BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7812_g1_i1 len=1129 path=[1107:0-874 1982:875-1128]

Length=1129
                                                                      Score     E

ref|XP_006342173.1|  PREDICTED: uncharacterized protein LOC102582...    222   5e-67   
ref|XP_004238457.1|  PREDICTED: uncharacterized protein LOC101267233    218   3e-65   
emb|CDP12005.1|  unnamed protein product                                209   2e-61   
ref|XP_009599962.1|  PREDICTED: uncharacterized protein LOC104095525    206   1e-60   
ref|XP_011074063.1|  PREDICTED: uncharacterized protein LOC105158...    205   2e-60   
ref|XP_011074062.1|  PREDICTED: uncharacterized protein LOC105158...    206   3e-60   
gb|EYU41195.1|  hypothetical protein MIMGU_mgv1a014259mg                202   2e-59   
ref|XP_009350890.1|  PREDICTED: uncharacterized protein LOC103942428    184   5e-50   
ref|XP_009372623.1|  PREDICTED: uncharacterized protein LOC103961758    184   6e-50   
ref|XP_008373379.1|  PREDICTED: uncharacterized protein LOC103436705    183   7e-50   
ref|XP_009796244.1|  PREDICTED: uncharacterized protein LOC104242838    177   8e-50   
gb|EPS65494.1|  hypothetical protein M569_09287                         176   1e-49   
gb|KDO85222.1|  hypothetical protein CISIN_1g039702mg                   182   1e-49   
ref|XP_008356415.1|  PREDICTED: uncharacterized protein LOC103420129    182   2e-49   
ref|XP_010664003.1|  PREDICTED: uncharacterized protein LOC100246...    179   5e-49   
ref|XP_002273277.1|  PREDICTED: uncharacterized protein LOC100246...    179   2e-48   Vitis vinifera
ref|XP_004300107.1|  PREDICTED: uncharacterized protein LOC101291244    176   2e-47   
ref|XP_006473921.1|  PREDICTED: uncharacterized protein LOC102607717    178   1e-46   
ref|XP_010259756.1|  PREDICTED: uncharacterized protein LOC104599085    174   1e-46   
ref|XP_010246890.1|  PREDICTED: uncharacterized protein LOC104590068    174   4e-46   
gb|KDP36748.1|  hypothetical protein JCGZ_08039                         171   3e-45   
emb|CBI40762.3|  unnamed protein product                                168   5e-44   
ref|XP_007209223.1|  hypothetical protein PRUPE_ppa006877mg             167   7e-44   
ref|XP_004487660.1|  PREDICTED: uncharacterized protein LOC101500...    166   1e-43   
ref|XP_006597328.1|  PREDICTED: uncharacterized protein LOC100786...    166   3e-43   
ref|XP_003547550.1|  PREDICTED: uncharacterized protein LOC100786...    164   1e-42   
ref|XP_008238065.1|  PREDICTED: uncharacterized protein LOC103336744    169   1e-42   
ref|XP_006584590.1|  PREDICTED: uncharacterized protein LOC100804...    162   7e-42   
ref|XP_002300625.2|  hypothetical protein POPTR_0002s00690g             162   8e-42   Populus trichocarpa [western balsam poplar]
ref|XP_003596486.1|  hypothetical protein MTR_2g081050                  162   2e-41   
ref|XP_003593054.1|  hypothetical protein MTR_2g007290                  161   2e-41   
ref|XP_011034812.1|  PREDICTED: uncharacterized protein LOC105132809    160   2e-41   
ref|NP_001242575.1|  uncharacterized protein LOC100804780               158   2e-40   
ref|XP_002510723.1|  conserved hypothetical protein                     157   4e-40   Ricinus communis
ref|XP_010498528.1|  PREDICTED: uncharacterized protein LOC104776209    157   9e-40   
ref|XP_006307427.1|  hypothetical protein CARUB_v10009051mg             157   1e-39   
ref|XP_010094518.1|  hypothetical protein L484_024810                   154   5e-39   
ref|XP_002893135.1|  hypothetical protein ARALYDRAFT_472323             155   6e-39   
ref|XP_002298345.1|  hypothetical protein POPTR_0001s24980g             145   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010686677.1|  PREDICTED: uncharacterized protein LOC104900845    144   7e-38   
ref|XP_010086740.1|  hypothetical protein L484_001972                   150   7e-38   
gb|KDO59514.1|  hypothetical protein CISIN_1g043145mg                   144   7e-38   
ref|XP_011035279.1|  PREDICTED: uncharacterized protein LOC105133134    143   2e-37   
ref|NP_173511.1|  HSP20-like chaperones superfamily protein             151   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477342.1|  PREDICTED: uncharacterized protein LOC104756442    150   2e-37   
emb|CDP15535.1|  unnamed protein product                                149   3e-37   
emb|CDY29497.1|  BnaA06g14730D                                          145   3e-37   
emb|CDY17558.1|  BnaC01g26820D                                          144   3e-37   
ref|XP_002510722.1|  conserved hypothetical protein                     142   4e-37   Ricinus communis
ref|XP_006433285.1|  hypothetical protein CICLE_v10002241mg             145   6e-37   
ref|XP_006416354.1|  hypothetical protein EUTSA_v10007660mg             149   7e-37   
ref|XP_006392479.1|  hypothetical protein EUTSA_v10023692mg             143   7e-37   
emb|CDY43486.1|  BnaA01g21410D                                          144   8e-37   
ref|XP_009149565.1|  PREDICTED: uncharacterized protein LOC103872871    144   8e-37   
ref|XP_004166361.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    148   9e-37   
ref|XP_004139188.1|  PREDICTED: uncharacterized protein LOC101212060    148   9e-37   
ref|XP_010659835.1|  PREDICTED: uncharacterized protein LOC100249...    144   1e-36   
ref|XP_008454867.1|  PREDICTED: uncharacterized protein LOC103495173    147   1e-36   
gb|AAO45755.1|  heat-shock protein-like protein                         147   1e-36   Cucumis melo [Oriental melon]
ref|XP_009119552.1|  PREDICTED: uncharacterized protein LOC103844508    142   1e-36   
gb|KFK35609.1|  hypothetical protein AALP_AA4G013300                    142   2e-36   
ref|XP_002280890.2|  PREDICTED: uncharacterized protein LOC100249...    144   2e-36   Vitis vinifera
ref|XP_010511225.1|  PREDICTED: uncharacterized protein LOC104787351    142   3e-36   
ref|XP_007018682.1|  HSP20-like chaperones superfamily protein, p...    146   4e-36   
ref|XP_009596036.1|  PREDICTED: uncharacterized protein LOC104092...    147   4e-36   
ref|XP_002891914.1|  hypothetical protein ARALYDRAFT_892730             141   4e-36   
ref|XP_009596033.1|  PREDICTED: uncharacterized protein LOC104092...    147   6e-36   
ref|XP_010537225.1|  PREDICTED: uncharacterized protein LOC104812004    145   7e-36   
ref|XP_010094520.1|  hypothetical protein L484_024812                   139   8e-36   
ref|XP_009769387.1|  PREDICTED: uncharacterized protein LOC104220254    146   9e-36   
ref|XP_007203069.1|  hypothetical protein PRUPE_ppa023477mg             145   9e-36   
gb|AAG51117.1|AC069144_14  hypothetical protein                         140   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175882.2|  alpha-crystallin domain of heat shock protein-c...    140   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244267.1|  PREDICTED: uncharacterized protein LOC103342424    145   1e-35   
ref|XP_006302788.1|  hypothetical protein CARUB_v10020913mg             140   1e-35   
gb|EPS66551.1|  hypothetical protein M569_08226                         138   1e-35   
ref|XP_002512356.1|  conserved hypothetical protein                     145   1e-35   Ricinus communis
ref|XP_008370486.1|  PREDICTED: uncharacterized protein LOC103433...    145   2e-35   
gb|AAT52226.1|  Hsp1                                                    137   2e-35   Cucumis melo [Oriental melon]
ref|XP_004303641.1|  PREDICTED: uncharacterized protein LOC101307316    144   2e-35   
gb|KDP23533.1|  hypothetical protein JCGZ_23366                         139   3e-35   
ref|XP_007148493.1|  hypothetical protein PHAVU_006G213300g             143   4e-35   
gb|EYU20996.1|  hypothetical protein MIMGU_mgv1a008490mg                142   7e-35   
ref|XP_010549932.1|  PREDICTED: uncharacterized protein LOC104820950    137   8e-35   
ref|XP_009334295.1|  PREDICTED: uncharacterized protein LOC103927...    143   9e-35   
ref|XP_006606509.1|  PREDICTED: uncharacterized protein LOC100785...    142   1e-34   
emb|CDY31860.1|  BnaC07g15100D                                          142   1e-34   
ref|XP_003591085.1|  Heat shock protein-like protein                    142   1e-34   
ref|XP_006361863.1|  PREDICTED: uncharacterized protein LOC102584031    143   2e-34   
ref|XP_006850735.1|  hypothetical protein AMTR_s00025p00054190          142   2e-34   
ref|XP_011087379.1|  PREDICTED: uncharacterized protein LOC105168887    141   2e-34   
emb|CBI36755.3|  unnamed protein product                                144   2e-34   
ref|XP_002319552.1|  Hsp1 family protein                                137   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002983718.1|  hypothetical protein SELMODRAFT_13541              140   3e-34   
ref|XP_002989048.1|  hypothetical protein SELMODRAFT_13540              140   3e-34   
ref|XP_003555597.2|  PREDICTED: uncharacterized protein LOC100785...    142   4e-34   
ref|XP_006849980.1|  hypothetical protein AMTR_s00022p00158430          142   4e-34   
ref|XP_002512357.1|  conserved hypothetical protein                     136   5e-34   Ricinus communis
gb|KHN20207.1|  hypothetical protein glysoja_023770                     140   5e-34   
ref|XP_008370489.1|  PREDICTED: uncharacterized protein LOC103433...    139   6e-34   
ref|XP_004495740.1|  PREDICTED: uncharacterized protein LOC101506728    140   6e-34   
ref|XP_004231265.1|  PREDICTED: uncharacterized protein LOC101262870    141   7e-34   
ref|XP_009334297.1|  PREDICTED: uncharacterized protein LOC103927...    139   7e-34   
emb|CDY31505.1|  BnaC05g16140D                                          137   8e-34   
ref|XP_010459778.1|  PREDICTED: uncharacterized protein LOC104740780    140   1e-33   
gb|KHN16138.1|  hypothetical protein glysoja_012114                     139   2e-33   
ref|XP_011023581.1|  PREDICTED: uncharacterized protein LOC105125...    134   2e-33   
ref|XP_011023579.1|  PREDICTED: uncharacterized protein LOC105125...    134   3e-33   
ref|XP_007144747.1|  hypothetical protein PHAVU_007G181300g             138   3e-33   
ref|XP_003535347.2|  PREDICTED: uncharacterized protein LOC100775950    138   4e-33   
gb|KHG22251.1|  16.6 kDa heat shock                                     131   4e-33   
ref|XP_010278216.1|  PREDICTED: uncharacterized protein LOC104612486    138   5e-33   
ref|XP_004139187.1|  PREDICTED: uncharacterized protein LOC101211821    132   7e-33   
ref|XP_006435432.1|  hypothetical protein CICLE_v10002801mg             130   7e-33   
ref|XP_008464812.1|  PREDICTED: uncharacterized protein LOC103502...    130   1e-32   
ref|XP_004144249.1|  PREDICTED: uncharacterized protein LOC101218...    130   1e-32   
ref|XP_007030879.1|  HSP20-like chaperones superfamily protein, p...    135   1e-32   
gb|AEW07440.1|  hypothetical protein 0_1575_01                          129   2e-32   
ref|XP_011023910.1|  PREDICTED: uncharacterized protein LOC105125244    136   2e-32   
ref|XP_006375771.1|  hypothetical protein POPTR_0013s02560g             135   2e-32   
ref|XP_010528867.1|  PREDICTED: uncharacterized protein LOC104805867    130   3e-32   
ref|XP_010674777.1|  PREDICTED: uncharacterized protein LOC104890861    130   3e-32   
ref|XP_006433286.1|  hypothetical protein CICLE_v10002661mg             130   3e-32   
gb|KDO59513.1|  hypothetical protein CISIN_1g025769mg                   132   4e-32   
ref|XP_006471987.1|  PREDICTED: uncharacterized protein LOC102608...    130   5e-32   
ref|XP_008454882.1|  PREDICTED: uncharacterized protein LOC103495...    130   6e-32   
gb|KGN60888.1|  hypothetical protein Csa_2G021590                       130   6e-32   
gb|AAO45756.1|  heat shock protein-like protein                         129   6e-32   Cucumis melo [Oriental melon]
ref|XP_006471986.1|  PREDICTED: uncharacterized protein LOC102608...    130   8e-32   
ref|XP_006392481.1|  hypothetical protein EUTSA_v10023555mg             133   9e-32   
gb|KDO59515.1|  hypothetical protein CISIN_1g025484mg                   131   9e-32   
ref|XP_008464810.1|  PREDICTED: uncharacterized protein LOC103502...    127   1e-31   
gb|KDP23534.1|  hypothetical protein JCGZ_23367                         133   2e-31   
ref|XP_010086739.1|  hypothetical protein L484_001971                   134   2e-31   
ref|XP_011023580.1|  PREDICTED: uncharacterized protein LOC105125...    129   2e-31   
ref|XP_002894607.1|  hypothetical protein ARALYDRAFT_474763             132   2e-31   
ref|XP_009103323.1|  PREDICTED: uncharacterized protein LOC103829409    133   3e-31   
emb|CDY01350.1|  BnaA07g11230D                                          133   3e-31   
ref|XP_010528868.1|  PREDICTED: uncharacterized protein LOC104805...    132   3e-31   
ref|XP_010528869.1|  PREDICTED: uncharacterized protein LOC104805...    132   3e-31   
ref|XP_007211215.1|  hypothetical protein PRUPE_ppa013125mg             126   3e-31   
ref|XP_001755242.1|  predicted protein                                  130   4e-31   
ref|XP_008454874.1|  PREDICTED: uncharacterized protein LOC103495...    127   5e-31   
gb|AAG51105.1|AC069144_2  unknown protein                               130   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175881.2|  alpha-crystallin domain of heat shock protein-c...    130   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207594.1|  hypothetical protein PRUPE_ppa019035mg             125   6e-31   
ref|XP_006471988.1|  PREDICTED: uncharacterized protein LOC102608881    128   8e-31   
ref|XP_010025172.1|  PREDICTED: uncharacterized protein LOC104415542    126   1e-30   
ref|XP_006433284.1|  hypothetical protein CICLE_v10003281mg             128   1e-30   
ref|XP_010511223.1|  PREDICTED: uncharacterized protein LOC104787350    128   2e-30   
gb|KHG06402.1|  17.8 kDa class I heat shock -like protein               125   4e-30   
ref|XP_010414927.1|  PREDICTED: uncharacterized protein LOC104701004    128   5e-30   
ref|XP_008246496.1|  PREDICTED: uncharacterized protein LOC103344661    124   7e-30   
ref|XP_010674779.1|  PREDICTED: uncharacterized protein LOC104890862    128   8e-30   
ref|XP_002319025.1|  hypothetical protein POPTR_0013s02570g             128   9e-30   Populus trichocarpa [western balsam poplar]
gb|KHG25717.1|  16.6 kDa heat shock                                     124   1e-29   
ref|XP_004302443.1|  PREDICTED: uncharacterized protein LOC101300639    123   2e-29   
ref|XP_009119537.1|  PREDICTED: uncharacterized protein LOC103844...    124   5e-29   
emb|CDY43484.1|  BnaA01g21390D                                          124   6e-29   
ref|XP_011023573.1|  PREDICTED: uncharacterized protein LOC105125011    125   7e-29   
ref|XP_009119531.1|  PREDICTED: uncharacterized protein LOC103844...    124   9e-29   
emb|CDY17557.1|  BnaC01g26810D                                          124   9e-29   
ref|NP_177770.1|  HSP20-like chaperones superfamily protein             119   2e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CBI36753.3|  unnamed protein product                                119   2e-28   
ref|XP_006300519.1|  hypothetical protein CARUB_v10020526mg             124   2e-28   
ref|XP_004300109.1|  PREDICTED: uncharacterized protein LOC101291...    119   2e-28   
emb|CDP15534.1|  unnamed protein product                                120   3e-28   
ref|XP_002889084.1|  hypothetical protein ARALYDRAFT_476801             118   3e-28   
ref|XP_006302835.1|  hypothetical protein CARUB_v10020967mg             119   7e-28   
gb|AAT52227.1|  Hsp2                                                    117   8e-28   Cucumis melo [Oriental melon]
ref|XP_010416565.1|  PREDICTED: uncharacterized protein LOC104702406    116   1e-27   
ref|XP_002280921.3|  PREDICTED: uncharacterized protein LOC100261344    119   1e-27   Vitis vinifera
ref|XP_010471799.1|  PREDICTED: uncharacterized protein LOC104751541    116   2e-27   
ref|XP_010428704.1|  PREDICTED: uncharacterized protein LOC104713309    116   2e-27   
dbj|BAF45120.1|  small heat shock protein                               116   2e-27   Nicotiana tabacum [American tobacco]
ref|XP_009796441.1|  PREDICTED: uncharacterized protein LOC104243...    117   2e-27   
ref|XP_009599966.1|  PREDICTED: uncharacterized protein LOC104095528    115   2e-27   
ref|XP_006390197.1|  hypothetical protein EUTSA_v10019300mg             115   3e-27   
emb|CDP16391.1|  unnamed protein product                                117   3e-27   
ref|XP_009629948.1|  PREDICTED: uncharacterized protein LOC104120011    117   4e-27   
ref|XP_008362532.1|  PREDICTED: uncharacterized protein LOC103426215    113   1e-26   
ref|XP_004230179.1|  PREDICTED: uncharacterized protein LOC101261366    115   2e-26   
ref|XP_009370547.1|  PREDICTED: uncharacterized protein LOC103959898    112   2e-26   
ref|XP_006361861.1|  PREDICTED: uncharacterized protein LOC102583357    115   3e-26   
emb|CDX85951.1|  BnaC06g21830D                                          112   3e-26   
ref|XP_010534303.1|  PREDICTED: uncharacterized protein LOC104809894    112   5e-26   
dbj|BAF45121.1|  small heat shock protein                               112   6e-26   Nicotiana benthamiana
ref|XP_009104673.1|  PREDICTED: uncharacterized protein LOC103830611    110   1e-25   
ref|XP_004238455.1|  PREDICTED: uncharacterized protein LOC101266717    110   2e-25   
ref|XP_006435434.1|  hypothetical protein CICLE_v100013582mg            108   2e-25   
emb|CDX68096.1|  BnaA07g21360D                                          110   2e-25   
ref|XP_006342171.1|  PREDICTED: uncharacterized protein LOC102581493    110   3e-25   
ref|XP_007018683.1|  HSP20-like chaperones superfamily protein, p...    109   3e-25   
ref|XP_009769386.1|  PREDICTED: uncharacterized protein LOC104220253    112   3e-25   
ref|XP_010659834.1|  PREDICTED: uncharacterized protein LOC100244207    109   6e-25   
emb|CDX87597.1|  BnaA07g32760D                                          107   2e-24   
ref|XP_009106309.1|  PREDICTED: uncharacterized protein LOC103832106    107   2e-24   
emb|CAN61082.1|  hypothetical protein VITISV_041915                     107   3e-24   Vitis vinifera
emb|CDX88280.1|  BnaC06g37240D                                          106   3e-24   
emb|CBI36754.3|  unnamed protein product                                109   3e-24   
ref|XP_007030876.1|  HSP20-like chaperones superfamily protein is...    107   2e-23   
ref|XP_007099598.1|  HSP20-like chaperones superfamily protein is...    107   2e-23   
ref|XP_008348670.1|  PREDICTED: uncharacterized protein LOC103411831    106   2e-23   
ref|XP_008381365.1|  PREDICTED: uncharacterized protein LOC103444224    106   2e-23   
ref|XP_007030874.1|  HSP20-like chaperones superfamily protein is...    106   2e-23   
ref|XP_007030875.1|  HSP20-like chaperones superfamily protein is...    106   3e-23   
gb|KHG06403.1|  3-methyl-2-oxobutanoate hydroxymethyltransferase        107   3e-23   
ref|XP_007030871.1|  HSP20-like chaperones superfamily protein is...    105   6e-23   
ref|XP_009370111.1|  PREDICTED: uncharacterized protein LOC103959483    103   6e-23   
emb|CAN61081.1|  hypothetical protein VITISV_041914                     108   7e-23   Vitis vinifera
ref|XP_007030873.1|  HSP20-like chaperones superfamily protein is...    104   7e-23   
ref|XP_007030872.1|  HSP20-like chaperones superfamily protein is...    105   7e-23   
ref|XP_008370503.1|  PREDICTED: uncharacterized protein LOC103433966    103   2e-22   
ref|XP_010027729.1|  PREDICTED: uncharacterized protein LOC104418173    100   4e-22   
ref|XP_009349980.1|  PREDICTED: uncharacterized protein LOC103941506    100   4e-21   
ref|XP_008388587.1|  PREDICTED: uncharacterized protein LOC103450956  99.4    7e-21   
ref|XP_007030877.1|  HSP20-like chaperones superfamily protein, p...  95.1    2e-19   
ref|XP_007030878.1|  HSP20-like chaperones superfamily protein, p...  94.4    8e-19   
ref|XP_010041787.1|  PREDICTED: uncharacterized protein LOC104430760  89.4    2e-18   
ref|XP_002275119.1|  PREDICTED: uncharacterized protein LOC100246177  89.0    1e-17   Vitis vinifera
ref|XP_010026618.1|  PREDICTED: uncharacterized protein LOC104416989  84.0    3e-15   
ref|XP_010041163.1|  PREDICTED: uncharacterized protein LOC104430098  83.6    2e-14   
ref|XP_010026623.1|  PREDICTED: uncharacterized protein LOC104416994  83.2    4e-14   
ref|XP_010026627.1|  PREDICTED: uncharacterized protein LOC104416998  80.5    6e-14   
ref|XP_010026626.1|  PREDICTED: uncharacterized protein LOC104416997  82.0    8e-14   
ref|XP_010026613.1|  PREDICTED: uncharacterized protein LOC104416984  80.1    1e-13   
ref|XP_010026621.1|  PREDICTED: uncharacterized protein LOC104416993  80.9    2e-13   
ref|XP_006606508.1|  PREDICTED: uncharacterized protein LOC100785...  80.9    2e-13   
ref|XP_010026615.1|  PREDICTED: uncharacterized protein LOC104416986  80.1    3e-13   
ref|XP_006435435.1|  hypothetical protein CICLE_v100013581mg          79.3    4e-13   
ref|XP_010026616.1|  PREDICTED: uncharacterized protein LOC104416987  76.3    6e-13   
ref|XP_009599964.1|  PREDICTED: uncharacterized protein LOC104095526  72.4    9e-12   
ref|XP_010026610.1|  PREDICTED: uncharacterized protein LOC104416982  73.2    2e-11   
ref|XP_009796246.1|  PREDICTED: uncharacterized protein LOC104242839  70.9    3e-11   
ref|XP_010026611.1|  PREDICTED: uncharacterized protein LOC104416983  73.2    4e-11   
ref|XP_006342172.1|  PREDICTED: uncharacterized protein LOC102581823  67.0    7e-10   
ref|XP_010041527.1|  PREDICTED: uncharacterized protein LOC104430481  66.6    3e-09   
ref|XP_010041164.1|  PREDICTED: uncharacterized protein LOC104430099  67.0    6e-09   
ref|XP_010026619.1|  PREDICTED: uncharacterized protein LOC104416991  67.0    6e-09   
ref|XP_010026624.1|  PREDICTED: uncharacterized protein LOC104416995  66.6    9e-09   
emb|CBI40761.3|  unnamed protein product                              62.8    1e-08   
ref|XP_010026629.1|  PREDICTED: uncharacterized protein LOC104417002  66.2    1e-08   
ref|XP_010026625.1|  PREDICTED: uncharacterized protein LOC104416996  62.4    2e-07   
ref|XP_007099599.1|  HSP20-like chaperones superfamily protein is...  55.8    5e-06   
ref|XP_008370488.1|  PREDICTED: uncharacterized protein LOC103433...  52.4    3e-04   
ref|XP_009334296.1|  PREDICTED: uncharacterized protein LOC103927...  52.4    3e-04   



>ref|XP_006342173.1| PREDICTED: uncharacterized protein LOC102582147 isoform X1 [Solanum 
tuberosum]
 ref|XP_006342174.1| PREDICTED: uncharacterized protein LOC102582147 isoform X2 [Solanum 
tuberosum]
 ref|XP_006342175.1| PREDICTED: uncharacterized protein LOC102582147 isoform X3 [Solanum 
tuberosum]
 ref|XP_006342176.1| PREDICTED: uncharacterized protein LOC102582147 isoform X4 [Solanum 
tuberosum]
 ref|XP_006342177.1| PREDICTED: uncharacterized protein LOC102582147 isoform X5 [Solanum 
tuberosum]
Length=200

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKR  471
            RPCMM LLP+PN+E  +S A  IL+GTACKGVTGPP+G  DIGVS SAYYFR+ALPGVK+
Sbjct  59   RPCMMSLLPLPNLEECNSGAPAILTGTACKGVTGPPVGVVDIGVSISAYYFRIALPGVKK  118

Query  470  DPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
            DPG+FNCEIE+DG V IRGVTSTGG+T+S+Y RVF M  QQQCP GAFT+SF LPGPVDP
Sbjct  119  DPGEFNCEIEKDGKVLIRGVTSTGGRTISRYSRVFDMKIQQQCPSGAFTVSFSLPGPVDP  178

Query  290  RLFSPNFGCDGIFEGVVAKY  231
            RLFSPNF  DGIFE VV KY
Sbjct  179  RLFSPNFRSDGIFEAVVMKY  198



>ref|XP_004238457.1| PREDICTED: uncharacterized protein LOC101267233 [Solanum lycopersicum]
 ref|XP_010320481.1| PREDICTED: uncharacterized protein LOC101267233 [Solanum lycopersicum]
 ref|XP_010320482.1| PREDICTED: uncharacterized protein LOC101267233 [Solanum lycopersicum]
Length=200

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNME-SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKR  471
            RPCMM LLP+PN+E  +S    IL+GTACKGV GPP+G  DIGVS SAYYFR+ALPGVK+
Sbjct  59   RPCMMSLLPLPNLEYCNSGGPAILTGTACKGVAGPPVGVVDIGVSISAYYFRIALPGVKK  118

Query  470  DPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
            DPG+FNCEIE+DG V IRGVTSTGG+TVS+Y RVF M  QQQCP G FT+SFRLPGPVDP
Sbjct  119  DPGEFNCEIEKDGKVLIRGVTSTGGRTVSRYSRVFDMKIQQQCPSGPFTVSFRLPGPVDP  178

Query  290  RLFSPNFGCDGIFEGVVAKY  231
            RLFSPNF  DGIFE VV KY
Sbjct  179  RLFSPNFRSDGIFEAVVMKY  198



>emb|CDP12005.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNM-ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            PCMMPLLPIPNM E SS   +IL+G A +G  GPP+GA DIGVSKSAYYF VALPGVK+D
Sbjct  100  PCMMPLLPIPNMQERSSDLCVILNGAANRGGIGPPVGAVDIGVSKSAYYFCVALPGVKKD  159

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
            PG+F+CE+ERDG VH+RGVT+TG +TVS+  RV+ M  QQQCPPG FTLSF LPGPVDPR
Sbjct  160  PGEFSCEVERDGNVHVRGVTTTGARTVSRNSRVYGMKFQQQCPPGPFTLSFSLPGPVDPR  219

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF PNF  DGIFEGVV K
Sbjct  220  LFYPNFRSDGIFEGVVVK  237



>ref|XP_009599962.1| PREDICTED: uncharacterized protein LOC104095525 [Nicotiana tomentosiformis]
 ref|XP_009599963.1| PREDICTED: uncharacterized protein LOC104095525 [Nicotiana tomentosiformis]
Length=197

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 14/196 (7%)
 Frame = -3

Query  779  MDALRSEkkgkkvigknsKQNLNGENDSPQ----VEVEGYSRR--------SNLERRPCM  636
            M+ L  EKK K++I K SK+  NGE+ +      +++EG  ++        S+L+R+  M
Sbjct  1    MECLHPEKKVKRIIWKRSKEKPNGEDSAENGMSLIKMEGNVKKRAHSDPMTSDLDRQ-YM  59

Query  635  MPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD  459
            M LLP+PN+E  +S   ++L+GTACKG TGPP+G  DIGVS+SAYYFR+ALPGVK+DPG+
Sbjct  60   MSLLPLPNLEECNSGVPIVLTGTACKGATGPPVGVVDIGVSESAYYFRIALPGVKKDPGE  119

Query  458  FNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFS  279
            F+CEIE+DG V IRG+TSTGG+ VS+Y RVF M  QQQC  G FT+SF LPGPVDPRLFS
Sbjct  120  FSCEIEKDGKVLIRGLTSTGGRIVSRYSRVFDMKIQQQCSSGPFTVSFSLPGPVDPRLFS  179

Query  278  PNFGCDGIFEGVVAKY  231
            PNF  DGIFE VV KY
Sbjct  180  PNFRSDGIFEAVVVKY  195



>ref|XP_011074063.1| PREDICTED: uncharacterized protein LOC105158865 isoform X2 [Sesamum 
indicum]
 ref|XP_011074064.1| PREDICTED: uncharacterized protein LOC105158865 isoform X2 [Sesamum 
indicum]
Length=199

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKR  471
            +P  +PLLPIP +E   S  S++ +GTAC+G TGPP+G  DIGVSKSAYYF VALPGVK+
Sbjct  59   QPFALPLLPIPKVEEWCSNTSIVFTGTACRGRTGPPVGVVDIGVSKSAYYFCVALPGVKK  118

Query  470  DPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
            DPG+F+CEI+RDG V +RGVTSTG KTV+KY RVF M  QQQCPPG FTL F LPGPVDP
Sbjct  119  DPGEFSCEIQRDGKVCVRGVTSTGAKTVTKYSRVFEMKFQQQCPPGPFTLFFSLPGPVDP  178

Query  290  RLFSPNFGCDGIFEGVVAKY  231
            RLFSP+F  DGIFE VVAKY
Sbjct  179  RLFSPSFRSDGIFEAVVAKY  198



>ref|XP_011074062.1| PREDICTED: uncharacterized protein LOC105158865 isoform X1 [Sesamum 
indicum]
Length=237

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKR  471
            +P  +PLLPIP +E   S  S++ +GTAC+G TGPP+G  DIGVSKSAYYF VALPGVK+
Sbjct  97   QPFALPLLPIPKVEEWCSNTSIVFTGTACRGRTGPPVGVVDIGVSKSAYYFCVALPGVKK  156

Query  470  DPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
            DPG+F+CEI+RDG V +RGVTSTG KTV+KY RVF M  QQQCPPG FTL F LPGPVDP
Sbjct  157  DPGEFSCEIQRDGKVCVRGVTSTGAKTVTKYSRVFEMKFQQQCPPGPFTLFFSLPGPVDP  216

Query  290  RLFSPNFGCDGIFEGVVAKY  231
            RLFSP+F  DGIFE VVAKY
Sbjct  217  RLFSPSFRSDGIFEAVVAKY  236



>gb|EYU41195.1| hypothetical protein MIMGU_mgv1a014259mg [Erythranthe guttata]
Length=195

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = -3

Query  638  MMPLLPIPNM-ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPG  462
            +MP+LP+P M E   K S+   GTAC+GVTGPP+G  DIGVSK+AYYF +ALPGVK+DPG
Sbjct  57   VMPMLPMPKMDEWCLKKSICFGGTACRGVTGPPVGVVDIGVSKNAYYFCIALPGVKKDPG  116

Query  461  DFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLF  282
            +F+CEI R+G V+I+GVT+TGG TVSKY RVF M  QQQCPPG FTL F LPGPVDPRLF
Sbjct  117  EFSCEIRREGKVYIQGVTTTGGNTVSKYSRVFVMKMQQQCPPGPFTLLFSLPGPVDPRLF  176

Query  281  SPNFGCDGIFEGVVAKY  231
            SP F  DGIFEGVVAKY
Sbjct  177  SPTFRSDGIFEGVVAKY  193



>ref|XP_009350890.1| PREDICTED: uncharacterized protein LOC103942428 [Pyrus x bretschneideri]
 ref|XP_009350891.1| PREDICTED: uncharacterized protein LOC103942428 [Pyrus x bretschneideri]
Length=397

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -3

Query  704  NDSPQVEVEGYSRRSNLERRPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFD  528
            ++S     +G S  SN +  P +MPL+ +PNME  +S +S++LSGTA KGV GPPIG  D
Sbjct  240  SESKHYNKDGASWMSNPDG-PALMPLISLPNMEEPTSDSSIVLSGTARKGVVGPPIGLVD  298

Query  527  IGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQ  348
            IGVSK AYYFRVALPGV++D   F+CEIE +G VH++G+TS GG  + K  RVF M  QQ
Sbjct  299  IGVSKVAYYFRVALPGVRKDFCQFSCEIESNGKVHLQGITS-GGNPIRKRSRVFQMKLQQ  357

Query  347  QCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
             CP G FTLSF LPGPVDPRLF+P+FG DGIFEGV+ K
Sbjct  358  LCPAGPFTLSFSLPGPVDPRLFAPHFGSDGIFEGVIVK  395



>ref|XP_009372623.1| PREDICTED: uncharacterized protein LOC103961758 [Pyrus x bretschneideri]
 ref|XP_009372624.1| PREDICTED: uncharacterized protein LOC103961758 [Pyrus x bretschneideri]
Length=397

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -3

Query  704  NDSPQVEVEGYSRRSNLERRPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFD  528
            ++S     +G S  SN +  P +MPL+ +PNME  +S +S++LSGTA KGV GPPIG  D
Sbjct  240  SESKHYNKDGASWMSNPDG-PALMPLISLPNMEEPTSDSSIVLSGTARKGVVGPPIGLVD  298

Query  527  IGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQ  348
            IGVSK AYYFRVALPGV++D   F+CEIE +G VH++G+TS GG  + K  RVF M  QQ
Sbjct  299  IGVSKVAYYFRVALPGVRKDFCQFSCEIESNGKVHLQGITS-GGNPIRKRSRVFQMKLQQ  357

Query  347  QCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
             CP G FTLSF LPGPVDPRLF+P+FG DGIFEGV+ K
Sbjct  358  LCPAGPFTLSFSLPGPVDPRLFAPHFGSDGIFEGVIVK  395



>ref|XP_008373379.1| PREDICTED: uncharacterized protein LOC103436705 [Malus domestica]
 ref|XP_008373380.1| PREDICTED: uncharacterized protein LOC103436705 [Malus domestica]
 ref|XP_008373382.1| PREDICTED: uncharacterized protein LOC103436708 [Malus domestica]
 ref|XP_008373383.1| PREDICTED: uncharacterized protein LOC103436708 [Malus domestica]
Length=397

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 118/163 (72%), Gaps = 10/163 (6%)
 Frame = -3

Query  698  SPQVEVE-------GYSRRSNLERRPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPP  543
            SPQV  E       G S  SN +  P +MPL+ +PNME  +S +S++LSGTA KGV GPP
Sbjct  235  SPQVXSESKHYNKDGASWMSNPDG-PALMPLISLPNMEEPTSDSSIVLSGTARKGVVGPP  293

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            +G  DIGVSK AYYFRVALPGV++D   F+CEIE +G VH++G+TS GG  + K  RVF 
Sbjct  294  VGLVDIGVSKVAYYFRVALPGVRKDFCQFSCEIESNGKVHLQGITS-GGNPIRKRSRVFQ  352

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M  QQ CP G FTLSF LPGPVDPRLF+P+FG DGIFEGV+ K
Sbjct  353  MKLQQLCPAGPFTLSFSLPGPVDPRLFAPHFGSDGIFEGVIVK  395



>ref|XP_009796244.1| PREDICTED: uncharacterized protein LOC104242838 [Nicotiana sylvestris]
 ref|XP_009796245.1| PREDICTED: uncharacterized protein LOC104242838 [Nicotiana sylvestris]
Length=201

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKR  471
            RP MM LLP+PN+E  +S   ++L+GTACKG TGPP+G  DIGVS++AYYFR+ALPGVK+
Sbjct  59   RPYMMSLLPLPNLEECNSGVPIVLTGTACKGATGPPVGVVDIGVSEAAYYFRIALPGVKK  118

Query  470  DPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
            DPG+F+CEIE DG V IRG+TSTGG+TVSKY RVF M  QQQC  G FTLSF LPGPVDP
Sbjct  119  DPGEFSCEIENDGKVLIRGLTSTGGRTVSKYSRVFDMKIQQQCSSGPFTLSFSLPGPVDP  178



>gb|EPS65494.1| hypothetical protein M569_09287 [Genlisea aurea]
Length=181

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = -3

Query  635  MPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD  459
            +PLL IP +E   S + +  +GTA +  TGPPIG  DIGVSKSAYYF +ALPGVK DPG+
Sbjct  45   LPLLSIPKVEEWCSGSGIAFTGTASRVGTGPPIGVLDIGVSKSAYYFCIALPGVKMDPGE  104

Query  458  FNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFS  279
            F C I+R+G V ++G+TSTGGK V+KY RVF M  QQQCPPG F + F LPGPVDPRLF+
Sbjct  105  FRCGIQREGKVCVQGITSTGGKIVTKYSRVFEMKLQQQCPPGPFKILFSLPGPVDPRLFA  164

Query  278  PNFGCDGIFEGVVAKYS  228
            P F  DGIFEGVVAK++
Sbjct  165  PCFRSDGIFEGVVAKFT  181



>gb|KDO85222.1| hypothetical protein CISIN_1g039702mg [Citrus sinensis]
Length=397

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPN-MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P MMPLL +PN  E  S AS+ L+GTA KG+ GPPIG  DIG+SK AY+F+ ALPGV+RD
Sbjct  259  PAMMPLLTVPNGKECMSDASVTLTGTATKGMVGPPIGVVDIGISKLAYFFQAALPGVRRD  318

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               F+CEIE DG VHIRG TS GGKT+ K  RVF M   Q CPPG FTL F LPGPVDPR
Sbjct  319  YSHFSCEIEADGKVHIRGSTS-GGKTIRKRSRVFRMRLHQICPPGQFTLDFSLPGPVDPR  377

Query  287  LFSPNFGCDGIFEGVVAK  234
            LFSP+F CDGIFE VV K
Sbjct  378  LFSPHFRCDGIFEAVVIK  395



>ref|XP_008356415.1| PREDICTED: uncharacterized protein LOC103420129 [Malus domestica]
 ref|XP_008356416.1| PREDICTED: uncharacterized protein LOC103420129 [Malus domestica]
 ref|XP_008356417.1| PREDICTED: uncharacterized protein LOC103420129 [Malus domestica]
 ref|XP_008356418.1| PREDICTED: uncharacterized protein LOC103420129 [Malus domestica]
Length=397

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 117/163 (72%), Gaps = 10/163 (6%)
 Frame = -3

Query  698  SPQVEVE-------GYSRRSNLERRPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPP  543
            SPQV  E       G S  SN +  P +MPL+ +PNME  +S  S++LSGTA KGV GPP
Sbjct  235  SPQVXSESKHYNKDGASWMSNPDG-PALMPLISLPNMEEPTSDXSIVLSGTARKGVVGPP  293

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            +G  DIGVSK AYYFRVALPGV++D   F+CEIE +G VH++G+TS GG  + K  RVF 
Sbjct  294  VGLVDIGVSKVAYYFRVALPGVRKDFCQFSCEIESNGKVHLQGITS-GGNPIRKRSRVFQ  352

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M  QQ CP G FTLSF LPGPVDPRLF+P+FG DGIFEGV+ K
Sbjct  353  MKLQQLCPAGPFTLSFSLPGPVDPRLFAPHFGSDGIFEGVIVK  395



>ref|XP_010664003.1| PREDICTED: uncharacterized protein LOC100246169 isoform X2 [Vitis 
vinifera]
Length=340

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = -3

Query  680  EGYSRRSNLERRPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAY  504
             G  RR NL+  P MMPLL + N E   S+AS++L+G A +   GPPIG  DIGVSK+AY
Sbjct  187  HGSPRRCNLDG-PSMMPLLSVSNAEECKSEASIVLTGVAGEVSAGPPIGRVDIGVSKTAY  245

Query  503  YFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFT  324
            +FRVALPGV++D   F CE+E DG V I G TS GG+T+ K+ RVF M  QQ CPPG FT
Sbjct  246  FFRVALPGVRKDNRHFGCEVENDGKVQIHGSTSAGGRTIVKHPRVFQMKLQQLCPPGPFT  305

Query  323  LSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            +SFRLPGPVDPRLF  NF  DGIFEG++ K
Sbjct  306  VSFRLPGPVDPRLFKANFRSDGIFEGIIVK  335



>ref|XP_002273277.1| PREDICTED: uncharacterized protein LOC100246169 isoform X1 [Vitis 
vinifera]
 ref|XP_010664002.1| PREDICTED: uncharacterized protein LOC100246169 isoform X1 [Vitis 
vinifera]
Length=395

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = -3

Query  680  EGYSRRSNLERRPCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAY  504
             G  RR NL+  P MMPLL + N E   S+AS++L+G A +   GPPIG  DIGVSK+AY
Sbjct  242  HGSPRRCNLDG-PSMMPLLSVSNAEECKSEASIVLTGVAGEVSAGPPIGRVDIGVSKTAY  300

Query  503  YFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFT  324
            +FRVALPGV++D   F CE+E DG V I G TS GG+T+ K+ RVF M  QQ CPPG FT
Sbjct  301  FFRVALPGVRKDNRHFGCEVENDGKVQIHGSTSAGGRTIVKHPRVFQMKLQQLCPPGPFT  360

Query  323  LSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            +SFRLPGPVDPRLF  NF  DGIFEG++ K
Sbjct  361  VSFRLPGPVDPRLFKANFRSDGIFEGIIVK  390



>ref|XP_004300107.1| PREDICTED: uncharacterized protein LOC101291244 [Fragaria vesca 
subsp. vesca]
Length=391

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 105/138 (76%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMESS-SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P +MP L +P ME+S S  S++LSGT  +GV GPPIGA DIG+SK AYYFRV+LPG+++D
Sbjct  253  PLIMPHLSVPRMEASVSDPSIVLSGTVKRGVVGPPIGAVDIGISKVAYYFRVSLPGIRKD  312

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               F+CEIE +G VH+ G TS GG  + K  RVF M  QQ CPPG FTLSF LPGPVDPR
Sbjct  313  FCQFSCEIEPNGKVHLEGFTS-GGNPIKKRSRVFQMKVQQVCPPGPFTLSFSLPGPVDPR  371

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+PNFG DGIFEGV+ K
Sbjct  372  LFAPNFGSDGIFEGVILK  389



>ref|XP_006473921.1| PREDICTED: uncharacterized protein LOC102607717 [Citrus sinensis]
Length=600

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 114/173 (66%), Gaps = 19/173 (11%)
 Frame = -3

Query  644  PCMMPLLPIPN-MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P MMPLL +PN  E  S AS+ L+GTA KG+ GPPIG  DIG+SK AY+F+ ALPGV+RD
Sbjct  259  PAMMPLLTVPNGKECMSDASVTLTGTATKGMVGPPIGVVDIGISKLAYFFQAALPGVRRD  318

Query  467  --------PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFR  312
                     G F+CEIE DG VHIRG TS GGKT+ K  RVF M   Q CPPG FTL F 
Sbjct  319  YSYYADHEAGHFSCEIEADGKVHIRGSTS-GGKTIRKRSRVFRMRLHQICPPGQFTLDFS  377

Query  311  LPGPVDPRLFSPNFGCDGIFEGVVAKYSP*LHVCMHTTV*TRLVYSISPVILY  153
            LPGPVDPRLFSP+F CDGIFE VV K           +  T L++ ++ V +Y
Sbjct  378  LPGPVDPRLFSPHFRCDGIFEAVVIK---------QNSSTTNLLFGLAHVYIY  421


 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K  +++ G+A +G   PP+G +DIGVS  AY FRV+LPG ++D  +  C I R+G V I+
Sbjct  472  KPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQ  531

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV  T G       +V+ M  QQ CPPG FT+SF LPGPVDPRLF P F  DGI EGVV 
Sbjct  532  GVM-TEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVM  590

Query  236  KY  231
            K+
Sbjct  591  KH  592



>ref|XP_010259756.1| PREDICTED: uncharacterized protein LOC104599085 [Nelumbo nucifera]
Length=397

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 112/167 (67%), Gaps = 9/167 (5%)
 Frame = -3

Query  704  NDSPQV--EVEGYSRRSNLERRPC------MMPLLPIPNMES-SSKASLILSGTACKGVT  552
            ND  Q+   ++G     ++  RPC      ++ L P PNM+  +SK  ++L+G A +G  
Sbjct  226  NDLLQIPTRIQGQQPIEDVLVRPCNLGGPSIVSLAPTPNMKQWNSKIPMVLTGAAKEGRA  285

Query  551  GPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYR  372
            GPPIG  DIG+S+ AY FRVALPGVKRDPG  +CEIE DG VH+RG+T TG K + ++ R
Sbjct  286  GPPIGLVDIGISRDAYLFRVALPGVKRDPGHLSCEIEHDGKVHLRGMTMTGEKFILRHSR  345

Query  371  VFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAKY  231
            +F M  Q  CPPG FT+SF LPGPVDPRLF P+F  DGI E VV KY
Sbjct  346  IFRMQTQNLCPPGPFTISFSLPGPVDPRLFLPDFRSDGILEAVVMKY  392



>ref|XP_010246890.1| PREDICTED: uncharacterized protein LOC104590068 [Nelumbo nucifera]
 ref|XP_010246891.1| PREDICTED: uncharacterized protein LOC104590068 [Nelumbo nucifera]
 ref|XP_010246892.1| PREDICTED: uncharacterized protein LOC104590068 [Nelumbo nucifera]
 ref|XP_010246893.1| PREDICTED: uncharacterized protein LOC104590068 [Nelumbo nucifera]
Length=407

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P ++ L   P++E  +SK  + L+GTA +G  GPP+G  DIG+S+ AY FRVALPGVKRD
Sbjct  260  PSILSLTSTPSVEQWNSKIPIALTGTAKEGRAGPPVGLVDIGISRDAYLFRVALPGVKRD  319

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
            PG F+CEIE+DG VH+RGVT TG K++ ++ RVF M  Q  CPPG FT+SF LPGPVDPR
Sbjct  320  PGQFSCEIEQDGKVHLRGVTVTGEKSILRHSRVFQMKTQSLCPPGPFTISFSLPGPVDPR  379

Query  287  LFSPNFGCDGIFEGVVAKY  231
            LF P F  DGI E VV KY
Sbjct  380  LFLPEFRSDGILEAVVMKY  398



>gb|KDP36748.1| hypothetical protein JCGZ_08039 [Jatropha curcas]
Length=409

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = -3

Query  698  SPQVEVEGYSRRSNLERRPCMMPLLPIPNMESS-SKASLILSGTACKGVTGPPIGAFDIG  522
            S Q   E  S+R+        MP++ +P +E   S  S++L+GTA +G+ GP +G  DIG
Sbjct  242  SEQQNEESTSKRTFKLDGSAAMPIITLPKLEDCISDESIVLTGTARRGMAGPQVGLVDIG  301

Query  521  VSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQC  342
            +SK+AY+F+VALPGV+RD  +F+CEIE DG VHI+G  S GG+T+ K  R F M  QQ C
Sbjct  302  ISKAAYFFQVALPGVRRDFCEFSCEIESDGKVHIQGSLS-GGRTIRKRSRAFKMKFQQMC  360

Query  341  PPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA----KYSP*LH  216
            PPG FTLSF LPGPVDPRLFSPNF  DGIFE V+     K+SP +H
Sbjct  361  PPGPFTLSFSLPGPVDPRLFSPNFRTDGIFEAVIIKTQRKFSPQVH  406



>emb|CBI40762.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 108/163 (66%), Gaps = 6/163 (4%)
 Frame = -3

Query  704  NDSPQVEVEGYSRRSNLERRPCMMPLLPIP------NMESSSKASLILSGTACKGVTGPP  543
            N+S + +   ++ R  +ER    +   P        N  S SKAS++L+G A +   GPP
Sbjct  173  NESQRYQHRHWTGREEIERNFLTISGGPYAGNASNINSISPSKASIVLTGVAGEVSAGPP  232

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            IG  DIGVSK+AY+FRVALPGV++D   F CE+E DG V I G TS GG+T+ K+ RVF 
Sbjct  233  IGRVDIGVSKTAYFFRVALPGVRKDNRHFGCEVENDGKVQIHGSTSAGGRTIVKHPRVFQ  292

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M  QQ CPPG FT+SFRLPGPVDPRLF  NF  DGIFEG++ K
Sbjct  293  MKLQQLCPPGPFTVSFRLPGPVDPRLFKANFRSDGIFEGIIVK  335



>ref|XP_007209223.1| hypothetical protein PRUPE_ppa006877mg [Prunus persica]
 gb|EMJ10422.1| hypothetical protein PRUPE_ppa006877mg [Prunus persica]
Length=392

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P  MPL+ +PN+E  +S +S++LSGTA KGV GPP+G  DIGVSK+AYYFRVALPGV++D
Sbjct  254  PVFMPLISVPNLEECTSDSSVVLSGTARKGVVGPPVGVVDIGVSKAAYYFRVALPGVRKD  313

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               FNCEIE +G +H++GVTS GG  + K  RVF M  QQ CPPG FTLSF LPGPVDPR
Sbjct  314  FCQFNCEIESNGKIHLQGVTS-GGNPIRKRSRVFQMKLQQLCPPGPFTLSFSLPGPVDPR  372

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+PNFG DGIFEGV+ K
Sbjct  373  LFAPNFGPDGIFEGVIIK  390



>ref|XP_004487660.1| PREDICTED: uncharacterized protein LOC101500685 isoform X1 [Cicer 
arietinum]
 ref|XP_004487661.1| PREDICTED: uncharacterized protein LOC101500685 isoform X2 [Cicer 
arietinum]
Length=391

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 105/138 (76%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMESSSK-ASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P MM L+PIP+++   + +S++L+GTA +G+ GP +G  DIG+SK AY FRV+LPGVKR+
Sbjct  254  PSMMSLIPIPDIDDYVQDSSVVLTGTAKRGILGPSVGVVDIGISKVAYLFRVSLPGVKRE  313

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
              +F+C+IE DG V I+G+ S GG T++K  R+F M  QQ C PG FTLSF LPGPVDPR
Sbjct  314  FNEFSCDIESDGRVEIKGMLS-GGITIAKQSRIFQMKTQQLCSPGPFTLSFSLPGPVDPR  372

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+PNF  DGIFEGVV K
Sbjct  373  LFAPNFRSDGIFEGVVIK  390



>ref|XP_006597328.1| PREDICTED: uncharacterized protein LOC100786407 isoform X3 [Glycine 
max]
 gb|KHN33469.1| hypothetical protein glysoja_005511 [Glycine soja]
Length=393

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = -3

Query  671  SRRSNLERRPCMMPLLPIPNMESSSK-ASLILSGTACKGVTGPPIGAFDIGVSKSAYYFR  495
            SR+      P  MPLLPIP+++  ++ +SLIL+G A +G  GP +G  DIG+SK AY FR
Sbjct  247  SRKKCKSDGPTFMPLLPIPDVDDCNRDSSLILTGAARRGPFGPSVGVVDIGISKVAYLFR  306

Query  494  VALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSF  315
            ++LPGVK+D   F+C+IE DG V IRGV  TGG T++K  RVF M  +Q C PG FTLSF
Sbjct  307  ISLPGVKKDCSQFSCDIESDGRVQIRGVL-TGGSTITKQSRVFKMKIRQLCSPGPFTLSF  365

Query  314  RLPGPVDPRLFSPNFGCDGIFEGVVAK  234
             LPGPVDPRLF+PNF  DGIFEGV+ K
Sbjct  366  SLPGPVDPRLFAPNFRPDGIFEGVIIK  392



>ref|XP_003547550.1| PREDICTED: uncharacterized protein LOC100786407 isoform X1 [Glycine 
max]
 ref|XP_006597327.1| PREDICTED: uncharacterized protein LOC100786407 isoform X2 [Glycine 
max]
Length=394

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -3

Query  671  SRRSNLERRPCMMPLLPIPNMESSSK-ASLILSGTACKGVTGPPIGAFDIGVSKSAYYFR  495
            SR+      P  MPLLPIP+++  ++ +SLIL+G A +G  GP +G  DIG+SK AY FR
Sbjct  247  SRKKCKSDGPTFMPLLPIPDVDDCNRDSSLILTGAARRGPFGPSVGVVDIGISKVAYLFR  306

Query  494  VALPGVKRD-PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLS  318
            ++LPGVK+D  G F+C+IE DG V IRGV  TGG T++K  RVF M  +Q C PG FTLS
Sbjct  307  ISLPGVKKDCTGQFSCDIESDGRVQIRGVL-TGGSTITKQSRVFKMKIRQLCSPGPFTLS  365

Query  317  FRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            F LPGPVDPRLF+PNF  DGIFEGV+ K
Sbjct  366  FSLPGPVDPRLFAPNFRPDGIFEGVIIK  393



>ref|XP_008238065.1| PREDICTED: uncharacterized protein LOC103336744 [Prunus mume]
Length=924

 Score =   169 bits (428),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P  MPL+ +PN+E  +S +S++LSGTA KGV GPP+G  DIGVSK+AYYFRVALPGV++D
Sbjct  254  PVFMPLISVPNLEDCTSDSSVVLSGTARKGVVGPPVGVVDIGVSKAAYYFRVALPGVRKD  313

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               FNCEIE +G +H++GVTS GG  + K  RVF M  QQ CPPG FTLSF LPGPVDPR
Sbjct  314  FCQFNCEIESNGKIHLQGVTS-GGNPIRKRSRVFQMKLQQLCPPGPFTLSFSLPGPVDPR  372

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+PNFG DGIFEGV+ K
Sbjct  373  LFAPNFGPDGIFEGVIIK  390


 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = -3

Query  590  SLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGV  411
            +++L GTA  G  GPP G  DIGVS++AY FRVALPG++++     C+I+RDG VHI G+
Sbjct  413  AVVLIGTAKGGNVGPPSGLVDIGVSEAAYLFRVALPGIRKNECRVKCDIQRDGKVHIEGI  472

Query  410  TSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
              TG   +     V+ +  QQ CPPGAF++SFRLPGPVDPRLFSP F  DGI E VV K
Sbjct  473  M-TGVGLLRNSSTVYRLRVQQLCPPGAFSISFRLPGPVDPRLFSPYFRHDGILEVVVMK  530



>ref|XP_006584590.1| PREDICTED: uncharacterized protein LOC100804780 isoform X1 [Glycine 
max]
 gb|KHN26688.1| hypothetical protein glysoja_011280 [Glycine soja]
Length=393

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNM-ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P  MPL+ IP++ + +  +SLIL GTA +G  GP +G  DIG+SK AY FRV+LPGVK+D
Sbjct  256  PTFMPLISIPDIGDCNGDSSLILKGTARRGPFGPSVGVVDIGISKVAYLFRVSLPGVKKD  315

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               F+C+IE DG V IRGV  TGG T++K  RVF M  +Q C PG FTLSF LPGPVDPR
Sbjct  316  FSQFSCDIESDGRVQIRGVL-TGGSTITKQSRVFQMKIRQLCSPGPFTLSFSLPGPVDPR  374

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+PNF  DGIFEGVV K
Sbjct  375  LFAPNFRPDGIFEGVVIK  392



>ref|XP_002300625.2| hypothetical protein POPTR_0002s00690g [Populus trichocarpa]
 gb|EEE79898.2| hypothetical protein POPTR_0002s00690g [Populus trichocarpa]
Length=396

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 105/156 (67%), Gaps = 8/156 (5%)
 Frame = -3

Query  680  EGYSRRSNLERRPC------MMPLLPIPNMESS-SKASLILSGTACKGVTGPPIGAFDIG  522
            +G+S  SN   R C       MP +  P  +   +  S+IL+GTA + +TGPPIG  DIG
Sbjct  240  QGHSEESNTFGRSCKLDGPTTMPRVAFPKFKDYFTDKSVILTGTARRELTGPPIGIVDIG  299

Query  521  VSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQC  342
            +SK+AY+F+VALPGV+ D  +F+CEIE  G VHI+G TS GGK + K  RVF M  QQ C
Sbjct  300  ISKAAYFFQVALPGVRSDSCEFSCEIESGGKVHIQGSTS-GGKIIKKRSRVFHMKSQQMC  358

Query  341  PPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            PPG FT+SF LPGPVDPRL SP F  DGIFE VV K
Sbjct  359  PPGPFTVSFNLPGPVDPRLVSPKFRTDGIFEAVVIK  394



>ref|XP_003596486.1| hypothetical protein MTR_2g081050 [Medicago truncatula]
 gb|AES66737.1| alpha-crystallin domain of heat shock protein [Medicago truncatula]
Length=453

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMESSSKA-SLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P +MPLL IP+++   ++ S++L+GTA +G+ GP +G  DIG+S+ AY FRV +PGVKR+
Sbjct  316  PSLMPLLSIPDIDDCVQSYSVVLTGTANRGLLGPSVGVVDIGISEVAYLFRVLVPGVKRE  375

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               F+C+IE DG V IRG+ S GG+T+++  R+F M   Q C PG FT+SF LPGPVDPR
Sbjct  376  HNRFSCDIESDGKVEIRGLLS-GGRTIARQSRLFQMKTHQLCSPGPFTISFSLPGPVDPR  434

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+PNF  DGIFEGVV K
Sbjct  435  LFAPNFRSDGIFEGVVIK  452



>ref|XP_003593054.1| hypothetical protein MTR_2g007290 [Medicago truncatula]
 gb|AES63305.1| alpha-crystallin domain of heat shock protein [Medicago truncatula]
Length=442

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNMESSSK-ASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKR  471
             P +MPL+ +P+++S  +  S++L+GTA +G+ GP +G  DIG+SK AY FRV+LPGVKR
Sbjct  304  EPSLMPLISLPDIDSCVQDHSIVLTGTANRGLLGPSVGVVDIGISKVAYLFRVSLPGVKR  363

Query  470  DPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
            +   F+C+IE DG V IRG+ S G +T++   RVF M  QQ C PG FT+SF LPGPVDP
Sbjct  364  EYNQFSCDIESDGKVEIRGLLS-GIRTIATQSRVFQMKTQQLCSPGPFTISFSLPGPVDP  422

Query  290  RLFSPNFGCDGIFEGVVAK  234
            RLF+PNF  DGIFEGVV K
Sbjct  423  RLFAPNFRDDGIFEGVVIK  441



>ref|XP_011034812.1| PREDICTED: uncharacterized protein LOC105132809 [Populus euphratica]
 ref|XP_011034813.1| PREDICTED: uncharacterized protein LOC105132809 [Populus euphratica]
 ref|XP_011034814.1| PREDICTED: uncharacterized protein LOC105132809 [Populus euphratica]
Length=396

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 105/156 (67%), Gaps = 8/156 (5%)
 Frame = -3

Query  680  EGYSRRSNLERRPCM------MPLLPIPNMESS-SKASLILSGTACKGVTGPPIGAFDIG  522
            +G+S  SN   R C       MP +  P  +   +  S++L+GTA + +TGPPIG  DIG
Sbjct  240  QGHSEESNTFGRSCKLDGPTSMPHVAFPKFKDYFTDKSVVLTGTARRELTGPPIGIVDIG  299

Query  521  VSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQC  342
            +S++AY+F+VALPGV+ D  +F+CEIE  G VHI+G TS GGK + K  RVF M  QQ C
Sbjct  300  ISRAAYFFQVALPGVRSDSCEFSCEIESSGKVHIQGSTS-GGKIIKKRSRVFHMKSQQMC  358

Query  341  PPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            PPG FT+SF LPGPVDPRL SP F  DGIFE VV K
Sbjct  359  PPGPFTVSFNLPGPVDPRLVSPKFRTDGIFEAVVIK  394



>ref|NP_001242575.1| uncharacterized protein LOC100804780 [Glycine max]
 gb|ACU21448.1| unknown [Glycine max]
Length=394

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 101/139 (73%), Gaps = 3/139 (2%)
 Frame = -3

Query  644  PCMMPLLPIPNMES-SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P  MPL+ IP++   +  +SLIL GTA +G  GP +G  DIG+SK AY FRV+LPGVK+D
Sbjct  256  PTFMPLISIPDIGGCNGDSSLILKGTARRGPFGPSVGVVDIGISKVAYLFRVSLPGVKKD  315

Query  467  -PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDP  291
              G F+C+IE DG V IRGV  TGG T++K  RVF M  +Q C PG FTLSF LPGPVDP
Sbjct  316  FTGQFSCDIESDGRVQIRGVL-TGGSTITKQSRVFQMKIRQLCSPGPFTLSFSLPGPVDP  374

Query  290  RLFSPNFGCDGIFEGVVAK  234
            RLF+PNF  DGIFEGVV K
Sbjct  375  RLFAPNFRPDGIFEGVVIK  393



>ref|XP_002510723.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52910.1| conserved hypothetical protein [Ricinus communis]
Length=392

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = -3

Query  617  PNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIER  438
            P ++  +   ++L+GTA KG TGP +G  DIG+S++AY+F+VALPGV+RD  +F CEIE 
Sbjct  264  PKLQDCTSKKIVLTGTARKGRTGPQVGVVDIGISRNAYFFQVALPGVRRDFCEFGCEIES  323

Query  437  DGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDG  258
             G VHI+G T +GG+T+ K  RVF M  ++ CP G FTLSF LPGPVDPRLFSPNF  DG
Sbjct  324  SGKVHIQG-TMSGGETIKKRSRVFRMKFRRLCPAGPFTLSFNLPGPVDPRLFSPNFRTDG  382

Query  257  IFEGVVAKY  231
            IFE V+ K+
Sbjct  383  IFEAVIIKH  391



>ref|XP_010498528.1| PREDICTED: uncharacterized protein LOC104776209 [Camelina sativa]
Length=467

 Score =   157 bits (398),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = -3

Query  638  MMPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD  459
             +P+LP    E  ++ S++ +GTA KG  GP +G  DIGV+K AY+F+VALPGV++D G+
Sbjct  329  FIPVLPPDMKECDAEPSVVTTGTASKGTLGPSVGVVDIGVNKVAYFFQVALPGVRKDYGE  388

Query  458  FNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFS  279
            F+CEIE DG V + G T+ G KT+ ++ RVF MT ++ CP G F + F LPGPVDPRLFS
Sbjct  389  FSCEIESDGKVILEGSTTAGEKTIKRHSRVFEMTIRKLCPSGPFKMCFSLPGPVDPRLFS  448

Query  278  PNFGCDGIFEGVVAKY  231
            PNF  DGIFE V+ ++
Sbjct  449  PNFRSDGIFEAVIIRH  464



>ref|XP_006307427.1| hypothetical protein CARUB_v10009051mg [Capsella rubella]
 gb|EOA40325.1| hypothetical protein CARUB_v10009051mg [Capsella rubella]
Length=469

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = -3

Query  647  RPCMMPLLPIPNM--ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVK  474
            +P    +LP P +  E  ++AS++ +GTA K   GP +G  DIGV+K AY+F+VALPGV+
Sbjct  326  KPTSQAVLPAPPVMKERDAEASIVTTGTASKQKLGPSVGVVDIGVNKVAYFFQVALPGVR  385

Query  473  RDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVD  294
            +D G+F+CEIE DG V I G T+TG KT+ ++ RVF M  ++  PPG F L F LPGPVD
Sbjct  386  KDYGEFSCEIESDGKVIIEGSTTTGEKTIKRHSRVFEMNIRKLSPPGPFKLCFSLPGPVD  445

Query  293  PRLFSPNFGCDGIFEGVVAKY  231
            PRLFSPNF  DGIFE V+ ++
Sbjct  446  PRLFSPNFRSDGIFEAVIIRH  466



>ref|XP_010094518.1| hypothetical protein L484_024810 [Morus notabilis]
 gb|EXB56272.1| hypothetical protein L484_024810 [Morus notabilis]
Length=395

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = -3

Query  680  EGYSRRSNLERRPCMMPLL-PIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAY  504
            +G  +R+ +   P +MPLL  +      S AS++LSG A KG  GPP+G  D+GVSK AY
Sbjct  243  KGDFQRARMSDGPAIMPLLLDVQKCIPKSDASIVLSGIAKKGKLGPPVGVVDVGVSKVAY  302

Query  503  YFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFT  324
            YFRVALPGV++D   F+CEIE  G VH+RG+T TGGKT+ K  RVF M  QQ CPPG FT
Sbjct  303  YFRVALPGVRKDYCKFSCEIESAGKVHVRGLT-TGGKTIRKPSRVFEMKFQQLCPPGPFT  361

Query  323  LSFRLPGPVDPRLFSPNFGCDGIFEGVVAKYS  228
            LSF LPGPVDPRLF+PNF  DGIFEGV+ K++
Sbjct  362  LSFTLPGPVDPRLFAPNFRSDGIFEGVIIKHT  393



>ref|XP_002893135.1| hypothetical protein ARALYDRAFT_472323 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69394.1| hypothetical protein ARALYDRAFT_472323 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = -3

Query  662  SNLERRPCMMPLLPIPNM-ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVAL  486
            ++LER     P+   P M ES ++ S++ +GTA K   G  +G  DIGV+K AY+F+VAL
Sbjct  318  TSLEREKTDKPIPVPPEMKESDAEPSVVTTGTASKETLGTSVGVVDIGVNKVAYFFQVAL  377

Query  485  PGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLP  306
            PGV++D G+F+CEIE DG V + G T+TG KT+ ++ RVF M  ++ CPPG F L F LP
Sbjct  378  PGVRKDYGEFSCEIESDGKVILEGSTTTGEKTIKRHSRVFEMNIRKLCPPGPFKLCFNLP  437

Query  305  GPVDPRLFSPNFGCDGIFEGVVAKY  231
            GPVDPRL SPNF  DGIFE V+ ++
Sbjct  438  GPVDPRLLSPNFRSDGIFEAVIIRH  462



>ref|XP_002298345.1| hypothetical protein POPTR_0001s24980g [Populus trichocarpa]
 gb|EEE83150.1| hypothetical protein POPTR_0001s24980g [Populus trichocarpa]
Length=147

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K  +ILSGTA +G  GPPIG  DIGVS++AY FRVALPG++R+  +  C+I+ +G VHI+
Sbjct  13   KPLVILSGTAKEGSAGPPIGLVDIGVSENAYLFRVALPGIRRNESNLKCDIQHNGTVHIK  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV +     +     VF M  QQ CPPG FT+SF+LPGPVDPRLF PNF  DG+ E  V 
Sbjct  73   GVVTVDAGMLKDSSSVFQMRVQQLCPPGPFTISFKLPGPVDPRLFCPNFRNDGVLEVAVM  132

Query  236  KYSP  225
            KY P
Sbjct  133  KYRP  136



>ref|XP_010686677.1| PREDICTED: uncharacterized protein LOC104900845 [Beta vulgaris 
subsp. vulgaris]
Length=146

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 94/132 (71%), Gaps = 6/132 (5%)
 Frame = -3

Query  611  MESSSKA----SLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEI  444
            ME +S A    S++++GTA +G  GP IG  DIGVS+SAY FRVALPGV++D  D +CEI
Sbjct  1    MEENSPALNPTSVVVTGTAREGTVGPAIGHVDIGVSESAYLFRVALPGVRKDNCDLSCEI  60

Query  443  ERDGMVHIRGVTSTGGKTVSKYYRV-FAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFG  267
            ERDG VH++GV  TGG+   K  +  + M   Q  PPG FT+SF+LPGPVDPRLFSP F 
Sbjct  61   ERDGKVHLQGVI-TGGELAKKNPKTEYHMNVAQLSPPGPFTISFKLPGPVDPRLFSPTFR  119

Query  266  CDGIFEGVVAKY  231
             DGI EGVV KY
Sbjct  120  SDGILEGVVMKY  131



>ref|XP_010086740.1| hypothetical protein L484_001972 [Morus notabilis]
 gb|EXB23275.1| hypothetical protein L484_001972 [Morus notabilis]
Length=394

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 6/140 (4%)
 Frame = -3

Query  635  MPLLPIP------NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVK  474
            M  LP P      N+ +++K+   L+G+A  G  GP IG  DIG  + +Y FR++LPGVK
Sbjct  247  MVFLPFPTKSELSNIVAATKSGFALTGSAAMGNMGPSIGLMDIGECEDSYLFRISLPGVK  306

Query  473  RDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVD  294
            RD  DF+CE+E DG V IRGV +TG KTV +Y ++F M  Q  CP G F++SF+LPGPVD
Sbjct  307  RDARDFSCEVESDGKVLIRGVATTGEKTVLRYSQMFEMQTQNLCPAGRFSISFKLPGPVD  366

Query  293  PRLFSPNFGCDGIFEGVVAK  234
            P+ FS NFG DGI EG+V K
Sbjct  367  PQQFSGNFGTDGILEGIVMK  386



>gb|KDO59514.1| hypothetical protein CISIN_1g043145mg, partial [Citrus sinensis]
Length=134

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
             + +++K    ++G+A  G  GP +G  DIG  + +Y FRVALPGVKRD GDF+CE++  
Sbjct  3    EITAATKTGFSVTGSAATGKVGPVVGLVDIGECEDSYMFRVALPGVKRDDGDFSCEVDPM  62

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG K+V KY +VF M  Q  CPPG F++SF+LPGPV+P  FS NFG DGI
Sbjct  63   GKVLIKGVTTTGEKSVYKYSQVFEMQTQNLCPPGHFSISFQLPGPVNPEQFSGNFGIDGI  122

Query  254  FEGVVAK  234
             EG+V K
Sbjct  123  LEGIVMK  129



>ref|XP_011035279.1| PREDICTED: uncharacterized protein LOC105133134 [Populus euphratica]
Length=147

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K  +ILSGTA +   GPPIG  DIGVS++AY FRVALPG++R+  +  C+I+ +G VHI+
Sbjct  13   KPLVILSGTAKEVSAGPPIGLVDIGVSENAYLFRVALPGIRRNESNLKCDIQHNGTVHIK  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV +     +     VF M  QQ CPPG FT+SF+LPGPVDPRLF PNF  DG+ E  V 
Sbjct  73   GVVTVDAGMLKDSSSVFQMRVQQLCPPGPFTISFKLPGPVDPRLFCPNFRNDGVLEVAVM  132

Query  236  KYSP  225
            KY P
Sbjct  133  KYRP  136



>ref|NP_173511.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
 gb|AAD30605.1|AC007369_15 Hypothetical protein [Arabidopsis thaliana]
 gb|AEE30033.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
Length=463

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
            ES ++ S++ +GTA K   G  +G  DIGV+K AY+F+VALPGV++D G+F+CEIE DG 
Sbjct  335  ESDAEPSVVTTGTASKETLGSSVGVVDIGVNKVAYFFQVALPGVRKDYGEFSCEIESDGK  394

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V + G T+ G K + ++ RVF M  ++ CPPG F L F LPGPVDPRLFSPNF  DGIFE
Sbjct  395  VILEGSTTRGEKNIKRHSRVFEMNIRKLCPPGPFKLCFNLPGPVDPRLFSPNFRSDGIFE  454

Query  248  GVVAKY  231
            GV+ ++
Sbjct  455  GVIIRH  460



>ref|XP_010477342.1| PREDICTED: uncharacterized protein LOC104756442 [Camelina sativa]
Length=456

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 97/142 (68%), Gaps = 3/142 (2%)
 Frame = -3

Query  647  RPCMMPLLPIP---NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGV  477
            +P    L+P+P     E  ++ S++ +GTA     GP +G  DIGV+  AY+F+VALPGV
Sbjct  312  KPTSQALIPVPPPDMKECDAEPSVVTTGTASNRTLGPSVGVVDIGVNNVAYFFQVALPGV  371

Query  476  KRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPV  297
            ++D G+F+CEIE DG V + G T+TG KT+ ++ RVF M  ++ CP G F L F LPGPV
Sbjct  372  RKDYGEFSCEIESDGKVILEGSTTTGEKTIQRHSRVFEMNIRKLCPSGPFKLCFSLPGPV  431

Query  296  DPRLFSPNFGCDGIFEGVVAKY  231
            DPRLFSPNF  DGIFE V+ ++
Sbjct  432  DPRLFSPNFRSDGIFEAVIIRH  453



>emb|CDP15535.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -3

Query  671  SRRSNLERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAY  504
            S   + E R   +P  P      N+ +++K    ++G+A +G  GP IG  DIG S  +Y
Sbjct  245  SSADDYEPRKIFLPSFPSREVWSNIIAATKNGFSVTGSAARGQVGPVIGLVDIGESDDSY  304

Query  503  YFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFT  324
             FRV+LPGVKRD  +F+CE+E DG V I+GV +TG KTV KY +VF M  Q  CP G F+
Sbjct  305  LFRVSLPGVKRDEREFSCEVENDGKVLIKGVATTGEKTVHKYSQVFEMQSQNLCPSGNFS  364

Query  323  LSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            +SF LPGPVDPR FS NFG DGI EG+  K
Sbjct  365  ISFNLPGPVDPRQFSGNFGTDGILEGIAMK  394



>emb|CDY29497.1| BnaA06g14730D [Brassica napus]
Length=255

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = -3

Query  635  MPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDF  456
            + L+P    E  ++A++I +GTA KG  G  I   DIGV+K+AY+F+VALPGV +  G+F
Sbjct  120  LVLVPPEMKECDAEAAVITTGTASKGTLGSSI---DIGVNKAAYFFQVALPGVCKASGEF  176

Query  455  NCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSP  276
            +CEIE DG V + G T+TG  T+ ++ RVF M  ++ C PG F LSFRLPGPVDPRLFSP
Sbjct  177  SCEIESDGKVILEGSTTTGCNTIKRHSRVFKMNIRKLCLPGPFKLSFRLPGPVDPRLFSP  236

Query  275  NFGCDGIFEGVVAK  234
            NF  DGIFE VV +
Sbjct  237  NFRSDGIFEAVVIR  250



>emb|CDY17558.1| BnaC01g26820D [Brassica napus]
Length=192

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S SK  + L+G+A  G  GP IG  DI  S  +YYFRV+LPGV RD  +F+CEIE DG +
Sbjct  64   SQSKTGVALTGSAAMGKIGPTIGLVDIAESDDSYYFRVSLPGVSRDEKEFSCEIEPDGKI  123

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG KTV K+ +VF M  Q  CPPG FT+SF+LPGPV    FS NFG DG+ EG
Sbjct  124  LIKGATTTGEKTVCKHNQVFKMLSQNLCPPGHFTISFQLPGPVSNEDFSGNFGADGVLEG  183

Query  245  VVAK  234
            VV K
Sbjct  184  VVKK  187



>ref|XP_002510722.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52909.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K  ++L+GTA +G  GPPIG  DIGVS+ AY FRVALPG++++     CEI  DG VH+R
Sbjct  13   KPPMVLTGTANEGSAGPPIGLTDIGVSEDAYLFRVALPGLRKNECSVKCEILHDGTVHVR  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV +  G  +     VF +  QQ CPPG FT+SF+LPGPVDPRLF PNF  DGI EGVV 
Sbjct  73   GVVTPDGGILRDSSGVFQLRVQQLCPPGPFTISFKLPGPVDPRLFCPNFRADGILEGVVM  132

Query  236  KYS-P*LHV  213
            K   P +HV
Sbjct  133  KQRVPVIHV  141



>ref|XP_006433285.1| hypothetical protein CICLE_v10002241mg [Citrus clementina]
 ref|XP_006472114.1| PREDICTED: uncharacterized protein LOC102620136 [Citrus sinensis]
 gb|ESR46525.1| hypothetical protein CICLE_v10002241mg [Citrus clementina]
Length=254

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
             + +++K    ++G+A  G  GP +G  DIG  + +Y FRVALPGVKRD GDF+CE++  
Sbjct  123  EITAATKTGFSVTGSAATGKVGPVVGLVDIGECEDSYMFRVALPGVKRDDGDFSCEVDPM  182

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG K+V KY +VF M  Q  CPPG F++SF+LPGPV+P  FS NFG DGI
Sbjct  183  GKVLIKGVTTTGEKSVYKYSQVFEMQTQNLCPPGHFSISFQLPGPVNPEQFSGNFGIDGI  242

Query  254  FEGVVAK  234
             EG+V K
Sbjct  243  LEGIVMK  249



>ref|XP_006416354.1| hypothetical protein EUTSA_v10007660mg [Eutrema salsugineum]
 gb|ESQ34707.1| hypothetical protein EUTSA_v10007660mg [Eutrema salsugineum]
Length=439

 Score =   149 bits (376),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -3

Query  590  SLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGV  411
            +++++GTA KG +GP IGA DIGV++ AY+F+VALPGV +D G+F+CEIE DG V + G 
Sbjct  317  AVVITGTASKGASGPSIGAVDIGVNEVAYFFQVALPGVSQDNGEFSCEIESDGKVILEGS  376

Query  410  TSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            T+TG KTV+++ RVF M  ++ CPPG F L F LPGPVDPRL SP F  DGIFE V+ +
Sbjct  377  TTTGVKTVNRFSRVFEMKVKKLCPPGPFKLCFSLPGPVDPRLVSPIFRSDGIFEAVIIR  435



>ref|XP_006392479.1| hypothetical protein EUTSA_v10023692mg [Eutrema salsugineum]
 gb|ESQ29765.1| hypothetical protein EUTSA_v10023692mg [Eutrema salsugineum]
Length=207

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N  + +K  + L+G+A  G  GP IG  DI  S  +YYFRV+LPGV RD  DF+CEIE D
Sbjct  76   NFIAQTKTGVALTGSAAMGKIGPTIGLVDIAESDDSYYFRVSLPGVSRDEKDFSCEIEPD  135

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+G T+TG KTV K+ +VF M  Q  CPPG FT+SF+LPGPV    F+ NFG DG+
Sbjct  136  GKILIKGATTTGEKTVCKHNQVFKMLTQNLCPPGHFTISFQLPGPVSSDDFNGNFGADGV  195

Query  254  FEGVVAK  234
             EGVV K
Sbjct  196  LEGVVKK  202



>emb|CDY43486.1| BnaA01g21410D [Brassica napus]
Length=244

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S SK  + L+G+A  G  GP IG  DI  S  +YYFRV+LPGV RD  +F+CEIE DG +
Sbjct  116  SQSKTGVALTGSAAMGKIGPTIGLVDIAESDDSYYFRVSLPGVSRDEKEFSCEIEPDGKI  175

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG KTV K+ +VF M  Q  CPPG FT+SF+LPGPV    FS NFG DG+ EG
Sbjct  176  LIKGATTTGEKTVCKHNQVFKMLSQNLCPPGHFTISFQLPGPVSNEDFSGNFGADGVLEG  235

Query  245  VVAK  234
            VV K
Sbjct  236  VVKK  239



>ref|XP_009149565.1| PREDICTED: uncharacterized protein LOC103872871 [Brassica rapa]
Length=255

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = -3

Query  635  MPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDF  456
            + L+P    E  ++A++I +GTA KG  G  I   DIGV+K+AY+F+VALPGV +  G+F
Sbjct  120  LVLVPPEMKECDAEAAVITTGTASKGTLGSSI---DIGVNKAAYFFQVALPGVCKASGEF  176

Query  455  NCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSP  276
            +CEIE DG V + G ++TG  T+ ++ RVF M  ++ C PG F LSFRLPGPVDPRLFSP
Sbjct  177  SCEIESDGKVILEGSSTTGCNTIKRHSRVFKMNIRKLCLPGPFKLSFRLPGPVDPRLFSP  236

Query  275  NFGCDGIFEGVVAK  234
            NF  DGIFE VV +
Sbjct  237  NFRSDGIFEAVVIR  250



>ref|XP_004166361.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224805 
[Cucumis sativus]
Length=391

 Score =   148 bits (373),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++     L+GTA  G  GP IG+ DIG  + +Y FRV+LPGVKRDP  FNCE+E+D
Sbjct  261  NLVAATNTGFALTGTAAMGNVGPIIGSMDIGECEDSYLFRVSLPGVKRDPCGFNCEVEKD  320

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG +TV K+ +VF M     CPPG F+LSF+LPGPVDP+ F  NF   GI
Sbjct  321  GRVVIKGVTTTGERTVKKHSQVFEMVTHNLCPPGEFSLSFQLPGPVDPQHFLANFDIAGI  380

Query  254  FEGVVAK  234
             EGVV K
Sbjct  381  LEGVVMK  387



>ref|XP_004139188.1| PREDICTED: uncharacterized protein LOC101212060 [Cucumis sativus]
 gb|KGN60887.1| hypothetical protein Csa_2G021580 [Cucumis sativus]
Length=391

 Score =   148 bits (373),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++     L+GTA  G  GP IG+ DIG  + +Y FRV+LPGVKRDP  FNCE+E+D
Sbjct  261  NLVAATNTGFALTGTAAMGNVGPIIGSMDIGECEDSYLFRVSLPGVKRDPCGFNCEVEKD  320

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG +TV K+ +VF M     CPPG F+LSF+LPGPVDP+ F  NF   GI
Sbjct  321  GRVVIKGVTTTGERTVKKHSQVFEMVTHNLCPPGEFSLSFQLPGPVDPQHFLANFDIAGI  380

Query  254  FEGVVAK  234
             EGVV K
Sbjct  381  LEGVVMK  387



>ref|XP_010659835.1| PREDICTED: uncharacterized protein LOC100249373 isoform X2 [Vitis 
vinifera]
Length=235

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = -3

Query  644  PCMMPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDP  465
            P    +  + N+ ++++    L+G+A  G  GP IG  DIG  + +Y FRV+LPGVKRD 
Sbjct  94   PSHPTMEELKNIVAATRGGFALTGSAAVGQIGPAIGHMDIGECEDSYLFRVSLPGVKRDE  153

Query  464  GDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRL  285
             +F+CE+E DG V IRGVT+TG +TV    +VF M  Q  CP G F++SF+LPGPVDP+ 
Sbjct  154  REFSCEVENDGKVLIRGVTTTGERTVYAGNQVFEMQTQNLCPSGHFSISFQLPGPVDPQQ  213

Query  284  FSPNFGCDGIFEGVVAK  234
            FS NFG DGI EG+V K
Sbjct  214  FSGNFGIDGILEGIVMK  230



>ref|XP_008454867.1| PREDICTED: uncharacterized protein LOC103495173 [Cucumis melo]
 ref|XP_008454871.1| PREDICTED: uncharacterized protein LOC103495173 [Cucumis melo]
Length=391

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++ +   L+GTA  G  GP IG+ DIG  + +Y FRV+LPGVKRDP  FNCE+E+D
Sbjct  261  NLVAATNSGFALTGTAAMGHVGPIIGSMDIGECEDSYLFRVSLPGVKRDPCGFNCEVEKD  320

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG +TV K+ +VF M     CPPG F+LSF+LPGPVDP+ F  NF   GI
Sbjct  321  GRVVIQGVTTTGERTVKKHSQVFEMVTHNLCPPGEFSLSFQLPGPVDPQHFLANFDIAGI  380

Query  254  FEGVVAK  234
             EGVV K
Sbjct  381  LEGVVMK  387



>gb|AAO45755.1| heat-shock protein-like protein [Cucumis melo subsp. melo]
Length=391

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++ +   L+GTA  G  GP IG+ DIG  + +Y FRV+LPGVKRDP  FNCE+E+D
Sbjct  261  NLVAATNSGFALTGTAAMGHVGPIIGSMDIGECEDSYLFRVSLPGVKRDPCGFNCEVEKD  320

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG +TV K+ +VF M     CPPG F+LSF+LPGPVDP+ F  NF   GI
Sbjct  321  GRVVIQGVTTTGERTVKKHSQVFEMVTHNLCPPGEFSLSFQLPGPVDPQHFLANFDIAGI  380

Query  254  FEGVVAK  234
             EGVV K
Sbjct  381  LEGVVMK  387



>ref|XP_009119552.1| PREDICTED: uncharacterized protein LOC103844508 [Brassica rapa]
Length=192

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S SK  + L+G+A  G  GP IG  DI  S  +YYFRV+LPGV RD  +F+CEIE DG +
Sbjct  64   SQSKTGVALTGSAAMGKIGPTIGLVDIAESDDSYYFRVSLPGVSRDEKEFSCEIEPDGKI  123

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG KTV ++ +VF M  Q  CPPG FT+SF+LPGPV    FS NFG DG+ EG
Sbjct  124  LIKGATTTGEKTVCRHNQVFKMLSQNLCPPGHFTISFQLPGPVSNEDFSGNFGADGVLEG  183

Query  245  VVAK  234
            VV K
Sbjct  184  VVKK  187



>gb|KFK35609.1| hypothetical protein AALP_AA4G013300 [Arabis alpina]
Length=203

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            + +K  + L+G+A  G  GP IG  DI  S  +YYFRV+LPGV RD  DF+CEIE DG +
Sbjct  75   TQTKTGIALTGSAAMGKIGPTIGLVDIAESDDSYYFRVSLPGVSRDEKDFSCEIEPDGKI  134

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG KTV K+ ++F M  Q  CPPG FT+SF+LPGPV    F+ NFG DG+ EG
Sbjct  135  LIKGATTTGEKTVCKHNQIFTMLTQNLCPPGQFTISFQLPGPVSNEEFNGNFGSDGVLEG  194

Query  245  VVAK  234
            +V K
Sbjct  195  LVKK  198



>ref|XP_002280890.2| PREDICTED: uncharacterized protein LOC100249373 isoform X1 [Vitis 
vinifera]
Length=261

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ ++++    L+G+A  G  GP IG  DIG  + +Y FRV+LPGVKRD  +F+CE+E
Sbjct  128  LKNIVAATRGGFALTGSAAVGQIGPAIGHMDIGECEDSYLFRVSLPGVKRDEREFSCEVE  187

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V IRGVT+TG +TV    +VF M  Q  CP G F++SF+LPGPVDP+ FS NFG D
Sbjct  188  NDGKVLIRGVTTTGERTVYAGNQVFEMQTQNLCPSGHFSISFQLPGPVDPQQFSGNFGID  247

Query  260  GIFEGVVAK  234
            GI EG+V K
Sbjct  248  GILEGIVMK  256



>ref|XP_010511225.1| PREDICTED: uncharacterized protein LOC104787351 [Camelina sativa]
 ref|XP_010480203.1| PREDICTED: uncharacterized protein LOC104758930 [Camelina sativa]
Length=206

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S +K  + L+G+A  G  GP IG  DI  S+ +YYFRV+LPGV RD  DF+CEIE DG +
Sbjct  78   SQTKTGVALTGSAAMGKIGPTIGLVDIAESEDSYYFRVSLPGVSRDEKDFSCEIEPDGKI  137

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG  TV K  ++F M  Q  CPPG FT+SF+LPGPV    F+ NFG DG+ EG
Sbjct  138  QIKGTTTTGEMTVCKNNQIFKMLTQNLCPPGHFTISFQLPGPVSNEEFNGNFGADGVLEG  197

Query  245  VVAK  234
            VV K
Sbjct  198  VVKK  201



>ref|XP_007018682.1| HSP20-like chaperones superfamily protein, putative [Theobroma 
cacao]
 gb|EOY15907.1| HSP20-like chaperones superfamily protein, putative [Theobroma 
cacao]
Length=388

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 96/144 (67%), Gaps = 24/144 (17%)
 Frame = -3

Query  593  ASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD------------PG----  462
            AS+IL+GTA  G+ GPPIG  DIGVSK AY+F VALPGV++D            P     
Sbjct  244  ASIILNGTAKMGIAGPPIGVLDIGVSKVAYFFGVALPGVRKDYCELQPSEFPQIPSKLTM  303

Query  461  -------DFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
                   +F+CEIE +G VH++G +++GG T+ K  RVF MT +Q CP G FTLSF LPG
Sbjct  304  GKHILIREFSCEIESNGKVHLQG-SASGGGTIKKRSRVFHMTFKQLCPAGPFTLSFSLPG  362

Query  302  PVDPRLFSPNFGCDGIFEGVVAKY  231
            PVDPRLFSPNF  +GIFE VV K+
Sbjct  363  PVDPRLFSPNFRPNGIFEAVVIKH  386



>ref|XP_009596036.1| PREDICTED: uncharacterized protein LOC104092203 isoform X2 [Nicotiana 
tomentosiformis]
Length=458

 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = -3

Query  674  YSRRSNLERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSA  507
            ++   + E     +P  P    + N+ +++K+   ++G+A KG  GP +G  D+G S+ +
Sbjct  304  HTNSKDFELSTVFLPSRPSKEELSNIVAATKSGFAVTGSAAKGKIGPVLGLLDVGESEDS  363

Query  506  YYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAF  327
            Y FRV+LPGVKRD  DF+ E+E DG V I+G+T+TG +TV KY + F M  Q  CP G F
Sbjct  364  YLFRVSLPGVKRDERDFSSEVESDGKVLIKGLTTTGDRTVRKYSQAFEMQTQNLCPTGQF  423

Query  326  TLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            ++SF+LPGPVDP+ FS NFG DGI EG+V K
Sbjct  424  SISFKLPGPVDPQQFSGNFGTDGILEGIVMK  454



>ref|XP_002891914.1| hypothetical protein ARALYDRAFT_892730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68173.1| hypothetical protein ARALYDRAFT_892730 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ S +K  + L+G+A  G  GP IG  DI   + +YYFRV+LPGV RD  DF+CEIE D
Sbjct  75   NLISQTKTGVALTGSAAMGKIGPTIGLVDIAECEDSYYFRVSLPGVSRDEKDFSCEIEPD  134

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+G T+TG +TV K+ ++F M  Q  CPPG FT++F+LPGPV    F+ NFG DG+
Sbjct  135  GRILIKGATTTGEQTVCKHNQIFKMLTQNLCPPGHFTINFQLPGPVSNEEFNGNFGSDGV  194

Query  254  FEGVVAK  234
             EGVV K
Sbjct  195  LEGVVKK  201



>ref|XP_009596033.1| PREDICTED: uncharacterized protein LOC104092203 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009596034.1| PREDICTED: uncharacterized protein LOC104092203 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009596035.1| PREDICTED: uncharacterized protein LOC104092203 isoform X1 [Nicotiana 
tomentosiformis]
Length=489

 Score =   147 bits (370),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = -3

Query  674  YSRRSNLERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSA  507
            ++   + E     +P  P    + N+ +++K+   ++G+A KG  GP +G  D+G S+ +
Sbjct  335  HTNSKDFELSTVFLPSRPSKEELSNIVAATKSGFAVTGSAAKGKIGPVLGLLDVGESEDS  394

Query  506  YYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAF  327
            Y FRV+LPGVKRD  DF+ E+E DG V I+G+T+TG +TV KY + F M  Q  CP G F
Sbjct  395  YLFRVSLPGVKRDERDFSSEVESDGKVLIKGLTTTGDRTVRKYSQAFEMQTQNLCPTGQF  454

Query  326  TLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            ++SF+LPGPVDP+ FS NFG DGI EG+V K
Sbjct  455  SISFKLPGPVDPQQFSGNFGTDGILEGIVMK  485



>ref|XP_010537225.1| PREDICTED: uncharacterized protein LOC104812004 [Tarenaya hassleriana]
 ref|XP_010537226.1| PREDICTED: uncharacterized protein LOC104812004 [Tarenaya hassleriana]
 ref|XP_010537227.1| PREDICTED: uncharacterized protein LOC104812004 [Tarenaya hassleriana]
 ref|XP_010537229.1| PREDICTED: uncharacterized protein LOC104812004 [Tarenaya hassleriana]
 ref|XP_010537230.1| PREDICTED: uncharacterized protein LOC104812004 [Tarenaya hassleriana]
Length=390

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 3/144 (2%)
 Frame = -3

Query  656  LERRPCMMPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGV  477
            +ER     P++P P+ E  S AS+ L GTA KG+ GP +G  DIG++K AY+FRV+LPG+
Sbjct  250  IERDKTDQPVIP-PD-EPISDASIRLIGTATKGILGPTVGVVDIGINKVAYFFRVSLPGL  307

Query  476  KRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPV  297
             +D  +F+CE+E DG V ++G +  GG T+ K  RVF +  +Q CPPG FTLSF LPGPV
Sbjct  308  CKDHCEFSCEVESDGKVILQG-SMGGGITIKKQSRVFEIKMRQLCPPGPFTLSFTLPGPV  366

Query  296  DPRLFSPNFGCDGIFEGVVAKYSP  225
            DPRL S NF  DGIFE V+ ++ P
Sbjct  367  DPRLLSLNFRSDGIFEAVIIRHEP  390



>ref|XP_010094520.1| hypothetical protein L484_024812 [Morus notabilis]
 gb|EXB56274.1| hypothetical protein L484_024812 [Morus notabilis]
Length=146

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K S++ +GTA +G  GPP+G  D+G S+ AY FRVALPGVK+D     CEI+RDG VHI 
Sbjct  13   KPSVVFTGTAKEGSVGPPVGLVDVGESEGAYLFRVALPGVKKDQCKIKCEIQRDGRVHIE  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV + G   +     V+ M  QQ CPPG FT+SF LPGPVDPRLFSP+F  DGI E VV 
Sbjct  73   GVMTGGVGPLRDSSTVYQMKVQQLCPPGPFTISFSLPGPVDPRLFSPSFRPDGILEVVVM  132

Query  236  KY  231
            K+
Sbjct  133  KH  134



>ref|XP_009769387.1| PREDICTED: uncharacterized protein LOC104220254 [Nicotiana sylvestris]
 ref|XP_009769388.1| PREDICTED: uncharacterized protein LOC104220254 [Nicotiana sylvestris]
Length=489

 Score =   146 bits (369),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = -3

Query  674  YSRRSNLERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSA  507
            ++   + E     +P  P    + ++ +++K+   ++G+A KG  GP +G  D+G S+ +
Sbjct  335  HTSSKDFELSIVFLPSRPSKEELSHIVAATKSGFAVTGSAAKGKIGPVLGLLDVGESEDS  394

Query  506  YYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAF  327
            Y FRV+LPGVKRD  DF  E+E DG V I+G+T+ G +TV KY +VF M  Q  CP G F
Sbjct  395  YLFRVSLPGVKRDERDFTSEVESDGKVFIKGMTTAGDRTVRKYSQVFEMQTQNLCPTGQF  454

Query  326  TLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            ++SF+LPGPVDP+ FS NFG DGIFEG+V K
Sbjct  455  SISFKLPGPVDPQQFSGNFGTDGIFEGIVMK  485



>ref|XP_007203069.1| hypothetical protein PRUPE_ppa023477mg [Prunus persica]
 gb|EMJ04268.1| hypothetical protein PRUPE_ppa023477mg [Prunus persica]
Length=424

 Score =   145 bits (367),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 96/143 (67%), Gaps = 6/143 (4%)
 Frame = -3

Query  644  PCMMPLLPIP------NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALP  483
            P M+ L  +P      N+ ++++    L+G+A K   GP IG  DIG  + +Y FRV+LP
Sbjct  275  PAMIFLPSLPTKREWSNIVAATRDGFALTGSAAKRQVGPTIGLIDIGECEDSYLFRVSLP  334

Query  482  GVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            GV+RD  DF+CE+E +G V IRGVT TG KTV +Y ++F M  Q  CP G F++SF+LPG
Sbjct  335  GVRRDERDFSCEVENEGRVLIRGVTITGEKTVYRYSQMFEMRTQNLCPSGHFSISFQLPG  394

Query  302  PVDPRLFSPNFGCDGIFEGVVAK  234
            PVDP+ FS NFG DGI EGVV K
Sbjct  395  PVDPQEFSGNFGTDGILEGVVMK  417



>gb|AAG51117.1|AC069144_14 hypothetical protein [Arabidopsis thaliana]
 gb|AAC64894.1| T22H22.24 [Arabidopsis thaliana]
Length=197

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ S +K  + L+G+A  G  G  IG  DI  S+ +YYFRVALPGV RD  +F+CEIE D
Sbjct  66   NLISQTKTGVALTGSAAMGKIGLTIGLVDIAESEDSYYFRVALPGVSRDEKEFSCEIEPD  125

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+G T+TG +TV K+ ++F M  Q  CPPG FT++F+LPGPV    F+ NFG DG+
Sbjct  126  GKIMIKGATTTGEQTVCKHNQIFKMLTQNLCPPGHFTINFQLPGPVSNEEFNGNFGSDGV  185

Query  254  FEGVVAK  234
             EGVV K
Sbjct  186  LEGVVKK  192



>ref|NP_175882.2| alpha-crystallin domain of heat shock protein-containing protein 
[Arabidopsis thaliana]
 gb|AAO22777.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42405.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33156.1| alpha-crystallin domain of heat shock protein-containing protein 
[Arabidopsis thaliana]
Length=206

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ S +K  + L+G+A  G  G  IG  DI  S+ +YYFRVALPGV RD  +F+CEIE D
Sbjct  75   NLISQTKTGVALTGSAAMGKIGLTIGLVDIAESEDSYYFRVALPGVSRDEKEFSCEIEPD  134

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+G T+TG +TV K+ ++F M  Q  CPPG FT++F+LPGPV    F+ NFG DG+
Sbjct  135  GKIMIKGATTTGEQTVCKHNQIFKMLTQNLCPPGHFTINFQLPGPVSNEEFNGNFGSDGV  194

Query  254  FEGVVAK  234
             EGVV K
Sbjct  195  LEGVVKK  201



>ref|XP_008244267.1| PREDICTED: uncharacterized protein LOC103342424 [Prunus mume]
Length=428

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 96/143 (67%), Gaps = 6/143 (4%)
 Frame = -3

Query  644  PCMMPLLPIP------NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALP  483
            P M+ L  +P      N+ ++++    L+G+A K   GP IG  DIG  + +Y FRV+LP
Sbjct  279  PAMIFLPSLPTKREWSNIVAATRDGFALTGSAAKRQVGPTIGLIDIGECEDSYLFRVSLP  338

Query  482  GVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            GV+RD  DF+CE+E +G V IRGVT TG KTV +Y ++F M  Q  CP G F++SF+LPG
Sbjct  339  GVRRDERDFSCEVENEGRVLIRGVTITGEKTVYRYSQMFEMRTQNLCPSGHFSISFQLPG  398

Query  302  PVDPRLFSPNFGCDGIFEGVVAK  234
            PVDP+ FS NFG DGI EGVV K
Sbjct  399  PVDPQEFSGNFGTDGILEGVVMK  421



>ref|XP_006302788.1| hypothetical protein CARUB_v10020913mg, partial [Capsella rubella]
 gb|EOA35686.1| hypothetical protein CARUB_v10020913mg, partial [Capsella rubella]
Length=223

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S  K  + L+G+A  G  GP +G  DI  S+ +YYFRV+LPGV RD  DF+CEIE DG +
Sbjct  95   SQIKTGVALTGSAAMGKIGPTVGLVDIAESEDSYYFRVSLPGVSRDEKDFSCEIEPDGKI  154

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG +T+ K+ ++F M  Q  CPPG FT+SF+LPGPV    F+ NFG DG+ EG
Sbjct  155  LIKGTTTTGERTICKHNQIFKMLTQNLCPPGHFTISFQLPGPVSNEEFNGNFGSDGVLEG  214

Query  245  VVAK  234
            VV K
Sbjct  215  VVKK  218



>gb|EPS66551.1| hypothetical protein M569_08226, partial [Genlisea aurea]
Length=160

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 93/154 (60%), Gaps = 6/154 (4%)
 Frame = -3

Query  677  GYSRRSNLERRPCMMPLLPIPNME------SSSKASLILSGTACKGVTGPPIGAFDIGVS  516
            G S   N      ++ L   P+ME      SSSK    ++G+A  G  GP IG  D+G S
Sbjct  6    GRSEEENPTTTRGILFLPTCPSMEQWSDLVSSSKRGFAVTGSAATGNVGPLIGLMDVGES  65

Query  515  KSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPP  336
            + AY FRV+LPGVKRD  +F+CE+E +G V I+G T TG KTV K  + F M  Q  CPP
Sbjct  66   EDAYLFRVSLPGVKRDEREFSCEVETNGTVTIKGATVTGEKTVKKCSQTFEMLSQNLCPP  125

Query  335  GAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            G F++SF LPGPVDP+ F   F  DGIFEG+  K
Sbjct  126  GPFSISFNLPGPVDPQQFHGTFATDGIFEGIAFK  159



>ref|XP_002512356.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49808.1| conserved hypothetical protein [Ricinus communis]
Length=409

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            ++ ++   L+G+A  G  GP IG  DIG  + +Y FR++LPGVKRD  DF+C +E DGMV
Sbjct  281  AAGRSGFALTGSAAMGQVGPIIGLMDIGECEDSYMFRISLPGVKRDEEDFSCVVENDGMV  340

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+GVT+TG +TV ++ +VF M  +  CPPG F++SF+LPGPV+PR FS NFG DGI EG
Sbjct  341  LIKGVTTTGERTVYRFSQVFEMQSKNLCPPGEFSISFQLPGPVNPRQFSGNFGTDGILEG  400

Query  245  VVAK  234
            +V K
Sbjct  401  IVMK  404



>ref|XP_008370486.1| PREDICTED: uncharacterized protein LOC103433955 isoform X1 [Malus 
domestica]
 ref|XP_008370487.1| PREDICTED: uncharacterized protein LOC103433955 isoform X1 [Malus 
domestica]
Length=426

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  656  LERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVA  489
            L+R    +P LP    + N+ ++++    L+G+A     GP IG  DIG    +Y FRV+
Sbjct  273  LDRAMIFLPSLPTKKELSNIVAATRDGFALTGSAAMAKVGPTIGLIDIGECDDSYLFRVS  332

Query  488  LPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRL  309
            LPGV+RD  +F+CE+E +G V IRGVT TG KTV +Y ++F M  Q  CP G F++SF+L
Sbjct  333  LPGVRRDEREFSCEVENEGQVLIRGVTVTGEKTVHRYSQMFEMQTQNLCPSGQFSISFQL  392

Query  308  PGPVDPRLFSPNFGCDGIFEGVVAK  234
            PGPV+P+ FS NFG DGI EG+V K
Sbjct  393  PGPVNPQQFSGNFGTDGILEGIVMK  417



>gb|AAT52226.1| Hsp1 [Cucumis melo]
Length=150

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++ +   L+GTA  G  GP IG+ DIG  + +Y FRV+LPGVKRDP  FNCE+E+D
Sbjct  31   NLVAATNSGFALTGTATMGHVGPIIGSMDIGECEDSYLFRVSLPGVKRDPCGFNCEVEKD  90

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG +TV K+ +VF M     CPPG F+LSF+LPGPVDP+ F  NF   GI
Sbjct  91   GRVVIQGVTTTGERTVKKHSQVFEMVTHNLCPPGEFSLSFQLPGPVDPQHFLANFDIAGI  150



>ref|XP_004303641.1| PREDICTED: uncharacterized protein LOC101307316 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 94/141 (67%), Gaps = 7/141 (5%)
 Frame = -3

Query  635  MPLLPIPNME-------SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGV  477
            M  LP P  E       +++K    L+G+A  G  GP IG  DIG S+ +Y FRV+LPGV
Sbjct  253  MIFLPSPPTEKEWSDIVAATKHGFALTGSAATGQIGPTIGLIDIGESEDSYLFRVSLPGV  312

Query  476  KRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPV  297
            +RD  +F+CE+E +G V IRGVT TG KTV +Y ++F M  Q  CP G F++SF+LPGPV
Sbjct  313  RRDEREFSCEVENEGRVLIRGVTITGEKTVYRYCQIFEMQTQNLCPTGHFSISFQLPGPV  372

Query  296  DPRLFSPNFGCDGIFEGVVAK  234
            +P+ FS NFG DGI EGVV K
Sbjct  373  NPQHFSGNFGTDGILEGVVMK  393



>gb|KDP23533.1| hypothetical protein JCGZ_23366 [Jatropha curcas]
Length=207

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +S+K ++ LSG+A  G+ GP +G  DIG S  AY FRV+LPGV RD  +F+C+IE D
Sbjct  80   NVLASAKGAVALSGSAAMGMVGPALGLMDIGESDDAYLFRVSLPGVARDEKEFSCDIEPD  139

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GVT+TG KTV K  ++F M  Q  CPPG F+++F+LPGPV+ + F  +FG DG+
Sbjct  140  GTILIKGVTTTGEKTVCKNSQIFRMQTQNLCPPGHFSITFQLPGPVNHKQFRGHFGNDGM  199

Query  254  FEGVVAK  234
             EG+V K
Sbjct  200  LEGIVKK  206



>ref|XP_007148493.1| hypothetical protein PHAVU_006G213300g [Phaseolus vulgaris]
 gb|ESW20487.1| hypothetical protein PHAVU_006G213300g [Phaseolus vulgaris]
Length=385

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNM-ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P  MPLL +P+    +   SL+L+GTA KG  GP +G  D+G+   AY FRV+L GV++D
Sbjct  248  PTFMPLLSVPDAGVENQDCSLVLTGTARKGKFGPSVGMVDLGIGARAYLFRVSLAGVQKD  307

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               FNC++E +G V I GV + GG+T+ K  RVF M  ++ CPPG FTLSF LPGP+DPR
Sbjct  308  LSQFNCDVETNGRVLITGVVN-GGRTIKKQSRVFHMKLRRLCPPGPFTLSFNLPGPIDPR  366

Query  287  LFSPNFGCDGIFEGVVAK  234
            LF+ NF  DG+ EG+  K
Sbjct  367  LFTANFRADGLLEGIAIK  384



>gb|EYU20996.1| hypothetical protein MIMGU_mgv1a008490mg [Erythranthe guttata]
Length=372

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ ++ K    L+G+A +G  GP +G  DIG S+ +Y FRV+LPGVKRD  DF CE+E D
Sbjct  243  NLAANIKCGFALTGSAARGHLGPVLGLMDIGESEDSYLFRVSLPGVKRDERDFRCEVESD  302

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT +G + V KY +VF M  Q  CPPG F++SF+LPGPVDP  F   F  DGI
Sbjct  303  GTVMIKGVTVSGERVVKKYAQVFEMQTQNLCPPGHFSISFKLPGPVDPLQFHGTFATDGI  362

Query  254  FEGVVAK  234
             EG+  K
Sbjct  363  LEGIALK  369



>ref|XP_010549932.1| PREDICTED: uncharacterized protein LOC104820950 [Tarenaya hassleriana]
Length=202

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 97/159 (61%), Gaps = 6/159 (4%)
 Frame = -3

Query  692  QVEVEGYSRRSNLERRPCMMPLLP------IPNMESSSKASLILSGTACKGVTGPPIGAF  531
            Q  + G+    N+E+R   M  LP        ++ + +K  + L+G+A  G  GP IG  
Sbjct  43   QASMSGHRANDNVEKRGPAMIFLPCESAPEFTDLANQTKTGVALTGSAAMGKIGPTIGLV  102

Query  530  DIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQ  351
            DI  ++ ++YFRV+LPGV  D  +F+CE++ DG + I+GVT+TG KTV K+ +VF M  Q
Sbjct  103  DIAENEDSFYFRVSLPGVSGDEKEFSCEVDPDGKILIKGVTTTGEKTVCKHSQVFRMLTQ  162

Query  350  QQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
              CPPG FT+SF+LPGPVD   F   FG DG+  G V K
Sbjct  163  NLCPPGHFTISFQLPGPVDNDEFVGQFGSDGVLVGTVKK  201



>ref|XP_009334295.1| PREDICTED: uncharacterized protein LOC103927130 isoform X1 [Pyrus 
x bretschneideri]
Length=426

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -3

Query  656  LERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVA  489
            L+R    +P LP    + N+ ++++    L+G+A     GP IG  DIG    +Y FRV+
Sbjct  273  LDRAMIFLPSLPTKKELSNIVAATRDGFALTGSAAMAKVGPTIGLIDIGECDDSYLFRVS  332

Query  488  LPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRL  309
            LPGV+RD  +F+CE+E +G V IRGV  TG KTV +Y ++F M  Q  CP G F++SF+L
Sbjct  333  LPGVRRDEREFSCEVENEGQVLIRGVAVTGEKTVHRYSQMFEMQTQNLCPSGQFSISFQL  392

Query  308  PGPVDPRLFSPNFGCDGIFEGVVAK  234
            PGPV+P+ FS NFG DGI EG+V K
Sbjct  393  PGPVNPQQFSGNFGTDGILEGIVMK  417



>ref|XP_006606509.1| PREDICTED: uncharacterized protein LOC100785823 isoform X3 [Glycine 
max]
Length=396

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+GT   G  GP +G  DIG  + AY FR++LPGVKRD  +F+CE+  D
Sbjct  266  DIVAATKNGFALTGTVAMGGIGPTMGLVDIGECEDAYLFRLSLPGVKRDEREFSCEVGTD  325

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I GVT+TG  TVS+Y +VF M  Q  CPPG F++SF+LPGPVDP  FS NFG DGI
Sbjct  326  GKVLISGVTTTGENTVSRYSQVFEMQTQNLCPPGRFSISFQLPGPVDPHQFSGNFGTDGI  385

Query  254  FEGVVAK  234
             EG+V K
Sbjct  386  LEGIVMK  392



>emb|CDY31860.1| BnaC07g15100D [Brassica napus]
Length=457

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 5/145 (3%)
 Frame = -3

Query  662  SNLERRPCMMPLLPIP--NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVA  489
            S +ER     PL+ +P    E  ++ +++  GTA +G +   IG  DIGV+K AY+F+VA
Sbjct  311  SLVERDKTDPPLVIVPPAMKECDAEPTVVTKGTASRGTS---IGVVDIGVNKVAYFFQVA  367

Query  488  LPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRL  309
            LPGV +D   F+CEI+ DG V + G T+TG KT+ ++ RVF M  Q+ CPPG F LSF L
Sbjct  368  LPGVSKDNDKFSCEIKSDGKVILEGSTTTGQKTIERHSRVFKMNSQKPCPPGPFKLSFSL  427

Query  308  PGPVDPRLFSPNFGCDGIFEGVVAK  234
            PGPVDPR  SPNF  DGIFE VV +
Sbjct  428  PGPVDPRFVSPNFRSDGIFEAVVIR  452



>ref|XP_003591085.1| Heat shock protein-like protein [Medicago truncatula]
 gb|AES61336.1| alpha-crystallin domain of heat shock protein [Medicago truncatula]
Length=421

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = -3

Query  716  LNGENDSPQVEVEGYSRRSNLERRPCMMPLLPIPNMESSSKASLILSGTACKGVTGPPIG  537
            L+GE DS +V   G      L  RP         N+ +++ +   L+G+A  G  GP +G
Sbjct  263  LDGEGDSVKV---GAPAALFLPSRPTKKEW---SNIVAATNSGFALTGSAAMGQIGPIMG  316

Query  536  AFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMT  357
              DIG  + +Y FR++LPGVKRD  +F+CE++ DG V I+G+T+TG KTVS   +VF M 
Sbjct  317  LVDIGECEDSYLFRMSLPGVKRDDKEFSCEVDTDGKVFIQGITTTGEKTVSMRTQVFEMQ  376

Query  356  HQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAKYSP  225
             Q  CP G F+++F+LPGPVDP  FS NFG DGI EG+V K  P
Sbjct  377  TQNLCPAGQFSITFQLPGPVDPHQFSGNFGTDGILEGIVVKRKP  420



>ref|XP_006361863.1| PREDICTED: uncharacterized protein LOC102584031 [Solanum tuberosum]
Length=489

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 5/151 (3%)
 Frame = -3

Query  674  YSRRSNLERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSA  507
            ++   +LE     +P  P    + N+ +++K+   ++G+A KG  GP +G  D+G S+ A
Sbjct  337  HTNSEDLELSIVFLPSRPSEEELSNIVAATKSGFAVAGSAAKGKIGPVLGLLDVGESEDA  396

Query  506  YYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAF  327
            Y FRV+LPGVKRD  +F CE+E DG V I+G+T TG +TV KY +VF M  Q  CP G F
Sbjct  397  YLFRVSLPGVKRDEREFICEVEIDGKVLIKGMT-TGDRTVHKYSQVFEMQTQNLCPTGDF  455

Query  326  TLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            T+SF+LPGPVDP+ FS  FG DGI EG+V K
Sbjct  456  TISFKLPGPVDPQEFSGIFGTDGILEGIVLK  486



>ref|XP_006850735.1| hypothetical protein AMTR_s00025p00054190 [Amborella trichopoda]
 gb|ERN12316.1| hypothetical protein AMTR_s00025p00054190 [Amborella trichopoda]
Length=414

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  602  SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVH  423
            ++   + L+GT      GP IG  DIGVS+ +Y FR++LPGV++D  +F+CE+E DG V 
Sbjct  287  AANGGISLTGTVVVRQPGPLIGLVDIGVSEDSYLFRISLPGVRKDEREFSCEVECDGRVM  346

Query  422  IRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGV  243
            IRGVT+TGG+ V K+ RVF M  Q  CP GAFT+SF+LPGPV+P+ FS NFG DGI EGV
Sbjct  347  IRGVTTTGGRRVFKFSRVFDMHTQYLCPSGAFTISFQLPGPVEPQEFSGNFGSDGILEGV  406

Query  242  VAK  234
            V K
Sbjct  407  VMK  409



>ref|XP_011087379.1| PREDICTED: uncharacterized protein LOC105168887 [Sesamum indicum]
 ref|XP_011087380.1| PREDICTED: uncharacterized protein LOC105168887 [Sesamum indicum]
 ref|XP_011087381.1| PREDICTED: uncharacterized protein LOC105168887 [Sesamum indicum]
 ref|XP_011087382.1| PREDICTED: uncharacterized protein LOC105168887 [Sesamum indicum]
Length=401

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = -3

Query  701  DSPQVEVEGYSRRSNLERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGA  534
            DSP +     S   +L++    +P  P      N+ ++ K    L+G+A +G  GP +G 
Sbjct  236  DSPVLAQMTGSYGEDLDQGIIFLPSCPSKEEWANLVATVKCGFALTGSAARGHVGPVLGL  295

Query  533  FDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTH  354
             D+G S+ +Y FRV+LPGV+RD  DF+CE+E DG V I+GVT TG  TV KY + F M  
Sbjct  296  MDVGESEDSYLFRVSLPGVRRDERDFSCEVESDGTVIIKGVTVTGEITVEKYSQAFIMQS  355

Query  353  QQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            Q  CPPG F++SF+LPGPVDP+ F   F  DGI EG+  K
Sbjct  356  QNLCPPGPFSISFKLPGPVDPQEFHGTFATDGILEGIALK  395



>emb|CBI36755.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ ++++    L+G+A  G  GP IG  DIG  + +Y FRV+LPGVKRD  +F+CE+E
Sbjct  618  LKNIVAATRGGFALTGSAAVGQIGPAIGHMDIGECEDSYLFRVSLPGVKRDEREFSCEVE  677

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V IRGVT+TG +TV    +VF M  Q  CP G F++SF+LPGPVDP+ FS NFG D
Sbjct  678  NDGKVLIRGVTTTGERTVYAGNQVFEMQTQNLCPSGHFSISFQLPGPVDPQQFSGNFGID  737

Query  260  GIFEGVVAK  234
            GI EG+V K
Sbjct  738  GILEGIVMK  746



>ref|XP_002319552.1| Hsp1 family protein [Populus trichocarpa]
 gb|EEE95475.1| Hsp1 family protein [Populus trichocarpa]
Length=220

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + ++  S++  + L+G+A  G  GP +GA DIG S  AY FRV+LPGV RD  DF+C+I+
Sbjct  91   LDDIMDSARNGIGLAGSAATGNVGPIVGAMDIGESDDAYLFRVSLPGVSRDEKDFSCDID  150

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT+TG  TV K+ ++F M  +  CPPG F+++F+LPGPVD + F  NFG D
Sbjct  151  PDGTVFIKGVTTTGESTVCKHSQIFRMQTRNLCPPGHFSITFQLPGPVDHQQFKGNFGID  210

Query  260  GIFEGVVAK  234
            G+ EG+V K
Sbjct  211  GMLEGIVKK  219



>ref|XP_002983718.1| hypothetical protein SELMODRAFT_13541, partial [Selaginella moellendorffii]
 gb|EFJ15214.1| hypothetical protein SELMODRAFT_13541, partial [Selaginella moellendorffii]
Length=356

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 95/141 (67%), Gaps = 7/141 (5%)
 Frame = -3

Query  635  MPLLP-IPNMES------SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGV  477
            M L+P +P +E       +++ S++L+GTA    +GP +G  DIGV+  AY FR ALPGV
Sbjct  216  MLLIPSLPTVEQWNRIVDAARPSIVLTGTAAARQSGPLVGLVDIGVADDAYLFRAALPGV  275

Query  476  KRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPV  297
            K+D GDFNCE+E DG V I+G+T+TG   + +  R+F M  Q  CPPG F++SF LPGPV
Sbjct  276  KKDEGDFNCEVECDGKVTIKGMTTTGESRIFRTNRMFHMQTQYLCPPGPFSVSFNLPGPV  335

Query  296  DPRLFSPNFGCDGIFEGVVAK  234
            +P  F+  FG DG+ EG+V K
Sbjct  336  EPNQFTGTFGSDGVLEGIVMK  356



>ref|XP_002989048.1| hypothetical protein SELMODRAFT_13540, partial [Selaginella moellendorffii]
 gb|EFJ09842.1| hypothetical protein SELMODRAFT_13540, partial [Selaginella moellendorffii]
Length=356

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 95/141 (67%), Gaps = 7/141 (5%)
 Frame = -3

Query  635  MPLLP-IPNMES------SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGV  477
            M L+P +P +E       +++ S++L+GTA    +GP +G  DIGV+  AY FR ALPGV
Sbjct  216  MLLIPSLPTVEQWNRIVDAARPSIVLTGTAAARQSGPLVGLVDIGVADDAYLFRAALPGV  275

Query  476  KRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPV  297
            K+D GDFNCE+E DG V I+G+T+TG   + +  R+F M  Q  CPPG F++SF LPGPV
Sbjct  276  KKDEGDFNCEVECDGKVTIKGMTTTGESRIFRTNRMFHMQTQYLCPPGPFSVSFNLPGPV  335

Query  296  DPRLFSPNFGCDGIFEGVVAK  234
            +P  F+  FG DG+ EG+V K
Sbjct  336  EPNQFTGTFGSDGVLEGIVMK  356



>ref|XP_003555597.2| PREDICTED: uncharacterized protein LOC100785823 isoform X1 [Glycine 
max]
Length=468

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+GT   G  GP +G  DIG  + AY FR++LPGVKRD  +F+CE+  D
Sbjct  338  DIVAATKNGFALTGTVAMGGIGPTMGLVDIGECEDAYLFRLSLPGVKRDEREFSCEVGTD  397

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I GVT+TG  TVS+Y +VF M  Q  CPPG F++SF+LPGPVDP  FS NFG DGI
Sbjct  398  GKVLISGVTTTGENTVSRYSQVFEMQTQNLCPPGRFSISFQLPGPVDPHQFSGNFGTDGI  457

Query  254  FEGVVAK  234
             EG+V K
Sbjct  458  LEGIVMK  464



>ref|XP_006849980.1| hypothetical protein AMTR_s00022p00158430 [Amborella trichopoda]
 gb|ERN11561.1| hypothetical protein AMTR_s00022p00158430 [Amborella trichopoda]
Length=494

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -3

Query  644  PCMMPLLPIPNMESSS-KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P M+ L     +E  + K S+  +GTA     GP +G  DIG  K AY FRVALPGVK+D
Sbjct  259  PAMVVLASANRVEQWNPKPSIHFTGTARDARLGPLVGLVDIGSCKDAYLFRVALPGVKKD  318

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               F+CE+E DG V I+GVT TG K + ++ R F M  +  CPPG FTLSFRLPGPVDPR
Sbjct  319  HRQFSCEVECDGKVLIKGVTVTGEKNMLRHSRWFHMRTENLCPPGPFTLSFRLPGPVDPR  378

Query  287  LFSPNFGCDGIFEGVVAKYSP  225
            LF   FG DGI E +V KY P
Sbjct  379  LFYGTFGPDGILEAIVRKYEP  399



>ref|XP_002512357.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49809.1| conserved hypothetical protein [Ricinus communis]
Length=234

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+  S+K+++ L+G+A  G+ GP IG  DIG S  AY FRV+LPGV  +  +F+C+IE D
Sbjct  106  NILVSAKSAVALTGSAAMGMVGPIIGLMDIGESDDAYLFRVSLPGVANNKKEFSCDIEPD  165

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G +HIRGVT+TG + V K  ++F M  Q  CPPG F+++F LPGPVD + F  +FG DG+
Sbjct  166  GKIHIRGVTTTGEQIVCKNSQIFRMQTQNLCPPGHFSITFHLPGPVDHKQFRGHFGNDGM  225

Query  254  FEGVVAK  234
             EG+V K
Sbjct  226  LEGIVKK  232



>gb|KHN20207.1| hypothetical protein glysoja_023770 [Glycine soja]
Length=396

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+GT   G  GP +G  DIG  + AY FR++LPGVKRD  +F+CE+  D
Sbjct  266  DIVAATKNGFALTGTVAMGGIGPTMGLVDIGECEDAYLFRLSLPGVKRDEREFSCEVGTD  325

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I GVT+TG  TVS+Y +VF M     CPPG F++SF+LPGPVDP  FS NFG DGI
Sbjct  326  GKVLISGVTTTGENTVSRYSQVFEMQTHNLCPPGRFSISFQLPGPVDPHQFSGNFGTDGI  385

Query  254  FEGVVAK  234
             EG+V K
Sbjct  386  LEGIVMK  392



>ref|XP_008370489.1| PREDICTED: uncharacterized protein LOC103433955 isoform X3 [Malus 
domestica]
Length=339

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            ++++    L+G+A     GP IG  DIG    +Y FRV+LPGV+RD  +F+CE+E +G V
Sbjct  207  AATRDGFALTGSAAMAKVGPTIGLIDIGECDDSYLFRVSLPGVRRDEREFSCEVENEGQV  266

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             IRGVT TG KTV +Y ++F M  Q  CP G F++SF+LPGPV+P+ FS NFG DGI EG
Sbjct  267  LIRGVTVTGEKTVHRYSQMFEMQTQNLCPSGQFSISFQLPGPVNPQQFSGNFGTDGILEG  326

Query  245  VVAK  234
            +V K
Sbjct  327  IVMK  330



>ref|XP_004495740.1| PREDICTED: uncharacterized protein LOC101506728 [Cicer arietinum]
Length=430

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+G A  G  GP IG  DIG  + +Y FR++LPGVKRD   F+CE++ +
Sbjct  300  DIVAATKNGFGLTGGAAMGRVGPIIGLVDIGECEDSYLFRMSLPGVKRDEKAFSCEVDTN  359

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V IRGVT+TG KTVS+Y +VF M     CPPG F+++F+LPGPVDP  FS NFG DGI
Sbjct  360  GKVLIRGVTTTGEKTVSRYSQVFEMQTHNLCPPGHFSITFQLPGPVDPHQFSGNFGIDGI  419

Query  254  FEGVVAKYSP  225
             EG+V K  P
Sbjct  420  LEGMVMKGKP  429



>ref|XP_004231265.1| PREDICTED: uncharacterized protein LOC101262870 [Solanum lycopersicum]
Length=487

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 100/153 (65%), Gaps = 8/153 (5%)
 Frame = -3

Query  671  SRRSNLERRPCMMPLLP-IPNMES------SSKASLILSGTACKGVTGPPIGAFDIGVSK  513
            S+ +N +     +  LP  P+ME       ++K+   ++G+A KG  GP +G  D+G S+
Sbjct  330  SKHTNSDDSELSIVFLPSCPSMEELSNIVGATKSGFAVAGSAAKGKIGPVLGLLDVGESE  389

Query  512  SAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPG  333
             AY FRV+LPGV+RD  +F CE+E DG V I+G+T TG +TV KY +VF M  Q  CP G
Sbjct  390  DAYLFRVSLPGVQRDEREFTCEVEIDGKVLIKGMT-TGDRTVHKYSQVFEMQTQNLCPTG  448

Query  332  AFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
             FT+SF+LPGPVDP+ FS  FG DGI EG+V K
Sbjct  449  NFTISFKLPGPVDPQAFSGIFGTDGILEGIVLK  481



>ref|XP_009334297.1| PREDICTED: uncharacterized protein LOC103927130 isoform X3 [Pyrus 
x bretschneideri]
Length=339

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = -3

Query  617  PNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIER  438
            P   ++++    L+G+A     GP IG  DIG    +Y FRV+LPGV+RD  +F+CE+E 
Sbjct  203  PKSNAATRDGFALTGSAAMAKVGPTIGLIDIGECDDSYLFRVSLPGVRRDEREFSCEVEN  262

Query  437  DGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDG  258
            +G V IRGV  TG KTV +Y ++F M  Q  CP G F++SF+LPGPV+P+ FS NFG DG
Sbjct  263  EGQVLIRGVAVTGEKTVHRYSQMFEMQTQNLCPSGQFSISFQLPGPVNPQQFSGNFGTDG  322

Query  257  IFEGVVAK  234
            I EG+V K
Sbjct  323  ILEGIVMK  330



>emb|CDY31505.1| BnaC05g16140D [Brassica napus]
Length=299

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
            E  ++  +  +GTA K   GP IG  DIGV+KSAY+ +VALPGV +D G+F+CEIE DG 
Sbjct  3    ECDAEPVVTTTGTASKVTLGPSIGVVDIGVNKSAYFLQVALPGVCKDSGEFSCEIESDGK  62

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDG  258
            V + G T+ G KT+ ++ RVF M  ++ CPPG F LSF LPGPVDPRLFSPNF  DG
Sbjct  63   VILEGSTTKGCKTIKRHSRVFKMNIRKLCPPGPFRLSFSLPGPVDPRLFSPNFRSDG  119



>ref|XP_010459778.1| PREDICTED: uncharacterized protein LOC104740780 [Camelina sativa]
Length=502

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  647  RPCMMPLLPIP---NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGV  477
            +P    ++P+P     E  ++ S++ +GTA KG  GP +G  DIGV+K AY+F+VALPGV
Sbjct  358  KPTSQAVIPVPPPDMKECDAEPSVVTTGTASKGTLGPSVGVIDIGVNKVAYFFQVALPGV  417

Query  476  KRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPV  297
            ++D G+F+CEIE DG V + G T+TG KT+ ++ RVF M  ++ CP G F + F LPGPV
Sbjct  418  RKDYGEFSCEIESDGKVILEGTTTTGEKTIKRHSRVFEMNIRKLCPSGPFKMCFSLPGPV  477

Query  296  DPRLFSPNFGCDGIFEGVVAKY  231
            DPRLFSPNF  DGIFE V+ ++
Sbjct  478  DPRLFSPNFRSDGIFEAVIIRH  499



>gb|KHN16138.1| hypothetical protein glysoja_012114 [Glycine soja]
Length=399

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+GT   G  GP +G  DIG  + AY FR++LPGVKR+  +F+CE+  D
Sbjct  269  DIVAATKNGFALTGTVAMGGIGPTMGLVDIGECEDAYLFRLSLPGVKRNEREFSCEVGTD  328

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I GVT+TG  TVS+Y +VF M  +  CPPG F++SF+LPGPVDP  FS NFG DGI
Sbjct  329  GKVLISGVTTTGENTVSRYSQVFEMQTRNLCPPGQFSVSFQLPGPVDPHQFSGNFGIDGI  388

Query  254  FEGVVAK  234
             EGVV K
Sbjct  389  LEGVVMK  395



>ref|XP_011023581.1| PREDICTED: uncharacterized protein LOC105125012 isoform X3 [Populus 
euphratica]
Length=220

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + ++  S++  + L+G+A  G  GP +GA DIG S  AY FRV+LPGV RD  DF+C+I+
Sbjct  91   LDDIMDSARNGIGLAGSAATGNVGPIVGAMDIGESNDAYLFRVSLPGVSRDERDFSCDID  150

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT+TG  TV K+ ++F M  +  CPPG F+++F+LPGPVD + F  N G D
Sbjct  151  PDGTVFIKGVTTTGESTVCKHSQIFRMQTRNLCPPGHFSITFQLPGPVDHQQFRGNLGID  210

Query  260  GIFEGVVAK  234
            G+ EG+V K
Sbjct  211  GMLEGIVKK  219



>ref|XP_011023579.1| PREDICTED: uncharacterized protein LOC105125012 isoform X1 [Populus 
euphratica]
Length=222

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++  S++  + L+G+A  G  GP +GA DIG S  AY FRV+LPGV RD  DF+C+I+ D
Sbjct  95   DIMDSARNGIGLAGSAATGNVGPIVGAMDIGESNDAYLFRVSLPGVSRDERDFSCDIDPD  154

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG  TV K+ ++F M  +  CPPG F+++F+LPGPVD + F  N G DG+
Sbjct  155  GTVFIKGVTTTGESTVCKHSQIFRMQTRNLCPPGHFSITFQLPGPVDHQQFRGNLGIDGM  214

Query  254  FEGVVAK  234
             EG+V K
Sbjct  215  LEGIVKK  221



>ref|XP_007144747.1| hypothetical protein PHAVU_007G181300g [Phaseolus vulgaris]
 gb|ESW16741.1| hypothetical protein PHAVU_007G181300g [Phaseolus vulgaris]
Length=423

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 90/143 (63%), Gaps = 6/143 (4%)
 Frame = -3

Query  644  PCMMPLLPIPNME------SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALP  483
            P M+ L   P+ E      +++K    L+GT  K   GP IG  DIG S+ +Y FRV+LP
Sbjct  279  PAMLVLPSRPSREELYDIVAATKNGFALTGTVAKTQFGPSIGLVDIGESEDSYLFRVSLP  338

Query  482  GVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            GVKRD  +F C++E DG + I GVT TG + V +Y + F M  Q  CPPG F +SF+LPG
Sbjct  339  GVKRDEKEFFCDVELDGKILISGVTITGERVVYRYSKAFEMQTQNLCPPGKFGMSFQLPG  398

Query  302  PVDPRLFSPNFGCDGIFEGVVAK  234
            PVDP  FS NFG DG+ EG+V K
Sbjct  399  PVDPHQFSGNFGTDGVLEGIVMK  421



>ref|XP_003535347.2| PREDICTED: uncharacterized protein LOC100775950 [Glycine max]
Length=400

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+GT   G  GP +G  DIG  + AY FR++LPGVKR+  +F+CE+  D
Sbjct  270  DIVAATKNGFGLTGTVATGGIGPTMGLVDIGECEDAYLFRLSLPGVKRNEREFSCEVGTD  329

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I GVT+TG  TVS+Y +VF M  +  CPPG F++SF+LPGPVDP  FS NFG DGI
Sbjct  330  GKVLISGVTTTGENTVSRYSQVFEMQTRNLCPPGQFSVSFQLPGPVDPHQFSGNFGIDGI  389

Query  254  FEGVVAK  234
             EGVV K
Sbjct  390  LEGVVMK  396



>gb|KHG22251.1| 16.6 kDa heat shock [Gossypium arboreum]
Length=147

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
            ES  K S+ L+G+A +   GP IG  DIGVS+SA+ FRVALPG++ D     CEI+RDG 
Sbjct  8    ESKLKPSVDLTGSAKECSNGPSIGVIDIGVSQSAFLFRVALPGIRSDQSKLKCEIQRDGK  67

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I+G+ + G + +     V  MT ++ C PG FT+SF LPGPVDPRL SP F  DGI E
Sbjct  68   VLIQGIVTQGSEVLQGLSSVCQMTVEKLCSPGPFTISFNLPGPVDPRLISPKFRPDGILE  127

Query  248  GVVAKY  231
             VV +Y
Sbjct  128  VVVMRY  133



>ref|XP_010278216.1| PREDICTED: uncharacterized protein LOC104612486 [Nelumbo nucifera]
 ref|XP_010278225.1| PREDICTED: uncharacterized protein LOC104612486 [Nelumbo nucifera]
 ref|XP_010278230.1| PREDICTED: uncharacterized protein LOC104612486 [Nelumbo nucifera]
Length=426

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++K  + L+G+  +   GP IG  DIGV + AY FR++LPGV++D  +F+CE+E D
Sbjct  295  NIVATTKNGIALTGSVAERQAGPLIGLVDIGVCEDAYLFRISLPGVRKDEKEFSCEVETD  354

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G T+TG K V K  +VF M  Q  CP G F+++F+LPGPV+PR FS NFG DGI
Sbjct  355  GRVLIKGATTTGEKLVYKNSQVFEMQTQYLCPSGHFSVAFQLPGPVEPREFSGNFGADGI  414

Query  254  FEGVVAK  234
             EG+V K
Sbjct  415  LEGIVMK  421



>ref|XP_004139187.1| PREDICTED: uncharacterized protein LOC101211821 [Cucumis sativus]
 ref|XP_004166363.1| PREDICTED: uncharacterized protein LOC101225250 [Cucumis sativus]
Length=204

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ S++K  + L+GTA  G  GP IG  DIG ++++Y+FRV+LPGV RD   F+C++E D
Sbjct  77   DIVSATKTGVSLTGTAAMGKVGPVIGRVDIGENENSYFFRVSLPGVARDQNSFSCDMEPD  136

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V IRGVT+TG   V K  ++F M  +  CPPG F+++F+LPGPV+   FS  FG DGI
Sbjct  137  GQVKIRGVTTTGENIVCKNSQIFRMQSKNLCPPGHFSITFQLPGPVNNLQFSGAFGADGI  196

Query  254  FEGVVAK  234
             EG VAK
Sbjct  197  LEGSVAK  203



>ref|XP_006435432.1| hypothetical protein CICLE_v10002801mg [Citrus clementina]
 ref|XP_006435433.1| hypothetical protein CICLE_v10002801mg [Citrus clementina]
 gb|ESR48672.1| hypothetical protein CICLE_v10002801mg [Citrus clementina]
 gb|ESR48673.1| hypothetical protein CICLE_v10002801mg [Citrus clementina]
 gb|KDO85219.1| hypothetical protein CISIN_1g032427mg [Citrus sinensis]
 gb|KDO85220.1| hypothetical protein CISIN_1g032427mg [Citrus sinensis]
 gb|KDO85221.1| hypothetical protein CISIN_1g032427mg [Citrus sinensis]
Length=141

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K  +++ G+A +G   PP+G +DIGVS  AY FRV+LPG ++D  +  C I R+G V I+
Sbjct  13   KPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQ  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV  T G       +V+ M  QQ CPPG FT+SF LPGPVDPRLF P F  DGI EGVV 
Sbjct  73   GVM-TEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVM  131

Query  236  KY  231
            K+
Sbjct  132  KH  133



>ref|XP_008464812.1| PREDICTED: uncharacterized protein LOC103502607 isoform X2 [Cucumis 
melo]
 ref|XP_008464813.1| PREDICTED: uncharacterized protein LOC103502607 isoform X2 [Cucumis 
melo]
 ref|XP_008464814.1| PREDICTED: uncharacterized protein LOC103502607 isoform X2 [Cucumis 
melo]
 ref|XP_008464815.1| PREDICTED: uncharacterized protein LOC103502607 isoform X2 [Cucumis 
melo]
Length=146

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K S+IL+GTA +G +GPPIG  DIGVS+ AY FRVALPGV++D      EI+ DG V I 
Sbjct  11   KPSVILTGTAKEGSSGPPIGLVDIGVSEGAYLFRVALPGVRKDRSKVKFEIKSDGKVQIE  70

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV S  G  + +   ++ M  QQ CPPG FT+SF+LPGPVDPRL SP+F  DGI E VV 
Sbjct  71   GVMSGPG-FLKESSAMYQMKVQQLCPPGPFTVSFKLPGPVDPRLSSPSFRPDGILEVVVM  129

Query  236  K  234
            K
Sbjct  130  K  130



>ref|XP_004144249.1| PREDICTED: uncharacterized protein LOC101218704 isoform 1 [Cucumis 
sativus]
 ref|XP_004144250.1| PREDICTED: uncharacterized protein LOC101218704 isoform 2 [Cucumis 
sativus]
 ref|XP_004158289.1| PREDICTED: uncharacterized LOC101218704 isoform 1 [Cucumis sativus]
 ref|XP_004158290.1| PREDICTED: uncharacterized LOC101218704 isoform 2 [Cucumis sativus]
 gb|KGN47518.1| hypothetical protein Csa_6G355370 [Cucumis sativus]
Length=146

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K S+IL+GTA +G +GPPIG  DIGVS+ AY FRVALPGV++D      EI+ DG V I 
Sbjct  11   KPSVILTGTAKEGSSGPPIGLVDIGVSEGAYLFRVALPGVRKDRSKVKFEIKSDGKVQIE  70

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV S  G  + +   ++ M  QQ CPPG FT+SF+LPGPVDPRL SP+F  DGI E VV 
Sbjct  71   GVMSGPG-FLKESSAMYQMKVQQLCPPGPFTVSFKLPGPVDPRLSSPSFRPDGILEVVVM  129

Query  236  K  234
            K
Sbjct  130  K  130



>ref|XP_007030879.1| HSP20-like chaperones superfamily protein, putative [Theobroma 
cacao]
 gb|EOY11381.1| HSP20-like chaperones superfamily protein, putative [Theobroma 
cacao]
Length=354

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 93/156 (60%), Gaps = 27/156 (17%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD---------  468
            + NM +++K+   L+G+A  G  GP IG  DI   + +Y FRV+LPGVKRD         
Sbjct  195  LANMAAATKSGAALTGSAAMGQVGPIIGLMDIAECEDSYMFRVSLPGVKRDERNSLPIIS  254

Query  467  ------------------PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQC  342
                               G+F+CE+E DG V IRGVT+TG KTV ++ ++F M  Q  C
Sbjct  255  LFLLLYCLCYIKVATLCAAGEFSCEVENDGKVVIRGVTTTGEKTVYRFSQMFEMLSQNLC  314

Query  341  PPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            PPG F++SF+LPG VDP+ FS NFG DGI EG+V K
Sbjct  315  PPGHFSISFQLPGRVDPQQFSGNFGTDGILEGIVMK  350



>gb|AEW07440.1| hypothetical protein 0_1575_01, partial [Pinus radiata]
 gb|AFG58217.1| hypothetical protein 0_1575_01, partial [Pinus taeda]
 gb|AFG58218.1| hypothetical protein 0_1575_01, partial [Pinus taeda]
 gb|AFG58219.1| hypothetical protein 0_1575_01, partial [Pinus taeda]
 gb|AFG58220.1| hypothetical protein 0_1575_01, partial [Pinus taeda]
 gb|AFG58221.1| hypothetical protein 0_1575_01, partial [Pinus taeda]
Length=117

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            +G  DIG+ + AY FR+ALPGVK+D  DF+CE+E DG V IRG T+TG + V K  R F 
Sbjct  1    VGLVDIGICEDAYLFRIALPGVKKDQRDFSCEVESDGKVLIRGTTTTGEQRVIKNSRTFF  60

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M  Q  CPPG FT+SF+LPGPV+PR F+ NFG D I EG+V K
Sbjct  61   MKTQSLCPPGPFTVSFQLPGPVEPRQFTGNFGSDAILEGIVMK  103



>ref|XP_011023910.1| PREDICTED: uncharacterized protein LOC105125244 [Populus euphratica]
Length=410

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = -3

Query  644  PCMMPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDP  465
            P    +  + ++ +++K S+ L+GTA  G  G  +G  DIG    AYYFRV+LPGV++DP
Sbjct  261  PSCADIEQLSDLIAATKNSVALTGTAAMGQVGQVVGLVDIGECDDAYYFRVSLPGVRKDP  320

Query  464  GDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRL  285
             +F+ +IE DG V I+GVT TG +TV ++ + F M  +  CPPG F++SF+LPGPVDPR 
Sbjct  321  NEFSYKIEADGKVLIKGVTITGERTVYRFSQKFEMLSRNLCPPGQFSISFQLPGPVDPRQ  380

Query  284  FSPNFGCDGIFEGVVAK  234
             + NFG DGI + ++ K
Sbjct  381  LTSNFGDDGILDALIMK  397



>ref|XP_006375771.1| hypothetical protein POPTR_0013s02560g [Populus trichocarpa]
 gb|ERP53568.1| hypothetical protein POPTR_0013s02560g [Populus trichocarpa]
Length=366

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + ++ +++K  + L+GTA  G  G  +G  DIG    AYYFRV+LPGV++DP +F+ +IE
Sbjct  233  LSDLIAATKNGVALTGTAAMGQVGQVVGLVDIGECDDAYYFRVSLPGVRKDPNEFSYKIE  292

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT TG +TV K+ + F M  +  CPPG F++SF+LPGPVDPR  + NFG D
Sbjct  293  ADGKVLIKGVTITGERTVYKFSQKFEMLSRNLCPPGQFSISFQLPGPVDPRQLTSNFGDD  352

Query  260  GIFEGVVAK  234
            GI + ++ K
Sbjct  353  GILDALIMK  361



>ref|XP_010528867.1| PREDICTED: uncharacterized protein LOC104805867 [Tarenaya hassleriana]
Length=201

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 90/159 (57%), Gaps = 6/159 (4%)
 Frame = -3

Query  692  QVEVEGYSRRSNLERRPCMMPLLP------IPNMESSSKASLILSGTACKGVTGPPIGAF  531
            Q  + G     + E+    M  LP         +   +K  + L+G+A  G  GP IG  
Sbjct  42   QAPMSGRRENDDAEKGGPAMIFLPSESAAEFTELAGQTKTGVALTGSAAMGKIGPAIGLV  101

Query  530  DIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQ  351
            DI  +  +Y+FRV+LPGV RD  DF+C+IE DG + I+GVT TG KTV +  +VF M  Q
Sbjct  102  DIAENDDSYFFRVSLPGVSRDEKDFSCDIEPDGKILIKGVTMTGEKTVCRDSQVFKMLTQ  161

Query  350  QQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
              CPPG FT+SF+LPGPV+   F   FG DG+  G V K
Sbjct  162  NLCPPGHFTVSFQLPGPVNSEEFDGQFGSDGVLAGTVKK  200



>ref|XP_010674777.1| PREDICTED: uncharacterized protein LOC104890861 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674778.1| PREDICTED: uncharacterized protein LOC104890861 [Beta vulgaris 
subsp. vulgaris]
Length=196

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ S +++ + LSG+A  G  GP +G  DI  SK  Y FRV+LPGV RD  DF C++  +
Sbjct  67   NILSVTRSGIGLSGSAAVGTIGPVLGKMDISESKDTYLFRVSLPGVARD--DFTCDVAPN  124

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GVT+TG KTV K    F M  Q  CPPG F++SFRLPGPVD +  + +FG DG+
Sbjct  125  GHILIKGVTTTGEKTVYKNSLKFEMQSQNLCPPGHFSISFRLPGPVDSQDLAGHFGIDGV  184

Query  254  FEGVVAKYSP  225
            FEG+V K  P
Sbjct  185  FEGIVKKKIP  194



>ref|XP_006433286.1| hypothetical protein CICLE_v10002661mg [Citrus clementina]
 gb|ESR46526.1| hypothetical protein CICLE_v10002661mg [Citrus clementina]
Length=175

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ + +K  + L+G A  G  G  IGA DI  S  +Y FRVALPGV RD  DF C+I+
Sbjct  44   LDNIIAVTKTGVALTGVAALGKVGTGIGAVDIAESDDSYAFRVALPGVARDEKDFTCDID  103

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT+TG KTV K  +VF M  Q   PPG F++SF+LPGPV+   F+  FG D
Sbjct  104  PDGKVTIKGVTTTGEKTVCKQNQVFKMLTQNLSPPGHFSISFKLPGPVNTEDFTGKFGTD  163

Query  260  GIFEGVVAK  234
            G+ EG+V K
Sbjct  164  GMLEGLVKK  172



>gb|KDO59513.1| hypothetical protein CISIN_1g025769mg [Citrus sinensis]
Length=248

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ + +K  + L+G A  G  G  IGA DI  S  +Y FRVALPGV RD  DF C+I+
Sbjct  117  LDNIIAVTKTGVALTGVAALGKVGTGIGAVDIAESDDSYAFRVALPGVARDEKDFTCDID  176

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT+TG KTV K  +VF M  Q   PPG F++SF+LPGPV+   F+  FG D
Sbjct  177  PDGKVTIKGVTTTGEKTVCKQNQVFKMLTQNLSPPGHFSISFKLPGPVNTEDFTGKFGTD  236

Query  260  GIFEGVVAK  234
            GI EG+V K
Sbjct  237  GILEGLVKK  245



>ref|XP_006471987.1| PREDICTED: uncharacterized protein LOC102608404 isoform X2 [Citrus 
sinensis]
Length=203

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ + +K  + L+G A  G  G  IGA DI  S  +Y FRVALPGV RD  DF C+I+
Sbjct  72   LDNIIAVTKTGVALTGVAALGKVGTGIGAVDIAESDDSYAFRVALPGVARDEKDFTCDID  131

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT+TG KTV K  +VF M  Q   PPG F++SF+LPGPV+   F+  FG D
Sbjct  132  PDGKVTIKGVTTTGEKTVCKQNQVFKMLTQNLSPPGHFSISFKLPGPVNTEDFTGKFGTD  191

Query  260  GIFEGVVAK  234
            G+ EG+V K
Sbjct  192  GMLEGLVKK  200



>ref|XP_008454882.1| PREDICTED: uncharacterized protein LOC103495185 isoform X2 [Cucumis 
melo]
Length=204

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ S++KA + L+GTA  G  GP IG  DI  ++++Y+FRV+LPGV RD   F+C++E D
Sbjct  77   DIVSATKAGVSLTGTAAMGKVGPVIGRVDIAENENSYFFRVSLPGVARDQNSFSCDMEPD  136

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V IRGVT+TG   V K  ++F M  +  CPPG F+++F+LPGPV+   FS  FG DGI
Sbjct  137  GKVKIRGVTTTGENIVCKNSQIFRMQSKNLCPPGHFSITFQLPGPVNNLQFSGAFGADGI  196

Query  254  FEGVVAK  234
             EG V K
Sbjct  197  LEGSVGK  203



>gb|KGN60888.1| hypothetical protein Csa_2G021590 [Cucumis sativus]
Length=205

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 1/128 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD-FNCEIER  438
            ++ S++K  + L+GTA  G  GP IG  DIG ++++Y+FRV+LPGV RD  D F+C++E 
Sbjct  77   DIVSATKTGVSLTGTAAMGKVGPVIGRVDIGENENSYFFRVSLPGVARDQTDSFSCDMEP  136

Query  437  DGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDG  258
            DG V IRGVT+TG   V K  ++F M  +  CPPG F+++F+LPGPV+   FS  FG DG
Sbjct  137  DGQVKIRGVTTTGENIVCKNSQIFRMQSKNLCPPGHFSITFQLPGPVNNLQFSGAFGADG  196

Query  257  IFEGVVAK  234
            I EG VAK
Sbjct  197  ILEGSVAK  204



>gb|AAO45756.1| heat shock protein-like protein [Cucumis melo subsp. melo]
Length=172

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ S++KA + L+GTA  G  GP IG  DI  ++++Y+FRV+LPGV RD   F+C++E D
Sbjct  45   DIVSATKAGVSLTGTAAMGKVGPVIGRVDIAENENSYFFRVSLPGVARDQNSFSCDMEPD  104

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V IRGVT+TG   V K  ++F M  +  CPPG F+++F+LPGPV+   FS  FG DGI
Sbjct  105  GKVKIRGVTTTGENIVCKNSQIFRMQSKNLCPPGHFSITFQLPGPVNNLQFSGAFGADGI  164

Query  254  FEGVVAK  234
             EG V K
Sbjct  165  LEGSVGK  171



>ref|XP_006471986.1| PREDICTED: uncharacterized protein LOC102608404 isoform X1 [Citrus 
sinensis]
Length=208

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ + +K  + L+G A  G  G  IGA DI  S  +Y FRVALPGV RD  DF C+I+
Sbjct  77   LDNIIAVTKTGVALTGVAALGKVGTGIGAVDIAESDDSYAFRVALPGVARDEKDFTCDID  136

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GVT+TG KTV K  +VF M  Q   PPG F++SF+LPGPV+   F+  FG D
Sbjct  137  PDGKVTIKGVTTTGEKTVCKQNQVFKMLTQNLSPPGHFSISFKLPGPVNTEDFTGKFGTD  196

Query  260  GIFEGVVAK  234
            G+ EG+V K
Sbjct  197  GMLEGLVKK  205



>ref|XP_006392481.1| hypothetical protein EUTSA_v10023555mg [Eutrema salsugineum]
 gb|ESQ29767.1| hypothetical protein EUTSA_v10023555mg [Eutrema salsugineum]
Length=354

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = -3

Query  590  SLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGV  411
             L++ G       G  +G  DIG    AY FRV+LPGV+RD  DF+C++E +G V +RG+
Sbjct  227  DLVVDGAIAGAQAGQVMGLMDIGECSDAYLFRVSLPGVRRDERDFSCQVEENGRVLVRGI  286

Query  410  TSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            T+TG K V +Y RVF M  Q  CPPG F++SF LPGPV P  FS  FG DGI EGVV K
Sbjct  287  TTTGEKEVHRYTRVFEMQTQNLCPPGHFSVSFHLPGPVHPHEFSGRFGTDGILEGVVMK  345



>gb|KDO59515.1| hypothetical protein CISIN_1g025484mg [Citrus sinensis]
Length=252

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
             + +++K+   L+G A  G  GP +G  D+G S+  Y FR+ALPGVKRD  +F+C ++  
Sbjct  122  KLRAATKSGFALTGVATLGQVGPHVGKADVGESEDDYMFRIALPGVKRDDDEFSCTVDPT  181

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GVT+TG K+V+K+ +VF M  Q   P G F+++  LPGPVDP+ FS NFG DGI
Sbjct  182  GKILIKGVTTTGEKSVNKFSQVFEMQTQNLTPAGPFSITINLPGPVDPQQFSANFGFDGI  241

Query  254  FEGVVAK  234
             EG V K
Sbjct  242  LEGTVKK  248



>ref|XP_008464810.1| PREDICTED: uncharacterized protein LOC103502607 isoform X1 [Cucumis 
melo]
 ref|XP_008464811.1| PREDICTED: uncharacterized protein LOC103502607 isoform X1 [Cucumis 
melo]
Length=150

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD----PGDFNCEIERDGM  429
            K S+IL+GTA +G +GPPIG  DIGVS+ AY FRVALPGV++D     G    EI+ DG 
Sbjct  11   KPSVILTGTAKEGSSGPPIGLVDIGVSEGAYLFRVALPGVRKDRNESSGKVKFEIKSDGK  70

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I GV S  G  + +   ++ M  QQ CPPG FT+SF+LPGPVDPRL SP+F  DGI E
Sbjct  71   VQIEGVMSGPG-FLKESSAMYQMKVQQLCPPGPFTVSFKLPGPVDPRLSSPSFRPDGILE  129

Query  248  GVVAK  234
             VV K
Sbjct  130  VVVMK  134



>gb|KDP23534.1| hypothetical protein JCGZ_23367 [Jatropha curcas]
Length=415

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 91/143 (64%), Gaps = 6/143 (4%)
 Frame = -3

Query  644  PCMMPLLPIPNME------SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALP  483
            P ++ L P P+ E      ++ K    L+G+A  G  GP IG  DIG    AY FR++LP
Sbjct  272  PGILFLPPFPSKEDLEKIVAAGKGGFALTGSAAMGQVGPIIGLMDIGECDDAYMFRISLP  331

Query  482  GVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            GVKRD  +F+C ++  G V I G T+TG +TV ++ +VF M  +  CPPG F+++F+LPG
Sbjct  332  GVKRDEKEFSCGVDAGGRVLINGETTTGERTVCRFSQVFEMQSKNLCPPGKFSIAFQLPG  391

Query  302  PVDPRLFSPNFGCDGIFEGVVAK  234
            PVDP  FS NFG DGI EG+V K
Sbjct  392  PVDPEQFSGNFGSDGILEGIVMK  414



>ref|XP_010086739.1| hypothetical protein L484_001971 [Morus notabilis]
 gb|EXB23274.1| hypothetical protein L484_001971 [Morus notabilis]
Length=483

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +S+K  + L+G+A  G  G  IG  DIG  + +Y FRV+LPGV RD  +F+C+IE D
Sbjct  130  NLMASNKLGVALTGSAAMGKIGSIIGLMDIGECEDSYLFRVSLPGVSRDESEFSCDIEPD  189

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG + V K  ++F M  +  CPPG F++SF+LPGPVD + FS +FG DGI
Sbjct  190  GKVLIKGVTTTGEQIVCKNSQIFHMLTRNLCPPGHFSISFQLPGPVDQQQFSGSFGTDGI  249

Query  254  FEGVVAKYS  228
             EG+V K S
Sbjct  250  LEGIVKKRS  258



>ref|XP_011023580.1| PREDICTED: uncharacterized protein LOC105125012 isoform X2 [Populus 
euphratica]
Length=221

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++  S++  + L+G+A  G  GP +GA DIG S  AY FRV+LPGV RD  +F+C+I+ D
Sbjct  95   DIMDSARNGIGLAGSAATGNVGPIVGAMDIGESNDAYLFRVSLPGVSRDE-NFSCDIDPD  153

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GVT+TG  TV K+ ++F M  +  CPPG F+++F+LPGPVD + F  N G DG+
Sbjct  154  GTVFIKGVTTTGESTVCKHSQIFRMQTRNLCPPGHFSITFQLPGPVDHQQFRGNLGIDGM  213

Query  254  FEGVVAK  234
             EG+V K
Sbjct  214  LEGIVKK  220



>ref|XP_002894607.1| hypothetical protein ARALYDRAFT_474763 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70866.1| hypothetical protein ARALYDRAFT_474763 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  551  GPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYR  372
            G  +G  DIG    AY FRV+LPGV RD  DF+CE+E +G V +RGVT+TGGK V +Y +
Sbjct  231  GLMVGLMDIGECDDAYLFRVSLPGVNRDERDFSCEVEDNGKVLVRGVTTTGGKRVQRYSQ  290

Query  371  VFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            VF M  +  CPPG F++SFRLPGPV P+ FS NFG DGI EG+V K
Sbjct  291  VFEMQTRNLCPPGHFSVSFRLPGPVHPQEFSGNFGEDGILEGIVMK  336



>ref|XP_009103323.1| PREDICTED: uncharacterized protein LOC103829409 [Brassica rapa]
 ref|XP_009103324.1| PREDICTED: uncharacterized protein LOC103829409 [Brassica rapa]
Length=460

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = -3

Query  656  LERRPCMMPLLPIP--NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALP  483
            +ER     PL+ +P    E   + +++  GTA +G +   IG  DIGV+  AY+F+VALP
Sbjct  316  MERDKTDPPLVIVPPEMKECDEEPTVVTKGTASRGTS---IGVVDIGVNNVAYFFQVALP  372

Query  482  GVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            GV ++   F+CEI+ DG V + G T+TG KT+ ++ RVF M  +   PPG F LSF LPG
Sbjct  373  GVSKENDKFSCEIKSDGKVILEGSTTTGQKTIERHSRVFKMNSRTLWPPGPFKLSFNLPG  432

Query  302  PVDPRLFSPNFGCDGIFEGVVAK  234
            PVDPR  SPNF  DGIFE VV +
Sbjct  433  PVDPRFVSPNFRSDGIFEAVVIR  455



>emb|CDY01350.1| BnaA07g11230D [Brassica napus]
Length=460

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = -3

Query  656  LERRPCMMPLLPIP--NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALP  483
            +ER     PL+ +P    E   + +++  GTA +G +   IG  DIGV+  AY+F+VALP
Sbjct  316  MERDKTDPPLVIVPPEMKECDEEPTVVTKGTASRGTS---IGVVDIGVNNVAYFFQVALP  372

Query  482  GVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            GV ++   F+CEI+ DG V + G T+TG KT+ ++ RVF M  +   PPG F LSF LPG
Sbjct  373  GVSKENDKFSCEIKSDGKVILEGSTTTGQKTIERHSRVFKMNSRTLWPPGPFKLSFNLPG  432

Query  302  PVDPRLFSPNFGCDGIFEGVVAK  234
            PVDPR  SPNF  DGIFE VV +
Sbjct  433  PVDPRFVSPNFRSDGIFEAVVIR  455



>ref|XP_010528868.1| PREDICTED: uncharacterized protein LOC104805868 isoform X1 [Tarenaya 
hassleriana]
Length=398

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N  SS K+   ++GTA  G     +G  DIG    AY FRV+LPGVKRD   F+CE+E +
Sbjct  269  NATSSVKSGFDVTGTAATG----QVGLMDIGECDDAYLFRVSLPGVKRDESYFSCEVEDN  324

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V IRGVT+TG   V ++ +VF M  +  CPPG F++SFRLPGPVDP  FS +FG DGI
Sbjct  325  GKVMIRGVTTTGETRVYRFSQVFEMQTRNLCPPGPFSISFRLPGPVDPEQFSGSFGTDGI  384

Query  254  FEGVVAK  234
             EG+V K
Sbjct  385  LEGMVMK  391



>ref|XP_010528869.1| PREDICTED: uncharacterized protein LOC104805868 isoform X2 [Tarenaya 
hassleriana]
Length=391

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N  SS K+   ++GTA  G     +G  DIG    AY FRV+LPGVKRD   F+CE+E +
Sbjct  262  NATSSVKSGFDVTGTAATG----QVGLMDIGECDDAYLFRVSLPGVKRDESYFSCEVEDN  317

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V IRGVT+TG   V ++ +VF M  +  CPPG F++SFRLPGPVDP  FS +FG DGI
Sbjct  318  GKVMIRGVTTTGETRVYRFSQVFEMQTRNLCPPGPFSISFRLPGPVDPEQFSGSFGTDGI  377

Query  254  FEGVVAK  234
             EG+V K
Sbjct  378  LEGMVMK  384



>ref|XP_007211215.1| hypothetical protein PRUPE_ppa013125mg [Prunus persica]
 gb|EMJ12414.1| hypothetical protein PRUPE_ppa013125mg [Prunus persica]
Length=138

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -3

Query  590  SLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGV  411
            +++L GTA  G  GPP G  DIGVS++AY FRVALPG++++     C+I+RDG VHI G+
Sbjct  15   AVVLIGTAKGGNVGPPSGLVDIGVSEAAYLFRVALPGIRKNECRVKCDIQRDGKVHIEGI  74

Query  410  TSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
              TG   +     V+    QQ CPPG F++SFRLPGPVDPRLFSP F  DGI E VV K
Sbjct  75   M-TGVGLLRNSSTVYHSRVQQLCPPGEFSISFRLPGPVDPRLFSPYFRHDGILEVVVMK  132



>ref|XP_001755242.1| predicted protein [Physcomitrella patens]
 gb|EDQ79722.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 0/124 (0%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            ++SK  +  +GTA     GP IG  DIG+S  AY FR ALPGV+++ G+F CE+E DG V
Sbjct  196  NTSKPVITFTGTAAARNAGPLIGLVDIGISDDAYLFRTALPGVRKEEGEFKCEVECDGKV  255

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G T+TG   + +   +F M  Q  CPPG FT+SF LPGPV+P  F+  FG DGI EG
Sbjct  256  MIKGTTTTGEARIVRNNAIFVMQTQYLCPPGPFTVSFSLPGPVEPNQFTGTFGSDGILEG  315

Query  245  VVAK  234
            +V K
Sbjct  316  IVMK  319



>ref|XP_008454874.1| PREDICTED: uncharacterized protein LOC103495185 isoform X1 [Cucumis 
melo]
Length=205

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD-FNCEIER  438
            ++ S++KA + L+GTA  G  GP IG  DI  ++++Y+FRV+LPGV RD  D F+C++E 
Sbjct  77   DIVSATKAGVSLTGTAAMGKVGPVIGRVDIAENENSYFFRVSLPGVARDQTDSFSCDMEP  136

Query  437  DGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDG  258
            DG V IRGVT+TG   V K  ++F M  +  CPPG F+++F+LPGPV+   FS  FG DG
Sbjct  137  DGKVKIRGVTTTGENIVCKNSQIFRMQSKNLCPPGHFSITFQLPGPVNNLQFSGAFGADG  196

Query  257  IFEGVVAK  234
            I EG V K
Sbjct  197  ILEGSVGK  204



>gb|AAG51105.1|AC069144_2 unknown protein [Arabidopsis thaliana]
 gb|AAC64893.1| ESTs gb|Z25669 and gb|Z33817 come from this gene [Arabidopsis 
thaliana]
Length=345

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  551  GPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYR  372
            G  +G  DIG    AY FRV+LPGVKRD   F+CE+E +G V +RGVT+TGGK V +Y  
Sbjct  233  GLMVGLMDIGECDDAYLFRVSLPGVKRDERYFSCEVEDNGKVLVRGVTTTGGKRVKRYSH  292

Query  371  VFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            VF M  +  CPPG F++SFRLPGPV P  FS NFG DGI EGVV K
Sbjct  293  VFEMQTRSLCPPGNFSVSFRLPGPVHPHEFSGNFGTDGILEGVVMK  338



>ref|NP_175881.2| alpha-crystallin domain of heat shock protein-containing protein 
[Arabidopsis thaliana]
 gb|AAM13019.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91343.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33154.1| alpha-crystallin domain of heat shock protein-containing protein 
[Arabidopsis thaliana]
Length=349

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  551  GPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYR  372
            G  +G  DIG    AY FRV+LPGVKRD   F+CE+E +G V +RGVT+TGGK V +Y  
Sbjct  237  GLMVGLMDIGECDDAYLFRVSLPGVKRDERYFSCEVEDNGKVLVRGVTTTGGKRVKRYSH  296

Query  371  VFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            VF M  +  CPPG F++SFRLPGPV P  FS NFG DGI EGVV K
Sbjct  297  VFEMQTRSLCPPGNFSVSFRLPGPVHPHEFSGNFGTDGILEGVVMK  342



>ref|XP_007207594.1| hypothetical protein PRUPE_ppa019035mg, partial [Prunus persica]
 gb|EMJ08793.1| hypothetical protein PRUPE_ppa019035mg, partial [Prunus persica]
Length=128

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
             ++K+ ++L+G A +G  GP IG  DIG ++ +Y FRV LPGV RD  +F C ++ DG V
Sbjct  3    ETNKSGIVLTGAAARGQVGPIIGLVDIGENEDSYLFRVNLPGVLRDE-NFECSVDIDGEV  61

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+GVT+TG KTV K  +VF M  Q  CPPG F++SF+LPGPV+ +  + +F  DGI E 
Sbjct  62   FIKGVTTTGEKTVCKNSQVFKMQTQNLCPPGHFSISFQLPGPVECQKVTLSFETDGILEA  121

Query  245  VVAKYSP  225
            +V K  P
Sbjct  122  IVQKKLP  128



>ref|XP_006471988.1| PREDICTED: uncharacterized protein LOC102608881 [Citrus sinensis]
Length=241

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
             + +++K+   L+G A  G  G  +G  D+G S+  Y FR+ALPGVKRD  +F+C ++  
Sbjct  111  KLRAATKSGFALTGVATLGQVGTHVGKADVGESEDDYMFRIALPGVKRDDDEFSCTVDPT  170

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GVT+TG K+V+K+ +VF M  Q   P G F+++  LPGPVDP+ FS NFG DGI
Sbjct  171  GKILIKGVTTTGEKSVNKFSQVFEMQTQNLTPAGPFSITINLPGPVDPQQFSANFGFDGI  230

Query  254  FEGVVAK  234
             EG V K
Sbjct  231  LEGTVKK  237



>ref|XP_010025172.1| PREDICTED: uncharacterized protein LOC104415542 [Eucalyptus grandis]
 gb|KCW61769.1| hypothetical protein EUGRSUZ_H04477 [Eucalyptus grandis]
Length=202

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            +++K+ + L G+A  G  GP +GA DIG  + +Y FRV+LPGV RD  DF C++E DG +
Sbjct  77   AAAKSGVGLVGSAAMGRMGPIVGAVDIGECEDSYLFRVSLPGVSRDEKDFRCDVEPDGKI  136

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+GVT+TG KTV K  ++F MT Q  CPPG F++SF+LPGPV+ +  +  FG +GI EG
Sbjct  137  FIKGVTTTGEKTVVKDSQIFKMT-QNLCPPGHFSISFQLPGPVNHQQLTGFFGTNGILEG  195

Query  245  VVAK  234
            +V K
Sbjct  196  IVKK  199



>ref|XP_006433284.1| hypothetical protein CICLE_v10003281mg, partial [Citrus clementina]
 gb|ESR46524.1| hypothetical protein CICLE_v10003281mg, partial [Citrus clementina]
Length=261

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
             + +++K+   L+G A  G  G  +G  D+G S+  Y FR+ALPGVKRD  +F+C ++  
Sbjct  131  KLRAATKSGFALTGVATLGQVGTHVGKADVGESEDDYMFRIALPGVKRDDDEFSCTVDPT  190

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GVT+TG K+V+K+ +VF M  Q   P G F+++  LPGPVDP+ FS NFG DGI
Sbjct  191  GKILIKGVTTTGEKSVNKFSQVFEMQTQNLTPAGPFSITINLPGPVDPQQFSANFGFDGI  250

Query  254  FEGVVAK  234
             EG V K
Sbjct  251  LEGTVKK  257



>ref|XP_010511223.1| PREDICTED: uncharacterized protein LOC104787350 [Camelina sativa]
Length=284

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  551  GPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYR  372
            G  +G  DIG    AY FRV+LPGVKRD  DF+C +E +G V IRGVT+TG K V ++ +
Sbjct  172  GLMVGLMDIGECDDAYLFRVSLPGVKRDERDFSCAVEDNGKVLIRGVTTTGQKQVQRFSQ  231

Query  371  VFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            VF M  Q  C PG F++SFRLPGPV P+ FS NFG DGI EG+V K
Sbjct  232  VFEMQTQNLCLPGHFSVSFRLPGPVHPQEFSGNFGTDGILEGIVMK  277



>gb|KHG06402.1| 17.8 kDa class I heat shock -like protein [Gossypium arboreum]
Length=229

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + N+ +++K  + L+G A  G  GP IG  DIG  + +YYFRVALPGV  D  DFNC+IE
Sbjct  101  LDNIMAATKNGVALTGAAATGSVGPVIGKVDIGELQDSYYFRVALPGVSMDKRDFNCDIE  160

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+GV++TG K V K +++F M  Q  CPPG FT+SF+LPGPV+ +  + ++  +
Sbjct  161  PDGKVVIKGVSTTGEKIVCKNFQIFHMLTQNLCPPGPFTVSFQLPGPVNNQE-AKSYLAN  219

Query  260  GIFEGVVAK  234
            G+ E VV K
Sbjct  220  GMLEAVVKK  228



>ref|XP_010414927.1| PREDICTED: uncharacterized protein LOC104701004 [Camelina sativa]
Length=357

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  551  GPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYR  372
            G  +G  DIG    AY FRV+LPGVKRD  DF+C +E +G V IRGVT+TG K V ++ +
Sbjct  245  GLMVGLMDIGECDDAYLFRVSLPGVKRDERDFSCAVEDNGKVLIRGVTTTGQKQVQRFSQ  304

Query  371  VFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            VF M  Q  C PG F++SFRLPGPV P+ FS NFG DGI EG+V K
Sbjct  305  VFEMQTQNLCLPGHFSVSFRLPGPVHPQEFSGNFGTDGILEGIVMK  350



>ref|XP_008246496.1| PREDICTED: uncharacterized protein LOC103344661 [Prunus mume]
Length=204

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = -3

Query  602  SSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVH  423
            ++K+ ++L+G A +G  GP IG  DIG ++ +Y FRV LPGV RD  +F C ++ DG V 
Sbjct  80   TNKSGIVLTGAAARGQVGPIIGLVDIGENEDSYLFRVNLPGVLRD-ENFECSVDIDGEVF  138

Query  422  IRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGV  243
            I+GVT+TG KTV K  +VF M  Q  CPPG F++SF+LPGPV+ +  + +F  DGI E +
Sbjct  139  IKGVTTTGEKTVCKNSQVFKMQTQNLCPPGHFSISFQLPGPVECQKVTLSFETDGILEAI  198

Query  242  VAKYSP  225
            V K  P
Sbjct  199  VQKKLP  204



>ref|XP_010674779.1| PREDICTED: uncharacterized protein LOC104890862 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674780.1| PREDICTED: uncharacterized protein LOC104890862 [Beta vulgaris 
subsp. vulgaris]
Length=382

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            ++ +  ++G+A KG  G  IG  DIG S+ +Y FRVALPGVKR+   F CE++ DG V I
Sbjct  247  TRNAYAVTGSAAKGQIGSGIGLMDIGESEDSYLFRVALPGVKRENRAFQCEVQSDGRVLI  306

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
            +G T TG K + +Y + F M  Q  CP G F++SF+LPGPVDP+ FS  FG D I EG+V
Sbjct  307  KGETITGEKQILRYSQTFVMQTQNLCPSGPFSVSFQLPGPVDPQRFSGKFGSDAILEGIV  366

Query  239  AK  234
             K
Sbjct  367  MK  368



>ref|XP_002319025.1| hypothetical protein POPTR_0013s02570g [Populus trichocarpa]
 gb|EEE94948.1| hypothetical protein POPTR_0013s02570g [Populus trichocarpa]
Length=395

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ ++ K  L L+GTA  G     +G  DIG  + AY FRV+LPGV++D  +F+C+IE D
Sbjct  267  SLVAACKGGLALTGTAAMGQVQQTVGLVDIGECEDAYLFRVSLPGVRQDDNEFSCKIEND  326

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+T+TG KTV ++ + F M  +  C PG F++SF+LPGPVDP  FS  FG DGI
Sbjct  327  GKVLIKGITTTGEKTVYRFSQKFEMLSRNLCSPGQFSISFQLPGPVDPSHFSGKFGFDGI  386

Query  254  FEGVVAK  234
             E +V K
Sbjct  387  LEVIVMK  393



>gb|KHG25717.1| 16.6 kDa heat shock [Gossypium arboreum]
Length=202

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            +K  + L+G A  G  GP IG  DIGV + +YYFRV+LPGV  D  DF+C+IE DG V I
Sbjct  81   TKHGVALTGAAATGTMGPIIGLVDIGVLEDSYYFRVSLPGVSPDKKDFSCDIESDGKVLI  140

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
            +G+T+TG K V K  +VF M  Q  CP G FT+SF+LPGPVDP   +     +G+ E VV
Sbjct  141  KGLTTTGEKLVVKNSQVFHMLTQNLCPSGHFTVSFKLPGPVDPEKVTSCLA-NGLLEAVV  199

Query  239  AK  234
             K
Sbjct  200  KK  201



>ref|XP_004302443.1| PREDICTED: uncharacterized protein LOC101300639 [Fragaria vesca 
subsp. vesca]
Length=201

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = -3

Query  695  PQVEVEGYSRRSNLERR--PCMMPLLPIPNMES-----SSKASLILSGTACKGVTGPPIG  537
            P  E  G +R S  +R+  P M+ L  +   E       +   ++L+G A  G  GP IG
Sbjct  41   PSTERSG-ARESGEQRKMEPAMVLLPSLATREERDRILETSKGVVLTGVAATGQLGPIIG  99

Query  536  AFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMT  357
              DIG +  +Y FRV+LPGV RD  +F+C IE DG V I+GVT+TG KTV K   VF M 
Sbjct  100  KVDIGEADDSYLFRVSLPGVSRDE-NFSCSIEADGEVKIKGVTTTGEKTVCKNSMVFQML  158

Query  356  HQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
             Q   P G F++SF LPGPVD + F+ +F  DGI EG+V K
Sbjct  159  TQNLAPAGYFSISFHLPGPVDFQQFTGSFETDGILEGIVKK  199



>ref|XP_009119537.1| PREDICTED: uncharacterized protein LOC103844491 isoform X2 [Brassica 
rapa]
Length=309

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -3

Query  617  PNMESSSKASLILSGTACKGVTGPPI-GAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            P     S+ +L ++G          + G  DIG    AY FRV+LPGVKRD   F+CE+E
Sbjct  174  PGNHDESEPTLEVNGVIIADAQAEQMMGLMDIGECADAYLFRVSLPGVKRDERHFSCEVE  233

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             +G V +RGVT+TG K V +Y +VF M     CPPG F++SF LPGPV P+ F+ +FG D
Sbjct  234  DNGRVLVRGVTTTGEKQVHRYSQVFKMKTHNLCPPGHFSVSFHLPGPVHPQEFTGSFGTD  293

Query  260  GIFEGVVAK  234
            GIFEG V K
Sbjct  294  GIFEGTVMK  302



>emb|CDY43484.1| BnaA01g21390D [Brassica napus]
Length=328

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -3

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            +G  DIG    AY FRV+LPGVKRD   F+CE+E +G V +RGVT+TG K V +Y +VF 
Sbjct  219  MGLMDIGECADAYLFRVSLPGVKRDERHFSCEVEDNGRVLVRGVTTTGEKQVHRYSQVFK  278

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M     CPPG F++SF LPGPV P+ F+ +FG DGIFEG V K
Sbjct  279  MKTHNLCPPGHFSVSFHLPGPVHPQEFTGSFGTDGIFEGTVMK  321



>ref|XP_011023573.1| PREDICTED: uncharacterized protein LOC105125011 [Populus euphratica]
 ref|XP_011023574.1| PREDICTED: uncharacterized protein LOC105125011 [Populus euphratica]
 ref|XP_011023575.1| PREDICTED: uncharacterized protein LOC105125011 [Populus euphratica]
 ref|XP_011023576.1| PREDICTED: uncharacterized protein LOC105125011 [Populus euphratica]
 ref|XP_011023577.1| PREDICTED: uncharacterized protein LOC105125011 [Populus euphratica]
Length=413

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ ++ K  L L+GTA  G     +G  DIG  + AY FRV+LPGV++D  +F+C+IE D
Sbjct  285  SLVAACKGGLALTGTAAMGQVQQTVGLVDIGECEDAYLFRVSLPGVRQDDNEFSCKIEND  344

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+T+TG KTV ++ + F M  +  C PG F++S +LPGPVDP  FS  FG DGI
Sbjct  345  GKVLIKGITTTGEKTVYRFSQKFEMLSRNLCSPGQFSISLQLPGPVDPSQFSGKFGFDGI  404

Query  254  FEGVVAK  234
             E +V K
Sbjct  405  LEVIVMK  411



>ref|XP_009119531.1| PREDICTED: uncharacterized protein LOC103844491 isoform X1 [Brassica 
rapa]
Length=336

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -3

Query  617  PNMESSSKASLILSGTACKGVTGPPI-GAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            P     S+ +L ++G          + G  DIG    AY FRV+LPGVKRD   F+CE+E
Sbjct  201  PGNHDESEPTLEVNGVIIADAQAEQMMGLMDIGECADAYLFRVSLPGVKRDERHFSCEVE  260

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             +G V +RGVT+TG K V +Y +VF M     CPPG F++SF LPGPV P+ F+ +FG D
Sbjct  261  DNGRVLVRGVTTTGEKQVHRYSQVFKMKTHNLCPPGHFSVSFHLPGPVHPQEFTGSFGTD  320

Query  260  GIFEGVVAK  234
            GIFEG V K
Sbjct  321  GIFEGTVMK  329



>emb|CDY17557.1| BnaC01g26810D [Brassica napus]
Length=336

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -3

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            +G  DIG    AY FRV+LPGVKRD   F+CE+E +G V +RGVT+TG K V +Y +VF 
Sbjct  227  MGLMDIGECADAYLFRVSLPGVKRDERHFSCEVEDNGRVLVRGVTTTGEKQVHRYSQVFK  286

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M     CPPG F++SF LPGPV P+ F+ +FG DGIFEG V K
Sbjct  287  MKTHNLCPPGQFSVSFHLPGPVHPQEFTGSFGTDGIFEGTVMK  329



>ref|NP_177770.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
 ref|NP_974155.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
 ref|NP_001031287.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
 gb|AAF16657.1|AC012394_6 hypothetical protein; 22462-23090 [Arabidopsis thaliana]
 gb|AAG51943.1|AC015450_4 hypothetical protein; 19301-18673 [Arabidopsis thaliana]
 gb|AAM91581.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15690.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH20202.1| AT1G76440 [Arabidopsis thaliana]
 gb|AEE35841.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
 gb|AEE35842.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
 gb|AEE35843.1| HSP20-like chaperones superfamily protein [Arabidopsis thaliana]
Length=143

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = -3

Query  614  NMESSSKASLILS-----GTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNC  450
            N ++++  S ++S     GTA  G  GPPIG  DIGVS+ AY FRV+LPG++++     C
Sbjct  5    NNQTTTTHSKVISHVFCTGTAKLGSVGPPIGLVDIGVSEVAYIFRVSLPGIEKNQDKIKC  64

Query  449  EIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNF  270
            EI+R+G V I+GV        S    ++ M  QQ CPPG F+++F LPG VDPRLFSPNF
Sbjct  65   EIQREGRVCIQGVIPEIAIP-SDTGCLYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPNF  123

Query  269  GCDGIFEGVVAK  234
              DGIFE VV K
Sbjct  124  RSDGIFEVVVVK  135



>emb|CBI36753.3| unnamed protein product [Vitis vinifera]
Length=167

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -3

Query  638  MMPLLPI---PNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
             MP  P+   P++ + +K  + L+G+A  G  G   G  DIG  + +Y FRV+LPG  RD
Sbjct  30   FMPFGPMEEEPDI-AVTKNGVGLTGSAAMGKVGSSFGLVDIGEFEDSYLFRVSLPGAARD  88

Query  467  PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPR  288
               F+C+I+ DG + I+GVT+TG K V + +++F M  Q  CPPG F++SF+LPGPVD +
Sbjct  89   ERRFSCDIKPDGNILIKGVTTTGEKIVCRNFQIFKMQTQNLCPPGHFSISFQLPGPVDDQ  148

Query  287  LFSPNFGCDGIFEGVVAK  234
              S  FG +GIFEG+V K
Sbjct  149  QISGGFGINGIFEGIVKK  166



>ref|XP_006300519.1| hypothetical protein CARUB_v10020526mg [Capsella rubella]
 gb|EOA33417.1| hypothetical protein CARUB_v10020526mg [Capsella rubella]
Length=363

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -3

Query  542  IGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFA  363
            +G  DIG    AY FRVALPGVKRD   F+C +E +G V IRGVT+TG K V +Y ++F 
Sbjct  254  VGLMDIGECDDAYLFRVALPGVKRDEKYFSCAVEDNGKVLIRGVTTTGEKRVQRYSQLFE  313

Query  362  MTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            M  Q  C PG F++SFRLPGPV P  FS NFG DGI E +V K
Sbjct  314  MQTQNLCLPGHFSVSFRLPGPVHPEDFSGNFGTDGILEAIVMK  356



>ref|XP_004300109.1| PREDICTED: uncharacterized protein LOC101291830 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004300110.1| PREDICTED: uncharacterized protein LOC101291830 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=159

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K +++++GTA +G  GP IG  DIGVS +AY FRVA+PG++R      C IE DG VHI 
Sbjct  13   KPAVVVTGTANEGTAGPAIGHVDIGVSDAAYLFRVAVPGLRRKQSTVKCIIESDGKVHIE  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV +  G  ++    V+ M  QQ C  G+FT+SF LPG VD RLFSP F  DGI E VV 
Sbjct  73   GVMTETGLVLNS-STVYQMKVQQLCGAGSFTISFNLPGTVDARLFSPVFRPDGILEVVVM  131

Query  236  K  234
            K
Sbjct  132  K  132



>emb|CDP15534.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ +++K+ + L+G+A  G  GP IG+ DIG S+  Y FRV+LPGV RD  +F C+++ D
Sbjct  91   NIITATKSGVALTGSAAMGKVGPAIGSVDIGESEDEYLFRVSLPGVVRDEKNFTCDVQHD  150

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVD-PRLFSPNFGCDG  258
            G + I G+TSTG K V +   VF M  Q  CP G F++SF+LPGP+D  +     FG DG
Sbjct  151  GEITITGLTSTGEKMVRRDSMVFEMQTQNLCPRGEFSISFQLPGPIDYEKPIKGVFGSDG  210

Query  257  IFEGVVAK  234
            IFE  V K
Sbjct  211  IFEATVKK  218



>ref|XP_002889084.1| hypothetical protein ARALYDRAFT_476801 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65343.1| hypothetical protein ARALYDRAFT_476801 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  614  NMESSSK--ASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            N  + SK  + +  +GTA +G  GPPIG  DIGVS+ AY FRV+LPG++++     CEI+
Sbjct  6    NQTTHSKVISHVFFTGTAKQGSAGPPIGLVDIGVSEVAYIFRVSLPGIEKNQDKIKCEIQ  65

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
            R+G V I+GV        S    ++ M  QQ CPPG F+++F LPG VDPRLFSP F  D
Sbjct  66   REGRVCIQGVVPEIA-IPSDTGCLYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPTFRPD  124

Query  260  GIFEGVVAK  234
            GIFE VV K
Sbjct  125  GIFEVVVVK  133



>ref|XP_006302835.1| hypothetical protein CARUB_v10020967mg, partial [Capsella rubella]
 gb|EOA35733.1| hypothetical protein CARUB_v10020967mg, partial [Capsella rubella]
Length=202

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 8/146 (5%)
 Frame = -3

Query  674  YSRRSNLERRPCMMPLLPIPNMESSSKASLI----LSGTACKGVTGPPIGAFDIGVSKSA  507
            YS R N E R   M      N ++++ + +I     +GTA +G  GPPIG  DIGVS+ A
Sbjct  48   YSLRKNRETRSNTMN---TENNQTTTHSKVISHVFCTGTAKQGSAGPPIGLVDIGVSEVA  104

Query  506  YYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAF  327
            Y FRVALPG++++     CEI+R+G V I+GV        S+   ++ M  QQ CPPG F
Sbjct  105  YIFRVALPGIEKNQNKIKCEIQREGRVCIQGVVPEIA-IPSETGSLYRMQVQQLCPPGPF  163

Query  326  TLSFRLPGPVDPRLFSPNFGCDGIFE  249
            +++F LPG VDPRLF+P F  DGIFE
Sbjct  164  SITFNLPGQVDPRLFTPTFRPDGIFE  189



>gb|AAT52227.1| Hsp2 [Cucumis melo]
Length=151

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ S++KA + L+GTA  G  GP IG  DI  ++++Y+FRV+LPGV RD   F+C++E D
Sbjct  35   DIVSATKAGVSLTGTAAMGKVGPVIGRVDIAENENSYFFRVSLPGVARDQNSFSCDMEPD  94

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFG  267
            G V IRGVT+TG   V K  ++F M  +  CPPG F+++F+LPGPV+   FS  FG
Sbjct  95   GKVKIRGVTTTGENIVCKNSQIFRMQSKNLCPPGHFSITFQLPGPVNNLQFSGAFG  150



>ref|XP_010416565.1| PREDICTED: uncharacterized protein LOC104702406 [Camelina sativa]
Length=150

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S   + + ++GTA +G  GPPIG  DIGVS++AY FRV+LPG++++     CEI+R+G V
Sbjct  20   SKVISHVFVTGTAKQGSLGPPIGLVDIGVSEAAYIFRVSLPGIEKNQNKIKCEIQREGRV  79

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
             I+GV           Y ++ M  QQ CPPG F+++F LPG VDPRLFSP F  DGI E
Sbjct  80   CIQGVVPEIAIPSETGY-LYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPTFRSDGILE  137



>ref|XP_002280921.3| PREDICTED: uncharacterized protein LOC100261344 [Vitis vinifera]
Length=248

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            +K  + L+G+A  G  G   G  DIG  + +Y FRV+LPG  RD   F+C+I+ DG + I
Sbjct  126  TKNGVGLTGSAAMGKVGSSFGLVDIGEFEDSYLFRVSLPGAARDERRFSCDIKPDGNILI  185

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
            +GVT+TG K V + +++F M  Q  CPPG F++SF+LPGPVD +  S  FG +GIFEG+V
Sbjct  186  KGVTTTGEKIVCRNFQIFKMQTQNLCPPGHFSISFQLPGPVDDQQISGGFGINGIFEGIV  245

Query  239  AK  234
             K
Sbjct  246  KK  247



>ref|XP_010471799.1| PREDICTED: uncharacterized protein LOC104751541 [Camelina sativa]
 ref|XP_010471800.1| PREDICTED: uncharacterized protein LOC104751541 [Camelina sativa]
Length=143

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S   + + ++GTA +G  GPPIG  DIGVS++AY FRV+LPG++++     CEI+R+G V
Sbjct  13   SKVISHVFVTGTAKQGSLGPPIGLVDIGVSEAAYIFRVSLPGIEKNQNKIKCEIQREGRV  72

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
             I+GV           Y ++ M  QQ CPPG F+++F LPG VDPRLFSP F  DGI E
Sbjct  73   CIQGVVPEIAIPSETGY-LYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPTFRSDGILE  130



>ref|XP_010428704.1| PREDICTED: uncharacterized protein LOC104713309 [Camelina sativa]
 ref|XP_010428705.1| PREDICTED: uncharacterized protein LOC104713309 [Camelina sativa]
Length=148

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S   + + ++GTA +G  GPPIG  DIGVS++AY FRV+LPG++++     CEI+R+G V
Sbjct  18   SKVISHVFVTGTAKQGSLGPPIGLVDIGVSEAAYIFRVSLPGIEKNQNKIKCEIQREGRV  77

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
             I+GV           Y ++ M  QQ CPPG F+++F LPG VDPRLFSP F  DGI E
Sbjct  78   CIQGVVPEIAIPSETGY-LYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPTFRSDGILE  135



>dbj|BAF45120.1| small heat shock protein [Nicotiana tabacum]
Length=154

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 79/123 (64%), Gaps = 2/123 (2%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            SK ++IL+GTA K   GP +G  DIG S++AY FRVALPGV R+  +  C+I+R+G V I
Sbjct  12   SKPTVILTGTAEKCAIGPSLGVVDIGNSENAYLFRVALPGV-RNKCNIKCDIQREGRVRI  70

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
             GV  T    +    + + M  QQ  PPG FT+SF LPGPVDP L SP F  DGI E +V
Sbjct  71   EGVV-TESDVLKNSSKGYEMKVQQLSPPGPFTVSFNLPGPVDPSLCSPRFRSDGILEVIV  129

Query  239  AKY  231
             KY
Sbjct  130  LKY  132



>ref|XP_009796441.1| PREDICTED: uncharacterized protein LOC104243021 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009796442.1| PREDICTED: uncharacterized protein LOC104243021 isoform X2 [Nicotiana 
sylvestris]
Length=202

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 79/123 (64%), Gaps = 2/123 (2%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            SK ++ L+GTA K   GP +G  DIG S++AY FRVALPGV R+  +  C+I+R+G V I
Sbjct  60   SKPTVTLTGTAEKCAIGPSLGVVDIGNSENAYLFRVALPGV-RNKCNIKCDIQREGRVRI  118

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
             GV  T    +    + + M  QQ  PPG FT+SF LPGPVDPRL SP F  DGI E +V
Sbjct  119  EGVV-TESDVLKNSSKGYEMKVQQLSPPGPFTVSFNLPGPVDPRLCSPRFRSDGILEVIV  177

Query  239  AKY  231
             KY
Sbjct  178  LKY  180



>ref|XP_009599966.1| PREDICTED: uncharacterized protein LOC104095528 [Nicotiana tomentosiformis]
 ref|XP_009599967.1| PREDICTED: uncharacterized protein LOC104095528 [Nicotiana tomentosiformis]
Length=154

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            SK  + L+GTA K   GP +G  DIG S++AY FRVALPGV R+  +  C+I+R+G V I
Sbjct  12   SKPIVTLTGTAEKCAIGPSLGVVDIGNSENAYLFRVALPGV-RNKCNIKCDIQREGRVRI  70

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
             GV  T    +    + + M  QQ  PPG FT+SF LPGPVDPRL SP F  DGI E +V
Sbjct  71   EGVV-TESDALKNSSKDYEMKVQQLSPPGPFTVSFNLPGPVDPRLCSPRFRSDGILEVIV  129

Query  239  AKY  231
             KY
Sbjct  130  LKY  132



>ref|XP_006390197.1| hypothetical protein EUTSA_v10019300mg [Eutrema salsugineum]
 gb|ESQ27483.1| hypothetical protein EUTSA_v10019300mg [Eutrema salsugineum]
Length=142

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = -3

Query  614  NMESSSKASLIL----SGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCE  447
            N ++S+ + +I     +GTA +G  GPPIG  DIGVS+ AY FRV+LPG++++     CE
Sbjct  5    NHQTSTHSKVISHVFSTGTAKQGCAGPPIGLVDIGVSEIAYLFRVSLPGIEKNQNKIKCE  64

Query  446  IERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFG  267
            I+R+G V I+GV        S+   ++ M  QQ CPPG F+++F LPG VDPRLFSP   
Sbjct  65   IQREGRVCIQGVVPEIA-IPSESGCLYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPKLR  123

Query  266  CDGIFEGVVAKY  231
             DGI E VV K 
Sbjct  124  PDGILEVVVVKL  135



>emb|CDP16391.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K  + LSGTA +G  GPP+G  DIG+ +SAY FRVALPGV+       C I+ +G VHI 
Sbjct  82   KPMVTLSGTAEEGAVGPPLGLVDIGICESAYLFRVALPGVRGSESKLKCNIQLNGRVHIE  141

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            GV  T  + +    +VF M  QQ CP G F++SF LPGPVDPRL S +F   GI E VV 
Sbjct  142  GVI-TESQFMKNCSKVFEMKVQQLCPTGPFSVSFNLPGPVDPRLCSFSFKAGGILEVVVL  200

Query  236  KY  231
            K+
Sbjct  201  KF  202



>ref|XP_009629948.1| PREDICTED: uncharacterized protein LOC104120011 [Nicotiana tomentosiformis]
Length=232

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ + +   + L+G+A  G  GP IG+ D+G S+  Y FRV+LPGV RD   F C++  +
Sbjct  100  NLINYANGGIALTGSALLGKVGPLIGSIDVGESEDDYVFRVSLPGVARDEKVFRCDVGPN  159

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GV+ TG   V +   VF M  Q  CPPG F++SF+LPGP+D +  +  FG DGI
Sbjct  160  GKILIKGVSVTGEAMVCRDNMVFKMQSQNLCPPGEFSISFQLPGPIDHQNLTCVFGSDGI  219

Query  254  FEGVVAK  234
            FEGVV K
Sbjct  220  FEGVVKK  226



>ref|XP_008362532.1| PREDICTED: uncharacterized protein LOC103426215 [Malus domestica]
Length=139

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 80/126 (63%), Gaps = 5/126 (4%)
 Frame = -3

Query  602  SSKASLILSGTA-CKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S  + ++L+GTA  K   G   G  DIG SK AY  RVAL G++ + G+  C I+RDG V
Sbjct  13   SEDSGVVLTGTANAKEGNG---GLVDIGESKDAYLVRVALAGLQTNRGNVKCVIQRDGKV  69

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
            HI+GV + G + +     V+ M  QQ   PG FTLSFRLPGPVDPRLFSP+F  DGI E 
Sbjct  70   HIQGVMN-GVELLKNSSTVYHMRAQQLSSPGPFTLSFRLPGPVDPRLFSPHFQHDGILEI  128

Query  245  VVAKYS  228
            VV K S
Sbjct  129  VVLKSS  134



>ref|XP_004230179.1| PREDICTED: uncharacterized protein LOC101261366 [Solanum lycopersicum]
Length=230

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ + +   + L+G+A  G  GP +G+ DI  S+  Y FRV+LPGV RD   F C++  +
Sbjct  96   NLINCANGGVALTGSALLGKVGPLVGSVDIAESEDDYVFRVSLPGVTRDERVFRCDVGPN  155

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G++ I+GV+ TG   V +   VF M  Q  CPPG F++SF+LPGP+D +  +  FG DGI
Sbjct  156  GVIVIKGVSETGENMVRRDNMVFKMQTQNLCPPGEFSVSFQLPGPIDHQNLNCVFGSDGI  215

Query  254  FEGVVAK  234
            FEGVV K
Sbjct  216  FEGVVKK  222



>ref|XP_009370547.1| PREDICTED: uncharacterized protein LOC103959898 [Pyrus x bretschneideri]
Length=139

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 80/126 (63%), Gaps = 5/126 (4%)
 Frame = -3

Query  602  SSKASLILSGTA-CKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S  + ++L+GTA  K   G   G  DIG SK AY  RVAL G++ + G+  C I+RDG V
Sbjct  13   SEDSGVVLTGTANAKEGNG---GLVDIGESKDAYLARVALAGLQTNRGNVKCVIQRDGKV  69

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
            HI+GV + G + +     V+ M  QQ   PG FTLSFRLPGPVDPRLFSP+F  DGI E 
Sbjct  70   HIQGVMN-GVELLKNSSTVYHMRAQQLSSPGPFTLSFRLPGPVDPRLFSPHFQHDGILEI  128

Query  245  VVAKYS  228
            VV K S
Sbjct  129  VVLKSS  134



>ref|XP_006361861.1| PREDICTED: uncharacterized protein LOC102583357 [Solanum tuberosum]
Length=231

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+ + +   + L+G+A  G  GP IG+ DI  S+  Y FRV+LPGV RD   F C++  +
Sbjct  96   NLINYANGGVALTGSALLGKVGPLIGSVDIAESEDDYVFRVSLPGVARDERVFRCDVGPN  155

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GV+ TG   V +   VF M  Q  CPPG F++SF+LPGP+D +  +  FG DGI
Sbjct  156  GAIVIKGVSETGENMVRRDNMVFKMQTQNLCPPGEFSVSFQLPGPIDHQNLNCVFGSDGI  215

Query  254  FEGVVAK  234
            FEGVV K
Sbjct  216  FEGVVKK  222



>emb|CDX85951.1| BnaC06g21830D [Brassica napus]
Length=142

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
             S   + +  +GTA +G  GPP+G  DIGVS  AY FRV+LPG+ ++     CEI+R+G 
Sbjct  11   HSKVISHVFFTGTAKQGCAGPPLGLVDIGVSDIAYIFRVSLPGIAKNQDKIKCEIQREGR  70

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I+GV        S    ++ M  QQ  PPG F+++F LPG VDPRLFSP F  DGIFE
Sbjct  71   VCIQGVVPEIA-IPSDSGCLYRMQVQQLSPPGPFSITFNLPGQVDPRLFSPKFRADGIFE  129

Query  248  GVVAK  234
             VV K
Sbjct  130  VVVVK  134



>ref|XP_010534303.1| PREDICTED: uncharacterized protein LOC104809894 [Tarenaya hassleriana]
 ref|XP_010534311.1| PREDICTED: uncharacterized protein LOC104809894 [Tarenaya hassleriana]
Length=151

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 7/121 (6%)
 Frame = -3

Query  587  LILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVT  408
            +IL+GTA +G  GPPIG  DIGVS++AY FRV LPG++++     CEI++ G V I+G  
Sbjct  16   VILTGTAKEGSVGPPIGLVDIGVSEAAYIFRVCLPGIQKNQNKIKCEIQKGGRVCIQGEV  75

Query  407  ---STGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
               +    + SKY     M  QQ CP G F++SF LPG VDPRLFSP F  DGI E VV 
Sbjct  76   PELAMENDSGSKYR----MQVQQFCPAGPFSVSFNLPGQVDPRLFSPRFRPDGILEVVVV  131

Query  236  K  234
            K
Sbjct  132  K  132



>dbj|BAF45121.1| small heat shock protein [Nicotiana benthamiana]
Length=154

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = -3

Query  599  SKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHI  420
            +K ++ L+GTA K   GP +G  DIG S++AY FRVALPGV R+  +  C+I+R+G V I
Sbjct  12   TKPTVTLTGTAEKCAIGPSLGVVDIGNSENAYLFRVALPGV-RNKCNIKCDIQREGRVRI  70

Query  419  RGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVV  240
             GV  T    +    + + M  QQ  PPG FT+SF LPGPVDPRL S  F  DGI E +V
Sbjct  71   EGVI-TESDVLKNSPKDYEMKVQQLSPPGPFTVSFNLPGPVDPRLCSRRFRSDGILEVIV  129

Query  239  AKY  231
             KY
Sbjct  130  LKY  132



>ref|XP_009104673.1| PREDICTED: uncharacterized protein LOC103830611 [Brassica rapa]
Length=142

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
               S   + +  +GTA +G  GPP+G  DIGVS  AY FRV+LPG+ +      CEI+R+
Sbjct  9    TTHSKVISHVFFTGTAKQGCAGPPLGLVDIGVSDIAYIFRVSLPGIAKYQDKIKCEIQRE  68

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GV        S    ++ M  QQ  PPG F+++F LPG VDPRLFSP F  DGI
Sbjct  69   GRVCIQGVVPEIA-IPSDSGCLYRMQVQQLSPPGPFSITFNLPGQVDPRLFSPKFRADGI  127

Query  254  FEGVVAK  234
            FE VV K
Sbjct  128  FEVVVVK  134



>ref|XP_004238455.1| PREDICTED: uncharacterized protein LOC101266717 [Solanum lycopersicum]
Length=153

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 78/126 (62%), Gaps = 2/126 (2%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
            +S +K  +IL+GTA     GPP+G  DIG S +AY FRVALPGV R   +   +I+R+G 
Sbjct  8    KSHAKPDIILTGTAKTCPIGPPLGLVDIGSSDNAYIFRVALPGV-RHKCNIQFDIQREGR  66

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I GV  T  + +    + + M  QQ   PG FT+SF LPGPVDPRL SP F  DGI E
Sbjct  67   VRIEGVI-TESEALKNSLKGYEMKVQQLPSPGPFTISFNLPGPVDPRLCSPQFRTDGILE  125

Query  248  GVVAKY  231
             +V KY
Sbjct  126  VIVMKY  131



>ref|XP_006435434.1| hypothetical protein CICLE_v100013582mg, partial [Citrus clementina]
 gb|ESR48674.1| hypothetical protein CICLE_v100013582mg, partial [Citrus clementina]
Length=77

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -3

Query  458  FNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFS  279
            F+CEIE DG VHIRG TS GGKT+ K  RVF M   Q CPPG FTL F LPGPVDPRLFS
Sbjct  2    FSCEIEADGKVHIRGSTS-GGKTIRKRSRVFRMRLHQICPPGQFTLDFSLPGPVDPRLFS  60

Query  278  PNFGCDGIFEGVVAK  234
            P+F CDGIFE VV K
Sbjct  61   PHFRCDGIFEAVVIK  75



>emb|CDX68096.1| BnaA07g21360D [Brassica napus]
Length=142

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
               S   + +  +GTA +G  GPP+G  DIGVS  AY FR++LPG+ +      CEI+R+
Sbjct  9    TTHSKVISHVFFTGTAKQGCAGPPLGLVDIGVSDIAYIFRISLPGIAKYQDKIKCEIQRE  68

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+GV        S    ++ M  QQ  PPG F+++F LPG VDPRLFSP F  DGI
Sbjct  69   GRVCIQGVVPEIA-IPSDSGCLYRMQVQQLSPPGPFSITFNLPGQVDPRLFSPKFRADGI  127

Query  254  FEGVVAK  234
            FE VV K
Sbjct  128  FEVVVVK  134



>ref|XP_006342171.1| PREDICTED: uncharacterized protein LOC102581493 [Solanum tuberosum]
Length=153

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 2/126 (2%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
            +S +K  +IL+GTA     GPP+G  DIG S++AY FRVALPGV R   +   +I+R+G 
Sbjct  8    KSHAKPDIILTGTAKTCPNGPPLGLVDIGSSENAYLFRVALPGV-RHKCNIKFDIQREGR  66

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I GV  T  + +    + + M  QQ   PG FT+SF LPGPVDPRL SP F  DGI E
Sbjct  67   VRIEGVI-TESEALKNSLKGYEMKVQQLPSPGPFTISFNLPGPVDPRLCSPQFRTDGILE  125

Query  248  GVVAKY  231
             +V K+
Sbjct  126  VIVMKF  131



>ref|XP_007018683.1| HSP20-like chaperones superfamily protein, putative isoform 1 
[Theobroma cacao]
 ref|XP_007018684.1| HSP20-like chaperones superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY15908.1| HSP20-like chaperones superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY15909.1| HSP20-like chaperones superfamily protein, putative isoform 1 
[Theobroma cacao]
Length=137

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = -3

Query  578  SGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTG  399
            S   C G  GP IG  ++GV+ SA+ FRVALPG++ D     CE++ DG V I+G+ + G
Sbjct  10   SAKECDG--GPAIGVIELGVTPSAFLFRVALPGIRNDLSKVQCEVQCDGKVLIQGIVTEG  67

Query  398  GKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAKY  231
                 +   +     QQ   PG FT+SF LPGPVDPRLFSP F  DGI EGV  ++
Sbjct  68   TGLTQQSVSICQTKVQQMSSPGPFTISFNLPGPVDPRLFSPRFRRDGILEGVAVRF  123



>ref|XP_009769386.1| PREDICTED: uncharacterized protein LOC104220253 [Nicotiana sylvestris]
Length=232

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            N+   +   + L+G+A  G  GP IG+ DIG S+  Y FRV+LPGV RD   F C++   
Sbjct  100  NLIIYANGGVALTGSALLGKIGPLIGSVDIGESEDDYVFRVSLPGVARDEKVFRCDVGPS  159

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G + I+GV+ TG   V +   VF M     CPPG F++SF+LPGP+D +  +  FG DGI
Sbjct  160  GKIVIKGVSVTGEDMVCRDNMVFKMQTLNLCPPGEFSISFQLPGPIDHQNLTCVFGSDGI  219

Query  254  FEGVVAK  234
            FEGVV K
Sbjct  220  FEGVVKK  226



>ref|XP_010659834.1| PREDICTED: uncharacterized protein LOC100244207 [Vitis vinifera]
Length=156

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 4/135 (3%)
 Frame = -3

Query  629  LLPIPNMESSSKAS---LILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD  459
            +LP    + S  A+   + L+ TA  G+ GP +G  DIG  + +Y FRV+LPGV  +   
Sbjct  22   ILPKKEWDDSIDATRRGVGLTRTAALGMVGPSVGLLDIGEMEDSYMFRVSLPGVAANERL  81

Query  458  FNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFS  279
            F+C I+ DG V I+GV++TG +TV +  ++F M  Q  CPPG F++SF LPGPVD +  S
Sbjct  82   FSCNIKPDGNVFIKGVSTTGEETVYRNSQLFKMKSQNLCPPGPFSISFELPGPVDDQQIS  141

Query  278  PNFGCDGIFEGVVAK  234
             +F  +G+FE +V K
Sbjct  142  TSFE-NGVFEAMVKK  155



>emb|CDX87597.1| BnaA07g32760D [Brassica napus]
Length=138

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
             S   + +  +G+A +G  GPPIG  DIG S  AY FRV+LPG+ ++     CEI+R+G 
Sbjct  7    HSKVISHVFFTGSAKQGSPGPPIGLVDIGESDIAYLFRVSLPGIHKNLNKIKCEIQREGR  66

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I+GV        S    ++ M  QQ CPPG F+++F LPG VDPRLFSP F  DGIFE
Sbjct  67   VCIQGVVPEIA-IPSDSGCLYRMQVQQLCPPGPFSIAFNLPGQVDPRLFSPKFRPDGIFE  125



>ref|XP_009106309.1| PREDICTED: uncharacterized protein LOC103832106 [Brassica rapa]
Length=138

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
             S   + +  +G+A +G  GPPIG  DIG S  AY FRV+LPG+ ++     CEI+R+G 
Sbjct  7    HSKVISHVFFTGSAKQGSPGPPIGLVDIGESDIAYLFRVSLPGIHKNLNKIKCEIQREGR  66

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I+GV        S    ++ M  QQ CPPG F+++F LPG VDPRLFSP F  DGIFE
Sbjct  67   VCIQGVVPEIA-IPSDSGCLYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPKFRPDGIFE  125



>emb|CAN61082.1| hypothetical protein VITISV_041915 [Vitis vinifera]
Length=164

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 83/156 (53%), Gaps = 32/156 (21%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD--------------  468
            + +K  + L+G+A  G  G   G  DIG  + +Y FRV+LPG  RD              
Sbjct  8    AVTKNGVGLTGSAAMGKVGSSFGLVDIGEFEDSYLFRVSLPGAARDEKRTIIRNVLFNIK  67

Query  467  ------------------PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQC  342
                               G F+C+I+ DG + I+GVT+TG K V + +++F M  Q  C
Sbjct  68   CLITLLTPLPVLITDFATAGRFSCDIKPDGKILIKGVTTTGEKIVCRNFQIFKMQTQNLC  127

Query  341  PPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            PPG F++SF+LPGPVD +  S  FG +GIFEG+V K
Sbjct  128  PPGHFSISFQLPGPVDDQQISGGFGINGIFEGIVKK  163



>emb|CDX88280.1| BnaC06g37240D [Brassica napus]
Length=138

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -3

Query  608  ESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGM  429
             S   + +  +G+A +G  GPPIG  DIG S  AY+FRV+LPG+ ++     C+I+R+G 
Sbjct  7    HSKVISHVFFTGSAKQGTPGPPIGLADIGESDIAYFFRVSLPGIHKNLNKIKCDIQREGR  66

Query  428  VHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            V I+GV        S    ++ M  QQ CPPG F+++F LPG VDPRLFSP F  DGIFE
Sbjct  67   VCIQGVVPEIA-IPSDSGCLYRMQVQQLCPPGPFSITFSLPGQVDPRLFSPKFRPDGIFE  125



>emb|CBI36754.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 4/135 (3%)
 Frame = -3

Query  629  LLPIPNMESSSKAS---LILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD  459
            +LP    + S  A+   + L+ TA  G+ GP +G  DIG  + +Y FRV+LPGV  +   
Sbjct  117  ILPKKEWDDSIDATRRGVGLTRTAALGMVGPSVGLLDIGEMEDSYMFRVSLPGVAANERL  176

Query  458  FNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFS  279
            F+C I+ DG V I+GV++TG +TV +  ++F M  Q  CPPG F++SF LPGPVD +  S
Sbjct  177  FSCNIKPDGNVFIKGVSTTGEETVYRNSQLFKMKSQNLCPPGPFSISFELPGPVDDQQIS  236

Query  278  PNFGCDGIFEGVVAK  234
             +F  +G+FE +V K
Sbjct  237  TSFE-NGVFEAMVKK  250



>ref|XP_007030876.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY11378.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
Length=229

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE
Sbjct  101  LDNMMAHTKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIE  160

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        D
Sbjct  161  PDGTVVIKGISTTGEKVVHWGSLVFEMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-AD  219

Query  260  GIFEGVVAK  234
            GIFE +V K
Sbjct  220  GIFEAIVKK  228



>ref|XP_007099598.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY20431.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
Length=229

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE
Sbjct  101  LDNMMAHTKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIE  160

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        D
Sbjct  161  PDGTVVIKGISTTGEKVVHWGSLVFEMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-AD  219

Query  260  GIFEGVVAK  234
            GIFE +V K
Sbjct  220  GIFEAIVKK  228



>ref|XP_008348670.1| PREDICTED: uncharacterized protein LOC103411831 [Malus domestica]
Length=201

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  539  GAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAM  360
            G  DIG S++AY  RVALPG+  + G+  C I+RDG VHI+GV   G + +     V+ M
Sbjct  32   GVVDIGESEAAYLARVALPGLXTNRGNVKCVIQRDGKVHIQGVM-XGVELLRNSSTVYHM  90

Query  359  THQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAKYS  228
              Q  CPPG F +SF LPGPVDPRLFSP+F  DG+ E V+ K S
Sbjct  91   RVQXLCPPGPFAVSFTLPGPVDPRLFSPHFRHDGLLEIVLLKSS  134



>ref|XP_008381365.1| PREDICTED: uncharacterized protein LOC103444224 [Malus domestica]
Length=201

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  539  GAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAM  360
            G  DIG S++AY  RVALPG+  + G+  C I+RDG VHI+GV   G + +     V+ M
Sbjct  32   GVVDIGESEAAYLARVALPGLXTNRGNVKCVIQRDGKVHIQGVM-XGVELLRNSSTVYHM  90

Query  359  THQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAKYS  228
              Q  CPPG F +SF LPGPVDPRLFSP+F  DG+ E V+ K S
Sbjct  91   RVQXLCPPGPFAVSFTLPGPVDPRLFSPHFRHDGLLEIVLLKSS  134



>ref|XP_007030874.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY11376.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
Length=205

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE D
Sbjct  79   NMMAHTKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIEPD  138

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        DGI
Sbjct  139  GTVVIKGISTTGEKVVHWGSLVFEMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-ADGI  197

Query  254  FEGVVAK  234
            FE +V K
Sbjct  198  FEAIVKK  204



>ref|XP_007030875.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY11377.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
Length=224

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE D
Sbjct  98   NMMAHTKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIEPD  157

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        DGI
Sbjct  158  GTVVIKGISTTGEKVVHWGSLVFEMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-ADGI  216

Query  254  FEGVVAK  234
            FE +V K
Sbjct  217  FEAIVKK  223



>gb|KHG06403.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase [Gossypium arboreum]
Length=264

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = -3

Query  611  MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDG  432
            M  ++   + L+G A  G  GP IG  +IG  K +YYFRV+LPGV  D  +FNC I  DG
Sbjct  139  MIDATNNGVALTGAAATGSMGPLIGKVEIGELKDSYYFRVSLPGVSMDKREFNCVIRADG  198

Query  431  MVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIF  252
             V I+G+ +TG + VS    VF M  Q   PPG FT+SF+LPGPV+ +    +  C G  
Sbjct  199  KVTIQGILTTGEQIVSNESGVFRMLTQNLGPPGPFTVSFQLPGPVNNQEVKSHLAC-GFL  257

Query  251  EGVVAK  234
            E +V K
Sbjct  258  EAIVKK  263



>ref|XP_007030871.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY11373.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
Length=205

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE D
Sbjct  79   NMMAHAKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIEPD  138

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        DGI
Sbjct  139  GTVVIKGISTTGEKVVYWGSLVFDMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-ADGI  197

Query  254  FEGVVAK  234
            FE +V K
Sbjct  198  FEAIVKK  204



>ref|XP_009370111.1| PREDICTED: uncharacterized protein LOC103959483 [Pyrus x bretschneideri]
Length=152

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 8/126 (6%)
 Frame = -3

Query  602  SSKASLILSGTA-CKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S ++ +  +GTA  K  +G   G  DIG S++AY  RVAL G++   G+  C I+RDG V
Sbjct  29   SKESGVAFTGTAIAKDGSG---GVVDIGESEAAYLARVALAGLR---GNIKCVIQRDGRV  82

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
            HI+GV + G + +     V+ M  QQ CPPG F +SF LPGPVDPRLFSP+F  DG+ E 
Sbjct  83   HIQGVMN-GVELLRNSSTVYHMRVQQLCPPGPFAVSFSLPGPVDPRLFSPHFRHDGLLEI  141

Query  245  VVAKYS  228
            VV K S
Sbjct  142  VVPKLS  147



>emb|CAN61081.1| hypothetical protein VITISV_041914 [Vitis vinifera]
Length=420

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 6/155 (4%)
 Frame = -3

Query  683  VEGYSRRSNLERRPCMMPLLPIPNME-----SSSKASLILSGTACKGVTGPPIGAFDIGV  519
            +E +S  ++ E+     P + +P  E      +++  + L+ TA  G+ GP +G  DIG 
Sbjct  266  LESWSPEADNEKVERAGPGVILPKKEWDDSIDATRRGVGLTRTAALGMVGPSVGLLDIGE  325

Query  518  SKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCP  339
             + +Y FRV+LPGV  +   F C I+ DG V I+GV++TG +TV +  ++F M  Q  CP
Sbjct  326  MEDSYMFRVSLPGVAANERLFRCNIKPDGNVFIKGVSTTGEETVYRNSQLFKMKSQNLCP  385

Query  338  PGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            PG F++SF LPGPV+ +  S +F  +G+FE +V K
Sbjct  386  PGPFSISFELPGPVNDQQISTSFE-NGVFEAMVKK  419



>ref|XP_007030873.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY11375.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
Length=200

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE D
Sbjct  74   NMMAHAKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIEPD  133

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        DGI
Sbjct  134  GTVVIKGISTTGEKVVYWGSLVFDMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-ADGI  192

Query  254  FEGVVAK  234
            FE +V K
Sbjct  193  FEAIVKK  199



>ref|XP_007030872.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY11374.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
Length=224

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE
Sbjct  96   LDNMMAHAKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIE  155

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        D
Sbjct  156  PDGTVVIKGISTTGEKVVYWGSLVFDMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-AD  214

Query  260  GIFEGVVAK  234
            GIFE +V K
Sbjct  215  GIFEAIVKK  223



>ref|XP_008370503.1| PREDICTED: uncharacterized protein LOC103433966 [Malus domestica]
 ref|XP_008370504.1| PREDICTED: uncharacterized protein LOC103433966 [Malus domestica]
Length=211

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -3

Query  611  MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDG  432
            +E++  A ++    A     GP +G+ DIG ++ +Y FRV++PG  ++   F C+++ DG
Sbjct  84   LETNESAIILTGAAAALAQGGPTVGSVDIGENEDSYLFRVSIPGALKE-DKFRCDVDPDG  142

Query  431  MVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIF  252
             V ++GVT+TGGK V + + VF M  Q  CPPG F++S +LPGPV+      +   DGI 
Sbjct  143  KVFVQGVTTTGGKIVCRDFHVFKMKTQNLCPPGHFSVSIQLPGPVESEQKIVSLDNDGIL  202

Query  251  EGVVAKYSP  225
            EG+V K  P
Sbjct  203  EGIVKKKLP  211



>ref|XP_010027729.1| PREDICTED: uncharacterized protein LOC104418173 [Eucalyptus grandis]
 ref|XP_010027730.1| PREDICTED: uncharacterized protein LOC104418173 [Eucalyptus grandis]
 gb|KCW54321.1| hypothetical protein EUGRSUZ_I00285 [Eucalyptus grandis]
Length=133

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 68/116 (59%), Gaps = 1/116 (1%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
            K++++L GTA  G  GPPIG  DIGV++ AY FRVA+PGV ++     C I   G V I+
Sbjct  13   KSAVVLRGTAKDGKPGPPIGVVDIGVAEKAYLFRVAVPGVDKESAKLKCSIGVHGRVEIQ  72

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFE  249
            G  +  G  +S    V+ M  QQ  P G F++ F LPGPVD R    NF  DGI E
Sbjct  73   GEITDRG-VLSSSSNVYRMITQQLSPTGPFSVHFNLPGPVDTRFTLANFRQDGILE  127



>ref|XP_009349980.1| PREDICTED: uncharacterized protein LOC103941506 [Pyrus x bretschneideri]
Length=212

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -3

Query  611  MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDG  432
            +E++    ++    A     GP +G+ DIG ++ +Y FRV++PG  ++   F+C ++ DG
Sbjct  85   LETNESTIILTGAAAALAQGGPTVGSVDIGENEDSYLFRVSIPGALKE-DKFSCNVDPDG  143

Query  431  MVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIF  252
             V I+GVT+TGGK V + + VF M  Q  CPPG F++S +LPGPV+      +   +GI 
Sbjct  144  KVLIQGVTTTGGKIVCRDFHVFKMKTQNLCPPGHFSVSIQLPGPVESEQKIVSLENEGIL  203

Query  251  EGVVAKYSP  225
            EG+V K  P
Sbjct  204  EGIVKKKLP  212



>ref|XP_008388587.1| PREDICTED: uncharacterized protein LOC103450956 [Malus domestica]
Length=212

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -3

Query  611  MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDG  432
            +E++    ++    A     GP +G+ DIG ++ +Y FRV++PG  ++   F+C ++ DG
Sbjct  85   LETNESTIILTGAAAALAQGGPTVGSVDIGENEDSYLFRVSIPGALKE-DKFSCNVDPDG  143

Query  431  MVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIF  252
             V ++GVT+TGGK V + + VF M  Q  CPPG F++S +LPGPV+      +   +GI 
Sbjct  144  KVLVQGVTTTGGKIVCRDFHVFKMKTQNLCPPGHFSVSIQLPGPVESEKKIVSLENEGIL  203

Query  251  EGVVAKYSP  225
            EG+V K  P
Sbjct  204  EGIVKKKLP  212



>ref|XP_007030877.1| HSP20-like chaperones superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY11379.1| HSP20-like chaperones superfamily protein, putative isoform 1 
[Theobroma cacao]
Length=205

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            NM +++K  + L+G A  G  GP  G  DI   + +Y+FRV +PG   + GDF+C+IE D
Sbjct  79   NMMANTKYGVALTGAAATGAIGPVRGLRDISDLEDSYFFRVNVPGASMEKGDFSCDIEPD  138

Query  434  GMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGI  255
            G V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        DGI
Sbjct  139  GTVVIKGISTTGEKVVYWGSLVFDMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-ADGI  197

Query  254  FEGVVAK  234
            FE +V K
Sbjct  198  FEAIVKK  204



>ref|XP_007030878.1| HSP20-like chaperones superfamily protein, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY11380.1| HSP20-like chaperones superfamily protein, putative isoform 2, 
partial [Theobroma cacao]
Length=262

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + NM +++K  + L+G A  G  GP  G  DI   + +Y+FRV +PG   + GDF+C+IE
Sbjct  134  LDNMMANTKYGVALTGAAATGAIGPVRGLRDISDLEDSYFFRVNVPGASMEKGDFSCDIE  193

Query  440  RDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCD  261
             DG V I+G+++TG K V     VF M  Q   P G FT+SF+LPGPV+P+        D
Sbjct  194  PDGTVVIKGISTTGEKVVYWGSLVFDMLTQNLGPLGPFTISFQLPGPVNPQEVVSRL-AD  252

Query  260  GIFEGVVAK  234
            GIFE +V K
Sbjct  253  GIFEAIVKK  261



>ref|XP_010041787.1| PREDICTED: uncharacterized protein LOC104430760 [Eucalyptus grandis]
Length=103

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = -3

Query  530  DIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQ  351
            DI  S+  Y F+V+LPGV+RD   F+CE++ +G V I G+  TG K + +   VF    +
Sbjct  2    DIAESEDLYLFQVSLPGVRRDRS-FSCELDMNGEVVISGMIVTGEKMIHRLGEVFVRKTE  60

Query  350  QQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                P  F+LSF+LPGP+DP   + NFG D IFEGVV K
Sbjct  61   NLYQPSPFSLSFQLPGPIDPVQSNLNFGRDAIFEGVVKK  99



>ref|XP_002275119.1| PREDICTED: uncharacterized protein LOC100246177 [Vitis vinifera]
 ref|XP_010663999.1| PREDICTED: uncharacterized protein LOC100246177 [Vitis vinifera]
 ref|XP_010664000.1| PREDICTED: uncharacterized protein LOC100246177 [Vitis vinifera]
 ref|XP_010664001.1| PREDICTED: uncharacterized protein LOC100246177 [Vitis vinifera]
Length=145

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            S +  ++  SG+A +  +GP  G  DIG S+  Y+ RVA+PG  RD G F+  I +DG V
Sbjct  8    SHTNPAVNASGSAKERSSGPAFGGVDIGESEGGYFLRVAMPGAMRDEGSFS--ISKDGTV  65

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I+G+      +     +V  M  QQ  PPG F LS +LPG VDPR+F+     DGIFE 
Sbjct  66   DIQGMIRYEIPS-----QVPKMKVQQLYPPGPFALSLKLPGRVDPRMFTCKLRYDGIFEV  120

Query  245  VVAK  234
            VV K
Sbjct  121  VVMK  124



>ref|XP_010026618.1| PREDICTED: uncharacterized protein LOC104416989 [Eucalyptus grandis]
Length=258

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = -3

Query  560  GVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSK  381
            G+ G   G  ++  S+  Y F+V+L GV+RD   F+ +++  G V I G T+TGGK V  
Sbjct  153  GLRGSINGRVNLAESRDYYLFQVSLQGVRRDQ-TFSWKLDMSGKVLIEGETATGGKEVES  211

Query  380  YYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                        CP G F+L F+LPG VDPRL   NFG DG+FEGVV K
Sbjct  212  -------RTGNLCPSGRFSLCFQLPGRVDPRLSHCNFGSDGMFEGVVKK  253



>ref|XP_010041163.1| PREDICTED: uncharacterized protein LOC104430098 [Eucalyptus grandis]
Length=398

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (56%), Gaps = 8/124 (6%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            ++  A + ++G A   +TG      ++  S+  Y F+V+LPGV+RD   F  E++  G V
Sbjct  279  AACSAGVGVAGNADVRLTGSTTWRVNLAESEDCYLFQVSLPGVRRDQ-TFGWEVDMSGEV  337

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I G T+T G+ V              CP G F+L F+LP  VDPRL + NFG DGIFEG
Sbjct  338  LIEGETATSGQVVES-------RTGNLCPSGHFSLCFQLPRRVDPRLSNCNFGSDGIFEG  390

Query  245  VVAK  234
            VV K
Sbjct  391  VVKK  394



>ref|XP_010026623.1| PREDICTED: uncharacterized protein LOC104416994 [Eucalyptus grandis]
Length=399

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = -3

Query  560  GVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSK  381
            G+ G   G  ++  S+  Y F+V+L GV+RD   F+ +++  G V I G T+TGGK V  
Sbjct  294  GLRGSINGRVNLAESRDYYLFQVSLQGVRRDQ-TFSWKLDMSGKVLIEGETATGGKEVES  352

Query  380  YYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                        CP G F+L F+LPG VDPRL   NFG DG+FEGVV K
Sbjct  353  -------RTGNLCPSGRFSLCFQLPGRVDPRLSHCNFGSDGMFEGVVKK  394



>ref|XP_010026627.1| PREDICTED: uncharacterized protein LOC104416998 [Eucalyptus grandis]
Length=260

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKY  378
            +TG      ++  S+  Y F+V+L GV+RD   F  E++  G V I G T+T G+ V   
Sbjct  156  LTGSTTWRVNLAESEDCYMFQVSLQGVRRDQT-FGWEVDMSGEVLIEGETATSGQVVES-  213

Query  377  YRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                       CP G F+L F+LP  VDPRL + NFG DGIFEGVV K
Sbjct  214  ------RTGNLCPSGHFSLCFQLPSRVDPRLSNCNFGSDGIFEGVVKK  255



>ref|XP_010026626.1| PREDICTED: uncharacterized protein LOC104416997 [Eucalyptus grandis]
Length=398

 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 64/116 (55%), Gaps = 8/116 (7%)
 Frame = -3

Query  581  LSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTST  402
            ++G A   +TG      ++  S+  Y F+V+LPGV+RD   F  E++  G V I G T+T
Sbjct  287  VAGNADVRLTGSTTWRVNLAESEDCYLFQVSLPGVRRDQ-TFGWEVDMSGEVLIEGETAT  345

Query  401  GGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
             G+ V              CP G F+L F+LP  VDPRL +  FG DGIFEGVV K
Sbjct  346  SGQMVES-------RTGNLCPSGHFSLCFQLPSRVDPRLSNCKFGSDGIFEGVVKK  394



>ref|XP_010026613.1| PREDICTED: uncharacterized protein LOC104416984 [Eucalyptus grandis]
 ref|XP_010042162.1| PREDICTED: uncharacterized protein LOC104431183 [Eucalyptus grandis]
Length=307

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 59/111 (53%), Gaps = 10/111 (9%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD---FNCEIERDGMVHIRGVTSTGGKTV  387
            + G   G   +  S+  Y F V+ PGVK D  +   F+CE   DG V I G  +TGG TV
Sbjct  200  LAGSITGRVTLAESEDCYLFNVSPPGVKVDQMEAAAFSCEFNMDGEVLIEGEIATGGNTV  259

Query  386  SKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                R         CPPG F+L F+LPG V PR  + NF  DGIFEG+V K
Sbjct  260  ESRTR-------NPCPPGHFSLRFQLPGSVYPRRANCNFRLDGIFEGIVKK  303



>ref|XP_010026621.1| PREDICTED: uncharacterized protein LOC104416993 [Eucalyptus grandis]
Length=398

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            ++  A + ++G A   +TG      ++  S+  Y F+V+LPGV+RD   F  E++  G V
Sbjct  279  AACSAGVGVAGNADVRLTGSTTWRANLAESEDCYLFQVSLPGVRRDQ-TFGWEVDMSGEV  337

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I G T+T G+ V              CP G F+L F+LP  VDPR+ + NF  DGIFEG
Sbjct  338  LIEGETATSGQVVES-------RTGNLCPSGHFSLCFQLPSRVDPRMSNCNFASDGIFEG  390

Query  245  VVAK  234
            VV K
Sbjct  391  VVKK  394



>ref|XP_006606508.1| PREDICTED: uncharacterized protein LOC100785823 isoform X2 [Glycine 
max]
Length=431

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  614  NMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERD  435
            ++ +++K    L+GT   G  GP +G  DIG  + AY FR++LPGVKRD  +F+CE+  D
Sbjct  338  DIVAATKNGFALTGTVAMGGIGPTMGLVDIGECEDAYLFRLSLPGVKRDEREFSCEVGTD  397

Query  434  GMVHIRGVTSTGGKTVSKYYRVF  366
            G V I GVT+TG  TVS+Y +V 
Sbjct  398  GKVLISGVTTTGENTVSRYSQVI  420



>ref|XP_010026615.1| PREDICTED: uncharacterized protein LOC104416986 [Eucalyptus grandis]
Length=366

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = -3

Query  605  SSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMV  426
            ++  A + ++G A   +TG      ++  S+  Y F+V+L GV+RD   F  E++  G V
Sbjct  247  ATCSAGVRVAGNADVRLTGSTTCRVNLAESEDCYLFQVSLSGVRRDQ-TFGWEVDMSGEV  305

Query  425  HIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEG  246
             I G T+T G+ V              CP   F+L F+LPG VDPRL + NFG DGIFEG
Sbjct  306  LIEGETATSGQVVES-------RTGNLCPYKHFSLCFQLPGRVDPRLSNCNFGSDGIFEG  358

Query  245  VVAK  234
            VV K
Sbjct  359  VVKK  362



>ref|XP_006435435.1| hypothetical protein CICLE_v100013581mg, partial [Citrus clementina]
 gb|ESR48675.1| hypothetical protein CICLE_v100013581mg, partial [Citrus clementina]
Length=326

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  644  PCMMPLLPIPN-MESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRD  468
            P MMPLL +PN  E  S AS+ L+GTA KG+ GPPIG  DIG+SK AY+F+ ALPGV+RD
Sbjct  259  PAMMPLLTVPNGKECMSDASVTLTGTATKGMVGPPIGVVDIGISKLAYFFQAALPGVRRD  318



>ref|XP_010026616.1| PREDICTED: uncharacterized protein LOC104416987 [Eucalyptus grandis]
Length=176

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 71/144 (49%), Gaps = 8/144 (6%)
 Frame = -3

Query  659  NLERRPCMMPLLPIPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPG  480
            N+   P +   +  P ++++  A + ++  A   + G   G   +  S+ +Y   ++LPG
Sbjct  39   NIAFSPLITADMQCPGVDATCSAGVGVAWNADVELAGSITGCLTLAESEDSYLLNLSLPG  98

Query  479  VKRDPG-DFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPG  303
            V+RD      C+ + DG V I G  +TGG TV               PPG F+L F+LP 
Sbjct  99   VRRDQAMILTCDFDMDGEVMIEGEIATGGNTVESRPESLG-------PPGHFSLHFQLPS  151

Query  302  PVDPRLFSPNFGCDGIFEGVVAKY  231
             V P   + NFG DGIFE +V K+
Sbjct  152  RVYPGRSNCNFGSDGIFEEIVKKH  175



>ref|XP_009599964.1| PREDICTED: uncharacterized protein LOC104095526 [Nicotiana tomentosiformis]
 ref|XP_009599965.1| PREDICTED: uncharacterized protein LOC104095526 [Nicotiana tomentosiformis]
Length=144

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -3

Query  587  LILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVT  408
            ++ +G A +G  G P     + +S+ +Y F+V LP V R+  D + +I  +G V + G  
Sbjct  20   VVQTGAAIEGRPGVPTDPVTVSISEYSYKFKVILPAVTRNMCDVSVDILFNGEVEVEGRV  79

Query  407  STGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            + G  T +     F    ++  PPG FT++F LPGP D    +     DG+ EGVV K
Sbjct  80   NAGVVTSTWAPVSFNRRARRVTPPGHFTITFTLPGPCDTNFATAKLNSDGVIEGVVLK  137



>ref|XP_010026610.1| PREDICTED: uncharacterized protein LOC104416982 [Eucalyptus grandis]
Length=248

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 56/111 (50%), Gaps = 10/111 (9%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRD---PGDFNCEIERDGMVHIRGVTSTGGKTV  387
            + G   G   +   +  Y F V+ PGV+ D      F+CE   DG V I G  +TGG TV
Sbjct  141  LAGSITGRVTLAEFEDCYLFNVSPPGVRIDQMEAAAFSCEFNMDGEVLIEGEIATGGNTV  200

Query  386  SKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                          CPPG F+L F+LPG V PR  + NF  DGIFEG+V K
Sbjct  201  ES-------RTGNPCPPGHFSLRFQLPGSVYPRRANCNFRSDGIFEGIVKK  244



>ref|XP_009796246.1| PREDICTED: uncharacterized protein LOC104242839 [Nicotiana sylvestris]
Length=144

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -3

Query  587  LILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVT  408
            ++ +G A +G  G P     + +S+ +Y F V LP V R+  D + +I  +G V + G  
Sbjct  20   VVQTGAAVEGRPGVPTDPVTVSISEYSYKFNVILPAVTRNMCDVSVDILFNGEVEVEGRV  79

Query  407  STGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
            + G  T +     F    ++  PPG FT++F LPGP D          DG+ EGVV K
Sbjct  80   NAGVVTSTSAPISFNRRARRVTPPGHFTINFTLPGPCDTNFAKAKLNSDGVIEGVVLK  137



>ref|XP_010026611.1| PREDICTED: uncharacterized protein LOC104416983 [Eucalyptus grandis]
Length=339

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 57/111 (51%), Gaps = 10/111 (9%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD---FNCEIERDGMVHIRGVTSTGGKTV  387
            + G   G   +   +  Y F V+ PGV+ D  +   F+CE   DG V I G  +TGG TV
Sbjct  232  LAGSITGRVTLAEFEDCYLFNVSPPGVRIDQMEAAAFSCEFNMDGEVLIEGEIATGGNTV  291

Query  386  SKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                          CPPG F+L F+LPG V PR  + NF  DGIFEG+V K
Sbjct  292  ES-------RTGNPCPPGHFSLRFQLPGSVYPRRANCNFRSDGIFEGIVKK  335



>ref|XP_006342172.1| PREDICTED: uncharacterized protein LOC102581823 [Solanum tuberosum]
Length=150

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = -3

Query  596  KASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIR  417
             A +I +G A +G  G       I ++  +Y F V LP V R  G+ +  +  +G V + 
Sbjct  23   NAHVIRTGAAREGREGDSNDTVTITITAISYKFEVVLPAVARSLGNLSVVVLPNGNVKVE  82

Query  416  GVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVA  237
            G+   G +T S    VF    ++  P G FT++F LPGP DP +       +G+ +G   
Sbjct  83   GIVRAGERTSSTAPTVFNRRTRRIFPLGHFTINFTLPGPADPTIVRAKLDSNGVLKGTAF  142

Query  236  K  234
            K
Sbjct  143  K  143



>ref|XP_010041527.1| PREDICTED: uncharacterized protein LOC104430481 [Eucalyptus grandis]
Length=267

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 56/111 (50%), Gaps = 10/111 (9%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGD---FNCEIERDGMVHIRGVTSTGGKTV  387
            + G   G   +  S+  Y F V+ PGV+ D  +   F+CE   DG V I G  +TGG TV
Sbjct  159  LAGIITGRVTLAESEDCYLFNVSPPGVRIDQMEAAAFSCEFNMDGEVLIEGEIATGGNTV  218

Query  386  SKYYRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                          CPPG F+L F+LPG V  R  + NF  DGI +G+V K
Sbjct  219  ES-------RTGNPCPPGHFSLRFQLPGSVYLRRANCNFRSDGISKGIVKK  262



>ref|XP_010041164.1| PREDICTED: uncharacterized protein LOC104430099 [Eucalyptus grandis]
Length=354

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 55/108 (51%), Gaps = 8/108 (7%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKY  378
            + G   G   +  S+ +Y F V+LPG++ D   F+CE + DG V I G  +TGG TV   
Sbjct  251  LAGSITGRVTLAESEDSYLFNVSLPGIRIDQS-FSCEFDMDGEVLIEGEIATGGNTVES-  308

Query  377  YRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                       C PG F+L F+LPG +  R  + NF  DG FEG   K
Sbjct  309  ------RTGNPCQPGHFSLRFQLPGRIYLRGANCNFRSDGTFEGRAKK  350



>ref|XP_010026619.1| PREDICTED: uncharacterized protein LOC104416991 [Eucalyptus grandis]
Length=354

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 55/108 (51%), Gaps = 8/108 (7%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKY  378
            + G   G   +  S+ +Y F V+LPG++ D   F+CE + DG V I G  +TGG TV   
Sbjct  251  LAGSITGRVTLAESEDSYLFNVSLPGIRIDQS-FSCEFDMDGEVLIEGEIATGGNTVES-  308

Query  377  YRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                       C PG F+L F+LPG +  R  + NF  DG FEG   K
Sbjct  309  ------RTGNPCQPGHFSLRFQLPGRIYLRGANCNFRSDGTFEGRAKK  350



>ref|XP_010026624.1| PREDICTED: uncharacterized protein LOC104416995 [Eucalyptus grandis]
Length=354

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 8/108 (7%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKY  378
            + G   G   +  S+ +Y F V+LPG++ D   F+CE + DG V + G  +TGG TV   
Sbjct  251  LAGSITGRVTLAESEDSYLFNVSLPGIRIDQS-FSCEFDMDGEVLVEGEIATGGNTVES-  308

Query  377  YRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                       C PG F+L F+LPG +  R  + NF  DG FEG   K
Sbjct  309  ------RTGNPCQPGHFSLRFQLPGRIYLRGANCNFRSDGTFEGRAKK  350



>emb|CBI40761.3| unnamed protein product [Vitis vinifera]
Length=99

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 7/85 (8%)
 Frame = -3

Query  488  LPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRL  309
            +PG  RD G F+  I +DG V I+G+      +     +V  M  QQ  PPG F LS +L
Sbjct  1    MPGAMRDEGSFS--ISKDGTVDIQGMIRYEIPS-----QVPKMKVQQLYPPGPFALSLKL  53

Query  308  PGPVDPRLFSPNFGCDGIFEGVVAK  234
            PG VDPR+F+     DGIFE VV K
Sbjct  54   PGRVDPRMFTCKLRYDGIFEVVVMK  78



>ref|XP_010026629.1| PREDICTED: uncharacterized protein LOC104417002 [Eucalyptus grandis]
Length=354

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 8/108 (7%)
 Frame = -3

Query  557  VTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIERDGMVHIRGVTSTGGKTVSKY  378
            + G   G   +   + +Y F V+LPG++ D   F+CE + DG V I G  +T G TV   
Sbjct  251  LAGSITGRVTLAEYEDSYLFNVSLPGIRIDQS-FSCEFDMDGEVLIEGEIATSGNTVES-  308

Query  377  YRVFAMTHQQQCPPGAFTLSFRLPGPVDPRLFSPNFGCDGIFEGVVAK  234
                       C PG F+L F+LPG + PR  + NF  DG FEG   K
Sbjct  309  ------RTGNPCQPGHFSLRFQLPGRIYPRGANCNFRSDGTFEGRAKK  350



>ref|XP_010026625.1| PREDICTED: uncharacterized protein LOC104416996 [Eucalyptus grandis]
Length=331

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 8/84 (10%)
 Frame = -3

Query  482  GVKRD-PGDFNCEIERDGMVHIRGVTSTGGKTVSKYYRVFAMTHQQQCPPGAFTLSFRLP  306
            GV+ D    F+CE   DG V I G  +TGG TV              CPPG F+L F+LP
Sbjct  251  GVRIDQTAAFSCEFNMDGEVLIEGEIATGGNTVES-------RTGNPCPPGHFSLHFQLP  303

Query  305  GPVDPRLFSPNFGCDGIFEGVVAK  234
            G V PR  + NF  +GIFEG+V K
Sbjct  304  GCVYPRRDNCNFRSNGIFEGIVKK  327



>ref|XP_007099599.1| HSP20-like chaperones superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY20432.1| HSP20-like chaperones superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=167

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  620  IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVALPGVKRDPGDFNCEIE  441
            + NM + +K  + L+G A  G  GP  G  +I  S+ +Y+FRV +PG   + GDF+C+IE
Sbjct  105  LDNMMAHTKYGVALTGAAATGSIGPLRGLRNISESEDSYHFRVNVPGASMEKGDFSCDIE  164

Query  440  RDG  432
             DG
Sbjct  165  PDG  167



>ref|XP_008370488.1| PREDICTED: uncharacterized protein LOC103433955 isoform X2 [Malus 
domestica]
Length=341

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = -3

Query  656  LERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVA  489
            L+R    +P LP    + N+ ++++    L+G+A     GP IG  DIG    +Y FRV+
Sbjct  273  LDRAMIFLPSLPTKKELSNIVAATRDGFALTGSAAMAKVGPTIGLIDIGECDDSYLFRVS  332

Query  488  LPGVKRD  468
            LPGV+RD
Sbjct  333  LPGVRRD  339



>ref|XP_009334296.1| PREDICTED: uncharacterized protein LOC103927130 isoform X2 [Pyrus 
x bretschneideri]
Length=342

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = -3

Query  656  LERRPCMMPLLP----IPNMESSSKASLILSGTACKGVTGPPIGAFDIGVSKSAYYFRVA  489
            L+R    +P LP    + N+ ++++    L+G+A     GP IG  DIG    +Y FRV+
Sbjct  273  LDRAMIFLPSLPTKKELSNIVAATRDGFALTGSAAMAKVGPTIGLIDIGECDDSYLFRVS  332

Query  488  LPGVKRD  468
            LPGV+RD
Sbjct  333  LPGVRRD  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2726091096384