYVC  299

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+ L+HGVLLVGYG   F+ +R+  KPYW+IKNSWG +WGE GY+++CRGH +CGI+NM
Sbjct  300   SKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNM  359

Query  1167  VSAV  1178
             VS V
Sbjct  360   VSTV  363



>ref|XP_001781954.1| predicted protein [Physcomitrella patens]
 gb|EDQ53250.1| predicted protein [Physcomitrella patens]
Length=369

 Score =   424 bits (1091),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 204/341 (60%), Positives = 250/341 (73%), Gaps = 11/341 (3%)
 Frame = +3

Query  171   IRQVTDD-----EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIR  335
             I+QVTD       +      LLG   E +F+SF++E GK Y T EEY +R  VF  NL+R
Sbjct  29    IQQVTDGVRVDGSVEQFAHALLGA--EKQFESFIKEFGKVYHTVEEYEHRFKVFKSNLLR  86

Query  336   AAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPET  515
             A +HQ LDPTA HGVT FSDLT  EF   Y+G+     R S L     A  L    LP +
Sbjct  87    ALKHQALDPTASHGVTMFSDLTEEEFATQYLGL----KRPSALSTAPTAEPLPTGDLPPS  142

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWR+KGAV  VK QGSCGSCWAFSTTGA+EGA+F+ATGKLL+LSEQQLVDCDH CD ++
Sbjct  143   FDWREKGAVGPVKNQGSCGSCWAFSTTGAVEGAHFLATGKLLSLSEQQLVDCDHQCDPEE  202

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPA  875
               ACD GC GGLMTNAY+Y+ E+GG+E E+ YPY G+ G C+F   KVA KV NFTN+P 
Sbjct  203   AQACDAGCGGGLMTNAYKYVEEAGGLELESDYPYKGRDGKCQFNPNKVAAKVSNFTNIPI  262

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DEDQ+AAYL+  GPLA+GINA +M TY+ GVSCP+ C+K+ L+HGVLLVGY + GF+  R
Sbjct  263   DEDQVAAYLIKSGPLAIGINAEFMQTYVAGVSCPIFCNKRNLDHGVLLVGYAEHGFAPAR  322

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L +KPYWIIKNSWG  WG++GY+++CRGHG CG++ MVSAV
Sbjct  323   LAYKPYWIIKNSWGPMWGDKGYYKICRGHGECGLNTMVSAV  363



>tpg|DAA40800.1| TPA: putative cysteine protease family protein [Zea mays]
Length=381

 Score =   422 bits (1086),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 258/345 (75%), Gaps = 8/345 (2%)
 Frame = +3

Query  171   IRQVTDDEIPA-AGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEH  347
             IRQVT     A AG  LL    E +F +F++ HG+ Y+  +EY  RL VFA NL RAA H
Sbjct  38    IRQVTTQGTRAGAGPGLL---PEAQFAAFVRRHGRRYSGPKEYARRLRVFAANLARAAAH  94

Query  348   QILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAP---RLDVSGLPETF  518
             Q LDPTA HGVT FSDLT  EFE    G+        L+ G   AP   + +V+ LP +F
Sbjct  95    QALDPTARHGVTPFSDLTREEFEARLTGLRAGGDVQRLMSGVPAAPPASKEEVARLPASF  154

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRDKGAVT VK QG+CGSCWAFSTTGA+EGANF+ATG+L++LSEQQLVDCDHTC    +
Sbjct  155   DWRDKGAVTGVKTQGACGSCWAFSTTGAVEGANFLATGELVDLSEQQLVDCDHTCSAVAQ  214

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPA-  875
             + C++GC+GGLMTNAY YL+ESGG+ E+++YPYTG  G CRF+  +VAV+V NFT +PA 
Sbjct  215   NECNNGCAGGLMTNAYSYLMESGGLMEQSAYPYTGAAGPCRFDPTQVAVRVANFTAVPAG  274

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE Q+ A LV  GPLAVG+NA +M TY+GGVSCPLIC +  +NHGVLLVGYG +GF+ LR
Sbjct  275   DEAQIRAALVRRGPLAVGLNAAFMQTYVGGVSCPLICPRAWVNHGVLLVGYGARGFAALR  334

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             LG++PYWIIKNSWGK WGE+GY+R+CRG  +CG+ +MVSAV   P
Sbjct  335   LGYRPYWIIKNSWGKQWGEQGYYRLCRGSNVCGVDSMVSAVAVAP  379



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   421 bits (1083),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/364 (56%), Positives = 260/364 (71%), Gaps = 14/364 (4%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--IRQVTDD-----EIPAAGENLLGTATEVRFKSFMQEH  266
             L +      + F SSA++  +  IRQVTD+     +I  A   L     EV F+ F++ +
Sbjct  7     LFSAFCIFSVIFLSSATRPDDDLIRQVTDEVVSDPQILDARSALFNA--EVHFRHFIRRY  64

Query  267   GKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVP  446
             GK+Y+  EE+ +R GVF  NL+RA EHQ LDP A HGVT+FSDLT   F   Y+G+    
Sbjct  65    GKKYSGPEEHEHRFGVFKSNLLRALEHQKLDPRASHGVTKFSDLTQEGFRHQYLGL----  120

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
              RA  L    +AP L  + LPE FDWR+KGAVTEVK QGSCGSCWAFSTTGA+EGANF+ 
Sbjct  121   -RAPPLRDAHDAPILPTNDLPEDFDWREKGAVTEVKNQGSCGSCWAFSTTGALEGANFLK  179

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TG+L++LSEQQLVDCDH CD  D  +CD GC+GGLMT+AY+Y ++SGG+E+E  YPYTGK
Sbjct  180   TGELVSLSEQQLVDCDHECDPSDARSCDSGCNGGLMTSAYQYALKSGGLEKEEDYPYTGK  239

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C F   K+   V NF+ +  DE Q+AA LV +GPL+VGINA +M TY+GGVSCP +C
Sbjct  240   DGTCSFNKNKIVAHVSNFSVVSIDEGQIAANLVKNGPLSVGINAAFMQTYVGGVSCPYVC  299

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             SK+ L+HGVLLVGYG   F+ +R+  KPYW+IKNSWG +WGE GY+++CRGH +CGI+NM
Sbjct  300   SKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNM  359

Query  1167  VSAV  1178
             VS V
Sbjct  360   VSTV  363



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   420 bits (1080),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 253/340 (74%), Gaps = 10/340 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVT D+   AG +LLG   E  F  F ++ GKEY+   E+ YR  VF  N+ RA  HQ
Sbjct  31    IRQVTSDD---AGNSLLGA--EGHFSLFKRKFGKEYSNEAEHNYRFSVFKANMARARRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGK-AEAPRLDVSGLPETFDWR  527
             ILDPTAVHGVT+FSDLT  EF++ Y+G+    G+   L     EAP L  + LP  FDWR
Sbjct  86    ILDPTAVHGVTQFSDLTEEEFQERYLGL---KGKLDFLKSNLPEAPILPTNDLPADFDWR  142

Query  528   DKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSAC  707
             D GAVT +K QGSCGSCW+FSTTGA+EGA+F+AT +L++LSEQQLVDCDH CD  +  AC
Sbjct  143   DHGAVTPIKNQGSCGSCWSFSTTGALEGAHFLATRELVSLSEQQLVDCDHECDPSNPGAC  202

Query  708   DDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADED  884
             D GC+GGLMT AYEYL+++GG+E E  YPYTG   G C+F+  K+A KV NF+ +  DED
Sbjct  203   DSGCNGGLMTTAYEYLLKAGGVEREQDYPYTGTDRGTCKFDKSKIAAKVSNFSVVSIDED  262

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             QMAA LV +GPL+VGINAV+M TY+GGVSCP ICSK+ L+HGVL+VGYG  G++ +RL  
Sbjct  263   QMAANLVKNGPLSVGINAVFMQTYIGGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKD  322

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMT  1184
             K YWIIKNSWG+ WGE+GY+++CRGH +CG+ +MVS V +
Sbjct  323   KAYWIIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVAS  362



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   418 bits (1075),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/348 (58%), Positives = 257/348 (74%), Gaps = 16/348 (5%)
 Frame = +3

Query  144   ASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             +S+  + L IRQV      A  ++LL  A E  F +F  + GK YAT EE+ YRLGVF  
Sbjct  27    SSNEPEDLLIRQVV-----AHDDDLLMNA-EHHFTNFKSKFGKSYATREEHAYRLGVFKA  80

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDV  497
             NL RA  HQ LDP+AVHG+T+FSDLTP EF + Y+G+  L++P  A       +AP L  
Sbjct  81    NLRRARRHQKLDPSAVHGITQFSDLTPAEFRRTYLGLKRLRIPADAH------KAPILPT  134

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
             + LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH
Sbjct  135   NDLPTDFDWRDHGAVTAVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDH  194

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVG  854
              CD  +  +CD GC+GGLMT+A+EY +++GG+ +E  YPYTG   G C+F+  K+   V 
Sbjct  195   ECDPDEPGSCDSGCNGGLMTSAFEYTLKTGGLMQEEDYPYTGTDHGTCKFDKSKIVASVA  254

Query  855   NFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGK  1034
             NF+ +  DEDQ+AA LV +GPLAVGINAV+M TY+GGVSCP ICS +RLNHGVLLVGYG 
Sbjct  255   NFSVVSLDEDQIAANLVKNGPLAVGINAVFMQTYIGGVSCPYICS-RRLNHGVLLVGYGS  313

Query  1035  KGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +G+S +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  314   EGYSPIRMKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVDSMVSTV  361



>ref|XP_004959670.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   418 bits (1074),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 251/345 (73%), Gaps = 7/345 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD     A     G   E +F +F++ HG+ Y+  EEY  RL VFA NL RAA HQ
Sbjct  27    IRQVTDGGGSRASRP--GLLPEAQFAAFVRRHGRRYSGPEEYARRLRVFAANLARAAAHQ  84

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGK----AEAPRLDVSGLPETF  518
              LDP+A HGVT FSDLT  EFE    GV        L+ G     A A   +V+ LP +F
Sbjct  85    ALDPSARHGVTPFSDLTREEFEARLTGVRHGGDAQRLVHGSVPAAAPATEEEVARLPASF  144

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD+GAVT VK QG+CGSCWAFSTTGA+EGANF+ATGKLL+LSEQQLVDCDH C    +
Sbjct  145   DWRDRGAVTGVKTQGACGSCWAFSTTGAVEGANFLATGKLLDLSEQQLVDCDHKCSAVAR  204

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPA-  875
             + CD+GC GGLMTNAY YL+ESGG+ E+ +YPYTG  G CRF+  + AV+V NFT +PA 
Sbjct  205   NECDNGCGGGLMTNAYAYLMESGGLMEQRAYPYTGAAGHCRFDPSRAAVRVANFTAVPAG  264

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE Q+ A LV HGPLAVG+NA +M TY+GGVSCPLIC +  +NHGVLLVGYG +GF+ LR
Sbjct  265   DEGQIRAALVRHGPLAVGLNAAFMQTYVGGVSCPLICPRAWVNHGVLLVGYGARGFAALR  324

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             LG++PYW+IKNSWG+ WGE+GY+R+CRG  +CG+  MVSAV   P
Sbjct  325   LGYRPYWVIKNSWGEQWGEKGYYRLCRGSNVCGVDTMVSAVAVAP  369



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   417 bits (1071),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 262/360 (73%), Gaps = 12/360 (3%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN---IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             + A++  A +A +S+ +   +   IRQV D+E     E+ L  A E  F SF  +  K Y
Sbjct  6     IFAIVLFAAVATSSTDNTNTDDFIIRQVVDNE-----EDHLLNA-EHHFTSFKSKFSKSY  59

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             +T EE+ YR GVF  NLI+A  HQ LDPTA HG+T+FSDLT +EF + ++G+ K   R  
Sbjct  60    STKEEHDYRFGVFKSNLIKAKLHQKLDPTAEHGITKFSDLTASEFRRQFLGLKK---RLR  116

Query  459   LLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
             L     +AP L  + LPE FDWR+KGAVT VK QGSCGSCWAFSTTGA+EGA+++ATGKL
Sbjct  117   LPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKL  176

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
             ++LSEQQLVDCDH CD +   +CD GC+GGLM NA+EYL++SGG+ +E  Y YTG+ G C
Sbjct  177   VSLSEQQLVDCDHVCDPEQAGSCDSGCNGGLMNNAFEYLLQSGGVVQEKDYAYTGRDGSC  236

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+  KV   V NF+ +  DE+Q+AA LV +GPLAVGINA +M TYM GVSCP +C+K R
Sbjct  237   KFDKSKVVASVSNFSVVSLDEEQIAANLVKNGPLAVGINAAWMQTYMSGVSCPYVCAKSR  296

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L+HGVLLVG+GK  ++ +RL  KPYWI+KNSWG++WGE+GY+++CRG  +CG+ +MVS V
Sbjct  297   LDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTV  356



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   417 bits (1072),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 250/338 (74%), Gaps = 10/338 (3%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV      +AG++ L +A E  F SF    GK Y T EE+ YR  VF  NL RA  
Sbjct  32    LLIRQVV-----SAGDDQLLSA-EHHFSSFKARFGKAYETEEEHDYRFEVFKANLRRAKT  85

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
             HQ LDP AVHGVT+FSDLTP EF K ++G+     R  L     +AP L  + LP  FDW
Sbjct  86    HQKLDPNAVHGVTKFSDLTPGEFRKKFLGL----KRLRLPADTQKAPILPTNDLPADFDW  141

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++K++
Sbjct  142   RDHGAVTLVKDQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHQCDPEEKNS  201

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADED  884
             CD GC+GGLMTNAYEY +++GG++ E  YPYTGK G C+F+  KV   V NF+ +  DED
Sbjct  202   CDAGCNGGLMTNAYEYALKAGGLQREVDYPYTGKDGTCKFDKTKVVASVANFSVVSLDED  261

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             Q+AA LV +GPL++GINAV+M TY+GGVSCP ICSK  L+HGVLLVGYG  G++ +R   
Sbjct  262   QIAANLVKNGPLSIGINAVFMQTYIGGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKD  321

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             KPYWIIKNSWG++WGE+GY+++CRG  +CG+ +MVS V
Sbjct  322   KPYWIIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTV  359



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   416 bits (1070),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 261/360 (73%), Gaps = 12/360 (3%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN---IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             + A++  A +A +S+     +   IRQV D+E     E+ L  A E  F SF  +  K Y
Sbjct  6     IFAIVLFAAVATSSTDDTNTDDFIIRQVVDNE-----EDHLLNA-EHHFTSFKSKFSKSY  59

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             +T EE+ YR GVF  NLI+A  HQ LDPTA HG+T+FSDLT +EF + ++G+ K   R  
Sbjct  60    STKEEHDYRFGVFKSNLIKAKLHQKLDPTAEHGITKFSDLTASEFRRQFLGLKK---RLR  116

Query  459   LLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
             L     +AP L  + LPE FDWR+KGAVT VK QGSCGSCWAFSTTGA+EGA+++ATGKL
Sbjct  117   LPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKL  176

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
             ++LSEQQLVDCDH CD +   +CD GC+GGLM NA+EYL++SGG+ +E  Y YTG+ G C
Sbjct  177   VSLSEQQLVDCDHVCDPEQAGSCDSGCNGGLMNNAFEYLLQSGGVVQEKDYAYTGRDGSC  236

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+  KV   V NF+ +  DE+Q+AA LV +GPLAVGINA +M TYM GVSCP +C+K R
Sbjct  237   KFDKSKVVASVSNFSVVSLDEEQIAANLVKNGPLAVGINAAWMQTYMSGVSCPYVCAKSR  296

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L+HGVLLVG+GK  ++ +RL  KPYWI+KNSWG++WGE+GY+++CRG  +CG+ +MVS V
Sbjct  297   LDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTV  356



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   417 bits (1071),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 251/341 (74%), Gaps = 9/341 (3%)
 Frame = +3

Query  156   SQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIR  335
             S  L IRQV D     A +++L    E  F SF  +  K YAT EE+ YR GVF  NLI+
Sbjct  28    SDDLLIRQVVD----TAEDHILNA--EHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIK  81

Query  336   AAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPET  515
             A  HQ LDP+A HG+T+FSDLT +EF + ++G+ K   R  L     +AP L  + LPE 
Sbjct  82    AKLHQKLDPSAQHGITKFSDLTASEFRRQFLGLNK---RLRLPAHAQKAPILPTNNLPED  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWR+KGAVT VK QGSCGSCWAFSTTGA+EGAN++ATGKL +LSEQQLVDCDH CD ++
Sbjct  139   FDWREKGAVTPVKDQGSCGSCWAFSTTGALEGANYLATGKLTSLSEQQLVDCDHVCDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPA  875
             + +CD GC+GGLM NA+EY+++SGG+  E  Y YTG+ G C+F+  KV   V NF+ +  
Sbjct  199   RGSCDSGCNGGLMNNAFEYILQSGGVVSEKDYAYTGRDGSCKFDKSKVVASVSNFSVVSL  258

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DEDQ+AA LV +GPLAV INA +M TYM GVSCP IC+K RL+HGVLL+G+G+ G++ +R
Sbjct  259   DEDQIAANLVKNGPLAVAINAAWMQTYMSGVSCPYICAKARLDHGVLLLGFGQGGYAPIR  318

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L  KPYWIIKNSWG++WGEEGY+++CRG  +CG+ +MVS V
Sbjct  319   LKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTV  359



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   416 bits (1069),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/340 (59%), Positives = 251/340 (74%), Gaps = 14/340 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             I+QV    +P A +NLL  A E  F SF    GK YAT EE+ YR GVF  NL RA  HQ
Sbjct  34    IQQV----VPEANDNLLLHA-ERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRAKRHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTAVHGVT+FSDLTP+EF + ++G+  L++P  A+      +AP L  + LP  FDW
Sbjct  89    GLDPTAVHGVTKFSDLTPSEFRRNFLGLKRLRLPSDAN------KAPILPTNDLPTDFDW  142

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RDKGAVT VK QGSCGSCWAFS TGA+EGA+++ TG+LL+LSEQQLVDCDH CD ++  +
Sbjct  143   RDKGAVTPVKDQGSCGSCWAFSATGALEGAHYLQTGELLSLSEQQLVDCDHECDPEEFGS  202

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADED  884
             CD GC+GGLM NA+EY +++GG+E E  YPYTG    C+F+  KV   V NF+ +  DED
Sbjct  203   CDSGCNGGLMNNAFEYTLKAGGLEREKDYPYTGTDDTCKFDKSKVVAAVSNFSVISTDED  262

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             Q+AA LV+HGPLAVGINAV+M TY+ GVSCP IC  KR++HGVLLVGYG  GF+ +R   
Sbjct  263   QIAANLVHHGPLAVGINAVFMQTYVKGVSCPYICG-KRIDHGVLLVGYGSSGFAPIRFKE  321

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMT  1184
             KPYWI+KNSWG+ WGEEG++++CRGH  CG+ ++VS V +
Sbjct  322   KPYWILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVAS  361



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 248/336 (74%), Gaps = 9/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D+E     ++LL    E  F SF  +  K YAT EE+ YR GVF  NLI+A  HQ
Sbjct  30    IRQVVDNE----EDHLLNA--EHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
               DPTA HG+T+FSDLT +EF + ++G+ K   R  L     +AP L  + LPE FDWR+
Sbjct  84    NRDPTAEHGITKFSDLTASEFRRQFLGLKK---RLRLPAHAQKAPILPTTNLPEDFDWRE  140

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT VK QGSCGSCWAFSTTGA+EGA+++ATGKL++LSEQQLVDCDH CD +   +CD
Sbjct  141   KGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKLVSLSEQQLVDCDHVCDPEQAGSCD  200

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLM NA+EYL+ESGG+ +E  Y YTG+ G C+F+  KV   V NF+ +  DEDQ+
Sbjct  201   SGCNGGLMNNAFEYLLESGGVVQEKDYAYTGRDGSCKFDKSKVVASVSNFSVVTLDEDQI  260

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV +GPLAV INA +M TYM GVSCP +C+K RL+HGVLLVG+GK  ++ +RL  KP
Sbjct  261   AANLVKNGPLAVAINAAWMQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKP  320

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGE+GY+++CRG  +CG+ +MVS V
Sbjct  321   YWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTV  356



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   415 bits (1067),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 261/365 (72%), Gaps = 16/365 (4%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGK  272
              + + L+     A L      S+   IRQV  D+     ++LL  A E  F +F ++ GK
Sbjct  11    FLLSSLIFAAAIASLVSPDDESEDPLIRQVVSDD-----DDLLLNA-EHHFNNFKRKFGK  64

Query  273   EYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVP  446
              YAT EE+ YRLGVF  NL RA  HQ LDP+AVHGVT+FSDLTP EF + Y+G+  LK+P
Sbjct  65    SYATPEEHAYRLGVFKANLRRARRHQKLDPSAVHGVTQFSDLTPAEFRRSYLGLKPLKLP  124

Query  447   GRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIA  626
               A        AP L  + LP  FDWRD GA+  VK QGSCGSCW+FST+GA+EGANF+A
Sbjct  125   VDAH------NAPILPTNDLPTDFDWRDHGAIAAVKNQGSCGSCWSFSTSGALEGANFLA  178

Query  627   TGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK  806
             TGKL++LSEQQLVDCDH CD ++  +CD GC+GGLMT+A+EY +++GG+  E  YPYTG 
Sbjct  179   TGKLVSLSEQQLVDCDHECDPEEPDSCDSGCNGGLMTSAFEYTLKAGGLMREEDYPYTGT  238

Query  807   G-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLI  983
               G C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAVGINAV+M TY+GGVSCP I
Sbjct  239   DRGTCKFDKTKIAASVANFSVVSLDEDQIAANLVKNGPLAVGINAVFMQTYIGGVSCPYI  298

Query  984   CSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISN  1163
             CS KRL+HGVLLVGYG +G++ +RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +
Sbjct  299   CS-KRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVDS  357

Query  1164  MVSAV  1178
             MVS V
Sbjct  358   MVSTV  362



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   414 bits (1065),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 235/315 (75%), Gaps = 4/315 (1%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F SF    GK YAT EEY YR GVF  NL RA  HQ LDPTAVHGVT+FSDLTP EF
Sbjct  48    ERHFSSFKATFGKAYATQEEYDYRFGVFKANLRRAKRHQALDPTAVHGVTKFSDLTPKEF  107

Query  414   EKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
              + ++G+ +   R  L     +AP L  S LP  FDWRDKGAVT VK QGSCGSCWAFS 
Sbjct  108   RRNFLGLKR---RLRLPADANKAPILPTSDLPADFDWRDKGAVTPVKDQGSCGSCWAFSA  164

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             TGA+EGA+++ TG+L++LSEQQLVDCDH CD ++  +CD GCSGGLM NA+EY +++GG+
Sbjct  165   TGALEGAHYLETGELVSLSEQQLVDCDHECDPEEYGSCDSGCSGGLMNNAFEYALKAGGL  224

Query  774   EEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHT  953
             E E  YPYTG    C+F+  K+   V NF+ +  DEDQ+AA LVNHGPLAVGINAV+M T
Sbjct  225   EREEDYPYTGTDDTCKFDKSKIVSSVSNFSVISTDEDQIAANLVNHGPLAVGINAVFMQT  284

Query  954   YMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMC  1133
             Y+GGVSCP IC  KR++HGVLLVGYG  GF+ +R   KPYWI+KNSWG+ WGE+GY+++C
Sbjct  285   YVGGVSCPYICG-KRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKIC  343

Query  1134  RGHGMCGISNMVSAV  1178
             RG+  CG+ ++VS V
Sbjct  344   RGYNSCGVDSLVSTV  358



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 247/332 (74%), Gaps = 10/332 (3%)
 Frame = +3

Query  195   IPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVH  374
             +P A +NLL  A E  F SF    G+ YAT EE+ YR GVF  NL RA  HQ LDPTAVH
Sbjct  37    VPEANDNLLLHA-ERHFSSFKATFGRTYATQEEHDYRFGVFKANLRRAKRHQGLDPTAVH  95

Query  375   GVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTE  548
             GVT+FSDLTP+EF + ++G+  L++P  A+      +AP L  + LP  FDWRDKGAVT 
Sbjct  96    GVTKFSDLTPSEFRRNFLGLKRLRLPSDAN------KAPILPTNDLPTDFDWRDKGAVTP  149

Query  549   VKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGG  728
             VK QGSCGSCWAFS TGA+EGA+++ TG+LL+LSEQQLVDCDH CD ++  +CD GC+GG
Sbjct  150   VKDQGSCGSCWAFSATGALEGAHYLETGELLSLSEQQLVDCDHECDPEEFGSCDSGCNGG  209

Query  729   LMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVN  908
             LM NA+EY +++GG+E E  YPYTG    C+F+  KV   V NF+ +  DEDQ+AA LV+
Sbjct  210   LMNNAFEYTLKAGGLEREKDYPYTGTDDTCKFDKSKVVAAVSNFSVISTDEDQIAANLVH  269

Query  909   HGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKN  1088
             HGPLAVGINA++M TY+ GVSCP IC  KR++HGVLLVGYG  GF+ +R   KPYWI+KN
Sbjct  270   HGPLAVGINALFMQTYVKGVSCPYICG-KRIDHGVLLVGYGSSGFAPIRFKEKPYWILKN  328

Query  1089  SWGKDWGEEGYFRMCRGHGMCGISNMVSAVMT  1184
             SWG+ WGEEGY+++CRGH  CG+ ++VS V +
Sbjct  329   SWGQSWGEEGYYKICRGHNPCGVDSLVSTVAS  360



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 250/336 (74%), Gaps = 10/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +    +N +  A E  F  F  ++GK YA+ EE+ +RL VF  NL RA  HQ
Sbjct  28    IRQV----VSETDDNHMLNA-EHHFSLFKSKYGKIYASQEEHDHRLKVFKANLRRARRHQ  82

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDPTA HG+T+FSDLTP+EF + Y+G+ K   R  L   KA  P L  S LPE FDWR+
Sbjct  83    LLDPTAEHGITQFSDLTPSEFRRTYLGLHKP--RPKLNAQKA--PILPTSDLPEDFDWRE  138

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++KS CD
Sbjct  139   KGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLATGELVSLSEQQLVDCDHECDAEEKSECD  198

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLMT A+EY +++GG++ E  YPYTG+ G C F+  K+A  V NF+ +  DEDQ+
Sbjct  199   AGCNGGLMTTAFEYTLKAGGLQREKDYPYTGRDGKCHFDKSKIAASVANFSVIGLDEDQI  258

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV HGPLAVGINA +M TYM GVSCPLIC  KR +HGVLLVGYG  GF+ +RL  KP
Sbjct  259   AANLVKHGPLAVGINAAWMQTYMRGVSCPLICF-KRQDHGVLLVGYGSAGFAPIRLKEKP  317

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGE GY+++CRGH +CG+  MVS V
Sbjct  318   YWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  353



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 251/347 (72%), Gaps = 6/347 (2%)
 Frame = +3

Query  138   AFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVF  317
             +F    S    IRQV  D + A  + L     E  F  F  ++GK Y T EE+ YR  VF
Sbjct  23    SFIEQVSDDPLIRQVVSDSVEAVDQLL---HAEHHFSLFKAKYGKTYDTQEEHDYRFSVF  79

Query  318   AKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDV  497
               NL RA  +Q+LDP+AVHGVTRFSDLTP+EFEK Y+G+ K   R  L     +AP L  
Sbjct  80    KSNLRRAKRNQLLDPSAVHGVTRFSDLTPDEFEKSYLGLHK--RRLKLPVDAHKAPDLPT  137

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
             + LP  FDWRD GAVT VK QGSCGSCW+FSTTG++EGA+++ATG+L++LSEQQLVDCDH
Sbjct  138   NNLPTDFDWRDHGAVTAVKDQGSCGSCWSFSTTGSLEGAHYLATGELVSLSEQQLVDCDH  197

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGN  857
              CD ++  +CD GC GGLM NA+EY ++ GG+++E  YPYTG  G C+F+  K+A  V N
Sbjct  198   ECDPEEYGSCDAGCDGGLMNNAFEYALKVGGVQKEKDYPYTGTNGVCKFDKSKIAASVSN  257

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAVGINA +M TY+GGVSCP IC  K L+HGVLLVGYG  
Sbjct  258   FSVVSIDEDQIAANLVKYGPLAVGINAAWMQTYIGGVSCPYICG-KHLDHGVLLVGYGAA  316

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G++ +RL  KPYWIIKNSWG++WGE GY+++CRGH +CG+++MVS V
Sbjct  317   GYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVASMVSTV  363



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 253/343 (74%), Gaps = 7/343 (2%)
 Frame = +3

Query  156   SQGLNIRQVTDD-EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
             S  L IRQV D  E  A  EN L  A    F +F ++ GK YAT EE+ YR  VF  N+ 
Sbjct  34    SDDLLIRQVVDHGEGGAVDENSLLNADH-HFAAFKRKFGKAYATQEEHDYRFSVFEANMR  92

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPE  512
             RA  HQ +DP+AVHGVT+FSDLTP EF + ++GV +   R  L     +AP L  + LP 
Sbjct  93    RAVRHQKIDPSAVHGVTQFSDLTPREFRQQFLGVNR---RLRLPSDAQKAPILPTNDLPT  149

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
              FDWRD GAVTEVK QG+CGSCW+FSTTGA+EGANF+ATG L++LSEQQLVDCDH CD +
Sbjct  150   DFDWRDHGAVTEVKNQGTCGSCWSFSTTGALEGANFLATGNLVSLSEQQLVDCDHECDPE  209

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNL  869
             +K +CD GCSGGLM +A+EY ++SGG+ +E  YPYTG   G C+F+  K+A KV NF+ +
Sbjct  210   EKDSCDSGCSGGLMNSAFEYTLKSGGLMQEKDYPYTGTDKGACKFDRTKIAAKVSNFSVV  269

Query  870   PADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSI  1049
               DE+Q+AA LV +GPLAVGINAV+M TY+GGVSCP IC+ KRL+HGVLLVGYG   F+ 
Sbjct  270   SLDEEQIAANLVKNGPLAVGINAVFMQTYVGGVSCPFICA-KRLDHGVLLVGYGAGAFAP  328

Query  1050  LRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +R+  KPYWIIKNSWG +WGE+GY+++C+G  +CG+ +MVS V
Sbjct  329   IRMKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTV  371



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 251/346 (73%), Gaps = 9/346 (3%)
 Frame = +3

Query  141   FASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFA  320
             FAS   + L IRQV  D     G +LL  A    F  F  ++GK YAT EE+ YR  VF 
Sbjct  14    FASIVDEPL-IRQVVTD-----GIDLL-DADHHHFALFKADYGKAYATQEEHDYRFSVFK  66

Query  321   KNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVS  500
              NL RA   Q LDP+AVHGVT FSDLTP+EF   Y+G+ K   R  L     +AP L   
Sbjct  67    TNLRRARSRQQLDPSAVHGVTMFSDLTPDEFRNSYLGLRK--RRLKLPTDAKQAPLLPTD  124

Query  501   GLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHT  680
              LPE FDWRDKGAVT VK QGSCGSCW+FSTTGA+EGAN++ATGKL++LSEQQLVDCDH 
Sbjct  125   HLPEDFDWRDKGAVTAVKDQGSCGSCWSFSTTGALEGANYLATGKLISLSEQQLVDCDHE  184

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNF  860
             CD ++  +CD GC+GGLM NA+EY ++ GG+++E  YPYTG+ G C+F+  ++A  V NF
Sbjct  185   CDPEEADSCDAGCNGGLMNNAFEYALKVGGLQKEEDYPYTGRDGSCKFQQNQIAASVLNF  244

Query  861   TNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKG  1040
             + +  D+ Q+AA LV+HGPLAVGINA +M TY+ GVSCPL+C K  L+HGVL+VGYG  G
Sbjct  245   SVVSIDDAQIAANLVSHGPLAVGINAAWMQTYIRGVSCPLVCGKSNLDHGVLMVGYGSSG  304

Query  1041  FSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             ++ +RL  KPYWI+KNSWGK+WGE+GY+++CRG  +CG+ +MVS V
Sbjct  305   YAPIRLKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVESMVSTV  350



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 208/360 (58%), Positives = 255/360 (71%), Gaps = 11/360 (3%)
 Frame = +3

Query  117   VLTCAHLAFASSASQG---LNIRQVTD--DEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             V T    +FA+    G   L IRQV D  D   A  EN L  A    F  F ++ GK YA
Sbjct  17    VATSFRYSFAAEDVAGNDDLLIRQVVDHGDGGGAVDENSLVNADH-HFTIFKRKFGKVYA  75

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL  461
             T EE+ YR  VF  NL RA  HQ LDP AVHGVT+FSDLTP EF + ++G+ +   R  L
Sbjct  76    TQEEHDYRFSVFKANLRRARRHQKLDPAAVHGVTQFSDLTPREFRRQFLGLNR---RLRL  132

Query  462   LGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLL  641
                  +AP L  + LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGANF+ATG L+
Sbjct  133   PSDAHKAPILPTNDLPMDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGDLV  192

Query  642   NLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDC  818
             +LSEQQLVDCDH CD ++K +CD GCSGGLM +A+EY ++SGG+  E  YPYTG   G C
Sbjct  193   SLSEQQLVDCDHECDPEEKDSCDSGCSGGLMNSAFEYTLKSGGLMREEDYPYTGTDRGAC  252

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+  K+A KV NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KR
Sbjct  253   KFDKNKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPFICS-KR  311

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L+HGVLLVGYG   ++ +RL  KPYWIIKNSWG++WGE GY+++CRGH +CG+ +MVS V
Sbjct  312   LDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVDSMVSTV  371



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   412 bits (1060),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 244/337 (72%), Gaps = 11/337 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D+     + LL  + E  F SF+  +GK YA   E+ YR  VF  NL RA  HQ
Sbjct  27    IRQVVSDD----QQQLL--SAEAHFSSFLSRYGKSYADEAEHAYRFSVFKSNLRRARRHQ  80

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDPTAVHGVTRF+DLTP+EF + Y+G+ + P  A   G   +AP L  + LP  FDWRD
Sbjct  81    RLDPTAVHGVTRFADLTPSEFRRTYLGLRRRPRTA---GSTHDAPILPTNELPADFDWRD  137

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FS  GA+EGAN+++TG L++LSEQQLVDCDH CD  +  +CD
Sbjct  138   HGAVTPVKNQGSCGSCWSFSAAGALEGANYLSTGNLVSLSEQQLVDCDHECDSSEPDSCD  197

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLMT A+EY+++SGG+E EA YPYTG   G C+F   K++    NF+ +  DEDQ
Sbjct  198   QGCNGGLMTTAFEYILKSGGLEREADYPYTGTDRGTCKFNKAKISAVASNFSVVSIDEDQ  257

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPLAVGINAV+M TY+GGVSCP IC  K L+HGVLLVGYG  GF+ +R   K
Sbjct  258   IAANLVKHGPLAVGINAVFMQTYVGGVSCPYICG-KHLDHGVLLVGYGSAGFAPIRFKEK  316

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS+V
Sbjct  317   PYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSSV  353



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   412 bits (1060),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 249/336 (74%), Gaps = 9/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D+E     E+ L  A E  F SF  +  K YAT EE+ YR GVF  NLI+A  HQ
Sbjct  25    IRQVVDNE-----EDHLLNA-EHHFTSFKSKFSKSYATKEEHDYRFGVFKANLIKAKLHQ  78

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDPTA HG+T+FSDLT +EF + ++G+ K   R  L     +AP L  + LPE FDWR+
Sbjct  79    KLDPTAEHGITKFSDLTASEFRRQFLGLNK---RLRLPAHAQKAPILPTTNLPEDFDWRE  135

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT VK QGSCGSCWAFSTTGA+EGA+++ATGKL++LSEQQLVDCDH CD ++  +CD
Sbjct  136   KGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKLVSLSEQQLVDCDHVCDPEEAGSCD  195

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLM NA+EYL++SGG+ +E  Y YTG+ G C+F+  KV   V NF+ +  DE+Q+
Sbjct  196   SGCNGGLMNNAFEYLLQSGGVVQEKDYAYTGRDGSCKFDKSKVVASVSNFSVVSLDEEQI  255

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV +GPLAV INA +M  YM GVSCP +C+K RL+HGVLLVG+GK  ++ +RL  KP
Sbjct  256   AANLVKNGPLAVAINAAWMQAYMSGVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKP  315

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGE+GY+++CRG  +CG+ +MVS V
Sbjct  316   YWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTV  351



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   412 bits (1059),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 235/315 (75%), Gaps = 4/315 (1%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F SF    GK YAT EE+ YR GVF  NL RA  HQ LDPTAVHGVT+FSDLTP EF
Sbjct  47    ERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRAKRHQALDPTAVHGVTKFSDLTPKEF  106

Query  414   EKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
              + ++G+ +   R  L     +AP L    LP  FDWRDKGAVT VK QGSCGSCWAFS 
Sbjct  107   RRNFLGLKR---RLRLPADANKAPILPTGDLPADFDWRDKGAVTPVKDQGSCGSCWAFSA  163

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             TGA+EGA+++ TG+L++LSEQQLVDCDH CD ++  +CD GCSGGLM NA+EY +++GG+
Sbjct  164   TGALEGAHYLETGELVSLSEQQLVDCDHECDPEEYGSCDSGCSGGLMNNAFEYALKAGGL  223

Query  774   EEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHT  953
             E E  YPYTG    C+F+  K+   V NF+ +  DEDQ+AA LVNHGPLAVGINAV+M T
Sbjct  224   EREEDYPYTGTDDTCKFDKSKIVSSVSNFSVISTDEDQIAANLVNHGPLAVGINAVFMQT  283

Query  954   YMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMC  1133
             Y+GGVSCP IC  KR++HGVLLVGYG  GF+ +RL  KPYWI+KNSWG+ WGE+GY+++C
Sbjct  284   YVGGVSCPYICG-KRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKIC  342

Query  1134  RGHGMCGISNMVSAV  1178
             RG+  CG+ ++VS V
Sbjct  343   RGYNSCGVDSLVSTV  357



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   412 bits (1058),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 206/363 (57%), Positives = 256/363 (71%), Gaps = 10/363 (3%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGK  272
             L    LL     +  AFA S    L IRQVT  E      +LL    E  F  F  + GK
Sbjct  4     LFLLSLLVFTIFSSSAFAFSDEDPL-IRQVTS-ESDDNNNHLLNA--EHHFSLFKSKFGK  59

Query  273   EYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGR  452
              YAT EE+ +RL VF  NL RA  HQ+LDPTA HG+T+FSDLTP+EF + Y+G+ K   +
Sbjct  60    IYATQEEHDHRLKVFKANLRRARRHQLLDPTAEHGITKFSDLTPSEFRRTYLGLHKPKPK  119

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
              S      +AP L  S LPE FDWR+KGAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG
Sbjct  120   LS----TTKAPILPTSDLPEDFDWREKGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLATG  175

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             +L++LSEQQLVDCDH CD + KS CD GC GGLMT A+EY +++GG++ E  YPYTG+ G
Sbjct  176   ELVSLSEQQLVDCDHECDAEQKSECDAGCGGGLMTTAFEYTLKAGGLQREKDYPYTGRNG  235

Query  813   DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSK  992
              C F+  K+A  V N++ +  DEDQ+AA LV HGPLAVGIN+ +M TY+GGVSCPL+C K
Sbjct  236   QCHFDKSKIAASVTNYSVVGLDEDQIAANLVKHGPLAVGINSAWMQTYIGGVSCPLVCFK  295

Query  993   KRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMV  1169
              + +HGVLLVGYG  GF+ +RL  KPYWIIKNSWG+ WGE GY+++CRG H +CG+  MV
Sbjct  296   HQ-DHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVDAMV  354

Query  1170  SAV  1178
             S V
Sbjct  355   STV  357



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 251/339 (74%), Gaps = 16/339 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +P   + LL  + +  F +F  + GK YAT EE+ YR  VF  NL RA +HQ
Sbjct  33    IRQV----VPDVEDYLL--SAQHHFTAFKAKFGKNYATQEEHDYRFKVFKANLRRAQKHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
             ++DP+AVHGVT+FSDLTP EF + Y+G+  L++P  A       EAP L   G+PE FDW
Sbjct  87    LMDPSAVHGVTKFSDLTPREFRRQYLGLKKLRLPADAH------EAPILPTDGIPEDFDW  140

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD GAVT VK QGSCGSCW+FS  GA+EGA+F+ATG+L++LSEQQLVDCDH CD  +  A
Sbjct  141   RDHGAVTNVKNQGSCGSCWSFSAAGALEGAHFLATGELVSLSEQQLVDCDHECDPTEYGA  200

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLMTNA+EY++++GG+E E  YPYTG   G C+FE  K+A  V NF+ +  DE
Sbjct  201   CDSGCNGGLMTNAFEYILKAGGLEREEDYPYTGSDRGPCKFERAKIAASVNNFSVVSVDE  260

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAVGINAV+M TY+GGVSCP ICS KR +HGV+LVGYG  G++ +RL 
Sbjct  261   DQIAANLVQNGPLAVGINAVFMQTYIGGVSCPYICS-KRQDHGVVLVGYGSAGYAPVRLK  319

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KP+WIIKNSWG++WGE GY+++CRG  +CG+  MVS V
Sbjct  320   DKPFWIIKNSWGENWGENGYYKICRGRNVCGVDAMVSTV  358



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/339 (58%), Positives = 255/339 (75%), Gaps = 16/339 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD      G++ +  A E  F +F  + GK YAT EE+ YR GVF  NL RA  H 
Sbjct  27    IRQVTD------GDHHMLNA-EHHFTTFKTKFGKSYATQEEHDYRFGVFRANLRRAKLHA  79

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+A HGVT+FSDLTP EF++ Y+G+  L++P  A+      +AP L  S LPE FDW
Sbjct  80    KLDPSAEHGVTKFSDLTPEEFKRQYLGLKPLRLPSTAN------KAPILPTSDLPENFDW  133

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RDKGAVT VK QGSCGSCWAFSTTGA+EGA++++TG+L++LSEQQLVDCDH CD ++  A
Sbjct  134   RDKGAVTPVKNQGSCGSCWAFSTTGALEGAHYLSTGELVSLSEQQLVDCDHVCDPEEYGA  193

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADED  884
             CD GC+GGLM NA++Y++++GG++ E  YPY+G+   C+F+  KVA  V NF+ +  DED
Sbjct  194   CDAGCNGGLMNNAFDYILQAGGVQTEKDYPYSGRDETCKFDKSKVAATVANFSVVSLDED  253

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             Q+AA LV HGPLAVGINA++M TY+GGVSCP IC  K L+HGVLLVGYG  G++ +R   
Sbjct  254   QIAANLVKHGPLAVGINAIFMQTYIGGVSCPYICG-KNLDHGVLLVGYGAAGYAPIRFKD  312

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             KP+WIIKNSWG+ WGE+GY+++CRG  +CG+ +MVS+V+
Sbjct  313   KPFWIIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVV  351



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   411 bits (1056),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 248/341 (73%), Gaps = 10/341 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D     GE+      +  F  F  ++GK YAT EE+ YRL VF  NL RA  HQ
Sbjct  28    IRQVVSD-----GEDDALLNADHHFTLFKSKYGKSYATQEEHDYRLSVFKANLRRAKRHQ  82

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPR-----LDVSGLPET  515
             +LDP+AVHGVT+FSDLTP EF + Y+G+ K       L  K  A       L  S LP  
Sbjct  83    MLDPSAVHGVTKFSDLTPKEFRRTYLGIRKSSSSKQKLKLKLPADAHAAEILPTSDLPFD  142

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             F+WRD GAVT VK QG CGSCW+FSTTG +EG NF+ATG+LL+L+EQ+LVDCDH CD K 
Sbjct  143   FEWRDYGAVTGVKDQGLCGSCWSFSTTGTLEGTNFLATGELLSLNEQELVDCDHLCDPKK  202

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPA  875
               ACD GC+GGLMT AYEY+++SGG+E+E  YPYTG+ G C+F+  K+A  V NF+ +  
Sbjct  203   AGACDAGCNGGLMTTAYEYVLQSGGLEKEKDYPYTGRDGTCKFDKSKIAAAVANFSVVSL  262

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DEDQ+AA LV HGPL+VGIN+++M TY+GGVSCP ICSKK L+HGVL+VGYG  G++ +R
Sbjct  263   DEDQIAANLVKHGPLSVGINSIFMQTYIGGVSCPYICSKKNLDHGVLIVGYGAAGYAPIR  322

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KPYWIIKNSWG++WGEEGY+++CRG+ +CG+ +MVS+V
Sbjct  323   FKDKPYWIIKNSWGENWGEEGYYKICRGNNICGVDSMVSSV  363



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   411 bits (1056),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 246/336 (73%), Gaps = 5/336 (1%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D   A  + L     +  F  F  ++GK YAT EE+ YR  VF  NL R+  HQ
Sbjct  35    IRQVVSDGADAVDQLL---HADHHFSLFKTKYGKSYATQEEHDYRFSVFKANLRRSKRHQ  91

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             ILDP+AVHGVT+FSDLTP EFEK Y+G+ +   +  L   + +A  L    LP  FDWRD
Sbjct  92    ILDPSAVHGVTKFSDLTPEEFEKSYLGLRQ--KKLKLPVDENKAAVLPTEDLPTDFDWRD  149

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FSTTGA+EGA+++ATG+L +LSEQQLVDCDH CD  + ++CD
Sbjct  150   HGAVTAVKDQGSCGSCWSFSTTGALEGAHYLATGELASLSEQQLVDCDHECDPDEANSCD  209

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLM NA+EY +++GG++ E  YPYTGK G C+F+  KV   V NF+ +  D+ Q+
Sbjct  210   AGCNGGLMNNAFEYTLKAGGLQREKDYPYTGKDGVCKFDKTKVVASVSNFSVVSLDDSQI  269

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV +GPLAVGINA +M TY+GGVSCP +C K+ L+HGVLLVGYG  G+S +RL  KP
Sbjct  270   AANLVKYGPLAVGINAAWMQTYIGGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKP  329

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWI+KNSWG+ WGEEGY+++C+GH +CG+ +MVS+V
Sbjct  330   YWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSV  365



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 256/350 (73%), Gaps = 15/350 (4%)
 Frame = +3

Query  147   SSASQGLNIRQVTDDEIPAAGE----NLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGV  314
             SSA+  + IRQV  D +  A E    +LL    E  F SF  + GK+YAT EE+  R GV
Sbjct  19    SSAADDILIRQVVPDAVGEAAEKEEDHLLNA--EHHFASFKAKFGKKYATKEEHDRRFGV  76

Query  315   FAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPR  488
             F  NL RA  H  LDP+AVHGVT+FSDLTP EF + ++G   L++P  A       +AP 
Sbjct  77    FKSNLRRARLHAKLDPSAVHGVTKFSDLTPAEFRRQFLGFKPLRLPANAQ------KAPI  130

Query  489   LDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVD  668
             L    LP+ FDWRDKGAVT VK QG+CGSCW+FSTTGA+EGA+++ATG+L++LSEQQLVD
Sbjct  131   LPTKDLPKDFDWRDKGAVTNVKDQGACGSCWSFSTTGALEGAHYLATGELVSLSEQQLVD  190

Query  669   CDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVK  848
             CDH CD ++  ACD GC+GGLM NA+EY+++SGG+++E  YPYTG+ G C+F+  KVA  
Sbjct  191   CDHVCDPEEYGACDSGCNGGLMNNAFEYILQSGGVQKEKDYPYTGRDGTCKFDKTKVAAT  250

Query  849   VGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGY  1028
             V N++ +  DEDQ+AA LV +GPLAVGINAV+M TY+GGVSCP IC  K L+HGVL+VGY
Sbjct  251   VSNYSVVSLDEDQIAANLVKNGPLAVGINAVFMQTYIGGVSCPYICG-KHLDHGVLIVGY  309

Query  1029  GKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G+  ++ +R   KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  310   GEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTV  359



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   410 bits (1054),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/369 (55%), Positives = 261/369 (71%), Gaps = 13/369 (4%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSAS-------QGLNIRQVTDDEIPAAGENLLGTATEVRFKSF  254
             + ++ + +L  + L FA++AS         L IRQV         ++LL  A E  F SF
Sbjct  3     LLSRFVLLLFSSSLVFAATASTVSSDESDDLLIRQVVAGADDHDNDDLLLNA-EHHFSSF  61

Query  255   MQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV  434
              +  GK Y + +E+  R GVF  NL RA  +QILDP+AVHGVT+F DLTP EF + Y+G+
Sbjct  62    KKRFGKAYTSCDEHDRRFGVFKANLRRAKRNQILDPSAVHGVTQFFDLTPAEFRRTYLGL  121

Query  435   LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGA  614
                  R  L     EAP L  + LP  FDWRD GAVT VK QGSCGSCW+FS TGA+EGA
Sbjct  122   ----KRLRLPADTHEAPILPTNDLPADFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGA  177

Query  615   NFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYP  794
             NF+ATGKL++LSEQQLVDCDH CD +D S+CD GC+GGLMT+A+EY +++GG+E E  YP
Sbjct  178   NFLATGKLVSLSEQQLVDCDHVCDSEDPSSCDSGCNGGLMTSAFEYTLKAGGLEREEDYP  237

Query  795   YTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVS  971
             YTG     C+F+  K+AV   NF+ +  DE+Q+AA LV +GPLA+GINA++M TY+GGVS
Sbjct  238   YTGTDHSKCKFDKTKIAVSASNFSVVSLDENQIAANLVTNGPLAIGINAMFMQTYIGGVS  297

Query  972   CPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMC  1151
             CP ICSK+ L+HGVLLVGYG  GF+ +R   KPYWIIKNSWG+ WGE+GY+++CRG  +C
Sbjct  298   CPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKICRGRNIC  357

Query  1152  GISNMVSAV  1178
             G+ +MVSAV
Sbjct  358   GMDSMVSAV  366



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   410 bits (1055),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 248/343 (72%), Gaps = 7/343 (2%)
 Frame = +3

Query  156   SQGLNIRQVTDD-EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
             S  L IRQV D  E    GEN L  A    F  F ++ GK Y    E+ YRL VF  N+ 
Sbjct  35    SDDLVIRQVVDHGEDEVVGENSLLNADH-HFAIFKRKFGKTYTDKAEHDYRLSVFKANMR  93

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPE  512
             RA +HQ +DP+AVHGVT+FSDLTP EF   ++GV +   R  L     +AP L  + LP 
Sbjct  94    RAVQHQKIDPSAVHGVTQFSDLTPREFRSRFLGVNR---RLRLPSDAHKAPILPTNDLPA  150

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
              FDWRD+GAVT VK QGSCGSCW+FSTTGA+EGANF+ATG L +LSEQQLVDCDH CD +
Sbjct  151   DFDWRDRGAVTAVKNQGSCGSCWSFSTTGALEGANFLATGNLESLSEQQLVDCDHECDPE  210

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNL  869
             +K +CD GC+GGLM +A+EY +++GG+  EA YPYTG   G C+FE  K+A KV NF+ +
Sbjct  211   EKDSCDSGCNGGLMNSAFEYTLKAGGLMREADYPYTGTDRGTCKFEKTKIAAKVANFSVV  270

Query  870   PADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSI  1049
               DEDQ+AA LV +GPLAV INA YM TYM GVSCP IC+ KRL+HGVLLVGYG+ G+S 
Sbjct  271   SLDEDQIAANLVKNGPLAVAINAAYMQTYMKGVSCPYICT-KRLDHGVLLVGYGETGYSP  329

Query  1050  LRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +R+  KPYWIIKNSWG +WGE+GY+++CRG  +CG+ +MVS V
Sbjct  330   IRMKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTV  372



>ref|XP_004290288.1| PREDICTED: cysteine proteinase RD19a-like [Fragaria vesca subsp. 
vesca]
Length=372

 Score =   410 bits (1054),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 256/348 (74%), Gaps = 21/348 (6%)
 Frame = +3

Query  171   IRQVTD--DEIPAA-------GENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             IRQV D  DE P         GE +LG   E  F  F ++ GK YA+ EE+ YR  VF  
Sbjct  29    IRQVVDGGDESPHHHHHHDHDGEAMLGA--EHHFSLFKRKFGKSYASQEEHDYRFSVFKT  86

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDV  497
             N+ RA  HQ LDPTA HGVTRFSDLTP EF K ++G+  LK+P  A+       AP L  
Sbjct  87    NMRRAKRHQRLDPTAQHGVTRFSDLTPAEFRKSHLGLRGLKLPADANT------APILPT  140

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
               LPE FDWR++GAVTEVK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH
Sbjct  141   ENLPEDFDWRERGAVTEVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDH  200

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVG  854
              CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYTG   G C+F+  K+A KV 
Sbjct  201   ECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMKEKDYPYTGTDRGTCKFDKTKIAAKVS  260

Query  855   NFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGK  1034
             NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG 
Sbjct  261   NFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICS-KRLDHGVLLVGYGS  319

Query  1035  KGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              G+S +R+  KPYWIIKNSWG++WGE+G++++CRG  +CG+ +MVS V
Sbjct  320   AGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVDSMVSTV  367



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   409 bits (1052),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 246/337 (73%), Gaps = 11/337 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D     GE+ L  A E  F SF  + GK YAT EE+ YR GVF  NL RA +HQ
Sbjct  33    IRQVVSD-----GEDDLLNA-EHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             ++DPTA HGVT+FSDLTP EF + ++G+ +   R  L     +AP L  + LP  FDWRD
Sbjct  87    MIDPTAAHGVTKFSDLTPKEFRRQFLGLKR---RLQLPTDANKAPILPTTDLPTDFDWRD  143

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVTEVK QGSCGSCW+FS TGA+EGA+++ATG+L +LSEQQLVDCDH CD ++  ACD
Sbjct  144   HGAVTEVKDQGSCGSCWSFSATGALEGAHYLATGQLASLSEQQLVDCDHECDPEEYGACD  203

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC GGLM NA+EY +++GG+E E  YPYTG  GG C+F+  KV   V NF+ +  DEDQ
Sbjct  204   SGCDGGLMNNAFEYALKAGGLEREEDYPYTGTDGGTCKFDKSKVVASVSNFSVVSIDEDQ  263

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPL+V INAV+M TY+GGVSCP ICS KR +HGVLLVGYG  G++ +R   K
Sbjct  264   IAANLVKHGPLSVAINAVFMQTYVGGVSCPYICS-KRQDHGVLLVGYGSAGYAPIRFKEK  322

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             P+WIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  323   PFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTV  359



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   409 bits (1052),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 259/366 (71%), Gaps = 21/366 (6%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN------IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             L++ L  A L+F  +++   +      IRQV    +P   ++ L  A E  F +F  + G
Sbjct  6     LISFLVYALLSFTIASTTSPDELDDPLIRQV----VPDGDQDHLLNA-EHHFTTFKAKFG  60

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKV  443
             K YAT EE+ YR  +F  NL RA +HQ++DPTAVHGVT FSDLTP EF + Y+G+  L++
Sbjct  61    KTYATQEEHDYRFKLFKANLRRARKHQMMDPTAVHGVTMFSDLTPREFRRQYLGLRRLRL  120

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P  A       EAP L  + LP  FDWRD GAVT VK QGSCGSCW+FS  GA+EGA+F+
Sbjct  121   PADAH------EAPILPTNDLPTDFDWRDHGAVTNVKNQGSCGSCWSFSAAGALEGAHFL  174

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATG+L++LSEQQLVDCDH CD ++  ACD GC+GGLMT A+EY +++GG+E E  YPYTG
Sbjct  175   ATGELVSLSEQQLVDCDHECDPEEYGACDSGCNGGLMTTAFEYTLKAGGLEREEDYPYTG  234

Query  804   KG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
                G C+F+  K+   V NF+ +  DEDQ+AA LV HGPLAVGINAV+M TYMGGVSCP 
Sbjct  235   NDRGPCKFDRNKIVASVSNFSVVSIDEDQIAANLVKHGPLAVGINAVFMQTYMGGVSCPY  294

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICS KR +HGVLLVGYG  G++ +RL  KP+WIIKNSWG+ WGE GY+R+CRG  +CG+ 
Sbjct  295   ICS-KRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICRGRNICGVD  353

Query  1161  NMVSAV  1178
              MVS+V
Sbjct  354   AMVSSV  359



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   409 bits (1051),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 202/364 (55%), Positives = 261/364 (72%), Gaps = 14/364 (4%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKE  275
             +++ L+     A    +S   +   IRQV DD     GE  + +A E  F  F ++ GK 
Sbjct  10    IFSLLIVSAVIAETLTSSETVEDPLIRQVVDD---GRGEAHVLSA-EHHFSLFKKKFGKS  65

Query  276   YATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPG  449
             YA+ EE+ YR  VF  NL RAA HQ LDP+A HGVT+FSDLTP EF+K ++G+  L++P 
Sbjct  66    YASQEEHNYRFKVFQANLRRAARHQKLDPSASHGVTQFSDLTPAEFKKQFLGLRSLRLPK  125

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
              A       +AP L  + LPE FDWR+KGAVT VK QGSCGSCW+FSTTGA+EGA+F++T
Sbjct  126   DAH------QAPILPTNDLPEDFDWREKGAVTNVKNQGSCGSCWSFSTTGALEGAHFLST  179

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG  809
             G+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG  
Sbjct  180   GELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTD  239

Query  810   -GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+  KVA  V NF+ +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP IC
Sbjct  240   RGACKFDKTKVAATVANFSVISLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYIC  299

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             S KRL+HGVLLVGYG  G++ +RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +M
Sbjct  300   S-KRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVDSM  358

Query  1167  VSAV  1178
             VS V
Sbjct  359   VSTV  362



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   409 bits (1050),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 245/337 (73%), Gaps = 7/337 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +P A E+      E  F +F    GK YA+ EE+ YR GVF  NL RA  HQ
Sbjct  30    IRQV----VPGAAEDDELLHAERHFSNFKATFGKSYASQEEHDYRFGVFKANLRRAKRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDPTAVHGVT+FSDLTP EF + ++G+ K   R  L     +AP L  + LP  FDWR+
Sbjct  86    GLDPTAVHGVTKFSDLTPKEFRRNFLGLKKR--RLRLPADANKAPILPTNDLPTEFDWRE  143

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT VK QG+CGSCW+FS  GA+EGA+++ TG+L++LSEQQLVDCDH CD ++  +CD
Sbjct  144   KGAVTPVKDQGACGSCWSFSAAGALEGAHYLTTGELVSLSEQQLVDCDHECDPEEYGSCD  203

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GCSGGLMTNA+EY +++GG+E+E  YPYTG   G C+F+  KV   V NF+ +  DEDQ
Sbjct  204   SGCSGGLMTNAFEYALKAGGLEQEKDYPYTGTDRGTCKFDKSKVVATVSNFSVVSLDEDQ  263

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV++GPLA+GINAV+M TY+GGVSCP IC K  L+HGVLLVGYG  G++ +R   K
Sbjct  264   IAANLVHNGPLAIGINAVFMQTYIGGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEK  323

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG+ WGEEGY+++CRG  +CG+ +MVS V
Sbjct  324   PYWIIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTV  360



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 238/329 (72%), Gaps = 2/329 (1%)
 Frame = +3

Query  195   IPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVH  374
             +P + E+ L    E  F SF++  GK YA  +E+ YR  VF  NL RA  HQ +DPTAVH
Sbjct  41    VPESDEDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRHQKMDPTAVH  100

Query  375   GVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVK  554
             G+T+FSDLTP EF + Y+G+         L    EAP L  + LP  FDWRD GAVT VK
Sbjct  101   GITKFSDLTPAEFRRTYLGLRGGRRLRRALASSHEAPILPTNNLPTDFDWRDHGAVTGVK  160

Query  555   MQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLM  734
              QGSCGSCW+FS +GA+EGANF+ATG+L +LSEQQLVDCDH CD  +  +CD GC+GGLM
Sbjct  161   DQGSCGSCWSFSASGALEGANFLATGQLESLSEQQLVDCDHECDSSEPDSCDSGCNGGLM  220

Query  735   TNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNH  911
             T A+EYL++SGG+E E  YPYTG   G C+F+  K+   V NF+ +  DEDQ+AA LV H
Sbjct  221   TTAFEYLLKSGGLEREKDYPYTGTDRGRCKFDESKIVASVKNFSVVSMDEDQIAANLVKH  280

Query  912   GPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNS  1091
             GPLAVGINAV+M TY+GGVSCP IC  K L+HGVLLVGYG  G++ +R   KPYWIIKNS
Sbjct  281   GPLAVGINAVFMQTYIGGVSCPYICG-KHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNS  339

Query  1092  WGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             WG++WGE+GY+++C+G  +CG+ +MVS V
Sbjct  340   WGENWGEDGYYKICKGRNVCGVDSMVSTV  368



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 249/340 (73%), Gaps = 17/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D     GE+ L  A E  F SF  + GK YAT EE+ YR GVF  NL RA +HQ
Sbjct  33    IRQVVSD-----GEDDLLNA-EHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
             ++DPTA HG+T+FSDLTP EF + ++G+   L++P  A+      +AP L  + LP  +D
Sbjct  87    MIDPTAAHGITKFSDLTPKEFRRQFLGLKRWLRLPTDAN------KAPILPTTDLPTDYD  140

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAVTEVK QGSCGSCW+FS TGA+EGA+++ATG+L +LSEQQLVDCDH CD ++  
Sbjct  141   WRDHGAVTEVKDQGSCGSCWSFSATGALEGAHYLATGELASLSEQQLVDCDHECDPEEYG  200

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPAD  878
             ACD GC GGLM NA+EY +++GG+E EA YPYTG  GG C+F+  KV   V NF+ +  D
Sbjct  201   ACDSGCDGGLMNNAFEYALKAGGLEREADYPYTGTDGGTCKFDKSKVVASVSNFSVVSID  260

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV HGPL+V INA +M TY+GGVSCP ICS KR +HGVLLVGYG  G++ +R 
Sbjct  261   EDQIAANLVKHGPLSVAINAAFMQTYVGGVSCPYICS-KRQDHGVLLVGYGSAGYAPIRF  319

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KP+WIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  320   KEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTV  359



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   408 bits (1048),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 250/340 (74%), Gaps = 12/340 (4%)
 Frame = +3

Query  171   IRQVTDDE-IPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEH  347
             IRQV  D  +    ++ L  A E  F  F  ++GK YA+ EE+ YRLGVF  NL RA  H
Sbjct  31    IRQVVSDGGVEEDSDDHLLNA-EHHFTLFKSKYGKTYASQEEHDYRLGVFKANLRRAKRH  89

Query  348   QILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
             Q+LDP+AVHGVT+FSDLTP+EF + Y+G+  LK+P  A       +AP L    LP+ FD
Sbjct  90    QVLDPSAVHGVTKFSDLTPSEFRRQYLGLKPLKLPADAQ------KAPILPTDNLPDDFD  143

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD  AVT VK QGSCGSCW+FS TGA+EGA+++ATG+L++LSEQQLVDCDH CD +   
Sbjct  144   WRDHDAVTGVKDQGSCGSCWSFSATGALEGAHYLATGELVSLSEQQLVDCDHECDPQQYG  203

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPAD  878
             ACD GC+GGLMT+A+EY ++ GG+E E  YPYTG   G C+F+  K+A  V NF+ +  D
Sbjct  204   ACDSGCNGGLMTSAFEYTLKVGGLEREKDYPYTGNDRGPCKFDKTKIAASVSNFSVISVD  263

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV HGPLAVGINAV+M TYMGGVSCP IC +  L+HGVLLVGYG  G+S +R 
Sbjct  264   EDQIAANLVKHGPLAVGINAVFMQTYMGGVSCPYICFRT-LDHGVLLVGYGAAGYSPIRF  322

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KP+WIIKNSWG +WGE+GY+R+CRG  +CG+ +MVS+V
Sbjct  323   KDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSV  362



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   409 bits (1051),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 252/339 (74%), Gaps = 11/339 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  +      ++ L  A E  F  F  ++GK YAT EE+ YRLGVF  NL RA  HQ
Sbjct  63    IRQVVSNGAGEDSDDHLLNA-EHHFTLFKSKYGKTYATQEEHDYRLGVFKANLRRAKRHQ  121

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
             +LDPTAVHGVT+FSDLTP+EF + ++G+  LK+P  A       +AP L  + LP  FDW
Sbjct  122   LLDPTAVHGVTKFSDLTPSEFRRQFLGLRPLKLPADAQ------KAPILPTNDLPTDFDW  175

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD GAVT VK QGSCGSCW+FSTTGA+EGA++++TG+L++LSEQQLVDCDH CD ++  A
Sbjct  176   RDHGAVTGVKDQGSCGSCWSFSTTGALEGAHYLSTGELVSLSEQQLVDCDHECDPQEYGA  235

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLMT A+EY +++GG+E E  YPYTG   G C+F+  K+A  V NF+ +  +E
Sbjct  236   CDSGCNGGLMTTAFEYTLKAGGLEREDDYPYTGNDRGACKFDKSKIAASVSNFSVISVNE  295

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV HGPLAVGINAV+M TYM GVSCP IC  + L+HGVLLVGYG  G++ +R  
Sbjct  296   DQIAANLVKHGPLAVGINAVFMQTYMKGVSCPYICG-RHLDHGVLLVGYGSAGYAPIRFK  354

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGEEGY+++CRG  +CG+ +MVS+V
Sbjct  355   EKPYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSV  393



>gb|EEC82027.1| hypothetical protein OsI_25996 [Oryza sativa Indica Group]
Length=709

 Score =   419 bits (1078),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 211/354 (60%), Positives = 254/354 (72%), Gaps = 19/354 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD      G    G   E +F +F++ HG+EY+  EEY  RL VFA NL RAA HQ
Sbjct  29    IRQVTD-----GGYWPPGLLPEAQFAAFVRRHGREYSGPEEYARRLRVFAANLARAAAHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLK------VPGRASLLGGKAEAPRLDVSGLPE  512
              LDPTA HGVT FSDLT  EFE    G+        V  R   +   A A   +VSGLP 
Sbjct  84    ALDPTARHGVTPFSDLTREEFEARLTGLATDVGDDDVRRRRLPMPSAAPATEEEVSGLPS  143

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
             +FDWRD+GAVT VKMQG+CGSCWAFSTTGA+EGANF+ATG LL+LSEQQLVDCDHTCD +
Sbjct  144   SFDWRDRGAVTGVKMQGACGSCWAFSTTGAVEGANFLATGNLLDLSEQQLVDCDHTCDAE  203

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNL-  869
              K+ CD GC GGLMTNAY YL+ SGG+ E+++YPYTG  G CRF++ +VAV+V NFT + 
Sbjct  204   KKTECDSGCGGGLMTNAYAYLMSSGGLMEQSAYPYTGAQGACRFDANRVAVRVANFTVVA  263

Query  870   ----PADED---QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGY  1028
                 P   D   QM A LV HGPLAVG+NA YM TY+GGVSCPL+C +  +NHGVLLVGY
Sbjct  264   PAAGPGGNDGDAQMRAALVRHGPLAVGLNAAYMQTYVGGVSCPLVCPRAWVNHGVLLVGY  323

Query  1029  GKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVMTRP  1190
             G++GF+ LRLG +PYWIIKNSWGK WGE+GY+R+CRG  +CG+  M+   + RP
Sbjct  324   GERGFAALRLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDTMLPEGINRP  377



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 198/336 (59%), Positives = 248/336 (74%), Gaps = 10/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD E     + LL    E  F +F  +  K YAT EE+ YR GVF  NL +A  HQ
Sbjct  29    IRQVTDHE----DDQLLNA--EHHFTTFKSKFSKSYATKEEHDYRFGVFKSNLKKAKLHQ  82

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDP+A HGVT+FSDLT +EF + ++G+ K   R  L     +AP L  + LPE FDWR+
Sbjct  83    KLDPSAEHGVTKFSDLTASEFRRQFLGLKK---RLRLPAHAQKAPILPTNNLPEDFDWRE  139

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT VK QGSCGSCWAFSTTGA+EGAN++ATGKL++LSEQQLVDCDH CD  + ++CD
Sbjct  140   KGAVTPVKDQGSCGSCWAFSTTGALEGANYLATGKLVSLSEQQLVDCDHVCDPDEYNSCD  199

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLM NA+EYL++SGG+  E  Y YTG+ G C+F+  K+A  V NF+ +  DEDQ+
Sbjct  200   SGCNGGLMNNAFEYLLQSGGVVREQDYSYTGRDGSCKFDKSKIAASVSNFSVVSVDEDQI  259

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV +GPLAV INA +M TYM GVSCP IC+K RL+HGVLLVG+G  GF+ +RL  KP
Sbjct  260   AANLVKNGPLAVAINAAWMQTYMSGVSCPYICAKSRLDHGVLLVGFG-NGFAPIRLKEKP  318

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGEEGY+++CRG  +CG+ +MVS V
Sbjct  319   YWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTV  354



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   407 bits (1045),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 190/329 (58%), Positives = 236/329 (72%), Gaps = 2/329 (1%)
 Frame = +3

Query  195   IPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVH  374
             +P A ++ L    E  F SF++  GK YA  +E+ YR  VF  NL RA  HQ LDPTAVH
Sbjct  38    VPDAEDDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLWRAQRHQRLDPTAVH  97

Query  375   GVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVK  554
             G+T+FSDLTP EF + Y+G+         L    EAP L  + LP   DWRD GAVT VK
Sbjct  98    GITKFSDLTPAEFRRNYLGLHGWRRLRRALAASHEAPILPTNDLPTDIDWRDSGAVTAVK  157

Query  555   MQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLM  734
              QGSCGSCW+FS  GA+EGANF+ATGKL +LSEQQLVDCDH CD  +  ACD GC+GGLM
Sbjct  158   DQGSCGSCWSFSAAGALEGANFLATGKLESLSEQQLVDCDHECDSSEPDACDSGCNGGLM  217

Query  735   TNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNH  911
             T A+EYL++SGG+E E  YPYTG   G C+F+  K+A  V NF+ +  D+DQ+AA LV H
Sbjct  218   TTAFEYLLKSGGLEREEDYPYTGTDRGGCKFDKSKIAASVKNFSVVSMDDDQIAANLVKH  277

Query  912   GPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNS  1091
             GPLAVGINA++M TY+GGVSCP IC  + L+HGVLLVGYG  G++ +R   KPYWIIKNS
Sbjct  278   GPLAVGINAIFMQTYIGGVSCPYICG-RHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNS  336

Query  1092  WGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             WG +WGE+GY+++CRG  +CG+ +MVS V
Sbjct  337   WGGNWGEDGYYKICRGQNICGVESMVSTV  365



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   406 bits (1044),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 243/337 (72%), Gaps = 11/337 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             I QV DDE    GE  L  + E  F SF++  GK YA  EE   R  VF  NL RAA +Q
Sbjct  34    ILQVVDDE---KGE--LALSAEAHFASFVRRFGKTYADEEERALRFKVFKANLHRAARYQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDPTA+HGVT+FSDL+P EF + Y+G+ +     S      EAP L    LP  FDWRD
Sbjct  89    RLDPTAIHGVTKFSDLSPAEFRRAYLGLRRPEAHKS----THEAPILPTDDLPTDFDWRD  144

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FST GA+EGANF+ATGKL +LSEQQLVDCDH CD  +  ACD
Sbjct  145   YGAVTGVKNQGSCGSCWSFSTAGALEGANFLATGKLESLSEQQLVDCDHECDSDEPDACD  204

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLMT A++YL++SGG+E E  YPYTG   G C+F+  K+A  V NF+ +  +EDQ
Sbjct  205   QGCNGGLMTTAFQYLLKSGGLEREEDYPYTGTDRGSCKFDKSKIAASVQNFSVISTNEDQ  264

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPLA+GIN+V+M TY+GGVSCP IC  + L+HGVLLVGYG  G+S +RL  K
Sbjct  265   IAANLVKHGPLAIGINSVFMQTYIGGVSCPYICG-RHLDHGVLLVGYGSAGYSPIRLKDK  323

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             P+WIIKNSWG++WGE GY+++CRG  +CG+ +MVS+V
Sbjct  324   PFWIIKNSWGENWGEHGYYKICRGRNICGVDSMVSSV  360



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 266/366 (73%), Gaps = 22/366 (6%)
 Frame = +3

Query  108   LLAVLTCAHLA--FASSAS----QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             LL++L C   +  FA++ S    +   IRQV    +P A ++LL    E  F +F  + G
Sbjct  6     LLSLLICTLFSSTFAATVSPDEVEDPLIRQV----VPEAVDHLLNA--EHHFTTFKSKFG  59

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKV  443
             K YAT EE+ +R  VF  NL RA +HQ++DP+AVHGVT+FSDLTP EF + Y+G+  L++
Sbjct  60    KNYATQEEHDHRFKVFKANLRRARKHQMMDPSAVHGVTKFSDLTPREFRRQYLGLKRLRL  119

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P  A       EAP L  + LP  FDWRDKGAVT VK QG+CGSCW+FS TGA+EGA+F+
Sbjct  120   PADAH------EAPILPTNDLPSDFDWRDKGAVTNVKDQGACGSCWSFSATGALEGAHFL  173

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             +TG+LL+LSEQQLVDCDH CD ++  ACD GC+GGLMT+A+EY +++GG+E E  YPYTG
Sbjct  174   STGELLSLSEQQLVDCDHECDPEEYGACDSGCNGGLMTSAFEYTLKAGGLEREEDYPYTG  233

Query  804   KG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
                G C+F+  K+A  V NF+ +  DE+Q+AA LV +GPLAVGINA++M TY+GGVSCP 
Sbjct  234   TDRGPCKFDRSKIAASVSNFSVISIDEEQIAANLVKNGPLAVGINAMFMQTYIGGVSCPY  293

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICSK + +HGVLLVGYG  G++ +R   KP+WIIKNSWG++WGE GY+++CRG  +CG+ 
Sbjct  294   ICSKSQ-DHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICRGRNICGMD  352

Query  1161  NMVSAV  1178
              MVS+V
Sbjct  353   AMVSSV  358



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 245/343 (71%), Gaps = 14/343 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +P   +N L    E  F SF+Q  GK Y   EE+ YRL +F  NL RA  HQ
Sbjct  28    IRQV----VPGGDDNELELNAESHFLSFVQRFGKSYKDAEEHAYRLSIFKANLRRARRHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLG--GKA--EAPRLDVSGLPETF  518
             +LDP+A HGVT+FSDLTP EF + Y+G+ K   R +LL   GK+  EAP L   GLP+ F
Sbjct  84    LLDPSAEHGVTKFSDLTPAEFRRTYLGLRK--SRRALLRELGKSANEAPVLPTDGLPDDF  141

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FST+GA+EGA+++ATGKL  LSEQQ+VDCDH CD  + 
Sbjct  142   DWRDHGAVTPVKNQGSCGSCWSFSTSGALEGAHYLATGKLEVLSEQQMVDCDHVCDTSEP  201

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPAD  878
              +CD GC+GGLMTNA+ YL ++GG+E E  YPYTG    C+F+  K+   V NF+ +  D
Sbjct  202   DSCDSGCNGGLMTNAFSYLQKAGGLESEKDYPYTGSDDKCKFDKSKIVASVQNFSVVSVD  261

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E Q+AA L+ HGPLA+GINA YM TY+GGVSCP IC +  L+HGVLLVGYG  GF+ +RL
Sbjct  262   EGQIAANLIKHGPLAIGINAAYMQTYIGGVSCPYICGRT-LDHGVLLVGYGAAGFAPIRL  320

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
               KPYWIIKNSWG++WGE GY+++CRG  +   CG+ +MVS V
Sbjct  321   KDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  363



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 259/366 (71%), Gaps = 15/366 (4%)
 Frame = +3

Query  105   QLLAVLTCAHLAFASSA---SQGLNIRQVTD--DEIPAAGENLLGTATEVRFKSFMQEHG  269
             ++L++L    L   S A   S    IRQV D  DE     ++      E  F  F  + G
Sbjct  3     RVLSLLVTFSLLIVSRAQLDSTDPLIRQVVDGGDESHHHHDHDHALGAEHHFSLFKHKFG  62

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKV  443
             K YA+ EE+ YR  VF  NL RAA HQ LDP+A HGVTRFSD+TP EF K  +G+  LK+
Sbjct  63    KSYASKEEHDYRFDVFKANLRRAARHQRLDPSAQHGVTRFSDMTPAEFRKSQLGLRGLKL  122

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P  A+      +AP L    LPE FDWR+ GAVT VK QGSCGSCW+FSTTGA+EGA+F+
Sbjct  123   PEDAT------KAPILPTENLPEDFDWREHGAVTAVKNQGSCGSCWSFSTTGALEGAHFL  176

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATG+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYTG
Sbjct  177   ATGELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYALKAGGLMKEEDYPYTG  236

Query  804   -KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
               GG C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP 
Sbjct  237   TDGGTCKFDKSKIAASVSNFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYVGGVSCPY  296

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICS KRL+HGVLLVGYG  G+S +RL  KPYWIIKNSWG++WGE G++++CRG  +CG+ 
Sbjct  297   ICS-KRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVD  355

Query  1161  NMVSAV  1178
             +MVS V
Sbjct  356   SMVSTV  361



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   405 bits (1042),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 200/367 (54%), Positives = 254/367 (69%), Gaps = 10/367 (3%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGEN----LLGTATEVRFKSFMQ  260
             ++   LLA         +  +     IRQV DD     G N    LLG   +  F  F Q
Sbjct  8     IVVLSLLAASAIGSEVISGESDGDFIIRQVVDDGGVNEGSNGDDLLLGA--DHHFSVFKQ  65

Query  261   EHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLK  440
             + GK YA+ EE+ +R  VF  NL RA  HQ LDP+A HGVT+FSDLTP+EF + ++G+  
Sbjct  66    KFGKSYASKEEHDHRFRVFKANLKRAQRHQALDPSATHGVTQFSDLTPSEFRRSFLGLRS  125

Query  441   VPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANF  620
                R  L     +AP L   GLP  FDWRDKGAV+EVK QGSCGSCW+FS TGA+EGANF
Sbjct  126   R--RLGLPADANKAPILPTDGLPTDFDWRDKGAVSEVKNQGSCGSCWSFSATGALEGANF  183

Query  621   IATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYT  800
             +ATGKL++LSEQQLVDCDH CD ++K +CD GC+GGLM +A+EY ++SGG+ +E  YPYT
Sbjct  184   LATGKLVSLSEQQLVDCDHECDPEEKGSCDSGCNGGLMNSAFEYTLKSGGLMKEQDYPYT  243

Query  801   GKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCP  977
             G   G C+F+  K+A  V NF+ +  DE+Q+AA LV +GPLAV INAV+M TY+ GVSCP
Sbjct  244   GTDRGTCKFDKSKIAASVANFSVVSLDEEQIAANLVKNGPLAVAINAVFMQTYIKGVSCP  303

Query  978   LICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGI  1157
              ICS K L+HGVLLVGYG  G++ +RL  KPYWIIKNSWG +WGE GY+++CRG  +CG+
Sbjct  304   YICS-KHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICRGRNICGV  362

Query  1158  SNMVSAV  1178
              +MVS V
Sbjct  363   DSMVSTV  369



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 238/329 (72%), Gaps = 2/329 (1%)
 Frame = +3

Query  195   IPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVH  374
             +P A ++ L   TE  F SF++  GK YA  +E+ YR  VF  NL RA  HQ LDPTAVH
Sbjct  36    VPDAEDDELMLNTEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRHQRLDPTAVH  95

Query  375   GVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVK  554
             G+T+FSDLTP EF + Y+G+         L    EAP L  + LP   DWRD GAVT VK
Sbjct  96    GITKFSDLTPAEFRRNYLGLRGGRRLRRALAASHEAPILPTNDLPTDIDWRDHGAVTAVK  155

Query  555   MQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLM  734
              QGSCGSCW+FS  GA+EGANF+ATGKL +LSEQQLVDCDH CD  +  +CD GC+GGLM
Sbjct  156   DQGSCGSCWSFSAAGALEGANFLATGKLESLSEQQLVDCDHECDSSEPDSCDSGCNGGLM  215

Query  735   TNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNH  911
             T A+EYL+++GG+E E  YPYTG   G C+F+  K+A  V NF+ +  DEDQ+ A LV H
Sbjct  216   TTAFEYLLKTGGLESEEDYPYTGTDRGGCKFDKSKIAASVRNFSVVSTDEDQIGANLVKH  275

Query  912   GPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNS  1091
             GPLAVGINAV+M TY+GGVSCP IC  + L+HGVLLVGYG  G++ +R   KPYWIIKNS
Sbjct  276   GPLAVGINAVFMQTYIGGVSCPYICG-RHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNS  334

Query  1092  WGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             WG++WGE+GY+++CRGH +CG+ +MVS V
Sbjct  335   WGENWGEDGYYKICRGHNICGVESMVSTV  363



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/342 (58%), Positives = 245/342 (72%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +    +N L    E  F SF+Q  GK Y   +E+ YRL VF  NL RA  HQ
Sbjct  30    IRQV----VGGGDDNELELNAERHFASFVQRFGKSYRDADEHAYRLSVFKANLRRARRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKA-EAPRLDVSGLPETFD  521
             +LDP+A HGVT+FSDLTP EF + Y+G L+   RA L  LGG A EAP L   GLP+ FD
Sbjct  86    LLDPSAEHGVTKFSDLTPAEFRRAYLG-LRTSRRAFLRGLGGSAHEAPVLPTDGLPDDFD  144

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAV  VK QGSCGSCW+FS +GA+EGAN++ATGK+  LSEQQ+VDCDH CD  +  
Sbjct  145   WRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLATGKMDVLSEQQMVDCDHECDSSEPD  204

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             +CD GC+GGLMTNA+ YL++SGG+E E  YPYTG+ G C+F+  K+   V NF+ +  DE
Sbjct  205   SCDAGCNGGLMTNAFSYLLKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDE  264

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV HGPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGYG  GF+ +RL 
Sbjct  265   DQIAANLVKHGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGYGASGFAPIRLK  323

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
              K YWIIKNSWG++WGE GY+++CRG  +   CG+ +MVS V
Sbjct  324   DKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTV  365



>gb|KHN00877.1| Cysteine proteinase 15A [Glycine soja]
Length=326

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/317 (61%), Positives = 237/317 (75%), Gaps = 54/317 (17%)
 Frame = +3

Query  231   TEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNE  410
             TE +FK FM+ +G+ Y+T EEY+ RLG+F++N++RAAEHQ LDPTAVHGVT+FSDLT  E
Sbjct  50    TEKKFKVFMENYGRSYSTREEYLRRLGIFSQNMLRAAEHQALDPTAVHGVTQFSDLTEVE  109

Query  411   FEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFS  590
             FEK+Y GV          GG                              G CGSCWAFS
Sbjct  110   FEKLYTGVN---------GG------------------------------GRCGSCWAFS  130

Query  591   TTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGG  770
             TTG+IEGANF+ATGKL++L                K++CD+GC+GGLMTNAY YL+ESGG
Sbjct  131   TTGSIEGANFLATGKLVSL---------------KKTSCDNGCNGGLMTNAYNYLLESGG  175

Query  771   IEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             +EEE+SYPYTG+ G+C+F+ EK+ V++ NFTN+P DE+Q+AAYLV +GPLA+G+NA++M 
Sbjct  176   LEEESSYPYTGERGECKFDPEKITVRITNFTNIPVDENQIAAYLVKNGPLAMGVNAIFMQ  235

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCPLICSKKRLNHGVLLVGYG KGFSILRLG KPYWIIKNSWGK WGE+GY+++
Sbjct  236   TYIGGVSCPLICSKKRLNHGVLLVGYGAKGFSILRLGNKPYWIIKNSWGKKWGEDGYYKL  295

Query  1131  CRGHGMCGISNMVSAVM  1181
             CRGHGMCGI+ MVSA M
Sbjct  296   CRGHGMCGINTMVSAAM  312



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   405 bits (1040),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 190/330 (58%), Positives = 243/330 (74%), Gaps = 6/330 (2%)
 Frame = +3

Query  192   EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAV  371
             ++ + GE+ L  A E  F SF  + GK YAT EE+ YR GVF  NL RA +HQ++DPTA 
Sbjct  35    QVVSDGEDDLLNA-EHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQMIDPTAA  93

Query  372   HGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEV  551
             HGVT+FSDLTP EF + ++G+ +   R  L     +AP L  + LP  +DWRD GAVTEV
Sbjct  94    HGVTKFSDLTPKEFRRQFLGLKR---RLRLPTDANKAPILPTTDLPTDYDWRDHGAVTEV  150

Query  552   KMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGL  731
             K QGSCGSCW+FS TGA+EGA+++ATG+L +LSEQQLVDCDH CD ++  ACD GC GGL
Sbjct  151   KDQGSCGSCWSFSATGALEGAHYLATGELASLSEQQLVDCDHECDPEEYGACDSGCDGGL  210

Query  732   MTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVN  908
             M NA+EY +++GG+E E  YPYTG  GG C+F+  KV   V NF+ +  DEDQ+AA LV 
Sbjct  211   MNNAFEYALKAGGLEREEDYPYTGTDGGTCKFDKSKVVASVSNFSVVSIDEDQIAANLVK  270

Query  909   HGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKN  1088
             HGPL+V INA +M TY+GGVSCP ICS KR +HGVLLVGYG  G++ +R   KP+WIIKN
Sbjct  271   HGPLSVAINAAFMQTYVGGVSCPYICS-KRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKN  329

Query  1089  SWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             SWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  330   SWGQNWGENGYYKICRGRNICGVDSMVSTV  359



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 256/366 (70%), Gaps = 8/366 (2%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVTDD---EIPAAGENLLGTATEVRFKSFMQE  263
             ++   LLA         +  +     IRQV DD      + G++LL    E  F  F Q+
Sbjct  8     IIALSLLAASAIGKEVISGESDGDFIIRQVVDDGGVNGASNGDDLL-LGAEHHFSVFKQK  66

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
              GK YA+ EE+ +R  VF  NL RA  HQ LDP+A HGVT+FSDLTP+EF + ++G+   
Sbjct  67    FGKSYASKEEHDHRFRVFKANLKRAQRHQALDPSATHGVTQFSDLTPSEFRRSFLGLRSR  126

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
               R  L     +AP L   GLP  FDWRDKGAVTEVK QGSCGSCW+FS TGA+EGANF+
Sbjct  127   --RLGLPEDANKAPILPTDGLPADFDWRDKGAVTEVKNQGSCGSCWSFSATGALEGANFL  184

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKL++LSEQQLVDCDH CD ++K +CD GC+GGLM +A+EY ++SGG+ +E  YPYTG
Sbjct  185   ATGKLVSLSEQQLVDCDHECDPEEKGSCDSGCNGGLMNSAFEYTLKSGGLMKEQDYPYTG  244

Query  804   KG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
                G C+F+  K+A  V NF+ +  DE+Q+AA LV +GPLAV INAV+M TY+ GVSCP 
Sbjct  245   TDRGTCKFDKSKIAASVANFSVVSLDEEQIAANLVKNGPLAVAINAVFMQTYIRGVSCPY  304

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICS + L+HGVLLVGYG +G++ +R+  KPYWIIKNSWG +WGE GY+++CRG  +CG+ 
Sbjct  305   ICS-RHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICRGRNICGVD  363

Query  1161  NMVSAV  1178
             +MVS V
Sbjct  364   SMVSTV  369



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   404 bits (1039),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 252/339 (74%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D       ++ LG   E  F  F  + GK YA+ EE+ YR  VF  NL RAA HQ
Sbjct  28    IRQVVDGGDDHQHDHRLGA--EHHFSLFKHQFGKSYASQEEHDYRFEVFKANLRRAARHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
             +LDP+A HGVTRFSD+TP EF K  +G+  L++P  A+      +AP L    LPE FDW
Sbjct  86    MLDPSAQHGVTRFSDMTPAEFRKSQLGLRGLRLPSDAT------KAPILPTENLPEDFDW  139

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  140   RDRGAVTAVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPEEAGS  199

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+ +E  YPYTG   G C+F+  K+A KV NF+ +  DE
Sbjct  200   CDSGCNGGLMNSAFEYTLKAGGLMKEEEYPYTGTDRGSCKFDKSKIAAKVANFSVVSLDE  259

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             +Q+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  G+S +R+ 
Sbjct  260   EQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICS-KRLDHGVLLVGYGAAGYSPIRMK  318

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGE+G++++C+G  +CG+ +MVS V
Sbjct  319   EKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTV  357



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   405 bits (1040),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/363 (56%), Positives = 257/363 (71%), Gaps = 19/363 (5%)
 Frame = +3

Query  138   AFASSASQGLN-IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGV  314
             A+ASS   G   IRQV D    AA +  L T     F  F    GK YA+ EE+ +R  V
Sbjct  18    AYASSEVDGDALIRQVVDG---AAADGDLSTEDHRHFSLFKTRFGKSYASQEEHDHRFAV  74

Query  315   FAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAP  485
             F  NL RA  HQ LDP+AVHGVTRFSDLTP+EF + ++G+   L++P  A+      EAP
Sbjct  75    FRANLHRARRHQELDPSAVHGVTRFSDLTPSEFRRSHLGIRGGLRLPKDAN------EAP  128

Query  486   RLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLV  665
              L    LPE FDWRD GAVT VK QGSCGSCW+FS TGA+EGA+++ATG+L++LSEQQLV
Sbjct  129   LLPTDDLPEDFDWRDHGAVTGVKNQGSCGSCWSFSATGALEGAHYLATGELVSLSEQQLV  188

Query  666   DCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVA  842
             DCDH CD  +  +CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  K+A
Sbjct  189   DCDHECDPDEPGSCDSGCNGGLMNSAFEYTLKAGGLMREGDYPYTGTDRGTCKFDKSKIA  248

Query  843   VKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLV  1022
               V NF+ +  +EDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLV
Sbjct  249   ASVSNFSVVSLNEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-KRLDHGVLLV  307

Query  1023  GYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVS----AVMTRP  1190
             GYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS    AV T P
Sbjct  308   GYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAVHTTP  367

Query  1191  GSY  1199
             GS+
Sbjct  368   GSH  370



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 256/362 (71%), Gaps = 12/362 (3%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLNIRQVTD--DEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             LL   +   ++ A S S    IRQV D  DE     ++      E  F  F  ++GK YA
Sbjct  7     LLVTFSLLIVSRAQSDSADPLIRQVVDGGDESHHDHDHDHVLGAEHHFSLFKHKYGKSYA  66

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRA  455
             + EE+ YR  VF  NL RAA HQ LDP+A HGVTRFSD+TP EF K  +G+  LK+P  A
Sbjct  67    SKEEHDYRFDVFKANLRRAARHQRLDPSAQHGVTRFSDMTPAEFRKSQLGLRGLKLPEDA  126

Query  456   SLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGK  635
             +      +AP L    LPE FDWR+ GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG 
Sbjct  127   T------KAPILPTENLPEDFDWREHGAVTAVKNQGSCGSCWSFSTTGALEGAHFLATGD  180

Query  636   LLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-G  812
             L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYTG   G
Sbjct  181   LVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMKEEDYPYTGTDRG  240

Query  813   DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSK  992
              C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS 
Sbjct  241   TCKFDESKIAASVSNFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICS-  299

Query  993   KRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVS  1172
             KRL+HGVLLVGYG  G+S +RL  KPYWIIKNSWG++WGE G++++CRG  +CG+ +MVS
Sbjct  300   KRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVS  359

Query  1173  AV  1178
              V
Sbjct  360   TV  361



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   405 bits (1040),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 252/343 (73%), Gaps = 17/343 (5%)
 Frame = +3

Query  171   IRQVTD---DEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAA  341
             IRQV D   DE+    EN L  A +  F  F ++ GK YA+ EE+ YR  VF  NL  A 
Sbjct  40    IRQVVDHGDDEV--VDENSLLNA-DYHFAIFKRKFGKSYASQEEHDYRFSVFKANLHLAR  96

Query  342   EHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPE  512
              HQ LDP+AVHGVT+FSDLTP EF   ++G+   L++P  A+      +AP L  + LP 
Sbjct  97    RHQKLDPSAVHGVTQFSDLTPREFRHQFLGINRRLRLPSHAN------KAPILPTNDLPT  150

Query  513   TFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIK  692
              FD RD GAVT VK QGSCGSCW+FSTTGA+EGANF+A GKL++LSEQQLVDCDH CD +
Sbjct  151   DFDXRDHGAVTPVKNQGSCGSCWSFSTTGALEGANFLARGKLVSLSEQQLVDCDHECDPE  210

Query  693   DKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNL  869
             +K +CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+FE  K+A KV NF+ +
Sbjct  211   EKGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDHGTCKFEKTKIAAKVANFSVV  270

Query  870   PADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSI  1049
             P DE+Q+AA LV +GPLAV INAVYM TY+GGVSCPLICS KRL+HGVLLVGYG+ G++ 
Sbjct  271   PIDEEQIAANLVKNGPLAVAINAVYMQTYIGGVSCPLICS-KRLDHGVLLVGYGEAGYAP  329

Query  1050  LRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +R   KPYWIIKNSWG+ WGE+GY+++CRG  +CG+ +MVS V
Sbjct  330   IRRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTV  372



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   404 bits (1038),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 246/349 (70%), Gaps = 13/349 (4%)
 Frame = +3

Query  144   ASSASQGLN---IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGV  314
             A S S G+    IRQV  D   A GE L     EV F  F++   K YA  EE   R  V
Sbjct  22    AYSTSDGIEDPLIRQVVQD---AEGE-LTALDAEVHFARFIKRFRKTYADTEERARRFAV  77

Query  315   FAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLD  494
             F  NL+RA  HQ+LDPTAVHGVT+FSDLTP EF + Y+G L+ P   + +    +AP L 
Sbjct  78    FKANLLRARRHQLLDPTAVHGVTKFSDLTPAEFRRAYLG-LRGP---TFVSSSHDAPILP  133

Query  495   VSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCD  674
              + LPE FDWRD GAVT VK QGSCGSCW+FS  GA+EGA+F+ TGKL +LSEQQLVDCD
Sbjct  134   TNDLPENFDWRDHGAVTPVKNQGSCGSCWSFSAAGALEGAHFLTTGKLESLSEQQLVDCD  193

Query  675   HTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKV  851
             H CD  +  +CD GC+GGLMT A+EYL++SGG+E E  YPYTG   G C+F+  K+A  V
Sbjct  194   HECDSSEPDSCDQGCNGGLMTTAFEYLLKSGGLEREEDYPYTGSDRGACKFDISKIAASV  253

Query  852   GNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYG  1031
             GNF+ +  +EDQ+AA LV HGPLAVGINAV+M TY+ GVSCP IC  K LNHGVLLVGYG
Sbjct  254   GNFSIVSIEEDQIAANLVKHGPLAVGINAVFMQTYVHGVSCPYICG-KHLNHGVLLVGYG  312

Query  1032  KKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               G++  R   K YWIIKNSWG++WGE GY+++CRG  +CG+ +MVS+V
Sbjct  313   SAGYAPARFKEKSYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSSV  361



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 247/339 (73%), Gaps = 14/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    + + G++ L    E  F  F    GK YAT EE+ YRLGVF  NL RA  HQ
Sbjct  34    IRQV----VSSGGDDDLALGAERHFVDFKLRFGKAYATPEEHDYRLGVFKANLRRARLHQ  89

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+AVHGVT+FSDLTP EF + ++G+  L++P  A+      +AP L    LP  FDW
Sbjct  90    KLDPSAVHGVTKFSDLTPEEFRRQFLGLKRLRLPTDAN------KAPVLPTDDLPTEFDW  143

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD+GAVT VK QG+CGSCW+FSTTGA+EGA+F+ATG+L +LSEQQLVDCDH CD ++  A
Sbjct  144   RDRGAVTGVKDQGACGSCWSFSTTGALEGAHFLATGELTSLSEQQLVDCDHECDPEEYGA  203

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GCSGGLMT A+EY ++ GG+E E  YPYTG   G C+F+  K+A  V NF+ +  DE
Sbjct  204   CDSGCSGGLMTTAFEYTLKVGGLEREEDYPYTGTDRGSCKFDKSKIAASVSNFSVITLDE  263

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             +Q+AA LV +GPLAVGINAVYM TY+GGVSCP IC  K L+HGVLLVGYG  G++ +R  
Sbjct  264   EQIAANLVKNGPLAVGINAVYMQTYIGGVSCPYICG-KHLDHGVLLVGYGSAGYAPIRFK  322

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  323   EKPYWIIKNSWGENWGENGYYKICRGRDICGVDSMVSTV  361



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/352 (57%), Positives = 247/352 (70%), Gaps = 17/352 (5%)
 Frame = +3

Query  135   LAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGV  314
             L FA      + IRQV  D     G+  L  A    F  F +  GK YA+ EE+ YRL V
Sbjct  19    LVFAEDDGDDILIRQVVGD-----GDGDLLNADH-HFAVFKRRFGKAYASDEEHDYRLSV  72

Query  315   FAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAP  485
             F  N+ RA  HQ LDP AVHGVT+FSDLTP EF + ++G+   LK P  A        AP
Sbjct  73    FKANMRRAKRHQQLDPAAVHGVTQFSDLTPTEFRRKFLGLNRRLKFPADAKT------AP  126

Query  486   RLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLV  665
              L    LP  FDWRD+GAVT VK QG+CGSCW+FSTTGA+EGANF+ATGKL++LSEQQLV
Sbjct  127   ILPTDELPSDFDWRDRGAVTPVKNQGTCGSCWSFSTTGALEGANFLATGKLVSLSEQQLV  186

Query  666   DCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVA  842
             DCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG     CRF+  K+A
Sbjct  187   DCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGNDLQVCRFDKTKIA  246

Query  843   VKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLV  1022
              KV NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLV
Sbjct  247   AKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-KRLDHGVLLV  305

Query  1023  GYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             GYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  306   GYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTV  357



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/330 (58%), Positives = 243/330 (74%), Gaps = 6/330 (2%)
 Frame = +3

Query  192   EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAV  371
             ++ + GE+ L  A E  F SF  + GK YAT EE+ YR GVF  NL RA +HQ++DPTA 
Sbjct  35    QVVSDGEDDLLNA-EHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKHQMIDPTAA  93

Query  372   HGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEV  551
             HGVT+FSDLTP EF + ++G+ +   R  L     +AP L  + LP  +DWRD GAVTEV
Sbjct  94    HGVTKFSDLTPKEFRRQFLGLKR---RLRLPTDANKAPILPTTDLPTDYDWRDHGAVTEV  150

Query  552   KMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGL  731
             K QGSCGSCW+FS TGA+EGA+++ATG+L +LSEQQLVDCDH CD ++  ACD GC GGL
Sbjct  151   KDQGSCGSCWSFSATGALEGAHYLATGELASLSEQQLVDCDHECDPEEYGACDSGCDGGL  210

Query  732   MTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVN  908
             M NA+EY +++GG+E E  YPYTG  GG C+F+  KV   V NF+ +  DEDQ+AA LV 
Sbjct  211   MNNAFEYALKAGGLEREEDYPYTGTDGGTCKFDKSKVVASVSNFSVVSIDEDQIAANLVK  270

Query  909   HGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKN  1088
             HGPL+V INA +M TY+GGVSCP ICS KR +HGVLLVGYG  G++ +R   KP+WIIKN
Sbjct  271   HGPLSVAINAAFMQTYVGGVSCPYICS-KRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKN  329

Query  1089  SWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             SWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  330   SWGQNWGENGYYKICRGRNICGVDSMVSTV  359



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 248/341 (73%), Gaps = 13/341 (4%)
 Frame = +3

Query  171   IRQVT----DDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRA  338
             IRQV     DD  P     LL    +  F  F  ++GK Y+T EE+ +R  VF  NL RA
Sbjct  39    IRQVVTSDGDDADP-----LLNA--DHHFSLFKTKYGKTYSTQEEHDHRFSVFKANLRRA  91

Query  339   AEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETF  518
               HQ+LDP+AVHGVT+FSDLTP+EF + ++G+ K   R  L     +AP L  + LP  F
Sbjct  92    KRHQLLDPSAVHGVTKFSDLTPSEFRRNHLGLNKHKRRLRLPADANKAPILPTTDLPADF  151

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FSTTGA+EGA+++AT +L++LSEQQLVDCDH CD  + 
Sbjct  152   DWRDHGAVTPVKDQGSCGSCWSFSTTGALEGAHYLATRELVSLSEQQLVDCDHECDPAEY  211

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPAD  878
             ++CD GC+GGLM NA+EY+++SGG+E E  YPYTG+   C+F+  K+A KV NF+ +  D
Sbjct  212   NSCDSGCNGGLMNNAFEYILKSGGVEREQDYPYTGRDEKCKFDKSKIAAKVSNFSVVSTD  271

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV HGPLAV INA++M TY+GGVSCP ICSK + +HGVLLVGYG  G++ +RL
Sbjct  272   EDQIAANLVKHGPLAVAINAIWMQTYIGGVSCPYICSKSQ-DHGVLLVGYGAAGYAPIRL  330

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSAV  1178
               KPYWIIKNSWG++WGE GY++ CR    +CG+ +MVS+V
Sbjct  331   KDKPYWIIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSV  371



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   404 bits (1039),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 247/339 (73%), Gaps = 13/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD +     E  L TA E  F  F     K Y + EE+ YR  VF  NL RAA HQ
Sbjct  59    IRQVTDGQ--DGAEPQLLTA-EHHFSLFKSRFKKSYGSQEEHDYRFKVFQDNLRRAARHQ  115

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+A HGVT+FSDLTP EF + Y+G+  L++P  A+      EAP L    LPE FDW
Sbjct  116   KLDPSASHGVTQFSDLTPREFRRTYLGLRRLRLPKDAT------EAPILPTDNLPEDFDW  169

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
              +KGAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++  +
Sbjct  170   SEKGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPDS  229

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  K+A KV NF+ +  DE
Sbjct  230   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGTCKFDKSKIAAKVANFSVVSLDE  289

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+ GVSCP ICS KRL+HGVLLVGYG  G++ +R+ 
Sbjct  290   DQIAANLVKNGPLAVAINAVFMQTYIKGVSCPYICS-KRLDHGVLLVGYGSAGYAPVRMK  348

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE+G++++CRG  +CG+ +MVS V
Sbjct  349   DKPYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTV  387



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/339 (58%), Positives = 248/339 (73%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IR+V D +  A+  NLL +A +  F  F  +  K Y + EE+ YR  VF  NL RAA HQ
Sbjct  31    IREVVDGQ-DASSSNLL-SAEQHHFSLFKSKFKKSYGSQEEHDYRFSVFKANLRRAARHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTA HGVT+FSDLTP EF K  +G+  L++P  A+      EAP L  S LPE FDW
Sbjct  89    ALDPTASHGVTQFSDLTPAEFRKQVLGLRRLRLPKDAN------EAPILPTSDLPEDFDW  142

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RDKGAV  VK QGSCGSCW+FS TGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  143   RDKGAVGPVKNQGSCGSCWSFSATGALEGAHFLATGELVSLSEQQLVDCDHECDPEEPDS  202

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY  ++GG+  E  YPYTG   G C+F+  KVA +V NF+ +  DE
Sbjct  203   CDSGCNGGLMNSAFEYTFKAGGLMREEDYPYTGTDRGTCKFDKNKVAARVANFSVVSLDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS +RL+HGVLLVGYG  G+S +R+ 
Sbjct  263   DQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-RRLDHGVLLVGYGSAGYSPIRMK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE G++++CRG  +CG+ +MVS V
Sbjct  322   DKPYWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTV  360



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/336 (59%), Positives = 249/336 (74%), Gaps = 10/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  +      +N +  A E  F  F  + GK YA+ EE+ +RL VF  NL RA  HQ
Sbjct  41    IRQVVSEN----DDNHMLNA-EHHFSLFKVKFGKIYASQEEHDHRLKVFKANLRRARRHQ  95

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+A HG+T+FSDLTP+EF + Y+G+ K   R +L   KA  P L  + LP  FDWR+
Sbjct  96    LLDPSAEHGITQFSDLTPSEFRRTYLGLNK--PRPNLNAEKA--PILPTTDLPADFDWRE  151

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT+VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD  +K+ CD
Sbjct  152   KGAVTDVKNQGSCGSCWSFSTTGAVEGAHFLATGELVSLSEQQLVDCDHECDPVEKNDCD  211

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC GGLMT+A+EY ++SGG++ E  YPYTGK G C F+  K+A  V NF+ +  DEDQ+
Sbjct  212   AGCGGGLMTSAFEYTLKSGGLQLEKDYPYTGKDGKCHFDKSKIAASVSNFSVVGLDEDQI  271

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA L+ HGPLAVGINA +M TY+ GVSCPLIC  KR +HGVLLVGYG +GF+ +RL  KP
Sbjct  272   AANLLKHGPLAVGINAAWMQTYVRGVSCPLICL-KRQDHGVLLVGYGSEGFAPIRLKNKP  330

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWGK WGE GY+++CRGH +CG+  MVS V
Sbjct  331   YWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTV  366



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 253/340 (74%), Gaps = 13/340 (4%)
 Frame = +3

Query  171   IRQVTD-DEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEH  347
             IRQVTD  +  +A  NLLG   E  F  F ++  K YA+ EE+ YR  +F  NL RA  H
Sbjct  35    IRQVTDGQDESSANPNLLGA--EHHFSLFKKKFKKTYASQEEHDYRFKIFKSNLRRAERH  92

Query  348   QILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
             Q LDPTA HGVT+FSDLT +EF + ++G+  L++P  A+      EAP L  + LP  FD
Sbjct  93    QKLDPTATHGVTQFSDLTHSEFRRQFLGLRRLRLPKDAN------EAPMLPTNDLPADFD  146

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WR+KGAVT VK QGSCGSCW+FSTTGA+EGAN++ATGKL++LSEQQLVDCDH CD  ++ 
Sbjct  147   WREKGAVTAVKNQGSCGSCWSFSTTGALEGANYLATGKLVSLSEQQLVDCDHECDPAEEG  206

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPAD  878
             ACD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  K+A KV NF+ +  D
Sbjct  207   ACDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGACQFDKTKIAAKVANFSVVSLD  266

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  G++ +R+
Sbjct  267   EDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-KRLDHGVLLVGYGSAGYAPIRM  325

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  326   KEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTV  365



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   402 bits (1034),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/363 (55%), Positives = 253/363 (70%), Gaps = 14/363 (4%)
 Frame = +3

Query  93    LMYAQLLA-VLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             L    LLA VL  + +AF+        +   TDD       +LL    E  F  F  + G
Sbjct  4     LFLLSLLAFVLFSSAIAFSDEDPLIRQVVSETDDS------HLLNA--EHHFSLFKSKFG  55

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K YA+ EE+ +R  VF  NL RA  HQ+LDP+A HG+T+FSDLTP+EF + Y+G+ K   
Sbjct  56    KIYASEEEHDHRFKVFKANLRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  115

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
             + +      +AP L  S LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F+AT
Sbjct  116   KLN----AEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLAT  171

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG  809
             G+L++LSEQQLVDCDH CD + + ACD GC GGLMT A+EY +++GG++ E  YPYTGK 
Sbjct  172   GELVSLSEQQLVDCDHECDPEQQDACDAGCGGGLMTTAFEYTLKAGGLQLEKDYPYTGKD  231

Query  810   GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
             G C F+  K+A  V NF+ +  DEDQ+AA LV HGPLAVGINA +M TY+GGVSCPLIC 
Sbjct  232   GKCHFDKSKIAAAVTNFSVIGLDEDQIAANLVKHGPLAVGINAAWMQTYVGGVSCPLICF  291

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              KR +HGVLLVGYG  GF+ +RL  K YWIIKNSWG++WGE GY+++CRGH +CG+  MV
Sbjct  292   -KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMV  350

Query  1170  SAV  1178
             S V
Sbjct  351   STV  353



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 203/378 (54%), Positives = 262/378 (69%), Gaps = 22/378 (6%)
 Frame = +3

Query  72    SRIAGGGLMYAQLLAVLTCAHLAFAS------SASQGLNIRQVTDDEIPAAGENLLGTAT  233
             +R     L +A LL+  T A+  F+       S  + L IRQV    +  A + LL    
Sbjct  2     ARFNAIALFFAILLSA-TVAYGVFSDQIDGDVSDGEDLLIRQV----VSGADDRLL--TA  54

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E RF++F  + GK YAT EE+ YR  VF  NL +A  HQ LDP AVHGVTRFSDLT +EF
Sbjct  55    EQRFQNFKLKFGKTYATAEEHDYRFRVFKDNLRKAKRHQKLDPDAVHGVTRFSDLTESEF  114

Query  414   EKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAF  587
              + ++G+  L++P  A       +AP L    L   FDWRDKGAVT VK QGSCGSCW+F
Sbjct  115   RENFVGLNRLRLPADAH------QAPILPTDNLASDFDWRDKGAVTPVKDQGSCGSCWSF  168

Query  588   STTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESG  767
             S  GA+EGANF++TGKL++LSEQQLVDCDH CD ++  ACD GC+GGLMT+A+EY++++G
Sbjct  169   SAVGALEGANFLSTGKLISLSEQQLVDCDHECDPEEAGACDAGCNGGLMTSAFEYILKAG  228

Query  768   GIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVY  944
             G+E E  YPYTG   G C+F++ K+A    NF+ +  D DQ+AA LV +GPLA+GINAV+
Sbjct  229   GLEREEDYPYTGTDRGSCKFQNGKIAASAANFSVISNDADQIAANLVKNGPLAIGINAVF  288

Query  945   MHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYF  1124
             M TYM GVSCP ICSK+ L+HGVLLVGYG  GF+ +R   KPYWIIKNSWG++WGE GY+
Sbjct  289   MQTYMKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYY  348

Query  1125  RMCRGHGMCGISNMVSAV  1178
              +C+G  +CG  +MVS+V
Sbjct  349   FICKGKNVCGSESMVSSV  366



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 253/347 (73%), Gaps = 20/347 (6%)
 Frame = +3

Query  171   IRQVTD--DEIPAAGE----NLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
             IRQVTD  DEI +  E    +LLG   E  F  F ++  K YA+ EE+ +R  +F  NL 
Sbjct  32    IRQVTDGGDEILSHHESTNNDLLGA--EHHFSLFKKKFNKAYASQEEHDHRFTIFKANLR  89

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSG  503
             RAA HQ LDP+A HG+T+FSDLTP EF + Y+G+   L++P  A       +AP L  + 
Sbjct  90    RAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDAD------QAPILPTND  143

Query  504   LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTC  683
             LP  FDWR+KGAV  VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH C
Sbjct  144   LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHEC  203

Query  684   DIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG--KGGDCRFESEKVAVKVGN  857
             D ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG  +G  C+F+  K+A  V N
Sbjct  204   DPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVAN  263

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP ICS +RL+HGVLLVGYG  
Sbjct  264   FSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICS-RRLDHGVLLVGYGSA  322

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G++ +RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  323   GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTV  369



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   403 bits (1036),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 248/338 (73%), Gaps = 10/338 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D   A  E+ L  A E  F SF  +  K YAT EE+ +R GVF  NL RA  H 
Sbjct  55    IRQVVPDVGEAEEEDNLLNA-EHHFASFKAKFAKTYATKEEHDHRFGVFKSNLRRARLHA  113

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+AVHGVT+FSDLTP EF + ++G+  L+ P  A       +AP L    LP+ FDW
Sbjct  114   KLDPSAVHGVTKFSDLTPAEFRRQFLGLKPLRFPAHAQ------KAPILPTKDLPKDFDW  167

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RDKGAVT VK QG+CGSCW+FSTTGA+EGA+++ATG+L++LSEQQLVDCDH CD ++  A
Sbjct  168   RDKGAVTNVKDQGACGSCWSFSTTGALEGAHYLATGELVSLSEQQLVDCDHVCDPEEYGA  227

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADED  884
             CD GC+GGLM NA+EY+++SGG+++E  YPYTG+ G C+F+  KVA  V N++ +  DE+
Sbjct  228   CDSGCNGGLMNNAFEYILQSGGVQKEKDYPYTGRDGTCKFDKTKVAATVSNYSVVSLDEE  287

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             Q+AA LV +GPLAV INAV+M TY+GGVSCP IC  K L+HGVLLVGYG+  ++ +R   
Sbjct  288   QIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICG-KHLDHGVLLVGYGEGAYAPIRFKN  346

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  347   KPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTV  384



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 253/347 (73%), Gaps = 20/347 (6%)
 Frame = +3

Query  171   IRQVTD--DEIPAAGE----NLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
             IRQVTD  DEI +  E    +LLG   E  F  F ++  K YA+ EE+ +R  +F  NL 
Sbjct  32    IRQVTDGGDEILSHHESTNNDLLGA--EHHFSLFKKKFNKAYASQEEHDHRFTIFKANLR  89

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSG  503
             RAA HQ LDP+A HG+T+FSDLTP EF + Y+G+   L++P  A       +AP L  + 
Sbjct  90    RAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDAD------QAPILPTND  143

Query  504   LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTC  683
             LP  FDWR+KGAV  VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH C
Sbjct  144   LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHEC  203

Query  684   DIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG--KGGDCRFESEKVAVKVGN  857
             D ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG  +G  C+F+  K+A  V N
Sbjct  204   DPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVAN  263

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP ICS +RL+HGVLLVGYG  
Sbjct  264   FSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICS-RRLDHGVLLVGYGSA  322

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G++ +RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  323   GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTV  369



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 253/348 (73%), Gaps = 12/348 (3%)
 Frame = +3

Query  144   ASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             A S S    IRQV D       ++ LG   E  F  F  + GK YA+ EE+ YR  VF  
Sbjct  19    AQSDSADPLIRQVVDGGDDHQHDHRLGA--EHHFSLFKHQFGKSYASQEEHDYRFEVFKA  76

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDV  497
             NL RAA HQ LDP+A HGVTRFSD+TP EF K  +G+  L++P  A+      +AP L  
Sbjct  77    NLRRAARHQRLDPSAQHGVTRFSDMTPAEFRKSQLGLRGLRLPADAT------KAPILPT  130

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
               LPE FDWRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQ VDCDH
Sbjct  131   ENLPEDFDWRDRGAVTAVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQFVDCDH  190

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVG  854
              CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYTG   G C+F+  K+A KV 
Sbjct  191   ECDPEEAGSCDAGCNGGLMNSAFEYTLKAGGLMKEEEYPYTGTDRGTCKFDKSKIAAKVA  250

Query  855   NFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGK  1034
             NF+ +  DE+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG 
Sbjct  251   NFSVVSLDEEQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICS-KRLDHGVLLVGYGA  309

Query  1035  KGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              G+S +R+  KPYWIIKNSWG++WGE+G++++C+G  +CG+ +MVS V
Sbjct  310   AGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTV  357



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 202/363 (56%), Positives = 251/363 (69%), Gaps = 19/363 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             L  +L    L FA+    G  + IRQV  D     G+  L  A    F  F +  GK YA
Sbjct  10    LCTLLATTSLVFAAEDDDGDDILIRQVVGD-----GDGDLLNADH-HFTVFKRRFGKAYA  63

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGR  452
             + EE+ YRL VF  N+ RA  HQ LDP AVHGVT+FSDLTP EF + ++G+   LK P  
Sbjct  64    SDEEHDYRLSVFKANMRRAKRHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNRRLKFPAD  123

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
             A        AP L    LP  FDWRD GAVT VK QG+CGSCW+FSTTGA+EGANF+ATG
Sbjct  124   AK------TAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCWSFSTTGALEGANFLATG  177

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             KL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG   
Sbjct  178   KLVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGNDL  237

Query  813   D-CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
               CRF+  K+A KV NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS
Sbjct  238   QVCRFDKTKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS  297

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              KRL+HGVLLVGYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MV
Sbjct  298   -KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMV  356

Query  1170  SAV  1178
             S V
Sbjct  357   STV  359



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   402 bits (1032),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 244/336 (73%), Gaps = 8/336 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV   E      +LL    E  F  F  + GK YA+ EE+ +R  VF  NL RA  HQ
Sbjct  28    IRQVVS-ETETDDSHLLNA--EHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRARRHQ  84

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+A HG+T+FSDLTP+EF + Y+G+ K   + +      +AP L  S LP  +DWRD
Sbjct  85    LLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKLN----AEKAPILPTSDLPADYDWRD  140

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD + + +CD
Sbjct  141   HGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLATGELVSLSEQQLVDCDHECDPEQQDSCD  200

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GCSGGLMT A+EY +++GG++ E  YPYTGK G C F+  K+A  V NF+ +  DEDQ+
Sbjct  201   AGCSGGLMTTAFEYTLKAGGLQREKDYPYTGKXGKCHFDKSKIAAAVTNFSVIGLDEDQI  260

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV HGPLAVGINA +M TY+GGVSCPLIC  KR +HGVLLVGYG  GF+ +RL  K 
Sbjct  261   AANLVKHGPLAVGINAAWMQTYVGGVSCPLICF-KRQDHGVLLVGYGSHGFAPIRLKEKA  319

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGE GY+++CRGH +CG+  MVS V
Sbjct  320   YWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   402 bits (1033),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 247/337 (73%), Gaps = 7/337 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV   +   + ++LL    E  F  F  +  K YAT EE+ YR  VF  NL RA   Q
Sbjct  31    IRQVVPSDGEQSEDHLLNA--EHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDPTAVHGVT+FSDLTP+EF + ++G+ +   R  L     +AP L  + LP  FDWRD
Sbjct  89    LLDPTAVHGVTKFSDLTPSEFRRQFLGLNR---RLRLPADAQKAPILPTNDLPTDFDWRD  145

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QG+CGSCW+FS TGA+EGA+F++TG+L++LSEQQLVDCDH CD ++  +CD
Sbjct  146   HGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCD  205

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLM +A+EY++++GG+E E  YPYTG  GG C+F+  K+A  V NF+ + +DEDQ
Sbjct  206   SGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSDEDQ  265

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             MAA LV HGPLAVGINAV+M TY+GGVSCP IC  K L+HGVL+VGYG  GF+ +R   K
Sbjct  266   MAANLVKHGPLAVGINAVWMQTYIGGVSCPYICG-KYLDHGVLIVGYGSSGFAPIRFKEK  324

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG++WGE GY+++C G  +CG+ +MVS+V
Sbjct  325   PYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSV  361



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   402 bits (1034),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 262/371 (71%), Gaps = 20/371 (5%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVT--DDEIPAAGENLLGTATEVRFKSFMQEH  266
             L+   L  +L+ +    ++ A   L IRQVT  D    ++  N L    +  F  F  + 
Sbjct  7     LLTFSLFIILSLS----SAIADDDLLIRQVTTEDSSSSSSSPNDLLLNADHHFSLFKSKF  62

Query  267   GKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV----  434
              K Y++ EE+  R  +F  NL RA+ HQ LDP+AVHGVT+FSDLTP EF + Y+G+    
Sbjct  63    NKIYSSKEEHDNRFSIFKANLRRASRHQTLDPSAVHGVTKFSDLTPREFRQKYLGLNGGK  122

Query  435   --LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIE  608
               LK+P  A+      +AP L    LPE FDWR+ GAVTEVK QG CGSCW+FSTTGA+E
Sbjct  123   RKLKLPSDAN------KAPVLPTDSLPEDFDWREHGAVTEVKDQGQCGSCWSFSTTGALE  176

Query  609   GANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEAS  788
             GAN++ATGKL++LSEQQLVDCDH CD +++++CD GC+GGLM NA+EY+++SGG++ E  
Sbjct  177   GANYLATGKLVSLSEQQLVDCDHECDPEERNSCDSGCNGGLMNNAFEYILKSGGVQREED  236

Query  789   YPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGG  965
             YPYTG   G C+F+  KVA  V NF+ +  DEDQ+AA LV +GPLAVGI+A YM TY+GG
Sbjct  237   YPYTGSDHGTCKFDKSKVAATVANFSVVALDEDQIAANLVKNGPLAVGIHAGYMQTYIGG  296

Query  966   VSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHG  1145
             VSCPL+C +  L+HGV+LVGYG  G++ +R   KPYWIIKNSWG +WG++GY+++CRGH 
Sbjct  297   VSCPLVCLRS-LDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICRGHN  355

Query  1146  MCGISNMVSAV  1178
             +CG+ +MVS V
Sbjct  356   VCGVDSMVSTV  366



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   402 bits (1033),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 247/337 (73%), Gaps = 7/337 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV   +   + ++LL    E  F  F  +  K YAT EE+ YR  VF  NL RA   Q
Sbjct  31    IRQVVPSDGEQSEDHLLNA--EHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDPTAVHGVT+FSDLTP+EF + ++G+ +   R  L     +AP L  + LP  FDWRD
Sbjct  89    LLDPTAVHGVTKFSDLTPSEFRRQFLGLNR---RLRLPADAQKAPILPTNDLPTDFDWRD  145

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QG+CGSCW+FS TGA+EGA+F++TG+L++LSEQQLVDCDH CD ++  +CD
Sbjct  146   HGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCD  205

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLM +A+EY++++GG+E E  YPYTG  GG C+F+  K+A  V NF+ + +DEDQ
Sbjct  206   SGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSDEDQ  265

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             MAA LV HGPLAVGINAV+M TY+GGVSCP IC  K L+HGVL+VGYG  GF+ +R   K
Sbjct  266   MAANLVKHGPLAVGINAVWMQTYIGGVSCPYICG-KYLDHGVLIVGYGSSGFAPIRFKEK  324

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG++WGE GY+++C G  +CG+ +MVS+V
Sbjct  325   PYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSV  361



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   402 bits (1033),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 202/363 (56%), Positives = 251/363 (69%), Gaps = 19/363 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             L  +L    L FA+    G +  IRQV  D     G+  L  A    F  F +  GK YA
Sbjct  10    LCTLLATTSLVFAAEDDDGDDVLIRQVVGD-----GDGDLLNADH-HFTVFKRRFGKAYA  63

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGR  452
             + EE+ YRL VF  N+ RA  HQ LDP AVHGVT+FSDLTP EF + ++G+   LK P  
Sbjct  64    SDEEHDYRLSVFKANMRRAKRHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNRRLKFPAD  123

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
             A        AP L    LP  FDWRD GAVT VK QG+CGSCW+FSTTGA+EGANF+ATG
Sbjct  124   AK------TAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCWSFSTTGALEGANFLATG  177

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             KL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG   
Sbjct  178   KLVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGNDL  237

Query  813   D-CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
               CRF+  K+A KV NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS
Sbjct  238   QVCRFDKTKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS  297

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              KRL+HGVLLVGYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MV
Sbjct  298   -KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMV  356

Query  1170  SAV  1178
             S V
Sbjct  357   STV  359



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   402 bits (1033),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 256/360 (71%), Gaps = 11/360 (3%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATH  287
             LL V         SS  +   IRQV D +  ++    L  + E  F  F  +  K Y + 
Sbjct  12    LLFVSAVVAETLTSSGREDPLIRQVVDGQDESSTSPHL-LSEEHHFSLFKSKFKKSYTSQ  70

Query  288   EEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASL  461
             +E+ YR  VF  NL RAA HQ LDPTA HGVT+FSDLTP EF + ++G+  L++P  A+ 
Sbjct  71    QEHDYRFKVFKANLRRAARHQKLDPTASHGVTQFSDLTPAEFRRQFLGLRRLRLPKDAN-  129

Query  462   LGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLL  641
                  +AP L  + LP+ FDWR+KGAV+ VK QGSCGSCW+FSTTGA+EGA+F+ATG+L+
Sbjct  130   -----QAPILPTNELPDDFDWREKGAVSPVKNQGSCGSCWSFSTTGALEGAHFLATGELV  184

Query  642   NLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDC  818
             +LSEQQLVDCDH CD ++  ACD GC+GGLM +A+EY +++GG+  E  YPYTG   G C
Sbjct  185   SLSEQQLVDCDHECDPEEAGACDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGAC  244

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+  KVA +V NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KR
Sbjct  245   KFDKTKVAARVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-KR  303

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L+HGVLLVGYG  G++ +RL  KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  304   LDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTV  363



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   402 bits (1033),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 247/337 (73%), Gaps = 7/337 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV   +   + ++LL    E  F  F  +  K YAT EE+ YR  VF  NL RA   Q
Sbjct  31    IRQVVPSDGEQSEDHLLNA--EHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDPTAVHGVT+FSDLTP+EF + ++G+ +   R  L     +AP L  + LP  FDWRD
Sbjct  89    LLDPTAVHGVTKFSDLTPSEFRRQFLGLNR---RLRLPADAQKAPILPTNDLPTDFDWRD  145

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QG+CGSCW+FS TGA+EGA+F++TG+L++LSEQQLVDCDH CD ++  +CD
Sbjct  146   HGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCD  205

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLM +A+EY++++GG+E E  YPYTG  GG C+F+  K+A  V NF+ + +DEDQ
Sbjct  206   SGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSDEDQ  265

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             MAA LV HGPLAVGINAV+M TY+GGVSCP IC  K L+HGVL+VGYG  GF+ +R   K
Sbjct  266   MAANLVKHGPLAVGINAVWMQTYIGGVSCPYICG-KYLDHGVLIVGYGSSGFAPIRFKEK  324

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG++WGE GY+++C G  +CG+ +MVS+V
Sbjct  325   PYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSV  361



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   402 bits (1032),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 248/336 (74%), Gaps = 10/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +    +N +  A E  F  F  + GK YA+ EE+ +RL VF  NL RA  HQ
Sbjct  28    IRQV----VSGNDDNHMLNA-EHHFSLFKAKFGKIYASQEEHDHRLKVFKANLHRAKRHQ  82

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+A HG+T+FSDLTP+EF + Y+G+ K   R +L   KA  P L    LP  FDWR+
Sbjct  83    LLDPSAEHGITQFSDLTPSEFRRTYLGLNK--PRPNLNAEKA--PILPTKDLPSDFDWRE  138

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT+VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD  +K+ CD
Sbjct  139   KGAVTDVKNQGSCGSCWSFSTTGAVEGAHFLATGELVSLSEQQLVDCDHECDPVEKNDCD  198

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLMT A+EY +++GG++ E  YPYTG+ G C F+  ++A  V NF+ +  DEDQ+
Sbjct  199   AGCNGGLMTTAFEYTLKAGGLQLEKDYPYTGRNGKCHFDKSRIAASVSNFSVVGLDEDQI  258

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA L+ HGPLAVGINA +M TY+ GVSCPLIC  KR +HGVLLVGYG +GF+ +RL  KP
Sbjct  259   AANLLKHGPLAVGINAAWMQTYVRGVSCPLICF-KRQDHGVLLVGYGSEGFAPIRLKNKP  317

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWGK WGE GY+++CRGH +CG+  MVS V
Sbjct  318   YWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTV  353



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   401 bits (1031),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 248/336 (74%), Gaps = 10/336 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +    +N +  A E  F  F  + GK YA+ EE+ +RL VF  NL RA  HQ
Sbjct  26    IRQV----VSGNDDNHMLNA-EHHFSLFKAKFGKIYASQEEHDHRLKVFKANLHRAKRHQ  80

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+A HG+T+FSDLTP+EF + Y+G+ K   R +L   KA  P L    LP  FDWR+
Sbjct  81    LLDPSAEHGITQFSDLTPSEFRRTYLGLNK--PRPNLNAEKA--PILPTKDLPSDFDWRE  136

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT+VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD  +K+ CD
Sbjct  137   KGAVTDVKNQGSCGSCWSFSTTGAVEGAHFLATGELVSLSEQQLVDCDHECDPVEKNDCD  196

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLMT A+EY +++GG++ E  YPYTG+ G C F+  ++A  V NF+ +  DEDQ+
Sbjct  197   AGCNGGLMTTAFEYTLKAGGLQLEKDYPYTGRNGKCHFDKSRIAASVSNFSVVGLDEDQI  256

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA L+ HGPLAVGINA +M TY+ GVSCPLIC  KR +HGVLLVGYG +GF+ +RL  KP
Sbjct  257   AANLLKHGPLAVGINAAWMQTYVRGVSCPLICF-KRQDHGVLLVGYGSEGFAPIRLKNKP  315

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWGK WGE GY+++CRGH +CG+  MVS V
Sbjct  316   YWIIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTV  351



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   402 bits (1032),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 237/337 (70%), Gaps = 12/337 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             I QV D E     ++ L    E  F SFM   GK YA  EE  +RL VF  NL RAA HQ
Sbjct  38    ILQVVDLE-----KDGLTLNAEAHFTSFMSRFGKTYADEEERSHRLKVFKANLRRAARHQ  92

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDPTAVHG+T+FSDLTP EF   Y+G+     R        +AP L  + LP  FDWRD
Sbjct  93    RLDPTAVHGITKFSDLTPAEFRSAYLGL-----RRQTPASSHQAPILPTNDLPTDFDWRD  147

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FS   A+EGANF+ATGKL +LSEQQLVDCDH CD  +  ACD
Sbjct  148   HGAVTGVKNQGSCGSCWSFSAAAALEGANFLATGKLESLSEQQLVDCDHMCDSDEPDACD  207

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLMT A++YL++SGG+  E  YPYTG +   C+F+  K+A  V NF+ +  DEDQ
Sbjct  208   QGCNGGLMTTAFQYLLKSGGLVREEDYPYTGSQRSTCKFDKSKIAASVQNFSVVSIDEDQ  267

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPLA+GINAVYM TY+GGVSCP IC  + L+HGVLLVGYG  G+S +RL  K
Sbjct  268   IAANLVKHGPLAIGINAVYMQTYIGGVSCPYICG-RHLDHGVLLVGYGSAGYSPIRLKQK  326

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             P+WIIKNSWG+ WGE+GY+++CRG  +CG+ +MVS V
Sbjct  327   PFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTV  363



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   401 bits (1031),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 255/347 (73%), Gaps = 15/347 (4%)
 Frame = +3

Query  147   SSASQGLNIRQVTDD-EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             S+ +  + IRQV  + E+    ++LL    E  F +F  + GK YAT EE+ +R GVF  
Sbjct  23    STDADDILIRQVVPEGEVE---DHLLNA--EHHFSTFKAKFGKTYATKEEHDHRFGVFKS  77

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDV  497
             N+ RA  H  LDP+AVHGVT+FSDLTP EF + ++G+  L++P  A       +AP L  
Sbjct  78    NMRRARLHAQLDPSAVHGVTKFSDLTPAEFHRKFLGLKPLRLPAHAQ------KAPILPT  131

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
             + LP+ FDWRDKGAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH
Sbjct  132   NNLPKDFDWRDKGAVTNVKDQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDH  191

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGN  857
              CD ++  +CD GC+GGLM NA+EYLI SGG++ E  YPYTG+ G C+F+  K+A  V N
Sbjct  192   VCDPEEYGSCDSGCNGGLMNNAFEYLIGSGGVQREKDYPYTGRDGTCKFDKSKIAASVSN  251

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             ++ +  DE+Q+AA LV +GPLAV INAVYM TY+GGVSCP IC  K L+HGVLLVGYG+ 
Sbjct  252   YSVISLDEEQIAANLVKNGPLAVAINAVYMQTYVGGVSCPYICG-KHLDHGVLLVGYGEG  310

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              ++ +R   KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  311   AYAPIRFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTV  357



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   402 bits (1032),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 248/354 (70%), Gaps = 17/354 (5%)
 Frame = +3

Query  147   SSASQGLN---IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVF  317
             SSAS+GL    I QV    +    EN L    E  F +F++  GK Y   +E+ +RL VF
Sbjct  24    SSASEGLEDPLIEQV----VGGDAENELELNAEAHFATFVRRFGKSYRDADEHAHRLSVF  79

Query  318   AKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLL----GGKAEAP  485
               NL RA  HQ LDP+AVHG+T+FSDLTP+EF + ++G+ K   R S L    G   +AP
Sbjct  80    RANLRRARRHQRLDPSAVHGITKFSDLTPDEFRERFLGLRK--SRRSFLKGISGSAHDAP  137

Query  486   RLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLV  665
              L   GLP  FDWR+ GAV  VK QGSCGSCW+FST+GA+EGAN++ATGKL  LSEQQLV
Sbjct  138   ALPTDGLPTEFDWREHGAVGPVKDQGSCGSCWSFSTSGALEGANYLATGKLEVLSEQQLV  197

Query  666   DCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAV  845
             DCDH CD  +  ACD GC+GGLMT A+ YL ++GG+E E  YPYTGK   C+F+  K+A 
Sbjct  198   DCDHECDPSEPRACDAGCNGGLMTTAFSYLAKAGGLETEKDYPYTGKNSACKFDKSKIAA  257

Query  846   KVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVG  1025
             +V NF+ +  DEDQ+AA LV HGPLA+GINAV+M TY+GGVSCP IC  + L+HGVLLVG
Sbjct  258   QVKNFSTVAIDEDQIAANLVKHGPLAIGINAVFMQTYIGGVSCPYICG-RHLDHGVLLVG  316

Query  1026  YGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG---HGMCGISNMVSAV  1178
             YG  G++ LR   KPYWIIKNSWG++WGE GY+++CRG      CG+ +MVS V
Sbjct  317   YGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTV  370



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 248/339 (73%), Gaps = 13/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             I QVTD       E  L TA    F  F +   K Y + EE+ YR  +F  NL RAA HQ
Sbjct  37    IEQVTDGH--EGAEPQLLTAKH-HFSLFKKRFKKSYGSQEEHDYRFKIFQVNLRRAARHQ  93

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+A HGVT+FSDLTP EF K Y+G+  L++P  A+      EAP L    LP+ FDW
Sbjct  94    KLDPSATHGVTQFSDLTPGEFRKAYLGLRRLRLPKDAT------EAPILPTDNLPQDFDW  147

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++  +
Sbjct  148   REKGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEAGS  207

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY++++GG+  E  YPYTG   G C+F++ KVA KV NF+ +  DE
Sbjct  208   CDSGCNGGLMNSAFEYILKAGGLMCEEDYPYTGTDRGTCKFDNTKVAAKVANFSVVSLDE  267

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA L  +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  G++ +R+ 
Sbjct  268   DQIAANLFRNGPLAVAINAVFMQTYIGGVSCPYICS-KRLDHGVLLVGYGSAGYAPVRMK  326

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGE G++R+CRG  +CG+ +MVS V
Sbjct  327   DKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTV  365



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   401 bits (1030),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 242/342 (71%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +P   +N L    E  F +F+Q  GK Y   +E+ YRL VF  NL RA  HQ
Sbjct  30    IRQV----VPGGDDNDLELNAESHFLNFVQRFGKSYKDADEHAYRLSVFKANLRRARRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKA-EAPRLDVSGLPETFD  521
             +LDP+A HG+T+FSDLTP EF + Y+G L+   RA L  LG  A EAP L   GLPE FD
Sbjct  86    LLDPSAEHGITKFSDLTPAEFRRTYLG-LRKSRRALLRELGDSAHEAPVLPTDGLPEDFD  144

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAV  VK QGSCGSCW+FS +GA+EGA+++ATGKL  LSEQQ VDCDH CD  +  
Sbjct  145   WRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDPSEPD  204

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             +CD GC+GGLMT A+ YL ++GG+E E  YPYTG  G C+F+  K+   V NF+ +  DE
Sbjct  205   SCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSNGKCKFDKSKIVASVQNFSVVSVDE  264

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA L+ HGPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGYG  GF+ +RL 
Sbjct  265   DQIAANLIKHGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGYGAAGFAPIRLK  323

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
              KPYWIIKNSWG++WGE GY+++CRG  +   CG+ +MVS V
Sbjct  324   EKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  365



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 253/362 (70%), Gaps = 19/362 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYAT  284
             L  +L   +L FA+      + IRQV  D     G +LL    +  F  F +  GK YA+
Sbjct  10    LCTLLATTYLVFAAEDDGDDILIRQVVGD-----GGDLLNA--DHHFTVFKRRFGKVYAS  62

Query  285   HEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRA  455
              EE+ YRL VF  N+ RA +HQ LDP AVHGVT+FSDLTP EF + ++G+   LK P  A
Sbjct  63    DEEHDYRLSVFKANMRRAKQHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNRRLKFPADA  122

Query  456   SLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGK  635
                     AP L    LP  FDWRD GAVT VK QG+CGSCW+FSTTGA+EGANF+ATGK
Sbjct  123   K------TAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCWSFSTTGALEGANFLATGK  176

Query  636   LLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD  815
             L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG    
Sbjct  177   LVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGNDLQ  236

Query  816   -CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSK  992
              CRF+  K+A KV NF+ +  DEDQ+AA LV +GPLAV INAV++ TY+GGVSCP ICS 
Sbjct  237   VCRFDKTKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFVQTYIGGVSCPYICS-  295

Query  993   KRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVS  1172
             KRL+HGVLLVGYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS
Sbjct  296   KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVS  355

Query  1173  AV  1178
              V
Sbjct  356   TV  357



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/329 (57%), Positives = 234/329 (71%), Gaps = 2/329 (1%)
 Frame = +3

Query  195   IPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVH  374
             +  A E+ L    E  F SF++  GK YA  +E+ YR  VF  NL RA  HQ +DPTAVH
Sbjct  38    VSEADEDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRHQKMDPTAVH  97

Query  375   GVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVK  554
             G+T++SDLTP EF + ++G+         L    EAP L  + LP  FDWRD GAVT VK
Sbjct  98    GITKYSDLTPAEFRRTFLGLRGGRRLRRALASSHEAPILPTNDLPTDFDWRDHGAVTGVK  157

Query  555   MQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLM  734
              QGSCGSCW+FS  G++EGANF+ATGKL +LSEQQLVDCDH CD  +  +CD GC+GGLM
Sbjct  158   DQGSCGSCWSFSAAGSLEGANFLATGKLESLSEQQLVDCDHECDSSEPDSCDSGCNGGLM  217

Query  735   TNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNH  911
             T A+EYL++SGG+E E  YPYTG   G C+F+  K+A  V NF+ +  DEDQ+AA LV H
Sbjct  218   TTAFEYLLKSGGLEREEDYPYTGTDRGRCKFDKSKIAASVKNFSVVSMDEDQIAANLVKH  277

Query  912   GPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNS  1091
             GPLAVGINAV+M TY+GGVSCP IC  + L+HGVLLVGYG   ++ +R   KPYWIIKNS
Sbjct  278   GPLAVGINAVFMQTYIGGVSCPYICG-RHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNS  336

Query  1092  WGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             WG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  337   WGEKWGENGYYKICRGRNVCGVDSMVSTV  365



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 252/363 (69%), Gaps = 14/363 (4%)
 Frame = +3

Query  93    LMYAQLLA-VLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             L    LLA VL  + +AF+        +   TDD       +LL    E  F  F  + G
Sbjct  4     LFLLSLLAFVLFSSAIAFSDEDPLIRQVVSETDDS------HLLNA--EHHFSLFKSKFG  55

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K YA+ EE+ +R  VF  N  RA  HQ+LDP+A HG+T+FSDLTP+EF + Y+G+ K   
Sbjct  56    KIYASEEEHDHRFKVFKANRRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  115

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
             + +      +AP L  S LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F+AT
Sbjct  116   KLN----AEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLAT  171

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG  809
             G+L++LSEQQLVDCDH CD + + ACD GC GGLMT A+EY +++GG++ E  YPYTGK 
Sbjct  172   GELVSLSEQQLVDCDHECDPEQQDACDAGCGGGLMTTAFEYTLKAGGLQLEKDYPYTGKD  231

Query  810   GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
             G C F+  K+A  V NF+ +  DEDQ+AA LV HGPLAVGINA +M TY+GGVSCPLIC 
Sbjct  232   GKCHFDKSKIAAAVTNFSVIGLDEDQIAANLVKHGPLAVGINAAWMQTYVGGVSCPLICF  291

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              KR +HGVLLVGYG  GF+ +RL  K YWIIKNSWG++WGE GY+++CRGH +CG+  MV
Sbjct  292   -KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMV  350

Query  1170  SAV  1178
             S V
Sbjct  351   STV  353



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   401 bits (1031),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 252/363 (69%), Gaps = 16/363 (4%)
 Frame = +3

Query  114   AVLTCAHLAFASSASQGLNIRQVTD-DEIPAAGENLLGTATEVRFKSFMQEHGKEYATHE  290
             AVL  + +A  SS  +   I QV   DE     +N L    E  F SF+Q   K Y   +
Sbjct  36    AVLLLSGVAALSSPVEDPLIEQVVGGDE-----KNELELNAEAHFASFVQRFNKSYRDAD  90

Query  291   EYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGG  470
             E+ +RL VF  NL RA  HQ LDP+AVHGVT+FSDLTP+EF   ++G+ K   R S L G
Sbjct  91    EHAHRLSVFTANLRRARRHQRLDPSAVHGVTKFSDLTPDEFRDRFLGLRKY--RRSFLKG  148

Query  471   KA----EAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
              +    +AP L   GLP  FDWR+ GAV  VK QGSCGSCW+FST+GA+EGA+++ATGKL
Sbjct  149   LSGSAHDAPALPTDGLPTEFDWREHGAVGPVKDQGSCGSCWSFSTSGALEGAHYLATGKL  208

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
               LSEQQ+VDCDH CD  +  ACD GC+GGLMT A+ YL ++GG+E E  YPYTG+GG C
Sbjct  209   EVLSEQQMVDCDHECDPSEPRACDAGCNGGLMTTAFSYLAKAGGLETEKDYPYTGRGGAC  268

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+  K+A +V NF+ +  DEDQ+AA LV HGPLA+GINAV+M TY+GGVSCP IC  + 
Sbjct  269   KFDKSKIAAQVKNFSTVAVDEDQIAANLVKHGPLAIGINAVFMQTYIGGVSCPFICG-RH  327

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG---HGMCGISNMV  1169
             L+HGVLLVGYG  G++ LR   KPYWIIKNSWG++WGE GY+++CRG      CG+ +MV
Sbjct  328   LDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGAHVKNKCGVDSMV  387

Query  1170  SAV  1178
             S V
Sbjct  388   STV  390



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 243/336 (72%), Gaps = 8/336 (2%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV   E      +LL    E  F  F  + GK YA+ EE+ +R  VF  NL RA  HQ
Sbjct  28    IRQVVS-ETETDDSHLLNA--EHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRARRHQ  84

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+A HG+T+FSDLTP+EF + Y+G+ K   + +      +AP L  S LP  +DWRD
Sbjct  85    LLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKLN----AEKAPILPTSDLPADYDWRD  140

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD + + +CD
Sbjct  141   HGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLATGELVSLSEQQLVDCDHECDSEQQDSCD  200

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC GGLMT A+EY +++GG++ E  YPYTGK G C F+  K+A  V NF+ +  DEDQ+
Sbjct  201   AGCGGGLMTTAFEYTLKAGGLQLEKDYPYTGKDGKCHFDKSKIAAAVTNFSVIGLDEDQI  260

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV HGPLAVGINA +M TY+GGVSCPLIC  KR +HGVLLVGYG  GF+ +RL  K 
Sbjct  261   AANLVKHGPLAVGINAAWMQTYVGGVSCPLICF-KRQDHGVLLVGYGSHGFAPIRLKEKA  319

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGE GY+++CRGH +CG+  MVS V
Sbjct  320   YWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 249/339 (73%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IR+V D +  A+  NLL +A +  F  F  +  K Y + EE+ YR  VF  NL RAA HQ
Sbjct  31    IREVVDGQ-DASSSNLL-SAEQHHFSLFKSKFKKSYGSQEEHDYRFSVFKANLRRAARHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTA HGVT+FSDLTP EF K  +G+  L++P  A+      EAP L  S LPE FDW
Sbjct  89    ELDPTASHGVTQFSDLTPAEFRKQVLGLRRLRLPKDAN------EAPILPTSDLPEDFDW  142

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RDKGAV  +K QGSCGSCW+FS TGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  143   RDKGAVGPIKNQGSCGSCWSFSATGALEGAHFLATGELVSLSEQQLVDCDHECDPEEPGS  202

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  KVA +V NF+ +  DE
Sbjct  203   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGACKFDKNKVAARVANFSVVSLDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS +RL+HGVLLVGYG  G+S +R+ 
Sbjct  263   DQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-RRLDHGVLLVGYGSAGYSPVRMK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KP+WIIKNSWG+ WGE G++++CRG  +CG+ +MVS V
Sbjct  322   EKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTV  360



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   400 bits (1027),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/339 (58%), Positives = 248/339 (73%), Gaps = 13/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             I QVTD       E  L TA E  +  F +   K Y + +E+ YR  +F  NL RAA HQ
Sbjct  37    IEQVTDGH--EGAEPQLLTA-EHHYSLFKKRFKKSYGSQKEHDYRFKIFQVNLRRAARHQ  93

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+A HGVT+FSDLTP EF K Y+G+  L++P  A+      EAP L    LP+ FDW
Sbjct  94    NLDPSATHGVTQFSDLTPGEFRKAYLGLRRLRLPKDAT------EAPILPTDNLPQDFDW  147

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++  +
Sbjct  148   REKGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEAGS  207

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F++ KVA KV NF+ +  DE
Sbjct  208   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGTCKFDNTKVAAKVANFSVVSLDE  267

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA L  +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  G++ +R+ 
Sbjct  268   DQIAANLFKNGPLAVAINAVFMQTYIGGVSCPYICS-KRLDHGVLLVGYGSAGYAPVRMK  326

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGE G++R+CRG  +CG+ +MVS V
Sbjct  327   DKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTV  365



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   399 bits (1026),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 240/317 (76%), Gaps = 9/317 (3%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F +F  + GK YAT EE+ +R GVF  N+ RA  H  LDP+AVHGVT+FSDLTP EF
Sbjct  48    EHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHAQLDPSAVHGVTKFSDLTPAEF  107

Query  414   EKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAF  587
              + ++G+  L++P  A       +AP L  + LP+ FDWRDKGAVT VK QGSCGSCW+F
Sbjct  108   HRKFLGLKPLRLPAHAQ------KAPILPTNNLPKDFDWRDKGAVTNVKDQGSCGSCWSF  161

Query  588   STTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESG  767
             STTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +CD GC+GGLM NA+EYLI SG
Sbjct  162   STTGALEGAHFLATGELVSLSEQQLVDCDHVCDPEEYGSCDSGCNGGLMNNAFEYLIGSG  221

Query  768   GIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYM  947
             G++ E  YPYTG+ G C+F+  K+A  V N++ +  DE+Q+AA LV +GPLAV INAVYM
Sbjct  222   GVQREKDYPYTGRDGTCKFDKSKIAASVSNYSVISLDEEQIAANLVKNGPLAVAINAVYM  281

Query  948   HTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFR  1127
              TY+GGVSCP IC  K L+HGVLLVGYG+  ++ +R   KPYWIIKNSWG++WGE GY++
Sbjct  282   QTYVGGVSCPYICG-KHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYK  340

Query  1128  MCRGHGMCGISNMVSAV  1178
             +CRG  +CG+ +MVS V
Sbjct  341   ICRGRNVCGVDSMVSTV  357



>emb|CBI31400.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   395 bits (1015),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 216/244 (89%), Gaps = 1/244 (0%)
 Frame = +3

Query  459   LLGGKAE-APRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGK  635
             + GG AE A  L+V GLPE+FDWR+KGAVTEVKMQG+CGSCWAFSTTGA+EGA+FI+T K
Sbjct  1     MKGGVAETAAALEVDGLPESFDWREKGAVTEVKMQGTCGSCWAFSTTGAVEGAHFISTKK  60

Query  636   LLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD  815
             LL LSEQQLVDCDH CDI+DK+ACD GC GGLMTNAY+YLIE+GG+EEE+SYPYTGK G+
Sbjct  61    LLTLSEQQLVDCDHMCDIRDKTACDSGCEGGLMTNAYKYLIEAGGLEEESSYPYTGKHGE  120

Query  816   CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKK  995
             C+F+ ++VAV+V NFT +P +E+Q+AA LV HGPLAVG+NA++M TY+GGVSCPLIC K+
Sbjct  121   CKFKPDRVAVRVVNFTEVPINENQIAANLVCHGPLAVGLNAIFMQTYIGGVSCPLICPKR  180

Query  996   RLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSA  1175
              +NHGVLLVGYG KG+SILR G+KPYWIIKNSWGK WGE GY+R+CRGHGMCG++ MVSA
Sbjct  181   WINHGVLLVGYGAKGYSILRFGYKPYWIIKNSWGKRWGEHGYYRLCRGHGMCGMNTMVSA  240

Query  1176  VMTR  1187
             V  R
Sbjct  241   VNVR  244



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   399 bits (1025),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 255/350 (73%), Gaps = 18/350 (5%)
 Frame = +3

Query  141   FASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFA  320
             + +    G+ IRQV  ++     ++LL    +  F  F +  GK YA+ EE+ YRL VF 
Sbjct  26    YINGGDDGILIRQVIGND----DDHLLNV--DHHFTIFKKRFGKTYASDEEHHYRLSVFK  79

Query  321   KNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRL  491
              NL RA  HQ LDP+AVHGVT+FSDLTP EF + ++GV   L++P  A+      +AP L
Sbjct  80    ANLRRAMRHQKLDPSAVHGVTQFSDLTPAEFRRKFLGVNRRLRLPSDAN------KAPVL  133

Query  492   DVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDC  671
                 LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGAN+++TGKL++LSEQQLVDC
Sbjct  134   PTEDLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGANYLSTGKLVSLSEQQLVDC  193

Query  672   DHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVK  848
             DH CD ++K +CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F++ KVA K
Sbjct  194   DHECDPEEKGSCDAGCNGGLMNSAFEYTLKAGGLMREGDYPYTGTDRGTCKFDNTKVAAK  253

Query  849   VGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGY  1028
             V NF+ +  DE+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGY
Sbjct  254   VANFSVVSLDEEQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICS-KRLDHGVLLVGY  312

Query  1029  GKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G  GFS +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  313   G-TGFSPIRMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTV  361



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 252/346 (73%), Gaps = 13/346 (4%)
 Frame = +3

Query  147   SSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKN  326
             S+ +  + IRQV  +      ++LL    E  F +F  + GK YAT EE+ +R GVF  N
Sbjct  23    STDADDILIRQVVPEG--EVEDHLLNA--EHHFSTFKSKFGKTYATKEEHDHRFGVFKSN  78

Query  327   LIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVS  500
             + RA  H  LDP+AVHGVT+FSDLTP EF + ++G+  L++P  A       +AP L  +
Sbjct  79    MRRARLHAQLDPSAVHGVTKFSDLTPAEFHRKFLGLKPLRLPAHAQ------KAPILPTN  132

Query  501   GLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHT  680
              LP+ FDWRDKGAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH 
Sbjct  133   NLPKDFDWRDKGAVTNVKDQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHV  192

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNF  860
             CD ++  +CD GC+GGLM NA+EYLI SGG++ E  YPYTG+ G C+F+  K+A  V N+
Sbjct  193   CDPEEYGSCDSGCNGGLMNNAFEYLIGSGGVQREKDYPYTGRDGTCKFDKSKIAASVSNY  252

Query  861   TNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKG  1040
             + +  DE+Q+AA LV +GPLAV INAVYM TY+GGVSCP IC  K L+HGVLLVGYG+  
Sbjct  253   SVISLDEEQIAANLVKNGPLAVAINAVYMQTYVGGVSCPYICG-KHLDHGVLLVGYGEGA  311

Query  1041  FSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             ++ +R   KPYWIIKNSWG++WG  GY+++CRG  +CG+ +MVS V
Sbjct  312   YAPIRFKEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTV  357



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   399 bits (1026),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 255/376 (68%), Gaps = 8/376 (2%)
 Frame = +3

Query  69    SSRIAGGGLMYAQLLAVLT-CAHLAFASSASQGL---NIRQVTDDEIPAAGENLLG--TA  230
             S  +  G L  A L  V T  AH+  ASS    +    IR+VTD +     ++L      
Sbjct  11    SVEMITGILSLALLFLVPTITAHVHEASSDLNAVLPNPIREVTDMDGEGVIDDLRRGLLN  70

Query  231   TEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNE  410
              E  F  F+++  KEY+  EE+  R  +F KNL +A  HQ LD  A+HG+ +FSDLT  E
Sbjct  71    AEAHFAHFVKKFNKEYSGAEEHARRFSIFKKNLHKALRHQKLDRDAIHGINKFSDLTEEE  130

Query  411   FEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFS  590
             F + Y+G L  P R SL      AP L    LP  FDWR+ GAVT VK QG+CGSCW FS
Sbjct  131   FHEQYLG-LTTPPR-SLSQRTQPAPILPTDDLPPDFDWRELGAVTPVKNQGACGSCWTFS  188

Query  591   TTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGG  770
             TTGA+EGANF+ TGKL++LSEQQLVDCDH CD  +   CD GC+GGLMT AY+Y +++GG
Sbjct  189   TTGAMEGANFMKTGKLISLSEQQLVDCDHECDSSEPDVCDSGCNGGLMTTAYQYALKAGG  248

Query  771   IEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             ++ E  YPYTG  G C+F++ KVA  V NF+ +  DEDQ+AA LV +GPLAVGINA +M 
Sbjct  249   LQREEDYPYTGIDGSCKFDNTKVAAMVANFSTVSIDEDQIAANLVKNGPLAVGINAAFMQ  308

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCP +C+K+ L+HGVLLVGYG  G++  RL  KP+WIIKNSWG DWGE+GY+++
Sbjct  309   TYVGGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKL  368

Query  1131  CRGHGMCGISNMVSAV  1178
             CRGH +CGI+ MVS V
Sbjct  369   CRGHNVCGINTMVSTV  384



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 255/368 (69%), Gaps = 16/368 (4%)
 Frame = +3

Query  102   AQLLAVLTCAHLAFASSASQGLNIRQ-VTDDEIP----AAGENLLGTATEVRFKSFMQEH  266
             + L   L+   LA A+++S     R  V  ++ P      G+N      +  F  F ++ 
Sbjct  5     SSLPLFLSVFFLAVATASSAIFEERDDVVSNDNPLIRQVVGDNDHLLTADHHFSLFKKKF  64

Query  267   GKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---L  437
             GK YA+ EE+ YR  VF  N+ RA  HQ LDP+AVHGVT+FSDLTP EF + ++G+   L
Sbjct  65    GKSYASKEEHDYRFAVFKANMRRALRHQKLDPSAVHGVTKFSDLTPAEFRRNFLGLRPRL  124

Query  438   KVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGAN  617
             K P  A+      +AP L    LP  FDWR+ GAVT VK QGSCGSCW+FS TGA+EGAN
Sbjct  125   KFPAHAN------KAPILPTDNLPTDFDWREHGAVTPVKNQGSCGSCWSFSATGALEGAN  178

Query  618   FIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPY  797
             F+ATGKL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPY
Sbjct  179   FLATGKLVSLSEQQLVDCDHECDPEEPDSCDSGCNGGLMNSAFEYTLKAGGLMREQDYPY  238

Query  798   TGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSC  974
             +G   G C F   K+A KV NF+ +  DE+Q+AA LV +GPLAV INAV+M TY+GGVSC
Sbjct  239   SGSDRGTCNFNKTKIAAKVANFSVVSLDEEQIAANLVKNGPLAVAINAVFMQTYIGGVSC  298

Query  975   PLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCG  1154
             P ICS KRL+HGVLLVGYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRGH +CG
Sbjct  299   PYICS-KRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICRGHNICG  357

Query  1155  ISNMVSAV  1178
             + +MVS V
Sbjct  358   VDSMVSTV  365



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/341 (57%), Positives = 245/341 (72%), Gaps = 12/341 (4%)
 Frame = +3

Query  171   IRQVTDD--EIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             IRQV  +  ++    E  L TA    F  F +  GK YA+ EE+ YR  VF  NL RA  
Sbjct  36    IRQVVPELGDVEGGEEENLLTADHHHFSIFKRRFGKSYASQEEHDYRFKVFKANLRRARR  95

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ LDP+A HGVT+FSDLTP EF   Y+G+  LK+P  A       +AP L  + LPE F
Sbjct  96    HQQLDPSATHGVTQFSDLTPAEFRGTYLGLRPLKLPHDAQ------KAPILPTNDLPEDF  149

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FSTTGA+EGANF+ATG L++LSEQQLV+CDH CD ++ 
Sbjct  150   DWRDHGAVTAVKNQGSCGSCWSFSTTGALEGANFLATGNLVSLSEQQLVECDHECDPEEM  209

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              +CD GC+GGLM  A+EY +++GG+ +E  YPYTG   G C+F+  K+A  V NF+ +  
Sbjct  210   GSCDSGCNGGLMNTAFEYTLKAGGLMKEEDYPYTGTDRGSCKFDKTKIAASVSNFSVISL  269

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DEDQ+AA LV  GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  G++ +R
Sbjct  270   DEDQIAANLVKIGPLAVAINAVFMQTYVGGVSCPYICS-KRLDHGVLLVGYGSAGYAPIR  328

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             +  KPYWIIKNSWG++WGE G++++CRG  +CG+ +MVS V
Sbjct  329   MKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTV  369



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/340 (58%), Positives = 248/340 (73%), Gaps = 18/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  DE      ++L    E  F  F +  GK YA+ EE+ YR  VF  NL RA  HQ
Sbjct  36    IRQVVGDE----DHHMLNA--EHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMRHQ  89

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              LDP+AVHGVT+FSD+TP+EF + ++GV   L+ P  A+      +AP L    LP  FD
Sbjct  90    KLDPSAVHGVTQFSDMTPDEFSQKFLGVNRRLRFPSDAN------KAPILPTEDLPSDFD  143

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WR+ GAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++K 
Sbjct  144   WREHGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEKD  203

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPAD  878
             +CD GCSGGLM +A+EY +++GG+  E  YPYTG     C+F++ KVA KV NF+ +  D
Sbjct  204   SCDSGCSGGLMNSAFEYTLKAGGLMREEDYPYTGTDKATCKFDNTKVAAKVANFSVVSLD  263

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICSK+ L+HGVLLVGYG  GFS +R+
Sbjct  264   EEQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICSKQ-LDHGVLLVGYG-TGFSPIRM  321

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  322   KEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTV  361



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 250/347 (72%), Gaps = 20/347 (6%)
 Frame = +3

Query  171   IRQVTD--DEI----PAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLI  332
             IRQVTD  DEI     +   +LLG   E  F  F ++  K YA+ EE+  R  +F  NL 
Sbjct  32    IRQVTDGGDEILSHHESTNNDLLGA--EHHFSLFKKKFNKAYASQEEHDRRFTIFKANLR  89

Query  333   RAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSG  503
             RAA  Q LDP+A HGVT+FSDLTP EF + Y+G+   L++P  A       +AP L  + 
Sbjct  90    RAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDAD------QAPILPTND  143

Query  504   LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTC  683
             LP  FDWR+KGAV  VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH C
Sbjct  144   LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHEC  203

Query  684   DIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG--KGGDCRFESEKVAVKVGN  857
             D ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG  +G  C+F+  K+A  V N
Sbjct  204   DPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVAN  263

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP ICS +RL+HGVLLVGYG  
Sbjct  264   FSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICS-RRLDHGVLLVGYGSA  322

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G++ +RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS +
Sbjct  323   GYAPIRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTI  369



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 248/341 (73%), Gaps = 17/341 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV  +     G++LL  + E +F  F  + GK Y+T EE+ YR  VF  NL RA  
Sbjct  33    LLIRQVVPE-----GDDLL--SAEHQFGLFKAKFGKTYSTVEEHDYRFSVFEANLRRARR  85

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ+LDP+AVHGVTRFSDLTP+EF + Y+G+  L++P  A       +AP L  + LP  F
Sbjct  86    HQLLDPSAVHGVTRFSDLTPDEFRRDYLGLKPLRLPADAQ------KAPILPTNDLPTDF  139

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FS  GA+EGA+F+ TG L+++SEQQLVDCDH CD ++ 
Sbjct  140   DWRDHGAVTPVKDQGSCGSCWSFSAIGALEGAHFLTTGNLISMSEQQLVDCDHECDPEEY  199

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              ACD GC+GGLMT+A+EY++++GG+E E +YPY G   G C+F   ++   V NF+ +  
Sbjct  200   GACDQGCNGGLMTSAFEYILKAGGVEREETYPYIGSDRGSCKFNKSQIVASVSNFSVVSL  259

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DEDQ+AA +V +GPLAVGINAV+M TYM GVSCP ICS+  L+HGV+LVGYG  G++ +R
Sbjct  260   DEDQIAANMVKNGPLAVGINAVFMQTYMKGVSCPYICSRN-LDHGVVLVGYGSAGYAPIR  318

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KPYWIIKNSWG+ WGE+GY+++CRGH  CG+ +MVS V
Sbjct  319   FKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTV  359



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 250/363 (69%), Gaps = 19/363 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             L  +L    L FA+    G  + IRQV  D     G+  L  A    F  F +  GK YA
Sbjct  10    LCTLLATTSLVFAAEDDDGDDILIRQVVGD-----GDGDLLNADH-HFTVFKRRFGKAYA  63

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGR  452
             + EE+ YRL VF  N+ RA  HQ LDP AVHGVT+FSD TP EF + ++G+   LK P  
Sbjct  64    SDEEHDYRLSVFKANMRRAKRHQELDPAAVHGVTQFSDSTPTEFRRKFLGLNRRLKFPAD  123

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
             A        AP L    LP  FDWRD+GAVT VK QG+CG CW+FSTTGA+EGANF+ATG
Sbjct  124   AK------TAPILPTDELPSDFDWRDRGAVTPVKNQGTCGLCWSFSTTGALEGANFLATG  177

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             KL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG   
Sbjct  178   KLVSLSEQQLVDCDHECDPEEAGSCDFGCNGGLMNSAFEYTLKAGGLMREEDYPYTGNDL  237

Query  813   D-CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
               CRF+  K+A KV NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS
Sbjct  238   QVCRFDKTKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS  297

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              KRL+HGVLLVGYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MV
Sbjct  298   -KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMV  356

Query  1170  SAV  1178
             S V
Sbjct  357   STV  359



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 241/342 (70%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +P   +N L    E  F SF+Q  GK Y   +E+ YRL VF  NL RA  HQ
Sbjct  28    IRQV----VPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKA-EAPRLDVSGLPETFD  521
             +LDP+A HGVT+FSDLTP EF + Y+G L+   RA L  LG  A EAP L   GLP+ FD
Sbjct  84    LLDPSAEHGVTKFSDLTPAEFRRTYLG-LRKSRRALLRELGESAHEAPVLPTDGLPDDFD  142

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAV  VK QGSCGSCW+FS +GA+EGA+++ATGKL  LSEQQ VDCDH CD  +  
Sbjct  143   WRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDSSEPD  202

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             +CD GC+GGLMT A+ YL ++GG+E E  YPYTG  G C+F+  K+   V NF+ +  DE
Sbjct  203   SCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSDGKCKFDKSKIVASVQNFSVVSVDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
              Q++A L+ HGPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGYG  GF+ +RL 
Sbjct  263   AQISANLIKHGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGYGASGFAPIRLK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
              KPYWIIKNSWG++WGE GY+++CRG  +   CG+ +MVS V
Sbjct  322   DKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  363



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/354 (54%), Positives = 254/354 (72%), Gaps = 19/354 (5%)
 Frame = +3

Query  135   LAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRL  308
             ++ AS AS G  + IRQV D+  P         ++E  F  F ++ GK Y + EE+ YR 
Sbjct  18    ISSASDASDGEDILIRQVVDETKPKV------LSSEDHFSLFKRKFGKVYGSREEHDYRF  71

Query  309   GVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAE  479
              VF  NL+RA  HQ LDP+A HGVT+FSDLTP+EF + ++GV    K+P  A+      +
Sbjct  72    SVFRANLLRAKRHQKLDPSAQHGVTQFSDLTPSEFRRRFLGVKGGFKLPKDAN------Q  125

Query  480   APRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQ  659
             AP L    LPE FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F++TG+L++LSEQQ
Sbjct  126   APILPTDKLPEDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLSTGELVSLSEQQ  185

Query  660   LVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEK  836
             LVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPY G + G C+F+  K
Sbjct  186   LVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYAGTESGTCKFDKSK  245

Query  837   VAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVL  1016
             V   V NF+ +  +EDQ+AA LV +GPLAV INA YM TY+GGVSCP ICS +RLNHGVL
Sbjct  246   VVASVANFSVVSVNEDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYICS-RRLNHGVL  304

Query  1017  LVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             LVGYG  G++  R+  KP+WIIKNSWG++WGE+G++++CRG  +CG+ ++VS V
Sbjct  305   LVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVDSLVSTV  358



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 241/342 (70%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV    +P   +N L    E  F SF+Q  GK Y   +E+ YRL VF  NL RA  HQ
Sbjct  28    IRQV----VPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKANLRRARRHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL--LGGKA-EAPRLDVSGLPETFD  521
             +LDP+A HGVT+FSDLTP EF + Y+G L+   RA L  LG  A EAP L   GLP+ FD
Sbjct  84    LLDPSAEHGVTKFSDLTPAEFRRTYLG-LRKSRRALLRELGESAHEAPVLPTDGLPDDFD  142

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAV  VK QGSCGSCW+FS +GA+EGA+++ATGKL  LSEQQ VDCDH CD  +  
Sbjct  143   WRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDSSEPD  202

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             +CD GC+GGLMT A+ YL ++GG+E E  YPYTG  G C+F+  K+   V NF+ +  DE
Sbjct  203   SCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSDGKCKFDKSKIVASVQNFSVVSVDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
              Q++A L+ HGPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGYG  GF+ +RL 
Sbjct  263   AQISANLIKHGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGYGASGFAPIRLK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
              KPYWIIKNSWG++WGE GY+++CRG  +   CG+ +MVS V
Sbjct  322   DKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTV  363



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 254/373 (68%), Gaps = 24/373 (6%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQ---------GLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQ  260
               A+L  A +A+  S+ Q          + IRQV       +G +      E  F+ F  
Sbjct  10    FFAILLSATVAYGVSSDQINSAVSDEEDILIRQVV------SGADDRPLTAEQHFQDFKL  63

Query  261   EHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--  434
             + GK Y T EE+ YR  VF  NL +A  HQ LDP AVHGVTRFSDLT +EF + ++G+  
Sbjct  64    KFGKTYTTDEEHDYRFRVFKANLRKAKRHQKLDPDAVHGVTRFSDLTESEFRENFVGLNR  123

Query  435   LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGA  614
             L++P  A       +AP L    L   FDWRD+GAVT VK QGSCGSCW+FS  GA+EGA
Sbjct  124   LRLPADAH------QAPILPTDNLASDFDWRDQGAVTPVKDQGSCGSCWSFSAVGALEGA  177

Query  615   NFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYP  794
             NF++TGKL++LSEQQLVDCDH CD ++  ACD GC+GGLMT+A+EY++++GG+E E  YP
Sbjct  178   NFLSTGKLISLSEQQLVDCDHECDPEEAGACDAGCNGGLMTSAFEYIVKAGGLEREEDYP  237

Query  795   YTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVS  971
             YTG   G C+F++ K+A    NF+ +  D DQ+AA LV +GPLA+GINAV+M TYM G+S
Sbjct  238   YTGTDRGSCKFQNGKIAASAANFSVISNDADQIAANLVKNGPLAIGINAVFMQTYMKGIS  297

Query  972   CPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMC  1151
             CP ICSK+ L+HGVLLVGYG  GF+ +RL  KPYWIIKNSWG++WGE GY+ +C+G  +C
Sbjct  298   CPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFICKGKNIC  357

Query  1152  GISNMVSAVMTRP  1190
             G  +MVS+V   P
Sbjct  358   GSESMVSSVAAIP  370



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 246/346 (71%), Gaps = 17/346 (5%)
 Frame = +3

Query  150   SASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             S+S G++  I QV DDE         G   E  F  F +  GK YAT EE+ YR  VF  
Sbjct  21    SSSDGVDPMICQVVDDE---------GLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKS  71

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSG  503
             N+ RA  HQ+LDP+AVHGVTRFSDLTP EF    +G+  V     L      AP L    
Sbjct  72    NMHRARRHQLLDPSAVHGVTRFSDLTPMEFRHSVLGLRGV----GLPSDADSAPILPTDN  127

Query  504   LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTC  683
             LP+ FDWR+ GAVT VK QGSCGSCW+FS TGA+EGA+F++TG+L++LSEQQLVDCDH C
Sbjct  128   LPKDFDWREHGAVTPVKNQGSCGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHQC  187

Query  684   DIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNF  860
             D ++  +CD GC+GGLM +A+EY++ +GG+  E  YPY+G  GG C+F+  K+A  V NF
Sbjct  188   DPEEAGSCDSGCNGGLMNSAFEYILNNGGVMREEDYPYSGTNGGTCKFDKAKIAASVANF  247

Query  861   TNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKG  1040
             + +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP +CSKK LNHGVLLVGYG + 
Sbjct  248   SVVSRDEDQIAANLVKNGPLAVAINAVYMQTYVGGVSCPYVCSKK-LNHGVLLVGYGSES  306

Query  1041  FSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             ++ +R+  KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  307   YAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTV  352



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 252/360 (70%), Gaps = 15/360 (4%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             L  VL    ++  S+  +G +  IRQV D+E    G        E  F  F  + GK Y+
Sbjct  8     LFVVLFIFSVSAFSTPDEGEDPIIRQVVDEEGVRLG-------AEHHFNLFKHKFGKVYS  60

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL  461
             + +E+ YR  +F  NL RA  HQ++DP+AVHGVTRFSDLTP EF K  +G+  V     L
Sbjct  61    SKDEHDYRFKIFKSNLNRAKRHQLMDPSAVHGVTRFSDLTPREFRKSVLGLRGV----GL  116

Query  462   LGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLL  641
                   AP L    LP+ FDWR+KGAVT VK QGSCGSCW+FSTTGA+EGA+F++TGKL+
Sbjct  117   PKDANAAPILPTDNLPKDFDWREKGAVTAVKNQGSCGSCWSFSTTGALEGAHFLSTGKLV  176

Query  642   NLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDC  818
             +LSEQQLVDCDH CD +   +CD GC+GGLM +A+EY+++SGG+  E  YPY+G   G C
Sbjct  177   SLSEQQLVDCDHECDPEQPGSCDAGCNGGLMNSAFEYILKSGGVMREEDYPYSGTDRGSC  236

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+ +K+A  V NF+ +  DEDQ+AA LV +GPLA+ +NAVYM TY+GGVSCP ICS KR
Sbjct  237   KFDKKKIAASVANFSVVSLDEDQIAANLVKNGPLAIALNAVYMQTYVGGVSCPYICS-KR  295

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             L+HGVLLVGYG   +S +RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  296   LDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTV  355



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   397 bits (1019),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 245/337 (73%), Gaps = 11/337 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D     GE+ L  A E  F +F  + GK YAT EE+ +R  VF  NL+ A +HQ
Sbjct  33    IRQVVSD-----GEDHLLNA-EHHFTTFKSKFGKNYATQEEHDFRFSVFKDNLLLAKKHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             ++DPTA HGVT+FSDLTP +  + ++G+ +   R  L     +AP L    LP  FDWRD
Sbjct  87    MMDPTAAHGVTKFSDLTPRDSPRQFLGLKR---RLRLPTDANKAPILPTGDLPTNFDWRD  143

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             +GAVT+VK QGSCGSCW+FS TGA+EGA+++ATG+L++LSEQQLVDCDH CD ++  ACD
Sbjct  144   QGAVTKVKDQGSCGSCWSFSATGALEGAHYLATGELVSLSEQQLVDCDHECDPEEYGACD  203

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GCSGGLM NA+EY +++GG+E E  YPYTG   G C+F+  KVA  V NF+ +  DEDQ
Sbjct  204   SGCSGGLMNNAFEYALKAGGLEREEDYPYTGNDRGACKFDKSKVAASVSNFSVVSLDEDQ  263

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPL+V INAV+M TY+GGVSCP ICSK + +HGVLLVGYG  G++ +R   K
Sbjct  264   IAANLVKHGPLSVAINAVFMQTYIGGVSCPYICSKHQ-DHGVLLVGYGAAGYAPIRFKEK  322

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             P+WIIKNSWG++WGE GY+++CR   +CG+ +MVS V
Sbjct  323   PFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTV  359



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   397 bits (1019),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 249/341 (73%), Gaps = 15/341 (4%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV    +P A ++ L  A E  F +F  + GK YAT EE+ +R  +F  NL+RA  
Sbjct  30    LLIRQV----VPDAEDHHLLNA-EHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKS  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ LDP+AVHGVTRFSDLTP EF + ++G+  L++P  A       +AP L  + LP  F
Sbjct  85    HQKLDPSAVHGVTRFSDLTPAEFRRQFLGLKPLRLPSDAQ------KAPILPTNDLPTDF  138

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWR+ GAVT VK QGSCGSCW+FS  GA+EGA+F++TG+L++LSEQQLVDCDH CD +++
Sbjct  139   DWREHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGELVSLSEQQLVDCDHECDPEER  198

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              ACD GC+GGLMT A+EY +++GG+  E  YPYTG+  G C+F+  KVA  V NF+ +  
Sbjct  199   GACDSGCNGGLMTTAFEYTLQAGGLMREKDYPYTGRDRGPCKFDKSKVAASVANFSVVSL  258

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE+Q+AA LV +GPLAVGINAV+M TY+GGVSCP IC  K L+HGVLLVGYG   ++ +R
Sbjct  259   DEEQIAANLVQNGPLAVGINAVFMQTYIGGVSCPYICG-KHLDHGVLLVGYGSGAYAPIR  317

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KPYWIIKNSWG+ WGEEGY+++CRG  +CG+ +MVS V
Sbjct  318   FKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTV  358



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   397 bits (1019),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 196/363 (54%), Positives = 253/363 (70%), Gaps = 19/363 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             +L V   + +   +S+S G  L IRQV D   P         ++E  F  F ++ GK YA
Sbjct  15    ILFVSVSSGIVAETSSSDGDDLVIRQVVDGAEPKV------LSSEDHFSLFKRKFGKVYA  68

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGR  452
             + EE+ YRL VF  NL RA  HQ LDP+A HGVT+FSDLT +EF K ++GV    K+P  
Sbjct  69    SSEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRSEFRKKHLGVRGGFKLPKD  128

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
             A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FS TGA+EGANF+ATG
Sbjct  129   AN------KAPILPTENLPEDFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANFLATG  182

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             KL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G
Sbjct  183   KLVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDG  242

Query  813   -DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
               C+ +  K+   V NF+ +  DEDQ+AA LV +GPLAV INA YM TY+GGVSCP IC+
Sbjct  243   PTCKLDKSKIVASVSNFSVISIDEDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYICA  302

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              +RLNHGVLLVGYG  G++  R   KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++V
Sbjct  303   -RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLV  361

Query  1170  SAV  1178
             S V
Sbjct  362   STV  364



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   396 bits (1018),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 252/360 (70%), Gaps = 12/360 (3%)
 Frame = +3

Query  111   LAVLTCAHLAFASSA----SQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEY  278
             L +L+    A  SSA     +   IRQV   E      +LL    E  F  F  + GK Y
Sbjct  4     LFLLSLPRFALFSSAIAFPDEDPLIRQVVS-ETETDDSHLLNA--EHHFSLFKSKFGKIY  60

Query  279   ATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRAS  458
             A+ EE+ +R  VF  NL RA  +Q+LDP+A HG+T+FSDLTP+EF + Y+G+ K   + +
Sbjct  61    ASEEEHDHRFKVFKANLRRARLNQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPKVN  120

Query  459   LLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKL  638
                   +AP L  S LP  +DWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L
Sbjct  121   ----AEKAPILPTSDLPADYDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLATGEL  176

Query  639   LNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDC  818
             ++LSEQQLVDCDH CD + + +CD GC GGLMT A+EY +++GG++ E  YPYTGK G C
Sbjct  177   VSLSEQQLVDCDHECDSEQQDSCDAGCGGGLMTTAFEYTLKAGGLQLEKDYPYTGKDGKC  236

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
              F+  K+A  V NF+ +  DEDQ+AA LV HGPLAVGINA +M TY+GGVSCPLIC  KR
Sbjct  237   HFDKSKIAAAVTNFSVIGLDEDQIAANLVKHGPLAVGINAAWMQTYVGGVSCPLICF-KR  295

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              +HGVLLVGYG  GF+ +RL  K YWIIKNSWG++WGE GY+++CRGH +CG+  MVS V
Sbjct  296   QDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   396 bits (1018),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 238/318 (75%), Gaps = 9/318 (3%)
 Frame = +3

Query  231   TEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNE  410
              E  F +F  + GK YAT EE+ +R GVF  NL RA  H  LDP+AVHGVT+FSDLT  E
Sbjct  46    AEHHFSNFKAKFGKTYATKEEHDHRFGVFKSNLRRARLHAQLDPSAVHGVTKFSDLTAAE  105

Query  411   FEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWA  584
             F++ ++G+  L +P  A       +AP L  + LP+ FDWRDKGAVT VK QG+CGSCW+
Sbjct  106   FQRQFLGLKPLGLPANAQ------KAPILPTNNLPKDFDWRDKGAVTNVKDQGACGSCWS  159

Query  585   FSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIES  764
             FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  ACD GC+GGLM NA+EY++ +
Sbjct  160   FSTTGALEGAHFLATGELVSLSEQQLVDCDHVCDPEEYGACDSGCNGGLMNNAFEYILGA  219

Query  765   GGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVY  944
             GG++ E  YPY G+   C+F+  K+A  V N++ +  DEDQ+AA LV +GPLAVGINAVY
Sbjct  220   GGVQREEDYPYAGRDSSCKFDKSKIAASVANYSVISLDEDQIAANLVKNGPLAVGINAVY  279

Query  945   MHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYF  1124
             M TY+GGVSCP IC+ KRL+HGV +VGYG+ G++ +R   KPYWIIKNSWG+ WGE GY+
Sbjct  280   MQTYIGGVSCPYICA-KRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYY  338

Query  1125  RMCRGHGMCGISNMVSAV  1178
             ++CRG   CG+ +MVS V
Sbjct  339   KICRGQNACGVDSMVSTV  356



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   395 bits (1015),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 247/340 (73%), Gaps = 16/340 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV DD      E+ +  A E  F +F  +  K YAT EE+ YR GVF  N+ RA  
Sbjct  2     LLIRQVVDDN-----EDHVLNA-EHHFSTFKSKFSKTYATKEEHDYRFGVFKSNVRRAKL  55

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             H  LDP+AVHGVT+FSDLTP+EF + ++G+  L++P  A       +AP L    LPE F
Sbjct  56    HAKLDPSAVHGVTKFSDLTPSEFRRQFLGLKPLRLPEHAQ------KAPILPTHDLPEDF  109

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRDKGAVT VK QGSCGSCWAFSTTGA+EG++F+ATG+L++LS+QQLVDCDH CD +  
Sbjct  110   DWRDKGAVTHVKNQGSCGSCWAFSTTGALEGSHFLATGELVSLSDQQLVDCDHVCDPEQY  169

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPAD  878
              ACD GC+GGLM NA+EY++ESGG++ E  YPYTG+      + E  A  V NF+ +  D
Sbjct  170   GACDSGCNGGLMNNAFEYILESGGVQREEDYPYTGRDRGPAID-EANAASVSNFSVVSLD  228

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ++A LV +GPLA+GINAV+M TY+GGVSCP IC K  L+HGVLLVGYGK G++ +RL
Sbjct  229   EDQISANLVKNGPLAIGINAVFMQTYIGGVSCPYICGKN-LDHGVLLVGYGKAGYAPIRL  287

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  288   KEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTV  327



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   396 bits (1018),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 245/338 (72%), Gaps = 11/338 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  +E   + E LL    E  F  F  ++ K YAT EE+ +R  VF  NL RA  HQ
Sbjct  31    IRQVVPEE---SDEQLL--TAEHHFALFKSKYEKTYATQEEHDHRFRVFKANLRRAKRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDPTAVHGVT+FSDLTP EF + Y+G+ +   R  L     +AP L  S LP  FDWR+
Sbjct  86    ALDPTAVHGVTQFSDLTPKEFRRKYLGLKR---RFRLPTDTQQAPILPTSDLPTDFDWRE  142

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             +GAVT VK QG CGSCW+FS TGA+EGA+F+AT +L++LSEQQL+DCDH CD +  ++CD
Sbjct  143   QGAVTPVKNQGMCGSCWSFSATGALEGAHFLATKELVSLSEQQLIDCDHECDPEQANSCD  202

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GCSGGLM NA+EY +++GG+ +EA YPYTG+    C+F++  +A KV NF+ + ADEDQ
Sbjct  203   SGCSGGLMNNAFEYTLKAGGLMKEADYPYTGRDHSTCKFDNSMIAAKVSNFSVVSADEDQ  262

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPLA+ INA++M TY+GGVSCP +CSK + +HGVLLVG+G  G+S +RL  K
Sbjct  263   IAANLVQHGPLAIAINALWMQTYIGGVSCPYVCSKSQ-DHGVLLVGFGSSGYSPIRLKEK  321

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSAV  1178
             PYWIIKNSWG  WGE GY+++CRG H +CG+  MVS V
Sbjct  322   PYWIIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTV  359



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 245/336 (73%), Gaps = 14/336 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD E     + LL    E  F +F  +  K YAT EE+ YR GVF  NL +A  HQ
Sbjct  29    IRQVTDHE----DDQLLNA--EHHFTTFKSKFSKSYATKEEHDYRFGVFKSNLKKAKLHQ  82

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDP+A HGVT+FSDLT +EF + ++G+ K   R  L     +AP L  + LPE FDWR+
Sbjct  83    KLDPSAEHGVTKFSDLTASEFRRQFLGLKK---RLRLPAHAQKAPILPTNNLPEDFDWRE  139

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
             KGAVT     GSCGSCWAFSTTGA+EGAN++ATGKL++LSEQQLVDCDH CD  + ++CD
Sbjct  140   KGAVTP----GSCGSCWAFSTTGALEGANYLATGKLVSLSEQQLVDCDHVCDPDEYNSCD  195

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQM  890
              GC+GGLM NA+EYL++SGG+  E  Y YTG+ G C+F+  K+A  V NF+ +  DEDQ+
Sbjct  196   SGCNGGLMNNAFEYLLQSGGVVREQDYSYTGRDGSCKFDKSKIAASVSNFSVVSVDEDQI  255

Query  891   AAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKP  1070
             AA LV +GPLAV INA +M TYM GVSCP IC+K RL+HGVLLVG+G  GF+ +RL  KP
Sbjct  256   AANLVKNGPLAVAINAAWMQTYMSGVSCPYICAKSRLDHGVLLVGFG-NGFAPIRLKEKP  314

Query  1071  YWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             YWIIKNSWG++WGEEGY+++CRG  +CG+ +MVS V
Sbjct  315   YWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTV  350



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 254/366 (69%), Gaps = 23/366 (6%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGK  272
             L++A  ++V      +F  +  + + IRQV +   P         ++E  F  F +  GK
Sbjct  12    LLFAFFVSV------SFCENNGEDILIRQVVNGSEPKV------LSSEDHFSLFKRRFGK  59

Query  273   EYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKV  443
              Y + EE+ +R  VF  NL RA  HQ +DP+A HGVT+FSDLTP+EF +M++GV    K+
Sbjct  60    VYGSLEEHRHRFAVFRSNLQRAMRHQKMDPSARHGVTQFSDLTPSEFRRMHLGVRGGFKL  119

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P  A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+
Sbjct  120   PKDAN------QAPILPTKDLPEDFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFL  173

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             +TG+L++LSEQQLVDCDH CD + + +CD GC+GGLM +A+EY +++GG+  E  YPYTG
Sbjct  174   STGQLVSLSEQQLVDCDHECDPEQEGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTG  233

Query  804   -KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
               GG C+ +  K+   V NF+ +  +EDQ+AA LV +GPLAV +NA YM TYMGGVSCP 
Sbjct  234   TDGGTCKLDKSKIVASVSNFSVVSINEDQIAANLVRNGPLAVALNAAYMQTYMGGVSCPY  293

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICS KRLNHGVLLVGYG  GFS  R   KPYWIIKNSWG+ WGE G++++C+G  +CGI 
Sbjct  294   ICS-KRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGID  352

Query  1161  NMVSAV  1178
             +MVS V
Sbjct  353   SMVSTV  358



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 251/366 (69%), Gaps = 18/366 (5%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKE  275
             +++  L +     ++F    S  L IRQV +   P         ++E  F  F ++ GK 
Sbjct  7     LFSVSLVLFVLVSVSFCEDDSDDLLIRQVVNVTEPRV------LSSEDHFALFKRKFGKV  60

Query  276   YATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV----LKV  443
             Y + EE+ +RL +F +NL+RA  HQ +DP A HGVT+FSDLTP+EF +M++GV     K+
Sbjct  61    YGSVEEHYHRLSIFRRNLLRAMHHQRMDPFASHGVTQFSDLTPSEFRRMHLGVKGLGFKI  120

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P   +      +AP L    LP+ FDWRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+
Sbjct  121   PKDVN------QAPILPTQNLPKEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFL  174

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKL++LSEQQL+DCDH CD +   +CD GC+GGLM  A+EY +++GG+  E  YPYTG
Sbjct  175   ATGKLVSLSEQQLLDCDHECDPEQAGSCDSGCNGGLMNTAFEYTLKTGGLMREEDYPYTG  234

Query  804   -KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
               GG C  +   +   V NF+ +  +EDQ+AA LV +GPLAV INA YM TY+GGVSCP 
Sbjct  235   TDGGTCNLDKSNIVASVSNFSLVSINEDQIAANLVQNGPLAVAINAGYMQTYIGGVSCPY  294

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICS +RLNHGVLLVGYG  GF+  RL  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ 
Sbjct  295   ICS-RRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCRGRNICGVD  353

Query  1161  NMVSAV  1178
             ++VS V
Sbjct  354   SLVSTV  359



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 245/347 (71%), Gaps = 16/347 (5%)
 Frame = +3

Query  144   ASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             +S+    L IRQV  +      ++LL  + E  F +F     K YAT EE+ YR  +F  
Sbjct  26    SSNELDDLLIRQVVSNS-----DDLL--SAEHHFAAFKARFRKTYATAEEHDYRFSIFKA  78

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDV  497
             NL RA  +Q+LDP+AVHGVTRFSDLTP EF + Y+G+  L+ P          +AP L  
Sbjct  79    NLRRAKRNQLLDPSAVHGVTRFSDLTPAEFRQNYLGLKPLRFPIDTQ------QAPILPT  132

Query  498   SGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH  677
             + LP  FDWRD GAVT VK QG CGSCW+FSTTGA+EGA+F+ATG L++LSEQQLVDCDH
Sbjct  133   NDLPTDFDWRDHGAVTAVKDQGECGSCWSFSTTGALEGAHFLATGNLVSLSEQQLVDCDH  192

Query  678   TCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGN  857
              CD ++  ACD GC+GGLM  A+EY++++GG+     YPYTG  G C+F+  K+A  V N
Sbjct  193   ECDPEEYGACDRGCNGGLMNTAFEYILKAGGVVRGEDYPYTGTDGHCKFDKTKIAASVSN  252

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAVGINA++M +Y GGVSCP ICS   LNHGVLLVGYG  
Sbjct  253   FSTVSIDEDQIAANLVKNGPLAVGINAIFMQSYAGGVSCPFICSTS-LNHGVLLVGYGSA  311

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G+S +R   KPYW++KNSWG++WGE GY+++CRGH +CG+ +MVS V
Sbjct  312   GYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVDSMVSTV  358



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 245/340 (72%), Gaps = 17/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D+  P         ++E  F  F ++ GK Y + EE+ YR  VF  NL+RA  HQ
Sbjct  30    IRQVVDETEPKV------LSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              +DP+A HGVT+FSDLT +EF + ++GV    K+P  A+      +AP L    LPE FD
Sbjct  84    KMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKDAN------QAPILPTQNLPEEFD  137

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATGKL++LSEQQLVDCDH CD +++ 
Sbjct  138   WRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEG  197

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPAD  878
             +CD GC+GGLM +A+EY +++GG+  E  YPYTG  GG C+ +  K+   V NF+ +  +
Sbjct  198   SCDSGCNGGLMNSAFEYTLKTGGLMREKDYPYTGTDGGSCKLDRSKIVASVSNFSVVSIN  257

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA L+ +GPLAV INA YM TY+GGVSCP ICS +RLNHGVLLVGYG  GFS  RL
Sbjct  258   EDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPYICS-RRLNHGVLLVGYGSAGFSQARL  316

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  317   KEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTV  356



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 248/340 (73%), Gaps = 18/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D+      ++L    +  F  F +  GK YA+ EE+ YR  VF  NL RA  HQ
Sbjct  36    IRQVVGDD----DHHMLNA--DHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMSHQ  89

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              LDP+AVHGVT+FSDLTP+EF + ++GV   L+ P  A+      +AP L    LP  FD
Sbjct  90    KLDPSAVHGVTQFSDLTPDEFSQKFLGVNRRLRFPSDAN------KAPILPTEDLPSDFD  143

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WR+ GAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++K 
Sbjct  144   WREHGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEKG  203

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPAD  878
             +CD GCSGGLM +A+EY +++GG+  E  YPYTG     C+F++ KVA KV NF+ +  D
Sbjct  204   SCDSGCSGGLMNSAFEYTLKAGGLMREEDYPYTGTDKATCKFDNTKVAAKVANFSVVSLD  263

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICSK+ L+HGVLLVGYG  GFS +R+
Sbjct  264   EEQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICSKQ-LDHGVLLVGYG-TGFSPIRM  321

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS V
Sbjct  322   KEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTV  361



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 245/339 (72%), Gaps = 17/339 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV DD     G   LG   E  F  F    GK Y+T +E+ YR  VF  N+ RA  HQ
Sbjct  31    IRQVVDD-----GGVRLGA--EHHFIEFKHRFGKVYSTKDEHDYRFNVFKANMRRAKRHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
             ++DP+AVHGVTRFSDLTP EF    +G+  L++P  A+       AP L    LP  FDW
Sbjct  84    LMDPSAVHGVTRFSDLTPREFRNSVLGLRGLRLPSDANT------APILPTDNLPADFDW  137

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD+GAVT VK QGSCGSCW+FSTTGA+EGA+F++TG+L++LSEQQLVDCDH CD  +  +
Sbjct  138   RDRGAVTSVKNQGSCGSCWSFSTTGALEGAHFLSTGELVSLSEQQLVDCDHECDPDEPGS  197

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY+++SGG+  E  YPY+G   G C+F+ EK+A  V NF+ +  DE
Sbjct  198   CDSGCNGGLMNSAFEYILKSGGVMREEDYPYSGTDRGTCKFDKEKIAASVANFSVVSLDE  257

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             +Q+AA LV +GPLAV INAVYM TY+GGVSCP ICS +RL+HGVLLVGYG   ++ +R+ 
Sbjct  258   NQIAANLVKNGPLAVAINAVYMQTYVGGVSCPYICS-RRLDHGVLLVGYGSGAYAPIRMK  316

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGE G++++CRG  +CG+ +MVS V
Sbjct  317   EKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTV  355



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 245/337 (73%), Gaps = 13/337 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  ++      +LL    E  F  F  ++ K YAT EE+ YR  +F  NL R+  HQ
Sbjct  38    IRQVVPED------HLL--HAEHHFSLFKSKYSKSYATQEEHDYRFRIFKANLRRSRRHQ  89

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+AVHGVT+FSDLTP EF + ++G+ +   R  L     +A  L  + LP  FDWRD
Sbjct  90    VLDPSAVHGVTKFSDLTPKEFRRQFLGLKR---RLRLPADAQQAQILPTNDLPTEFDWRD  146

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAV  VK QGSCGSCW+FS TGA+EGA+F++TG L++LSEQQLVDCDH CD +++ +CD
Sbjct  147   HGAVAPVKDQGSCGSCWSFSATGALEGAHFLSTGNLVSLSEQQLVDCDHECDPEERGSCD  206

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLM NA+EY +++GG+ +E  YPYTG+ G  C+F+  K+A +V NF+ + +DEDQ
Sbjct  207   SGCNGGLMNNAFEYALKAGGLMKEEDYPYTGRDGKVCKFDKSKIAARVANFSVVSSDEDQ  266

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPLA+ INA++M TY+GGVSCP ICS KR +HGVLLVGYG  G+S +RL  K
Sbjct  267   IAANLVKHGPLAIAINAMWMQTYIGGVSCPYICS-KRQDHGVLLVGYGSAGYSPIRLKEK  325

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG +WGEEGY+++C G  +CG+  MVS+V
Sbjct  326   PYWIIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSV  362



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 244/344 (71%), Gaps = 17/344 (5%)
 Frame = +3

Query  156   SQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIR  335
             S+ L I QV  D     G++LL    E +F  F  + GK YAT EE+ +R  VF  NL R
Sbjct  34    SEDLLIHQVVSD-----GDDLLNA--EYQFAEFKTKFGKTYATAEEHDHRFNVFKANLRR  86

Query  336   AAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLP  509
             A  HQ+LDP+A HGVT+FSDLTP EF + Y+G+  L++P  A       +AP L    LP
Sbjct  87    AKRHQLLDPSAEHGVTQFSDLTPREFRQNYLGLKRLQLPADAQ------KAPILPTKDLP  140

Query  510   ETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDI  689
               FDWRD GAVT VK QG CGSCW+FST GA+EGA+F+ATG L++LS QQL+DCD  CD 
Sbjct  141   TDFDWRDHGAVTAVKDQGYCGSCWSFSTIGALEGAHFLATGNLVSLSTQQLLDCDTECDP  200

Query  690   KDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTN  866
             ++  ACDDGC+GGLM NA+EY++++GG+ +E  YPYTG   G CRF   K+A  V NF+ 
Sbjct  201   EEYDACDDGCNGGLMNNAFEYILKAGGVAQEEDYPYTGTDRGLCRFNKTKIAASVANFSV  260

Query  867   LPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFS  1046
             +  DEDQ+AA LV +GPLAVGINAV+M TY  GVSCP ICS   L+HGVLLVGYG  G+S
Sbjct  261   VSLDEDQIAANLVKNGPLAVGINAVFMQTYKSGVSCPYICSST-LDHGVLLVGYGSAGYS  319

Query  1047  ILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              +R   KPYWIIKNSWG+ WGE+GY+++CRGH +CG+ +MVS V
Sbjct  320   PIRFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTV  363



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 248/347 (71%), Gaps = 18/347 (5%)
 Frame = +3

Query  147   SSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKN  326
             SS  + L I+Q+ D + P + ++         F+ F +  GK YAT E++ YR  VF  N
Sbjct  26    SSDGEDLVIQQIVDGDHPLSADH--------HFRLFKRRFGKSYATQEDHDYRFSVFKTN  77

Query  327   LIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVS  500
             L RA  HQ LDP+AVHGVT+FSDLTP EF + ++G+  L+ P  A+      +AP L   
Sbjct  78    LRRARHHQRLDPSAVHGVTQFSDLTPAEFRRNHLGLKRLRFPADAN------KAPILPTE  131

Query  501   GLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHT  680
              LP  FDWRD GAV  VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH 
Sbjct  132   DLPADFDWRDHGAVASVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHE  191

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGN  857
             CD ++  +CD GC+GGLM +A EY +++GG+  E  YPY+G   G C+F+  K+A  V N
Sbjct  192   CDPEEPGSCDSGCNGGLMNSALEYTLKAGGLMREEDYPYSGTDRGTCKFDETKIAASVAN  251

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DE+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  
Sbjct  252   FSVVSLDENQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICS-KRLDHGVLLVGYGSA  310

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             G++ +R+  KPYWIIKNSWG+ WGE G++++C+G  +CG+ +MVS V
Sbjct  311   GYAPIRMKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVDSMVSTV  357



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   395 bits (1015),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 237/318 (75%), Gaps = 8/318 (3%)
 Frame = +3

Query  243   FKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKM  422
             F SF+Q  GK Y   EE+ +RL VF  NL RA  HQ+LDP+A HG+T+FSDLTP EF + 
Sbjct  53    FTSFVQRFGKTYKDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGITKFSDLTPAEFRRT  112

Query  423   YMGVLKVPGRASL--LGGKA-EAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
             ++G LK   R+ L  +GG A +AP L   GLP+ FDWRD GAV  VK QGSCGSCW+FS 
Sbjct  113   FLG-LKTSRRSFLREIGGSAHDAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSA  171

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             +GA+EGAN++ATGK+  LSEQQ VDCDH CD ++  +CD GC+GGLMT+A+ YL++SGG+
Sbjct  172   SGALEGANYLATGKMEVLSEQQFVDCDHECDPEEPDSCDAGCNGGLMTSAFSYLLKSGGL  231

Query  774   EEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHT  953
             E E  YPYTG+ G C+F+  K+   V NF+ +  DE+Q+AA LV HGPLA+GINA YM T
Sbjct  232   EREKDYPYTGRDGTCKFDKSKIVASVQNFSVVSVDEEQIAANLVKHGPLAIGINAAYMQT  291

Query  954   YMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMC  1133
             Y+GGVSCP IC +  L+HGVLLVGYG  GF+  RL  KPYW+IKNSWG++WGE+GY+++C
Sbjct  292   YIGGVSCPYICGRS-LDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKIC  350

Query  1134  RGHGM---CGISNMVSAV  1178
             RG  +   CG+ +MVS V
Sbjct  351   RGSNVRNKCGVDSMVSTV  368



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   394 bits (1013),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 247/340 (73%), Gaps = 18/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  DE      ++L    E  F  F +  GK YA+ EE+ YR  VF  NL RA  HQ
Sbjct  36    IRQVVGDE----DHHMLNA--EHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMRHQ  89

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              LDP+AVHGVT+FSD+TP+EF + ++GV   L+ P  A+      +AP L    LP  FD
Sbjct  90    KLDPSAVHGVTQFSDMTPDEFSQKFLGVNRRLRFPSDAN------KAPILPTEDLPSDFD  143

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WR+ GAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++K 
Sbjct  144   WREHGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEKD  203

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPAD  878
             +CD GCSGGLM +A+EY +++GG+  E  YPYTG     C+F++ KVA KV NF+ +  D
Sbjct  204   SCDSGCSGGLMNSAFEYTLKAGGLMREEDYPYTGTDKATCKFDNTKVAAKVANFSVVSLD  263

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICSK+ L+HGVLLVGYG  GFS +R+
Sbjct  264   EEQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICSKQ-LDHGVLLVGYG-TGFSPIRM  321

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE GY+++ RG  +CG+ +MVS V
Sbjct  322   KEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTV  361



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   394 bits (1013),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 190/342 (56%), Positives = 244/342 (71%), Gaps = 17/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV D   P          +E  F  F ++ GK Y ++EE+ YRL VF  NL RA  
Sbjct  30    LVIRQVVDGSEPKI------LTSEDHFSLFKKKFGKVYVSNEEHDYRLSVFKANLRRAKR  83

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A+HGVT+FSDLT +EF KM++GV    K+P  A+      +AP L V  LPE 
Sbjct  84    HQKLDPSAIHGVTQFSDLTRSEFRKMHLGVRSGFKLPKDAN------KAPILPVENLPED  137

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWRD GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++
Sbjct  138   FDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  197

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  198   AGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDGPVCKLDKSKIVASVSNFSVIS  257

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q++A LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  
Sbjct  258   IDEEQISANLVKNGPLAVAINAAYMQTYIGGVSCPYICA-RRLNHGVLLVGYGSAGYAPA  316

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  317   RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTV  358



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 247/341 (72%), Gaps = 15/341 (4%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV    +P A ++ L  A E  F +F  +  K YAT EE+ +R  +F  NL+RA  
Sbjct  30    LLIRQV----VPDAEDHHLLNA-EHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKS  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ LDP+AVHGVTRFSDLTP+EF   ++G+  L++P  A       +AP L  S LP  F
Sbjct  85    HQKLDPSAVHGVTRFSDLTPSEFRGQFLGLKPLRLPSDAQ------KAPILPTSDLPTDF  138

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FS  GA+EGA+F++TG L++LSEQQLVDCDH CD +++
Sbjct  139   DWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGGLVSLSEQQLVDCDHECDPEER  198

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              ACD GC+GGLMT A+EY +++GG+  E  YPYTG+  G C+F+  K+A  V NF+ +  
Sbjct  199   GACDSGCNGGLMTTAFEYTLKAGGLMREEDYPYTGRDRGPCKFDKSKIAASVANFSVVSL  258

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE+Q+AA LV +GPLAVGINAV+M TY+GGVSCP IC  K L+HGVLLVGYG   ++ +R
Sbjct  259   DEEQIAANLVKNGPLAVGINAVFMQTYIGGVSCPYICG-KHLDHGVLLVGYGSGAYAPIR  317

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KPYWIIKNSWG+ WGEEGY+++CRG  +CG+ +MVS V
Sbjct  318   FKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTV  358



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   395 bits (1014),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 248/360 (69%), Gaps = 8/360 (2%)
 Frame = +3

Query  114   AVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENL-LGTATEVRFKSFMQEHGKEYATHE  290
             A L  A    AS+A++   I QV  D   AA + L +    E  F SF++  GK Y    
Sbjct  23    AALCSAEPDDASAAAEDPLIEQVVGDG--AADDELEMELNAEAHFASFVRRFGKSYRDDG  80

Query  291   EYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGG  470
             E  +R+ VF  NL RA  HQ LDPTAVHGVT+FSDLTP+EF + ++G+ +   R  L G 
Sbjct  81    ERAHRMSVFKANLRRARRHQRLDPTAVHGVTQFSDLTPDEFRRQFLGLRRSSARDLLKGS  140

Query  471   KA-EAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNL  647
              A +AP L   GLP  FDWR+ GAV  VK QGSCGSCW+FS +GA+EGA+++ATGKL  L
Sbjct  141   SAHQAPILPTDGLPTDFDWREHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVL  200

Query  648   SEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFE  827
             SEQQ+VDCDH CD  +  +CD GC+GGLMT A+ YL +SGG+E E  YPY G GG C+F+
Sbjct  201   SEQQMVDCDHECDPSEPRSCDAGCNGGLMTTAFSYLQKSGGLESEKDYPYAGTGGTCKFD  260

Query  828   SEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNH  1007
               K+  +V NF+ +  DEDQ+AA LV HGPLA+GINA++M TY+GGVSCP IC  + L+H
Sbjct  261   KSKIVAQVKNFSVVSVDEDQIAANLVKHGPLAIGINAIFMQTYIGGVSCPYICG-RHLDH  319

Query  1008  GVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG---HGMCGISNMVSAV  1178
             GVLLVGYG  G++ +R   KPYWIIKNSWG++WGE GY+++CRG      CG+ +MVS V
Sbjct  320   GVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTV  379



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 247/341 (72%), Gaps = 15/341 (4%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV    +P A ++ L  A E  F +F  + GK YAT EE+ +R  +F  NL+RA  
Sbjct  30    LLIRQV----VPDAEDHHLLNA-EHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKS  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ LDP+AVHGVTRFSDL P EF + ++G+  L++P  A       +AP L  + LP  F
Sbjct  85    HQKLDPSAVHGVTRFSDLNPAEFRRQFLGLKPLRLPSDAQ------KAPILPTNDLPTDF  138

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWR+ GAVT VK QGSCGSCW+FS  GA+EGA+F++TG+L++LSEQQLVDCDH CD +++
Sbjct  139   DWREHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGELVSLSEQQLVDCDHECDPEER  198

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              ACD GC+GGLMT A+EY +++GG+  E  YPYTG+  G C+F+  KVA  V NF+ +  
Sbjct  199   GACDSGCNGGLMTTAFEYTLQAGGLMREKDYPYTGRDRGPCKFDKSKVAASVANFSVVSL  258

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE+Q+AA LV +GPLAVGINAV+M TY+GGVSCP IC  K L+HGVLLVGYG   ++ +R
Sbjct  259   DEEQIAANLVQNGPLAVGINAVFMQTYIGGVSCPYICG-KHLDHGVLLVGYGSGAYAPIR  317

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KPYWIIKNSWG+ WGEEGY+ +CRG  +CG+ +MVS V
Sbjct  318   FKEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTV  358



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 240/348 (69%), Gaps = 23/348 (7%)
 Frame = +3

Query  156   SQGLNIRQV---TDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKN  326
             S  L IRQV    DD + A          E  F+ F     K YAT EE+ YR  VF  N
Sbjct  30    SDNLMIRQVESHVDDFLNA----------ERHFEKFKARFQKTYATPEEHDYRFNVFKAN  79

Query  327   LIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVS  500
             L RA  HQ+LDP+AVHGVT+FSDLTP EF + Y+G+  L+ P  A       +AP L   
Sbjct  80    LRRAKRHQLLDPSAVHGVTQFSDLTPAEFRRDYLGLNPLRFPADAQ------QAPILPTD  133

Query  501   GLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHT  680
              LP  FDWR+ GAVT VK QG+CGSCW+FST GA+EGA+F+ATG L +LSEQQLVDCD  
Sbjct  134   NLPTDFDWRENGAVTPVKNQGNCGSCWSFSTIGALEGAHFLATGNLESLSEQQLVDCDRE  193

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGN  857
             CD ++  ACDDGC+GGLM NA+EY++++GG+E E  YPYTG+    C+F   K+   V N
Sbjct  194   CDPEEYDACDDGCNGGLMNNAFEYILKTGGVEREKDYPYTGRDRSPCKFNESKIVASVSN  253

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAVGINAV+M TY  GVSCP +CS + L+HGVLLVGYG  
Sbjct  254   FSVVSIDEDQIAANLVKNGPLAVGINAVFMQTYTAGVSCPFLCSGE-LDHGVLLVGYGSA  312

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             G+S +R   KPYWI+KNSW K WGE GY+R+CRG  MCG+ +MVS+V+
Sbjct  313   GYSPIRFKEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVV  360



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 247/341 (72%), Gaps = 17/341 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  +E     E LL    E  F  F  ++ K YAT  E+ +R  VF  NL RA  HQ
Sbjct  32    IRQVVPEE---NDEQLLNA--EHHFSLFKSKYQKTYATQAEHDHRFRVFKANLRRARRHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
             +LDP+AVHGVT+FSDLTP EF + Y+G+   L++P  A       +AP L  S LP  FD
Sbjct  87    LLDPSAVHGVTQFSDLTPKEFRRKYLGLKRKLRLPNDAQ------KAPILPTSDLPTDFD  140

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRDKGAVT VK QGSCGSCW+FS TGA+EGA+F+AT +L++LSEQQLVDCDH CD ++ +
Sbjct  141   WRDKGAVTPVKNQGSCGSCWSFSATGALEGAHFLATKELVSLSEQQLVDCDHECDPEEAN  200

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLPAD  878
             +CD GC GGLM NA+EY +++GG+ +E+ YPYTG     C+F+   +A +V NF+ + AD
Sbjct  201   SCDSGCGGGLMNNAFEYTLKAGGLMKESDYPYTGHDNSGCKFDKSMIAARVSNFSVVSAD  260

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV+HGPLA+ INA++M TY+GGVSCP ICSK + +HGVLLVG+G  G++ +RL
Sbjct  261   EDQIAANLVHHGPLAIAINAMWMQTYIGGVSCPYICSKSQ-DHGVLLVGFGSSGYAPIRL  319

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSAV  1178
               KPYWIIKNSWG  WGE+GY+++CRG H +CG+  MVS V
Sbjct  320   KEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTV  360



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 245/347 (71%), Gaps = 18/347 (5%)
 Frame = +3

Query  150   SASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             S+S G++  I QV DDE         G   E  F  F +  GK YAT EE+ YR  VF  
Sbjct  21    SSSDGVDPMICQVVDDE---------GLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKS  71

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSG  503
             N+ RA  HQ+LDP+AVHGVTRFSDLTP EF    +G+  V     L      AP L    
Sbjct  72    NMHRARRHQLLDPSAVHGVTRFSDLTPMEFRHSVLGLRGV----GLPSDADSAPILPTDN  127

Query  504   LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH-T  680
             LP+ FDWR+ GAVT VK QGSCGSCW+FS TGA+EGA+F++TGKL++LSEQQLVDCDH  
Sbjct  128   LPKDFDWREHGAVTPVKNQGSCGSCWSFSATGALEGAHFLSTGKLVSLSEQQLVDCDHEQ  187

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK-GGDCRFESEKVAVKVGN  857
             CD ++  +CD GC GGLM +A+EY++ +GG+  E  YPY+G  GG C+F+  K+A  V N
Sbjct  188   CDPEEAGSCDSGCKGGLMNSAFEYILNNGGVMREEDYPYSGTAGGTCKFDQTKIAASVAN  247

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP +CSKK LNHGVLLVGYG +
Sbjct  248   FSVVSRDEDQIAANLVKNGPLAVAINAVYMQTYVGGVSCPYVCSKK-LNHGVLLVGYGSE  306

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              ++ +R+  KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  307   SYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTV  353



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 233/313 (74%), Gaps = 5/313 (2%)
 Frame = +3

Query  243   FKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKM  422
             F  F +  G+ Y + EE+ YR GVF  NL RA  HQ LDP+A HGVT+FSDLTP+EF + 
Sbjct  60    FSLFKRRFGRSYGSQEEHDYRFGVFRANLRRARRHQKLDPSAAHGVTQFSDLTPSEFRRT  119

Query  423   YMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGA  602
             ++G+ +   +  L     EAP L    LP+ FDWRD GAVT VK QGSCGSCW+FSTTGA
Sbjct  120   HLGLRR---KVKLPKDANEAPILPTQDLPKDFDWRDHGAVTAVKNQGSCGSCWSFSTTGA  176

Query  603   IEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEE  782
             +EGAN++ATGKL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E
Sbjct  177   LEGANYLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMRE  236

Query  783   ASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYM  959
               YPYTG     C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLA+ INAV+M TY+
Sbjct  237   EDYPYTGTDRSSCKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAIAINAVFMQTYV  296

Query  960   GGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG  1139
             GGVSCP ICS KRL+HGVLLVGYG   +S +R+  KPYWIIKNSWG++WGE G++++CRG
Sbjct  297   GGVSCPYICS-KRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICRG  355

Query  1140  HGMCGISNMVSAV  1178
               +CG+ +MVS V
Sbjct  356   RNICGVDSMVSTV  368



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 251/362 (69%), Gaps = 19/362 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSAS-QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYAT  284
             L  +L   +L FA+      + IRQV  D     G +LL    +  F  F +  GK YA+
Sbjct  10    LCTLLATTYLVFAAEDDGDDILIRQVVGD-----GGDLLNA--DHHFTVFKRRFGKVYAS  62

Query  285   HEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRA  455
              EE+ YRL  F  N+ RA +HQ LDP AVHGVT+FSDLTP EF + ++G+   LK P  A
Sbjct  63    DEEHDYRLSEFKANMRRAKQHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNRRLKFPADA  122

Query  456   SLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGK  635
                     AP L    LP  FDWRD GAVT VK QG+CGSC +FSTTGA+EGANF+ATGK
Sbjct  123   K------TAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCCSFSTTGALEGANFLATGK  176

Query  636   LLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD  815
             L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  +PYTG    
Sbjct  177   LVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKAGGLMREEDHPYTGNDLQ  236

Query  816   -CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSK  992
              CRF+  K+A KV NF+ +  DEDQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS 
Sbjct  237   VCRFDKTKIAAKVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-  295

Query  993   KRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVS  1172
             KRL+HGVLLVGYG  G++ +R+  KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +MVS
Sbjct  296   KRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVS  355

Query  1173  AV  1178
              V
Sbjct  356   TV  357



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 244/340 (72%), Gaps = 17/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D+  P         ++E  F  F ++ GK Y + EE+ YR  VF  NL+RA  HQ
Sbjct  30    IRQVVDETEPKV------LSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQ  83

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              +DP+A HGVT+FSDLT +EF + ++GV    K+P  A+      +AP L    LPE FD
Sbjct  84    KMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKDAN------QAPILPTQNLPEEFD  137

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATGKL++LSEQQLVDCDH CD +++ 
Sbjct  138   WRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEG  197

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPAD  878
             +CD GC+G LM +A+EY +++GG+  E  YPYTG  GG C+ +  K+   V NF+ +  +
Sbjct  198   SCDSGCNGRLMNSAFEYTLKTGGLMREKDYPYTGTDGGSCKLDRSKIVASVSNFSVVSIN  257

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA L+ +GPLAV INA YM TY+GGVSCP ICS +RLNHGVLLVGYG  GFS  RL
Sbjct  258   EDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPYICS-RRLNHGVLLVGYGSAGFSQARL  316

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  317   KEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTV  356



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 253/366 (69%), Gaps = 23/366 (6%)
 Frame = +3

Query  93    LMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGK  272
             L++A  ++V      +F  +  + + IRQV +   P         ++E  F  F +  GK
Sbjct  12    LLFAFFVSV------SFCENNGEDILIRQVVNGSEPKV------LSSEDHFSLFKRRFGK  59

Query  273   EYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKV  443
              Y + EE+ +R  VF  NL RA  HQ +DP+A HGVT+FSDLTP+EF +M++GV    K+
Sbjct  60    VYGSLEEHRHRFAVFRSNLQRAMRHQKMDPSARHGVTQFSDLTPSEFRRMHLGVRGGFKL  119

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
             P  A+      +AP L    LP  FDWRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+
Sbjct  120   PKDAN------QAPILPTKDLPVDFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFL  173

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             +TG+L++LSEQQLVDCDH CD + + +CD GC+GGLM +A+EY +++GG+  E  YPYTG
Sbjct  174   STGQLVSLSEQQLVDCDHECDPEQEGSCDSGCNGGLMNSAFEYTLKTGGLMREDDYPYTG  233

Query  804   -KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPL  980
               GG C+ +  K+   V NF+ +  +EDQ+AA LV +GPLAV +NA YM TYMGGVSCP 
Sbjct  234   TDGGTCKLDKSKIVASVSNFSVVSINEDQIAANLVRNGPLAVALNAAYMQTYMGGVSCPY  293

Query  981   ICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGIS  1160
             ICS KRLNHGVLLVGYG  GFS  R   KPYWIIKNSWG+ WGE G++++C+G  +CGI 
Sbjct  294   ICS-KRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGID  352

Query  1161  NMVSAV  1178
             +MVS V
Sbjct  353   SMVSTV  358



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 246/341 (72%), Gaps = 15/341 (4%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV    +P A ++ L  A E  F +F  +  K YAT EE+ +R  +F  NL+RA  
Sbjct  30    LLIRQV----VPDAEDHHLLNA-EHHFSAFKTKFAKTYATQEEHDHRFRIFKNNLLRAKS  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ LDP+AVHGVTRFSDLTP EF   ++G+  L++P  A       +AP L  S LP  F
Sbjct  85    HQKLDPSAVHGVTRFSDLTPAEFRGQFLGLKPLRLPSDAQ------KAPILPTSDLPTDF  138

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FS  GA+EGA+F++TG L++LSEQQLVDCDH CD +++
Sbjct  139   DWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGGLVSLSEQQLVDCDHECDPEER  198

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              ACD GC+GGLMT A+EY +++GG+  E  YPYTG+  G C+F+  K+A  V NF+ +  
Sbjct  199   GACDSGCNGGLMTTAFEYTLKAGGLMREEDYPYTGRDRGPCKFDKSKIAASVANFSVVSL  258

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE+Q+AA LV +GPLAVGINAV+M TY+GGVSCP IC  K L+HGVLLVGYG   ++ +R
Sbjct  259   DEEQIAANLVKNGPLAVGINAVFMQTYIGGVSCPYICG-KHLDHGVLLVGYGSGAYAPIR  317

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KPYWIIKNSWG+ WGEEGY+++CRG  +CG+ +MVS V
Sbjct  318   FKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTV  358



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/337 (57%), Positives = 243/337 (72%), Gaps = 11/337 (3%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  +     GE+ L  A E  F +F  + GK YAT EE+ YR  VF  NL+RA +HQ
Sbjct  33    IRQVVSE-----GEDHLLNA-EHHFTTFKSKFGKNYATQEEHDYRFSVFKANLLRAKKHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             I+DPTA HGVT+FSDLTP EF +  +G+ +     +      +AP L    LP  FDWRD
Sbjct  87    IMDPTAAHGVTKFSDLTPKEFRRQLLGLKRRLRLPT---DANKAPILPTGDLPTDFDWRD  143

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCGSCW+FS TGA+EGA+++ATG+L++LSEQQLVDCDH CD ++  ACD
Sbjct  144   HGAVTSVKDQGSCGSCWSFSATGALEGAHYLATGELVSLSEQQLVDCDHECDPEEYGACD  203

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GCSGGLM NA+EY +++GG+E E  YPYTG   G C+FE  KVA  V NF+ +  DEDQ
Sbjct  204   SGCSGGLMNNAFEYALKAGGLEREKDYPYTGNDRGACKFEKSKVAASVSNFSVVSLDEDQ  263

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV HGPL+V INAV+M TY+GGVSCP ICSK + +HGVLLVGYG  G++ +R   K
Sbjct  264   IAANLVKHGPLSVAINAVFMQTYIGGVSCPYICSKHQ-DHGVLLVGYGAAGYAPIRFKEK  322

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             P+WIIKNSWG++WGE GY+++CR   +CG+ +MVS V
Sbjct  323   PFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTV  359



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 247/341 (72%), Gaps = 17/341 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  +E     E LL    E  F  F  ++ K YAT  E+ +R  VF  NL RA  HQ
Sbjct  32    IRQVVPEE---NDEQLLNA--EHHFSLFKSKYDKTYATQAEHDHRFRVFKANLRRARRHQ  86

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
             +LDP+AVHGVT+FSDLTP EF + Y+G+   L++P  A       +AP L  S LP  FD
Sbjct  87    LLDPSAVHGVTQFSDLTPKEFRRKYLGLKRKLRLPSDAQ------KAPILPTSDLPTDFD  140

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD+GAVT VK QGSCGSCW+FS TGA+EGA+F+AT +L++LSEQQLVDCDH CD ++ +
Sbjct  141   WRDQGAVTRVKNQGSCGSCWSFSATGALEGAHFLATKELVSLSEQQLVDCDHECDPEEAN  200

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLPAD  878
             +CD GC GGLM NA+EY +++GG+ +E+ YPYTG     C+F+   +A +V NF+ + AD
Sbjct  201   SCDSGCGGGLMNNAFEYTLKAGGLMKESDYPYTGHDNSGCKFDKSMIAARVSNFSVVSAD  260

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV+HGPLA+ INA++M TY+GGVSCP ICSK + +HGVLLVG+G  G++ +RL
Sbjct  261   EDQIAANLVHHGPLAIAINAMWMQTYIGGVSCPYICSKSQ-DHGVLLVGFGSSGYAPIRL  319

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSAV  1178
               KPYWIIKNSWG  WGE+GY+++CRG H +CG+  MVS V
Sbjct  320   KEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTV  360



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 246/344 (72%), Gaps = 17/344 (5%)
 Frame = +3

Query  159   QGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRA  338
             + L IRQV D+  P         ++E  F  F ++ GK+Y + EE+ YR  VF  NL RA
Sbjct  25    EDLLIRQVVDEAEPKV------LSSEDHFTLFKKKFGKDYGSIEEHYYRFSVFKANLRRA  78

Query  339   AEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLP  509
               HQ +DP+A HGVT+FSDLT +EF + ++GV    K+P  A+      +AP L    LP
Sbjct  79    MRHQKMDPSARHGVTQFSDLTGSEFRRKHLGVTGGFKLPKDAN------QAPILPTHNLP  132

Query  510   ETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDI  689
             E FDWRD+GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATGKL++LSEQQLVDCDH CD 
Sbjct  133   EEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDP  192

Query  690   KDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTN  866
             ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTG  GG C+ +  K+   V NF+ 
Sbjct  193   EEAGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGTDGGSCKLDRSKIVASVSNFSV  252

Query  867   LPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFS  1046
             +  +EDQ+AA LV +GPLAV INA YM TY+GGVSCP ICS +RLNHGVLL+GYG  G+S
Sbjct  253   VSINEDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYICS-RRLNHGVLLMGYGSSGYS  311

Query  1047  ILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               RL  KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  312   QARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTV  355



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 238/337 (71%), Gaps = 15/337 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D E         G   E  F  F +  GK Y + EE+ YR  VF  N+ RA  HQ
Sbjct  30    IRQVVDGE---------GLGAEHHFLEFKRRFGKVYVSEEEHGYRFNVFKSNMHRARRHQ  80

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
             +LDP+AVHGVTRFSDLTP EF    +G+  V     L      AP L    LP+ FDWR+
Sbjct  81    LLDPSAVHGVTRFSDLTPMEFRHSVLGLRGV----GLPSDADSAPILRTDNLPKDFDWRE  136

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QGSCG+CW+FS TGA+EGA+F++TGKL++LSEQQLVDCDH CD ++  +CD
Sbjct  137   HGAVTPVKNQGSCGACWSFSATGALEGAHFLSTGKLVSLSEQQLVDCDHECDPEEAGSCD  196

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGK-GGDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC GGLM +A+EY++ +GG+  E  YPY+G  GG C+F+  K+A  V NF+ +  DEDQ
Sbjct  197   SGCKGGLMNSAFEYILNNGGVMREEDYPYSGTAGGTCKFDQTKIAASVANFSVVSRDEDQ  256

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV +GPLAV INAVYM TY+GGVSCP +CSKK LNHGVLLVGYG + ++ +R+  K
Sbjct  257   IAANLVKNGPLAVAINAVYMQTYVGGVSCPYVCSKK-LNHGVLLVGYGSESYAPIRMKQK  315

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             PYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  316   PYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTV  352



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   391 bits (1004),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 247/338 (73%), Gaps = 10/338 (3%)
 Frame = +3

Query  171   IRQVTD--DEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             IRQV D  +EI     +LL  A    F  F  ++GK YAT EE+  R  VF  NL RA +
Sbjct  4     IRQVVDGVEEI-----DLLLNADH-HFSLFKSKYGKSYATQEEHDRRFSVFKANLRRAKK  57

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              Q+LDP+AVHG+T+FSDLTP EF+K ++G+     R  L     +AP L  + LPE FDW
Sbjct  58    RQLLDPSAVHGITKFSDLTPAEFKKTFLGLHT--KRVKLPSDANKAPVLPTNDLPENFDW  115

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAVT VK QGSCGSCW FSTTGA+EGA F++TGKL++LSEQQLVDCDH CD ++  +
Sbjct  116   REKGAVTAVKDQGSCGSCWTFSTTGALEGATFLSTGKLVSLSEQQLVDCDHECDPQEADS  175

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADED  884
             CD GC+GGLM  A EY ++ GGIE+E  YPYTG+ G C+F+  KVA  V NF+ +  DE 
Sbjct  176   CDSGCNGGLMNTALEYALKVGGIEKEEDYPYTGQDGVCKFQKNKVASSVSNFSVVSVDEG  235

Query  885   QMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGF  1064
             Q+AA LV HGPLAV INA +M TY+ GVSCPLIC K RL+HG+L+VGYG  G++ +RL  
Sbjct  236   QIAANLVKHGPLAVAINAAWMQTYVHGVSCPLICMKTRLDHGILIVGYGASGYAPIRLKE  295

Query  1065  KPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             KPYWI+KNSWG++WGE+GY+++C+GH +CG+ ++VS V
Sbjct  296   KPYWIVKNSWGENWGEQGYYKICKGHNVCGVESLVSTV  333



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 247/347 (71%), Gaps = 18/347 (5%)
 Frame = +3

Query  150   SASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAK  323
             S+S G++  I QV DDE         G   E  F  F +  GK YAT EE+ YR  VF  
Sbjct  21    SSSDGVDPMICQVVDDE---------GLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKS  71

Query  324   NLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSG  503
             N+ RA  HQ+LDP+AVHGVT+FSDLTP EF+   +G+  V     L      AP L    
Sbjct  72    NMHRARRHQLLDPSAVHGVTQFSDLTPMEFQHSVLGLRGV----GLPSDADSAPILPTDN  127

Query  504   LPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDH-T  680
             LP+ FDWR+ GAVT VK QGSCGSCW+FS TGA+EGA+F++TG+L++LSEQQLVDCDH  
Sbjct  128   LPKDFDWREHGAVTPVKNQGSCGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHQQ  187

Query  681   CDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGN  857
             CD ++  +CD GC+GGLM +A+EY++ +GG+  E  YPY+G  GG C+F+  K+A  V N
Sbjct  188   CDPEEAGSCDSGCNGGLMNSAFEYILNNGGVMREEDYPYSGTNGGTCKFDKAKIAASVAN  247

Query  858   FTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKK  1037
             F+ +  DEDQ+AA LV +GPLAV INAVYM TY+GGVSCP +CSKK LNHGVLLVGYG +
Sbjct  248   FSVVSRDEDQIAANLVKNGPLAVAINAVYMQTYVGGVSCPYVCSKK-LNHGVLLVGYGSE  306

Query  1038  GFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              ++ +R+  KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  307   SYAPIRMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTV  353



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   392 bits (1007),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 247/359 (69%), Gaps = 18/359 (5%)
 Frame = +3

Query  132   HLAFASSASQGLN---IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVY  302
             H    SSA++GL    I QV    +    EN L    E  F SF++  GK Y   +E+ +
Sbjct  22    HHPALSSATEGLEDPLIEQV----VGGDAENELELNAEAHFASFVRRFGKSYRDADEHEH  77

Query  303   RLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLL----GG  470
             RL VF  NL RA  HQ LDP+AVHG+T+FSDLTP+EF + ++G+ K   R S L    G 
Sbjct  78    RLSVFRANLRRARRHQRLDPSAVHGITKFSDLTPDEFRERFLGLRK--SRRSFLKGISGS  135

Query  471   KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLS  650
               +AP L   GLP  FDWR+ GAV  VK QGSCGSCW+FST+GA+EGAN++ATGKL  LS
Sbjct  136   AHDAPALPTDGLPTEFDWREHGAVGPVKDQGSCGSCWSFSTSGALEGANYLATGKLEVLS  195

Query  651   EQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFES  830
             EQQLVDCDH CD  +  ACD GC+GGLMT A+ YL ++GG+E E  YPYTG+   C+F+ 
Sbjct  196   EQQLVDCDHECDPSEPRACDAGCNGGLMTTAFSYLAKAGGLETEKDYPYTGRNSACKFDK  255

Query  831   EKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHG  1010
              K+A +V NF+ +  DEDQ+AA LV HGPLA+GINAV+M TY+GGVSCP IC  + L+H 
Sbjct  256   SKIAAQVKNFSTVAIDEDQIAANLVKHGPLAIGINAVFMQTYIGGVSCPYICG-RHLDH-  313

Query  1011  VLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG---HGMCGISNMVSAV  1178
             V LVGYG  G++ LR   KPYWIIKNSWG++WGE GY+++CRG      CG+ +MVS V
Sbjct  314   VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTV  372



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   392 bits (1006),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/353 (54%), Positives = 247/353 (70%), Gaps = 12/353 (3%)
 Frame = +3

Query  138   AFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVF  317
             A A++  +   IRQV     P   +  L    + +F  F+Q  GK Y   EE+ +RL VF
Sbjct  22    ATAAAGDEEPLIRQVVGGADPLDNDLEL----DSQFVGFVQRFGKTYRDAEEHAHRLSVF  77

Query  318   AKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRA---SLLGGKAEAPR  488
               NL RA  HQ+LDP+A HGVT+FSDLTP EF + Y+G LK   R+    + G   +AP 
Sbjct  78    KANLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRTYLG-LKTTRRSFLREMAGSAHDAPV  136

Query  489   LDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVD  668
             L   GLPE FDWRD GAV  VK QGSCGSCW+FS +GA+EGAN++A+GK+  LSEQQLVD
Sbjct  137   LPTDGLPEDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLASGKMEVLSEQQLVD  196

Query  669   CDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVK  848
             CDH CD  +  +CD GC+GGLMT+A+ YL++SGG+E E  YPYTGK G C+F+  K+A  
Sbjct  197   CDHECDPSEPDSCDAGCNGGLMTSAFSYLLKSGGLEREKDYPYTGKDGTCKFDKSKIAAS  256

Query  849   VGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGY  1028
             V N++ +  DE+Q+AA LV +GPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGY
Sbjct  257   VQNYSVVAVDEEQIAANLVKYGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGY  315

Query  1029  GKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
             G  GF+  R   KPYWIIKNSWG++WG++GY+++CRG  +   CG+ +MVS V
Sbjct  316   GASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  368



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   391 bits (1004),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 255/363 (70%), Gaps = 19/363 (5%)
 Frame = +3

Query  111   LAVLTCAHLAFASSASQG---LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             L VL    L+ +S  ++G   L I+QV D     A  N+L  ++E  F  F ++ GK YA
Sbjct  10    LFVLFFLVLSASSDGNEGGDDLVIKQVVDG---GAEPNVL--SSEDHFSLFKKKFGKVYA  64

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGR  452
             + EE+ YR  VF  NL RA  HQ LDP+A HGVT+FSDLT +EF+K ++GV    K+P  
Sbjct  65    SSEEHDYRFSVFKTNLRRARRHQKLDPSARHGVTQFSDLTRSEFKKKHLGVRGGFKLPKD  124

Query  453   ASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATG  632
             A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FS TGA+EGANF+ATG
Sbjct  125   AN------KAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANFLATG  178

Query  633   KLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG  812
             KL++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G
Sbjct  179   KLVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDG  238

Query  813   -DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
               C+ +  K+   V NF+ +  DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC 
Sbjct  239   PTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYIC-  297

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              +RLNHGVLLVGYG  G++  R   KPYWIIKNSWG+ WGE G++++CRG  +CG+ ++V
Sbjct  298   MRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLV  357

Query  1170  SAV  1178
             S V
Sbjct  358   STV  360



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 242/339 (71%), Gaps = 19/339 (6%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D     A E+ L          F    GK YAT EE+ YR  VF  NL RA  HQ
Sbjct  31    IRQVVDGVRLGAEEHFL---------EFKSRFGKAYATPEEHDYRFTVFKANLRRARRHQ  81

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+AVHGVTRFSDLTP+EF    +G+  +++P  A+      +AP L    +P  FDW
Sbjct  82    SLDPSAVHGVTRFSDLTPSEFRNKVLGLRGVRLPSDAN------KAPILPTDDIPSDFDW  135

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             RD GAVT VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD +++ +
Sbjct  136   RDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPEEQGS  195

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY+++SGG+  E  YPY+G   G C F+  KVA  V NF+ +  DE
Sbjct  196   CDSGCNGGLMNSAFEYILKSGGVMREEDYPYSGTDRGTCNFDKAKVAASVANFSVISLDE  255

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TYM GVSCP ICS +RL+HGVLLVGYG   ++ +R+ 
Sbjct  256   DQIAANLVKNGPLAVAINAVFMQTYMHGVSCPYICS-RRLDHGVLLVGYGSGAYAPIRMK  314

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG++WGE GY+++CRG  +CG+ +MVS V
Sbjct  315   EKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTV  353



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 254/367 (69%), Gaps = 21/367 (6%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             +Y  +  V        +S A+ G  L IRQV D+    + E+         F  F ++ G
Sbjct  7     LYFSVFLVFVFIVSVSSSDANDGDDLLIRQVVDEAKVLSSED--------HFSLFKKKFG  58

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LK  440
             K YA++EE+ YRL VF  NL RA  HQ LDP+A HGVT+FSDLT  EF+K ++GV    K
Sbjct  59    KVYASNEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRAEFKKKHLGVKGGFK  118

Query  441   VPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANF  620
             +P  A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FS TGA+EGANF
Sbjct  119   LPKDAN------KAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANF  172

Query  621   IATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYT  800
             +ATG+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYT
Sbjct  173   LATGELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYT  232

Query  801   GKGG-DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCP  977
             GK G  C+ +  K+   V NF+ +  DE+Q+AA LV +GPLAV INA YM TY+GGVSCP
Sbjct  233   GKDGPTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCP  292

Query  978   LICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGI  1157
              IC+ +RLNHGVLLVGYG  G++  R   KPYWIIKNSWG+ WGE G++++C+G  +CG+
Sbjct  293   YICA-RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGV  351

Query  1158  SNMVSAV  1178
              ++VS V
Sbjct  352   DSLVSTV  358



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 253/367 (69%), Gaps = 21/367 (6%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             +Y  +  V        +S A+ G  L IRQV D+    + E+         F  F ++ G
Sbjct  8     LYFSVFLVFVFIVSVSSSDANDGDDLLIRQVVDEAKVLSSED--------HFSLFKKKFG  59

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LK  440
             K YA++EE+ YRL VF  NL RA  HQ LDP+A HGVT+FSDLT  EF K ++GV    K
Sbjct  60    KVYASNEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRAEFRKKHLGVKGGFK  119

Query  441   VPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANF  620
             +P  A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FS TGA+EGANF
Sbjct  120   LPKDAN------KAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANF  173

Query  621   IATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYT  800
             +ATG+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYT
Sbjct  174   LATGELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYT  233

Query  801   GKGG-DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCP  977
             GK G  C+ +  K+   V NF+ +  DE+Q+AA LV +GPLAV INA YM TY+GGVSCP
Sbjct  234   GKDGPTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCP  293

Query  978   LICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGI  1157
              IC+ +RLNHGVLLVGYG  G++  R   KPYWIIKNSWG+ WGE G++++C+G  +CG+
Sbjct  294   YICA-RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGV  352

Query  1158  SNMVSAV  1178
              ++VS V
Sbjct  353   DSLVSTV  359



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 247/339 (73%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV + +  ++  NLL TA +  F  F ++  K Y + EE+ YR  VF  NL RAA HQ
Sbjct  31    IRQVVEGQDESSS-NLL-TAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAARHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTA HGVT+FSDLT  EF K  +G+  L++P  A+       AP L  + LPE FDW
Sbjct  89    KLDPTASHGVTQFSDLTSAEFRKQVLGLRKLRLPKDANT------APILPTNDLPEDFDW  142

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAV  VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  143   REKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPEEPGS  202

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  KVA  V NF+ +  DE
Sbjct  203   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGMDRGACKFDKNKVAAGVANFSAVSLDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS +RL+HGVLLVGYG   ++ +R+ 
Sbjct  263   DQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-RRLDHGVLLVGYGSAAYAPVRMK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE G++++CRG  +CG+ +MVS V
Sbjct  322   EKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTV  360



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   390 bits (1002),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/342 (56%), Positives = 241/342 (70%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV     P   +  L    + +F  F+Q  GK Y   EE+ +RL VF   L RA  HQ
Sbjct  25    IRQVVGGADPLDNDLEL----DSQFLGFVQRFGKTYRDAEEHAHRLSVFKATLRRARRHQ  80

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRA---SLLGGKAEAPRLDVSGLPETFD  521
             +LDP+A HGVT+FSDLTP EF + ++G LK   R+    + G   +AP L   GLPE FD
Sbjct  81    LLDPSAEHGVTKFSDLTPAEFRRTFLG-LKTTRRSFLREMAGSAHDAPVLPTDGLPEDFD  139

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAV  VK QGSCGSCW+FS +GA+EGAN++ATGK+  LSEQQLVDCDH CD  +  
Sbjct  140   WRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLATGKMEVLSEQQLVDCDHECDPAEPD  199

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             +CD GC+GGLMT+A+ YL++SGG+E E  YPYTGK G C+FE  K+A  V NF+ +  DE
Sbjct  200   SCDAGCNGGLMTSAFSYLLKSGGLEREKDYPYTGKDGTCKFEKSKIAASVQNFSVVAVDE  259

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             +Q+AA LV +GPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGYG  GF+  R  
Sbjct  260   EQIAANLVKYGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGYGASGFAPSRFK  318

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
              KPYWIIKNSWG++WG++GY+++CRG  +   CG+ +MVS V
Sbjct  319   EKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  360



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 247/339 (73%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV + +  ++  NLL TA +  F  F ++  K Y + EE+ YR  VF  NL RAA HQ
Sbjct  31    IRQVVEGQDESSS-NLL-TAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAARHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTA HGVT+FSDLT  EF K  +G+  L++P  A+       AP L  + LPE FDW
Sbjct  89    KLDPTASHGVTQFSDLTSAEFRKQVLGLRKLRLPKDANT------APILPTNDLPEDFDW  142

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAV  VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  143   REKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPEEPGS  202

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  KVA  V NF+ +  DE
Sbjct  203   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGMDRGACKFDKNKVAAGVANFSVVSLDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS +RL+HGVLLVGYG   ++ +R+ 
Sbjct  263   DQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-RRLDHGVLLVGYGSAAYAPVRMK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE G++++CRG  +CG+ +MVS V
Sbjct  322   EKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTV  360



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   390 bits (1001),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 248/339 (73%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV + +  ++  NLL TA +     F ++  K Y + EE+ YR  VF  NL RAA HQ
Sbjct  37    IRQVVEGQDESS-PNLL-TAEQHHLSLFKRKFKKSYLSQEEHDYRFSVFKSNLRRAARHQ  94

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTA HGVT+FSDLT  EF K  +G+  L++P  A+      +AP L  + LPE FDW
Sbjct  95    KLDPTASHGVTQFSDLTSAEFRKQVLGLRKLRLPKDAN------KAPILPTNDLPEDFDW  148

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAV  VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  149   REKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPEEPGS  208

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+ +KVA  V NF+ +  DE
Sbjct  209   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGMDRGACKFDKDKVAAGVANFSVVSLDE  268

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV  NAV+M TY+GGVSCP ICS +RL+HGVLLVGYG  G++ +R+ 
Sbjct  269   DQIAANLVKNGPLAVATNAVFMQTYIGGVSCPYICS-RRLDHGVLLVGYGSAGYAPVRMK  327

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE G++++CRG  +CG+ +MVS V
Sbjct  328   EKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTV  366



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 253/367 (69%), Gaps = 21/367 (6%)
 Frame = +3

Query  96    MYAQLLAVLTCAHLAFASSASQG--LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             +Y  +  V        +S A+ G  L IRQV D+    + E+         F  F ++ G
Sbjct  7     LYFSVFLVFFFIVSVSSSDANDGDDLVIRQVVDEAKVLSSED--------HFSLFKKKFG  58

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LK  440
             K YA++EE+ YRL VF  NL RA  HQ LDP+A HGVT+FSDLT  EF K ++GV    K
Sbjct  59    KVYASNEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRAEFRKKHLGVKGGFK  118

Query  441   VPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANF  620
             +P  A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FS TGA+EGANF
Sbjct  119   LPKDAN------KAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANF  172

Query  621   IATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYT  800
             +ATG+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY +++GG+ +E  YPYT
Sbjct  173   LATGELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYT  232

Query  801   GKGG-DCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCP  977
             GK G  C+ +  K+   V NF+ +  DE+Q+AA LV +GPLAV INA YM TY+GGVSCP
Sbjct  233   GKDGPTCKLDKSKIVASVSNFSVVSIDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCP  292

Query  978   LICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGI  1157
              IC+ +RLNHGVLLVGYG  G++  R   KPYWIIKNSWG+ WGE G++++C+G  +CG+
Sbjct  293   YICA-RRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGV  351

Query  1158  SNMVSAV  1178
              ++VS V
Sbjct  352   DSLVSTV  358



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 241/338 (71%), Gaps = 12/338 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV +D      E+LL    E  F +F  +  K YAT EE+ YR GVF  NL+RA  HQ
Sbjct  31    IRQVVED----GDEHLLNA--EHHFSAFKTKFSKTYATKEEHDYRFGVFKSNLLRAKSHQ  84

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGGKAEAPRLDVSGLPETFDWRD  530
              LDP+A+HGVT+FSDLTP+EF   ++G+  +    SL      AP L    LP+ FDWRD
Sbjct  85    ELDPSAIHGVTKFSDLTPSEFRSQFLGLKPL----SLPSDAHNAPILPTDNLPKDFDWRD  140

Query  531   KGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACD  710
              GAVT VK QG+ GSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD     ACD
Sbjct  141   HGAVTNVKNQGTGGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPDLNDACD  200

Query  711   DGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQ  887
              GC+GGLMT A+ Y  ++GG+  E  Y YTG+  G C+F+  K+A  V NF+ +  DEDQ
Sbjct  201   SGCNGGLMTTAFGYTKKAGGLVREEDYLYTGRDRGPCKFDKSKIAASVSNFSVVSLDEDQ  260

Query  888   MAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFK  1067
             +AA LV +GPL+VGINAVYM TY+GGVSCP IC  K L+HGVLLVGYG  G++ +R   K
Sbjct  261   IAANLVKNGPLSVGINAVYMQTYIGGVSCPFICG-KHLDHGVLLVGYGAGGYAPIRFKEK  319

Query  1068  PYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAVM  1181
             PYWIIKNSWG++WGE GY+++CRG  MCG+ +MVS V+
Sbjct  320   PYWIIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVI  357



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 196/363 (54%), Positives = 249/363 (69%), Gaps = 14/363 (4%)
 Frame = +3

Query  93    LMYAQLLA-VLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             L    LLA VL  + +AF+        +   TDD       +LL    E  F  F  + G
Sbjct  4     LFLLSLLAFVLFSSAIAFSDEDPLIRQVVSETDDS------HLLNA--EHHFSLFKSKFG  55

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K YA+ EE+ +R  VF  NL RA  +Q+LDP+A HG+T+FSDLTP+EF + Y+G+ K   
Sbjct  56    KIYASEEEHDHRFKVFKANLRRARLNQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  115

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
             + +      +AP L  S LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F+AT
Sbjct  116   KLN----AEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLAT  171

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG  809
             G+L++LSEQQLVDCDH CD + + ACD GC GG    A+EY +++GG++ E  YPYTGK 
Sbjct  172   GELVSLSEQQLVDCDHECDPEQQDACDAGCGGGHYATAFEYTLKAGGLQLEKDYPYTGKD  231

Query  810   GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICS  989
             G C F+  K+   V NF+ +  DEDQ+AA LV HGPLAVGINA +M TY+GGVSCPLIC 
Sbjct  232   GKCHFDKSKICAAVTNFSVIGLDEDQIAANLVKHGPLAVGINAAWMQTYVGGVSCPLICF  291

Query  990   KKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMV  1169
              KR +HGVLLVGYG  GF+ +RL  K YWIIKNSWG++WGE GY+++CRGH +CG+  MV
Sbjct  292   -KRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMV  350

Query  1170  SAV  1178
             S V
Sbjct  351   STV  353



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 248/339 (73%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV + +  ++  NLL T  +  F  F ++  K Y + +E+ YR  VF  NL RAA HQ
Sbjct  31    IRQVVEGQDESS-SNLL-TGEQHHFSLFKRKFKKSYLSQQEHDYRFSVFKSNLRRAARHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDPTA HGVT+FSDLT  EF K  +G+  L++P  A+      +AP L  + LPE FDW
Sbjct  89    KLDPTASHGVTQFSDLTAAEFRKQVLGLRKLRLPKDAN------KAPILPTNDLPEDFDW  142

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAV  VK QGSCGSCW+FSTTGA+EGA+F+ATG+L++LSEQQLVDCDH CD ++  +
Sbjct  143   REKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLATGELVSLSEQQLVDCDHECDPEEPGS  202

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  KVA  V NF+ +  DE
Sbjct  203   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGMDRGACKFDKNKVAAGVANFSVVSLDE  262

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS +RL+HGVLLVGYG  G++ +R+ 
Sbjct  263   DQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-RRLDHGVLLVGYGSAGYAPVRMK  321

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE G++++CRG  +CG+ +MVS V
Sbjct  322   EKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTV  360



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 246/342 (72%), Gaps = 16/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L I+QV D     A  N+L  ++E  F  F ++ GK YA+ EE+ YR  VF  NL RA  
Sbjct  30    LVIKQVVDG---GAEPNVL--SSEDHFSLFKKKFGKVYASREEHDYRFSVFKSNLRRARR  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A HGVT+FSDLT +EF++ ++GV    K+P  A+      +AP L    LPE 
Sbjct  85    HQKLDPSARHGVTQFSDLTRSEFKRKHLGVKGGFKLPKDAN------KAPILPTENLPEE  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWR++GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++
Sbjct  139   FDWRERGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK-GGDCRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  199   AGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDGATCKLDKSKIVASVSNFSVIS  258

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC  +RLNHGVLLVGYG  G++  
Sbjct  259   IDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYIC-MRRLNHGVLLVGYGSAGYAPA  317

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE+G++++CRG  +CG+ ++VS V
Sbjct  318   RFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTV  359



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/370 (53%), Positives = 253/370 (68%), Gaps = 10/370 (3%)
 Frame = +3

Query  75    RIAGGGLMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSF  254
             R+    L+ A  LAV++   +           IRQV    +P    +      E+ F  F
Sbjct  3     RVVFFFLIAATSLAVISGEEVTVVVDGGLDNPIRQV----VPELKNDEQILNAELHFTLF  58

Query  255   MQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV  434
               ++ K YAT EE+ YR  VF  NL RA  +Q+LDP+AVHGVT+FSDLTP EF + Y+G 
Sbjct  59    KSKYEKTYATQEEHDYRFRVFEANLRRAKRNQLLDPSAVHGVTQFSDLTPKEFRRSYLG-  117

Query  435   LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGA  614
             LK   R  L     EAP L  S LP  FDWR++GAVT VK QG CGSCW+FS TGA+EGA
Sbjct  118   LKRGFR--LPTDTKEAPILPTSELPTDFDWREQGAVTPVKNQGMCGSCWSFSATGALEGA  175

Query  615   NFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYP  794
             +F+AT +L++LSEQQLVDCDH CD    ++CD GCSGGLM NA+EY +++GG+ +E  YP
Sbjct  176   HFLATKELVSLSEQQLVDCDHECDPAQANSCDSGCSGGLMNNAFEYALKAGGLMKEEDYP  235

Query  795   YTGKGGD-CRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVS  971
             YTG+    C F+  K+A  V NF+ + ADEDQ+AA L+ HGPLA+ INA++M TY+GGVS
Sbjct  236   YTGRDHSVCNFDKSKIAASVSNFSVVSADEDQIAANLIKHGPLAIAINAMWMQTYIGGVS  295

Query  972   CPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG-HGM  1148
             CP +CSK + +HGVLLVG+G+ G++ +RL  KPYWIIKNSWGK WGE GY+++CRG H +
Sbjct  296   CPYVCSKSQ-DHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICRGRHNI  354

Query  1149  CGISNMVSAV  1178
             CG+  MVS V
Sbjct  355   CGMDTMVSTV  364



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   387 bits (993),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 234/313 (75%), Gaps = 11/313 (4%)
 Frame = +3

Query  252   FMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMG  431
             F ++ GK Y + EE+ YR  VF  NL+RA  HQ +DP+A HGVT+FSDLT +EF + ++G
Sbjct  3     FKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLG  62

Query  432   V---LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGA  602
             V    K+P  A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FSTTGA
Sbjct  63    VKGGFKLPKDAN------QAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGA  116

Query  603   IEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEE  782
             +EGA+F+ATGKL++LSEQQLVDCDH CD +++ +CD GC+GGLM +A+EY +++GG+  E
Sbjct  117   LEGAHFLATGKLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMRE  176

Query  783   ASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYM  959
               YPYTG  GG C+ +  K+   V NF+ +  +EDQ+AA L+ +GPLAV INA YM TY+
Sbjct  177   KDYPYTGTDGGSCKLDRSKIVASVSNFSVVSINEDQIAANLIKNGPLAVAINAAYMQTYI  236

Query  960   GGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG  1139
             GGVSCP ICS +RLNHGVLLVGYG  GFS  RL  KPYWIIKNSWG+ WGE G++++C+G
Sbjct  237   GGVSCPYICS-RRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKG  295

Query  1140  HGMCGISNMVSAV  1178
               +CG+ ++VS V
Sbjct  296   RNICGVDSLVSTV  308



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 254/370 (69%), Gaps = 17/370 (5%)
 Frame = +3

Query  75    RIAGGGLMYAQLLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTATEVRFKSF  254
             R+    L+ A LLAV      +  S       IRQV    +P   + LL    E  F  F
Sbjct  3     RVVFSFLIAAALLAV------SLGSGEGSDNPIRQV----VPEENDELLNA--EHHFSLF  50

Query  255   MQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV  434
               ++ K YAT EE+ +RL VF  NL RA  +Q+LDP+AVHGVT+FSDLTP EF + ++G+
Sbjct  51    KSKYQKTYATQEEHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFRRQFLGL  110

Query  435   LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGA  614
              +   R  L      AP L  + LP  FDWR++GAVT VK QG CGSCW+FS TGA+EGA
Sbjct  111   KRRKFR--LPTDTETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGA  168

Query  615   NFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYP  794
             +F+AT +L++LSEQQL+DCDH CD    ++CD GCSGGLM NA+EY +++GG+ +E  YP
Sbjct  169   HFLATKELVSLSEQQLIDCDHECDPAQANSCDSGCSGGLMNNAFEYTLKAGGLMKEEEYP  228

Query  795   YTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVS  971
             YTG+    C+F+  K+A  V NF+ + ADEDQ+AA LV HGPLA+ INA++M TY+GGVS
Sbjct  229   YTGRDHSACKFDKSKIAASVFNFSVVSADEDQIAANLVKHGPLAIAINAMWMQTYIGGVS  288

Query  972   CPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG-HGM  1148
             CP +CSK + +HGVLLVG+G  G++ +RL  KPYWIIKNSWG  WGE GY+++CRG H M
Sbjct  289   CPYVCSKNQ-DHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNM  347

Query  1149  CGISNMVSAV  1178
             CG+ +MVS V
Sbjct  348   CGMDSMVSTV  357



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   389 bits (998),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 246/336 (73%), Gaps = 18/336 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV  D+     ++LL    +  F  F +  GK YA+ EE+ YR  VF  NL RA  HQ
Sbjct  37    IRQVVGDD----DDHLLNA--DHHFTIFKRRFGKTYASDEEHHYRFSVFKANLRRAMRHQ  90

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              LDP+AVHGVT+FSDLTP EF + ++GV   L++P  A+      +AP L    LP  FD
Sbjct  91    KLDPSAVHGVTQFSDLTPAEFRRNFLGVNRRLRLPSDAN------KAPILPTEDLPSGFD  144

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAVT VK QGSCGSCW+FSTTGA+EGA +++TGKL++LSEQQLVDCDH CD ++K 
Sbjct  145   WRDHGAVTSVKNQGSCGSCWSFSTTGALEGATYLSTGKLVSLSEQQLVDCDHECDPEEKD  204

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPAD  878
             +CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F++ KVA KV NF+ +  D
Sbjct  205   SCDAGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGTCKFDNTKVAAKVANFSVVSLD  264

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E+Q+AA LV +GPLAV INAV+M TY+GGVSCP ICSKK L+HGVLLVGYG  GFS +R+
Sbjct  265   EEQIAANLVKNGPLAVAINAVFMQTYVGGVSCPYICSKK-LDHGVLLVGYG-TGFSPIRM  322

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
               KPYWIIKNSWG+ WGE GY+++CRG  +CG+ +M
Sbjct  323   KEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSM  358



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 252/366 (69%), Gaps = 19/366 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFA--SSASQGLN----IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             L  +L    L FA  S++S G N    I QV D      G+  LG   E  F  F +  G
Sbjct  6     LFLLLVAFSLVFAAVSASSDGGNEEPLIMQVVD-----GGDVRLGA--EHHFLEFKRRFG  58

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K Y + +E+ YR  VF  N+ RA  HQ LDP+A HGVTRFSDLTP+EF    +G+  V  
Sbjct  59    KAYDSEDEHDYRYKVFKANMRRARRHQSLDPSAAHGVTRFSDLTPSEFRNKVLGLRGV--  116

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
             R  L   KA  P L    LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F++T
Sbjct  117   RLPLDANKA--PILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  174

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-K  806
             G+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY+++SGG+  E  YPY+G  
Sbjct  175   GELVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYILKSGGVMREEDYPYSGAD  234

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAV INA YM TY+GGVSCP +C
Sbjct  235   SGTCKFDKTKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYVC  294

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             S +RLNHGVLLVGYG   ++ +R+  KP+WIIKNSWG++WGE GY+++CRG  +CG+ +M
Sbjct  295   S-RRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRSICGVDSM  353

Query  1167  VSAVMT  1184
             VS V +
Sbjct  354   VSTVAS  359



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 252/366 (69%), Gaps = 19/366 (5%)
 Frame = +3

Query  108   LLAVLTCAHLAFA--SSASQGLN----IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHG  269
             L  +L    L FA  S++S G N    I QV D      G+  LG   E  F  F +  G
Sbjct  6     LFLLLVAFSLVFAAVSASSDGGNEEPLIMQVVD-----GGDVRLGA--EHHFLEFKRRFG  58

Query  270   KEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPG  449
             K Y + +E+ YR  VF  N+ RA  HQ LDP+A HGVTRFSDLTP+EF    +G+  V  
Sbjct  59    KAYDSEDEHDYRYKVFKANMRRARRHQSLDPSAAHGVTRFSDLTPSEFRNKVLGLRGV--  116

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
             R  L   KA  P L    LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F++T
Sbjct  117   RLPLDANKA--PILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  174

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG-K  806
             G+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY+++SGG+  E  YPY+G  
Sbjct  175   GELVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYILKSGGVMREEDYPYSGAD  234

Query  807   GGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAV INA YM TY+GGVSCP +C
Sbjct  235   SGTCKFDKTKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYVC  294

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             S +RLNHGVLLVGYG   ++ +R+  KP+WIIKNSWG++WGE GY+++CRG  +CG+ +M
Sbjct  295   S-RRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSM  353

Query  1167  VSAVMT  1184
             VS V +
Sbjct  354   VSTVAS  359



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 254/358 (71%), Gaps = 13/358 (4%)
 Frame = +3

Query  117   VLTCAHLAFASSASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHE  290
             ++  A LA +  + +GL+  IRQV    +P   + LL    E  F  F  ++ K YAT +
Sbjct  9     LIAAALLAVSLGSGEGLDNPIRQV----VPEENDELLNA--EHHFSLFKSKYQKTYATQQ  62

Query  291   EYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGG  470
             E+ +RL VF  NL RA  +Q+LDP+AVHGVT+FSDLTP EF + ++G+ +   R  L   
Sbjct  63    EHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFRRQFLGLKRRKFR--LPTD  120

Query  471   KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLS  650
                AP L  + LP  FDWR++GAVT VK QG CGSCW+FS TGA+EGA+F+AT +L++LS
Sbjct  121   TETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHFLATKELVSLS  180

Query  651   EQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFE  827
             EQQL+DCDH CD    ++CD GCSGGLM NA+EY +++GG+ +E  YPYTG+    C+F+
Sbjct  181   EQQLIDCDHECDPAQANSCDSGCSGGLMNNAFEYTLKAGGLMKEEEYPYTGRDHSACKFD  240

Query  828   SEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNH  1007
               K+A  V NF+ + ADEDQ+AA LV HGPLA+ INA++M TY+GGVSCP +CSK + +H
Sbjct  241   KSKIAASVFNFSVVSADEDQIAANLVKHGPLAIAINAMWMQTYIGGVSCPYVCSKSQ-DH  299

Query  1008  GVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSAV  1178
             GVLLVG+G  G++ +RL  KPYWIIKNSWG  WGE GY+++CRG H MCG+ +MVS V
Sbjct  300   GVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTV  357



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 243/340 (71%), Gaps = 16/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D    AA  N+L  ++E  F  F  + GK YA+ EE+ YR  VF  NL RA  HQ
Sbjct  31    IRQVVDG---AAEPNVL--SSEDHFSLFKSKFGKVYASGEEHDYRFSVFKANLRRARRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              +DP+A HGVT+FSDLT +EF + ++GV    K+P  A+      +AP L    LPE FD
Sbjct  86    KMDPSARHGVTQFSDLTRSEFREKHLGVKGGFKLPKDAN------KAPILPTENLPEDFD  139

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++  
Sbjct  140   WRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEAG  199

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLPAD  878
             +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G  C+ +  K+   V NF+ +  D
Sbjct  200   SCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDGPVCKLDKSKIVASVSNFSVISID  259

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             EDQ+AA LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  R 
Sbjct  260   EDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYICT-RRLNHGVLLVGYGSAGYAPARF  318

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  319   KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTV  358



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/383 (51%), Positives = 255/383 (67%), Gaps = 16/383 (4%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--------IRQVTDDEIPAAGENLLGTATEVRFKSFMQE  263
             L AV+T A L  + S +   +        IRQV +D+      N      E  F  F + 
Sbjct  7     LFAVITAATLCLSESLTSPHSVQHDRDPFIRQVVEDD---GDFNRHALGAEHHFSLFKRR  63

Query  264   HGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV  443
              GK YAT EE+  R  +F  N+ RA  HQ  DP+A+HG+T+FSDLTP EF K ++G+   
Sbjct  64    FGKSYATEEEHDRRFKIFKANMRRAERHQSFDPSAIHGITQFSDLTPFEFRKAFLGLRG-  122

Query  444   PGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFI  623
               R  L      AP L    LP  FDWR++GAVT VK QGSCGSCW+FSTTGAIEGANF+
Sbjct  123   -HRLRLPVDTNAAPILPTENLPIDFDWRERGAVTRVKNQGSCGSCWSFSTTGAIEGANFL  181

Query  624   ATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTG  803
             ATGKL++LSEQQLVDCDH CD +++ ACD GC+GGLM +A+EY +++GG+ +E  YPYTG
Sbjct  182   ATGKLVSLSEQQLVDCDHECDPEEEDACDSGCNGGLMNSAFEYTLKAGGLMKEQDYPYTG  241

Query  804   KG-GDCRFESEKVAVKVGNFTNLPA-DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCP  977
                  C F+  K+A  + NF+ + + DEDQ+AA LV +GPLA+ INAV+M TY+GGVSCP
Sbjct  242   TDHSTCNFDKSKIAASIANFSVVNSLDEDQIAANLVKNGPLAIAINAVFMQTYIGGVSCP  301

Query  978   LICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGI  1157
              ICS  RL+HGVLLVGYG  G++ +R+  K YWIIKNSWG++WGE GY+++CRG  +CG+
Sbjct  302   FICS-NRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICRGRNICGV  360

Query  1158  SNMVSAVMTRPGSYIAS*GRAPR  1226
              ++VS V      + +S    PR
Sbjct  361   DSLVSTVAAVHIHHTSSIASPPR  383



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 231/319 (72%), Gaps = 6/319 (2%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F SF +  G+ Y    E  YR+ VFA NL RA  HQ LDPTA HGVT+FSDLTP EF
Sbjct  55    EAHFASFERRFGRTYRDAGERAYRMSVFAANLRRARRHQRLDPTATHGVTKFSDLTPGEF  114

Query  414   EKMYMGVLKVPGRASLLGGKA-EAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFS  590
                ++G L+ P    L+GG+  EAP L   GLP+ FDWR+ GAV  VK QGSCGSCW+FS
Sbjct  115   RDRFLG-LRRPSLEGLVGGEPHEAPILPTDGLPDDFDWREHGAVGPVKDQGSCGSCWSFS  173

Query  591   TTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGG  770
             T+GA+EGA+F+ATGKL  LSEQQ+VDCDH CD  +  ACD GC+GGLMT A+ YL++SGG
Sbjct  174   TSGALEGAHFLATGKLEVLSEQQMVDCDHECDASESRACDSGCNGGLMTTAFSYLMKSGG  233

Query  771   IEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
             ++ E  YPY G+   C+F+  K+  +V NF+ +  +EDQ+AA LV HGPLA+ INA YM 
Sbjct  234   LQSEKDYPYAGRENTCKFDKSKIVAQVKNFSVISVNEDQIAANLVKHGPLAIAINAAYMQ  293

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TY+GGVSCP IC  + L+HGVLLVGYG  G++ +R   KPYWIIKNSWG++WGE+GY+++
Sbjct  294   TYIGGVSCPFICG-RHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKI  352

Query  1131  CRG---HGMCGISNMVSAV  1178
             CRG      CG+ +MVS+V
Sbjct  353   CRGPHDKNKCGVDSMVSSV  371



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 241/342 (70%), Gaps = 17/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV     P          +E  F  F ++ GK YA++EE+ YR  VF  NL RA  
Sbjct  31    LVIRQVVGGAEPQV------LTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARR  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A HGVT+FSDLT +EF K ++GV    K+P  A+      +AP L    LPE 
Sbjct  85    HQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDAN------KAPILPTENLPED  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWRD GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++
Sbjct  139   FDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+EY +++GG+ +E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  199   ADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKDGKTCKLDKSKIVASVSNFSVIS  258

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  
Sbjct  259   IDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICT-RRLNHGVLLVGYGAAGYAPA  317

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE G++++C+G  +CG+ +MVS V
Sbjct  318   RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTV  359



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 235/318 (74%), Gaps = 10/318 (3%)
 Frame = +3

Query  234   EVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEF  413
             E  F  F +  GK YA+ EE+ YR  VF  N+ RA  HQ LDP+A HGVTRFSDLT +EF
Sbjct  14    EHHFLDFKRRFGKAYASQEEHNYRFEVFKANMRRARRHQSLDPSAAHGVTRFSDLTASEF  73

Query  414   EKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAF  587
                 +G+  +++P  A+      +AP L    LP  FDWRD GAVT VK QGSCGSCW+F
Sbjct  74    RNKVLGLRGVRLPSNAN------KAPILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSF  127

Query  588   STTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESG  767
             STTGA+EGA+F++TG+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY+++SG
Sbjct  128   STTGALEGAHFLSTGELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYILKSG  187

Query  768   GIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVY  944
             G+  E  YPY+G   G+C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAV INA Y
Sbjct  188   GVMREEDYPYSGTDRGNCKFDKAKIAASVANFSVISLDEDQIAANLVKNGPLAVAINAAY  247

Query  945   MHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYF  1124
             M TY+GGVSCP ICS +RL+HGVLLVGYG   ++ +R+  KP+WIIKNSWG++WGE GY+
Sbjct  248   MQTYIGGVSCPYICS-RRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYY  306

Query  1125  RMCRGHGMCGISNMVSAV  1178
             ++CRG  +CG+ +MVS V
Sbjct  307   KICRGRNICGVDSMVSTV  324



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 242/339 (71%), Gaps = 12/339 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQVTD +        L    E  F  F     K Y + EE+ YR  VF  NL RA  HQ
Sbjct  37    IRQVTDGQDDGVETQPL--TAEHHFSLFKARFKKSYGSEEEHDYRFKVFRANLRRAERHQ  94

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKV--PGRASLLGGKAEAPRLDVSGLPETFDW  524
              LDP+A HGVT+FSDLTP EF K ++G+ ++  P  A+      +AP L    LPE FDW
Sbjct  95    KLDPSATHGVTQFSDLTPGEFRKRFLGLRRLRLPTDAN------QAPILPTDNLPEDFDW  148

Query  525   RDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSA  704
             R+KGAVT VK QGSCGSCW+FSTTGA+EGANF+ATGKL++LSEQQLVDCDH CD ++  +
Sbjct  149   REKGAVTPVKNQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEAGS  208

Query  705   CDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPADE  881
             CD GC+GGLM +A+EY +++GG+  E  YPYTG   G C+F+  K+  KV NF+ +  DE
Sbjct  209   CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGTCKFDKSKIVAKVANFSVVSLDE  268

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             DQ+AA LV +GPLAV INAV+M TY+GGVSCP ICS KRL+HGVLLVGYG  G++ +RL 
Sbjct  269   DQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICS-KRLDHGVLLVGYGSAGYAPIRLK  327

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
              KPYWIIKNSWG+ WGE GY+++CRG  +CG+ ++VS V
Sbjct  328   DKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSLVSTV  366



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 240/342 (70%), Gaps = 12/342 (4%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV     P   +  L    + +   F+Q  GK Y   EE+ +RL VF  NL RA  HQ
Sbjct  33    IRQVVGGADPLDNDLEL----DSQLLGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQ  88

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRA---SLLGGKAEAPRLDVSGLPETFD  521
             +LDP+A HGVT+FSDLTP EF + ++G LK   R+    + G   +AP L   GLPE FD
Sbjct  89    MLDPSAEHGVTKFSDLTPAEFRRTFLG-LKTTRRSFLREMAGSAHDAPVLPTDGLPEDFD  147

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAV  VK QGSC SCW+FS +GA+EGAN++ATGK+  LSEQQLVDCDH CD  +  
Sbjct  148   WRDHGAVGPVKNQGSCWSCWSFSASGALEGANYLATGKMEVLSEQQLVDCDHECDPAEPD  207

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGDCRFESEKVAVKVGNFTNLPADE  881
             +CD GC+GGLMT+A+ YL++SGG+E E  YPYTGK G C+FE  K+A  V NF+ +  DE
Sbjct  208   SCDAGCNGGLMTSAFSYLLKSGGLEREKDYPYTGKDGTCKFEKSKIAASVQNFSVVAVDE  267

Query  882   DQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLG  1061
             +Q+AA LV +GPLA+GINA YM TY+GGVSCP IC  + L+HGVLLVGYG  GF+  R  
Sbjct  268   EQIAANLVEYGPLAIGINAAYMQTYIGGVSCPYICG-RHLDHGVLLVGYGASGFAPSRFK  326

Query  1062  FKPYWIIKNSWGKDWGEEGYFRMCRGHGM---CGISNMVSAV  1178
              KPYWIIKNSWG++WG++GY+++CRG  +   CG+ +MVS V
Sbjct  327   EKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTV  368



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   386 bits (992),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 252/361 (70%), Gaps = 13/361 (4%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYA  281
             L  ++  A LA +  + +G +  IRQV    +P     LL    E  F  F  ++ K YA
Sbjct  6     LFFLIAAALLAVSLGSGEGFDNPIRQV----VPEENHELLNA--EHHFSLFKSKYQKTYA  59

Query  282   THEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASL  461
             T EE+ +RL VF  NL RA  +Q+LDP+AVHGVT+FSDLTP EF +  MG+ +   R  L
Sbjct  60    TQEEHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFSRQLMGLKRRKFR--L  117

Query  462   LGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLL  641
                   AP L  + LP  FDWR++GAVT VK QG CGSCW+FS TGA+EGA+F+AT +L+
Sbjct  118   PTDTETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHFLATKELV  177

Query  642   NLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-C  818
             +LSEQQL+DCDH CD    ++CD GCSGGLM NA+EY +++GG+ +E  YPYTG+    C
Sbjct  178   SLSEQQLIDCDHECDPAQANSCDSGCSGGLMNNAFEYTLKAGGLMKEEEYPYTGRDHSAC  237

Query  819   RFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKR  998
             +F+  K+A  V NF+ + ADEDQ+AA LV HGPLA+ INA++M TY+GGVSCP +CSK +
Sbjct  238   KFDKSKIAASVFNFSVVSADEDQIAANLVKHGPLAIAINAMWMQTYIGGVSCPYVCSKSQ  297

Query  999   LNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSA  1175
              +HGVLLVG+G  G++ +RL  KPYWIIKNSWG  WGE GY+++CRG H +CG+ +MVS 
Sbjct  298   -DHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVST  356

Query  1176  V  1178
             V
Sbjct  357   V  357



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 241/342 (70%), Gaps = 17/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV     P          +E  F  F  + GK YA++EE+ YR  VF  NL RA  
Sbjct  31    LVIRQVVGGAEPQV------LTSEDHFSLFKSKFGKVYASNEEHDYRFSVFKANLRRARR  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A HGVT+FSDLT +EF K ++GV    K+P  A+      +AP L    LPE 
Sbjct  85    HQKLDPSARHGVTQFSDLTRSEFRKKHLGVRAGFKLPKDAN------KAPILPTENLPED  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWRD+GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++
Sbjct  139   FDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+EY +++GG+ +E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  199   AGSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKDGKTCKLDKSKIVASVSNFSVIS  258

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  
Sbjct  259   IDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICT-RRLNHGVLLVGYGSAGYAPA  317

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  318   RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTV  359



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   386 bits (991),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 253/364 (70%), Gaps = 22/364 (6%)
 Frame = +3

Query  108   LLAVLTCAHLAFASSASQGLNIRQVTDDEIPAAGENLLGTAT----EVRFKSFMQEHGKE  275
             ++  L    + FA+SA  G       DDE P   + + G+      E  F  F +  GK 
Sbjct  7     IIFFLVIFSVFFAASADGG-------DDE-PLIMQVVEGSGVRLGAEHHFLDFKRRFGKA  58

Query  276   YATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPG  449
             YA+ EE+ YR  VF  N+ RA  HQ LDP+A HGVTRFSDLT +EF    +G+  +++P 
Sbjct  59    YASQEEHNYRFEVFKANMRRARRHQSLDPSAAHGVTRFSDLTASEFRNKVLGLRGVRLPS  118

Query  450   RASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIAT  629
              A+      +AP L    LP  FDWRD GAVT VK QGSCGSCW+FSTTGA+EGA+F++T
Sbjct  119   NAN------KAPILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  172

Query  630   GKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG  809
             G+L++LSEQQLVDCDH CD ++  +CD GC+GGLM +A+EY+++SGG+  E  YPY+G  
Sbjct  173   GELVSLSEQQLVDCDHECDPEEAGSCDSGCNGGLMNSAFEYILKSGGVMREEDYPYSGTD  232

Query  810   -GDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLIC  986
              G+C+F+  K+A  V NF+ +  DEDQ+AA LV +GPLAV INA YM TY+GGVSCP IC
Sbjct  233   RGNCKFDKAKIAASVANFSVISLDEDQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYIC  292

Query  987   SKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNM  1166
             S +RL+HGVLLVGYG   ++ +R+  KP+WIIKNSWG++WGE GY+++CRG  +CG+ +M
Sbjct  293   S-RRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSM  351

Query  1167  VSAV  1178
             VS V
Sbjct  352   VSTV  355



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 244/342 (71%), Gaps = 16/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L I+QV D     A  N+L  ++E  F  F ++ GK YA+ EE+ YR  VF  NL RA  
Sbjct  30    LVIKQVVDG---GADPNVL--SSEDHFSLFKKKFGKVYASREEHDYRFSVFKSNLRRARR  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A HGVT+FSDLT +EF++ ++GV    K+P  A+      +AP L    LP  
Sbjct  85    HQKLDPSARHGVTQFSDLTRSEFKRKHLGVKGGFKLPKDAN------KAPILPTENLPVE  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWR++GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL +LSEQQLVDCDH CD ++
Sbjct  139   FDWRERGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLASLSEQQLVDCDHECDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGK-GGDCRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  199   AGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDGATCKLDKSKIVASVSNFSVIS  258

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC  +RLNHGVLLVGYG  G++  
Sbjct  259   IDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYIC-MRRLNHGVLLVGYGSAGYAPA  317

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE+G++++CRG  +CG+ ++VS V
Sbjct  318   RFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTV  359



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 243/340 (71%), Gaps = 16/340 (5%)
 Frame = +3

Query  171   IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQ  350
             IRQV D    AA  N+L   +E  F  F ++ GK YA+ EE+ YR  VF  NL RA  HQ
Sbjct  31    IRQVVDG---AAEPNVL--TSEDHFSLFKRKFGKVYASGEEHDYRFSVFKANLRRARRHQ  85

Query  351   ILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFD  521
              +DP+A HGVT+FSDLT +EF + ++GV    K+P  A+      +AP L    LPE FD
Sbjct  86    KMDPSARHGVTQFSDLTRSEFREKHLGVKGGFKLPKDAN------KAPILPTENLPEDFD  139

Query  522   WRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKS  701
             WRD GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++  
Sbjct  140   WRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEAG  199

Query  702   ACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLPAD  878
             +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G  C+ +  K+   V NF+ +  D
Sbjct  200   SCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDGPVCKLDKSKIVASVSNFSVISID  259

Query  879   EDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRL  1058
             E+Q+AA LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  R 
Sbjct  260   EEQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYICT-RRLNHGVLLVGYGSAGYAPARF  318

Query  1059  GFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
               +PYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  319   KERPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTV  358



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 241/342 (70%), Gaps = 17/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV     P          +E  F  F ++ GK YA++EE+ YR  VF  NL RA  
Sbjct  31    LVIRQVVGGAEPQV------LTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARR  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A HGVT+FSDLT +EF K ++GV    K+P  A+      +AP L    LPE 
Sbjct  85    HQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDAN------KAPILPTENLPED  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWRD GAVT VK QGSCGSCW+FS TGA+EGANF+ATGKL++LSEQQLVDCDH CD ++
Sbjct  139   FDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGGD-CRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+E+ +++GG+ +E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  199   ADSCDSGCNGGLMNSAFEHTLKTGGLMKEEDYPYTGKDGKTCKLDKSKIVASVSNFSVIS  258

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  
Sbjct  259   IDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICT-RRLNHGVLLVGYGAAGYAPA  317

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE G++++C+G  +CG+ +MVS V
Sbjct  318   RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTV  359



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 232/316 (73%), Gaps = 11/316 (3%)
 Frame = +3

Query  243   FKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKM  422
             F  F +  GK Y + EE+ +R  VF  NL RA  HQ +DP+A HGVT+FSDLTP+EF +M
Sbjct  31    FSLFKRRFGKVYGSLEEHHHRFAVFRSNLQRAMRHQRMDPSARHGVTQFSDLTPSEFRRM  90

Query  423   YMGV---LKVPGRASLLGGKAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFST  593
             ++GV    K+P  A+      +AP L    LPE FDWRD+GAVT VK QGSCGSCW+FST
Sbjct  91    HLGVRGGFKLPKDAN------QAPILPTKDLPEDFDWRDRGAVTPVKNQGSCGSCWSFST  144

Query  594   TGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGI  773
             TGA+EGA+F++TG+L++LSEQQLVDCDH CD + + +CD GC+GGLM +A+EY +++GG+
Sbjct  145   TGALEGAHFLSTGQLVSLSEQQLVDCDHECDPEQEGSCDSGCNGGLMNSAFEYTLKTGGL  204

Query  774   EEEASYPYTG-KGGDCRFESEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMH  950
               E  YPY G  GG C+ +  K+   V NF+ +  +EDQ+AA LV +GPLAV +NA YM 
Sbjct  205   MREDDYPYEGTDGGTCKLDKSKIVASVSNFSVVSINEDQIAANLVKNGPLAVALNAAYMQ  264

Query  951   TYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRM  1130
             TYMGGVSCP ICS KRLNHGVLLVGYG  GFS  R   KPYWIIKNSWG+ WGE G++++
Sbjct  265   TYMGGVSCPYICS-KRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKL  323

Query  1131  CRGHGMCGISNMVSAV  1178
             C+G  +CG+ +MVS V
Sbjct  324   CKGRNVCGVDSMVSTV  339



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 243/342 (71%), Gaps = 17/342 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV    +  A   +L +A    F  F ++ GK YA++EE+ YR  VF  NL +A  
Sbjct  31    LVIRQV----VGGADSEVLSSADH--FSLFKKKFGKVYASNEEHDYRFSVFKANLRQARR  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV---LKVPGRASLLGGKAEAPRLDVSGLPET  515
             HQ LDP+A HGVT+FSDLT +EF K ++GV    K+P  A+      +AP L    LPE 
Sbjct  85    HQKLDPSARHGVTQFSDLTRSEFRKKHLGVKGGFKLPKDAN------KAPILPTENLPEE  138

Query  516   FDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKD  695
             FDWRD GAVT VK QGSCGSCW+FS TGA+EGANF++TGKL++LSEQQLVDCDH CD ++
Sbjct  139   FDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLSTGKLISLSEQQLVDCDHECDPEE  198

Query  696   KSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKGG-DCRFESEKVAVKVGNFTNLP  872
               +CD GC+GGLM +A+EY +++GG+  E  YPYTGK G  C+ +  K+   V NF+ + 
Sbjct  199   AGSCDSGCNGGLMNSAFEYTLKTGGLMREEDYPYTGKDGPTCKLDKSKIVASVSNFSVIS  258

Query  873   ADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSIL  1052
              DE+Q+AA LV +GPLAV INA YM TY+GGVSCP IC+ +RLNHGVLLVGYG  G++  
Sbjct  259   IDEEQIAANLVKNGPLAVAINAAYMQTYIGGVSCPYICA-RRLNHGVLLVGYGSAGYAPA  317

Query  1053  RLGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
             R   KPYWIIKNSWG+ WGE G++++C+G  +CG+ ++VS V
Sbjct  318   RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTV  359



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 250/358 (70%), Gaps = 13/358 (4%)
 Frame = +3

Query  117   VLTCAHLAFASSASQGLN--IRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHE  290
             ++  A LA +  +  G +  IRQV    +P   + LL  A    F  F  ++ K YAT +
Sbjct  9     LIAAALLAVSLGSGDGFDNPIRQV----VPEENDELLNAAHH--FSLFKSKYEKTYATQD  62

Query  291   EYVYRLGVFAKNLIRAAEHQILDPTAVHGVTRFSDLTPNEFEKMYMGVLKVPGRASLLGG  470
             E+ +R  VF  NL RA  +Q+LDP+AVHGVT+FSDLTP EF + ++G+ +   R  L   
Sbjct  63    EHDHRFRVFKANLRRAKRNQLLDPSAVHGVTQFSDLTPKEFRRQFLGLKRQKFR--LPTD  120

Query  471   KAEAPRLDVSGLPETFDWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLS  650
                AP L  + LP  FDWR++GAVT VK QG CGSCW+FS TGA+EGA+F+AT +L++LS
Sbjct  121   TEIAPILPTTDLPTDFDWREQGAVTPVKNQGLCGSCWSFSATGALEGAHFLATKELVSLS  180

Query  651   EQQLVDCDHTCDIKDKSACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFE  827
             EQQL+DCDH CD    ++CD GCSGGLM NA+EY +++GG+ +E  YPYTG+    C+F+
Sbjct  181   EQQLIDCDHECDPAQANSCDSGCSGGLMNNAFEYALKTGGLMKEEDYPYTGRDHSACKFD  240

Query  828   SEKVAVKVGNFTNLPADEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNH  1007
               ++A  V NF+ + +DEDQ+AA LV HGPLA+ INA++M TY+GGVSCP +CSK + +H
Sbjct  241   KSRIAASVFNFSVVSSDEDQIAANLVKHGPLAIAINAMWMQTYIGGVSCPYVCSKSQ-DH  299

Query  1008  GVLLVGYGKKGFSILRLGFKPYWIIKNSWGKDWGEEGYFRMCRG-HGMCGISNMVSAV  1178
             GVLLVG+G  G++ +RL  KPYWIIKNSWG  WGE GY+++CRG H MCG+  MVS V
Sbjct  300   GVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTV  357



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 250/341 (73%), Gaps = 16/341 (5%)
 Frame = +3

Query  165   LNIRQVTDDEIPAAGENLLGTATEVRFKSFMQEHGKEYATHEEYVYRLGVFAKNLIRAAE  344
             L IRQV    +P A E+LL    E  F +F  + G+ YAT EE+ YR  +F  NL+RA  
Sbjct  31    LLIRQV----VPDAEEHLLNA--ENHFSAFKTKFGRTYATKEEHDYRFRIFKNNLLRAKS  84

Query  345   HQILDPTAVHGVTRFSDLTPNEFEKMYMGV--LKVPGRASLLGGKAEAPRLDVSGLPETF  518
             HQ LDP+AVHGVT+FSDLTP EF + ++G+  L++P  A       +AP L  S LP  F
Sbjct  85    HQKLDPSAVHGVTKFSDLTPAEFSRQFLGLKPLRLPSDAQ------KAPILPTSDLPSDF  138

Query  519   DWRDKGAVTEVKMQGSCGSCWAFSTTGAIEGANFIATGKLLNLSEQQLVDCDHTCDIKDK  698
             DWRD GAVT VK QGSCGSCW+FS  GA+EGA+F++TG+L++LSEQQLVDCDH CD +++
Sbjct  139   DWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLSTGELVSLSEQQLVDCDHECDPEER  198

Query  699   SACDDGCSGGLMTNAYEYLIESGGIEEEASYPYTGKG-GDCRFESEKVAVKVGNFTNLPA  875
              ACD GC GGLMTNA+EY +++GG+  E  YPYTG+  G C+F++ ++A  V NF+ +  
Sbjct  199   GACDAGCGGGLMTNAFEYSLKAGGLMRENDYPYTGRDRGPCKFDNSRIAASVANFSVVSL  258

Query  876   DEDQMAAYLVNHGPLAVGINAVYMHTYMGGVSCPLICSKKRLNHGVLLVGYGKKGFSILR  1055
             DE+Q+AA LV +GPLAVGINA++M TY+GGVSCP IC  K L+HGVLLVGYG   ++ +R
Sbjct  259   DEEQIAANLVKNGPLAVGINAIFMQTYIGGVSCPYICG-KHLDHGVLLVGYGAGAYAPIR  317

Query  1056  LGFKPYWIIKNSWGKDWGEEGYFRMCRGHGMCGISNMVSAV  1178
                KP+WIIKNSWG+ WGE GY+++CRGH +CG+ +MVS V
Sbjct  318   FKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTV  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3423712266800