BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78128_g1_i1 len=1791 path=[1769:0-1790]

Length=1791
                                                                      Score     E

dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          749   0.0     
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    711   0.0     
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       711   0.0     
dbj|BAG80542.1|  glycosyltransferase                                    705   0.0     Lycium barbarum [goji berry]
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    699   0.0     
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    696   0.0     
emb|CDP01076.1|  unnamed protein product                                693   0.0     
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       693   0.0     
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    688   0.0     
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    682   0.0     
dbj|BAD93690.1|  glycosyltransferase                                    679   0.0     Nicotiana tabacum [American tobacco]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             679   0.0     
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    677   0.0     
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    677   0.0     
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    677   0.0     
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          676   0.0     
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         676   0.0     Populus trichocarpa [western balsam poplar]
dbj|BAG80547.1|  glycosyltransferase                                    676   0.0     Lycium barbarum [goji berry]
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    675   0.0     Vitis vinifera
gb|ADG65641.1|  glycosyltransferase                                     674   0.0     
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    674   0.0     Vitis vinifera
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    673   0.0     
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    672   0.0     Vitis vinifera
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    672   0.0     
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    672   0.0     
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    671   0.0     
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    670   0.0     Vitis vinifera
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    668   0.0     
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       668   0.0     
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                667   0.0     
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      669   0.0     
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    667   0.0     Vitis vinifera
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    667   0.0     
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    667   0.0     
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         665   0.0     
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       664   0.0     
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      663   0.0     
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       662   0.0     
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    662   0.0     
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             662   0.0     
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    660   0.0     
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             660   0.0     
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             660   0.0     
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     660   0.0     
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       660   0.0     
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                658   0.0     
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       658   0.0     
gb|AIL51400.1|  glycosyltransferase                                     657   0.0     
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    657   0.0     
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         657   0.0     
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    655   0.0     
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       655   0.0     
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  655   0.0     
emb|CDP01078.1|  unnamed protein product                                656   0.0     
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       655   0.0     
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       655   0.0     
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       655   0.0     
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            654   0.0     
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    653   0.0     
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    652   0.0     
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    652   0.0     
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    652   0.0     
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     651   0.0     
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       651   0.0     
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       650   0.0     
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             650   0.0     
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    649   0.0     
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             649   0.0     Prunus dulcis [sweet almond]
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       648   0.0     
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    648   0.0     
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    648   0.0     
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             647   0.0     
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       646   0.0     
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             645   0.0     
emb|CDP01079.1|  unnamed protein product                                645   0.0     
emb|CDO97426.1|  unnamed protein product                                645   0.0     
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       645   0.0     
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             645   0.0     
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    644   0.0     
ref|XP_004299646.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       644   0.0     
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       644   0.0     
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             642   0.0     
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    642   0.0     
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    642   0.0     
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    642   0.0     
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       640   0.0     
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       640   0.0     
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    639   0.0     
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    637   0.0     
gb|AFK34769.1|  unknown                                                 637   0.0     
emb|CAN65645.1|  hypothetical protein VITISV_012510                     640   0.0     Vitis vinifera
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    637   0.0     
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  637   0.0     
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    636   0.0     
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    636   0.0     
gb|ACJ84649.1|  unknown                                                 635   0.0     Medicago truncatula
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    635   0.0     
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  634   0.0     
gb|AFK33787.1|  unknown                                                 634   0.0     
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                633   0.0     
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              633   0.0     Ricinus communis
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             634   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    633   0.0     
emb|CDP01087.1|  unnamed protein product                                632   0.0     
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    632   0.0     
ref|XP_004305885.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       632   0.0     
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       632   0.0     
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    632   0.0     
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    631   0.0     
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       630   0.0     
gb|ABW96222.1|  glucosyltransferase                                     630   0.0     Linum usitatissimum
gb|AFK37311.1|  unknown                                                 630   0.0     
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             629   0.0     
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    628   0.0     
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       628   0.0     
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             628   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    628   0.0     
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              627   0.0     Ricinus communis
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       627   0.0     
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             626   0.0     
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             625   0.0     Populus trichocarpa [western balsam poplar]
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            625   0.0     
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    625   0.0     
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       625   0.0     
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       624   0.0     
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    624   0.0     Vitis vinifera
ref|XP_004300654.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       624   0.0     
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             623   0.0     
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  623   0.0     
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             623   0.0     
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       622   0.0     
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               622   0.0     
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            621   0.0     
emb|CDY38225.1|  BnaC05g17420D                                          621   0.0     
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       620   0.0     
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    620   0.0     
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       620   0.0     
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    621   0.0     
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    620   0.0     
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            619   0.0     
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    619   0.0     
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       619   0.0     
emb|CDP01082.1|  unnamed protein product                                625   0.0     
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    619   0.0     
emb|CDY46643.1|  BnaA07g10530D                                          619   0.0     
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    619   0.0     
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       619   0.0     
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    618   0.0     Vitis vinifera
ref|XP_004299645.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       618   0.0     
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     617   0.0     
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       618   0.0     
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             618   0.0     
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       618   0.0     
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              617   0.0     Ricinus communis
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             617   0.0     
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           614   0.0     
emb|CDP01073.1|  unnamed protein product                                615   0.0     
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       614   0.0     
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       615   0.0     
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    614   0.0     
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          614   0.0     
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    615   0.0     
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       613   0.0     
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       614   0.0     
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    613   0.0     
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       629   0.0     
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          613   0.0     
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         613   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    613   0.0     
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             612   0.0     Populus trichocarpa [western balsam poplar]
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    612   0.0     
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             612   0.0     
gb|ADV71371.1|  glycosyltransferase GT14M03                             612   0.0     
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         612   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      612   0.0     
gb|AHL38933.1|  glycosyltransferase                                     611   0.0     
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             611   0.0     
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    611   0.0     
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    611   0.0     
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    610   0.0     
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       610   0.0     
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             610   0.0     
dbj|BAB86928.1|  glucosyltransferase-10                                 610   0.0     Vigna angularis [azuki bean]
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       610   0.0     
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       609   0.0     
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          609   0.0     
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    608   0.0     
ref|XP_004303932.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       608   0.0     
ref|XP_003544213.2|  PREDICTED: UDP-glycosyltransferase 85A2-like       608   0.0     
gb|KHN24339.1|  UDP-glycosyltransferase 85A2                            608   0.0     
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    607   0.0     
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    610   0.0     
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    608   0.0     
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         607   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       607   0.0     
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    607   0.0     
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             610   0.0     
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    607   0.0     
ref|XP_008375649.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       607   0.0     
ref|XP_002893221.1|  UDP-glycosyltransferase                            605   0.0     
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       607   0.0     
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    605   0.0     
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            605   0.0     
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         605   0.0     
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             605   0.0     
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          605   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    619   0.0     
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    604   0.0     
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       604   0.0     
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    605   0.0     
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            603   0.0     
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       603   0.0     
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    603   0.0     
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       603   0.0     
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       603   0.0     
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     602   0.0     
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       603   0.0     
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       603   0.0     
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             612   0.0     
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            602   0.0     Stevia rebaudiana
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    602   0.0     
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       601   0.0     
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    600   0.0     
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    601   0.0     
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       601   0.0     
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            600   0.0     
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             600   0.0     
ref|XP_009349618.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    599   0.0     
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         598   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    598   0.0     
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       598   0.0     
ref|XP_004136879.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       598   0.0     
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       598   0.0     
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    598   0.0     
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    598   0.0     
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    597   0.0     
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             598   0.0     Populus trichocarpa [western balsam poplar]
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     597   0.0     
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       597   0.0     
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       597   0.0     
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    596   0.0     
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    597   0.0     
ref|XP_009377941.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    597   0.0     
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       597   0.0     
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             596   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       596   0.0     
ref|XP_004303931.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       596   0.0     
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    597   0.0     
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             595   0.0     
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             595   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    595   0.0     
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     594   0.0     
ref|XP_008245954.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       594   0.0     
ref|XP_004305887.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       594   0.0     
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    594   0.0     
emb|CDY46645.1|  BnaA07g10510D                                          593   0.0     
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       595   0.0     
emb|CDY62991.1|  BnaC07g48390D                                          593   0.0     
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    593   0.0     
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       595   0.0     
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     592   0.0     
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             593   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       593   0.0     
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    592   0.0     
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       592   0.0     
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    591   0.0     
gb|KDP40911.1|  hypothetical protein JCGZ_24910                         591   0.0     
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       590   0.0     
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    590   0.0     
ref|XP_010676237.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    591   0.0     
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        590   0.0     Lycium barbarum [goji berry]
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            588   0.0     
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    590   0.0     
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             589   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      589   0.0     
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    590   0.0     
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    589   0.0     
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       589   0.0     
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       589   0.0     
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             588   0.0     
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     588   0.0     
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       588   0.0     
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       588   0.0     
gb|KCW73111.1|  hypothetical protein EUGRSUZ_E01562                     586   0.0     
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    588   0.0     
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               588   0.0     
ref|XP_008342288.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       588   0.0     
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    588   0.0     
ref|NP_001031078.1|  UDP-glucosyl transferase 85A2                      588   0.0     
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            588   0.0     
ref|XP_009377942.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    588   0.0     
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              587   0.0     
gb|ACU24374.1|  unknown                                                 587   0.0     
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      587   0.0     
emb|CDO97432.1|  unnamed protein product                                587   0.0     
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             587   0.0     
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    586   0.0     
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                586   0.0     
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             586   0.0     
ref|XP_004305884.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       585   0.0     
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    586   0.0     
emb|CDY62992.1|  BnaC07g48400D                                          586   0.0     
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       585   0.0     
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    585   0.0     
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
emb|CDY41486.1|  BnaA08g20880D                                          585   0.0     
ref|XP_009377945.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    585   0.0     
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            585   0.0     
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       585   0.0     
gb|KCW66553.1|  hypothetical protein EUGRSUZ_F00351                     583   0.0     
ref|XP_007215295.1|  hypothetical protein PRUPE_ppa004989mg             584   0.0     
ref|XP_008342462.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       584   0.0     
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    583   0.0     
ref|XP_002891115.1|  predicted protein                                  584   0.0     
ref|XP_002893219.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    584   0.0     
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         584   0.0     
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          583   0.0     
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       583   0.0     
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             582   0.0     
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              582   0.0     
ref|XP_008455194.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       582   0.0     
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    582   0.0     
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             580   0.0     
ref|XP_009377949.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    580   0.0     
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          580   0.0     
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    580   0.0     
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             579   0.0     
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             580   0.0     
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             578   0.0     
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    578   0.0     
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                      578   0.0     
ref|XP_009377946.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    578   0.0     
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              578   0.0     
ref|XP_010030928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    578   0.0     
ref|XP_004155440.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    577   0.0     
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             577   0.0     
ref|XP_008229793.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       578   0.0     
ref|XP_009377951.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    577   0.0     
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             577   0.0     
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       577   0.0     
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             577   0.0     
emb|CDX91674.1|  BnaC08g05930D                                          576   0.0     
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             576   0.0     
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       576   0.0     
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               576   0.0     
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         574   0.0     
emb|CDP21827.1|  unnamed protein product                                571   0.0     
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    574   0.0     
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       573   0.0     
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    574   0.0     
ref|XP_009377934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    574   0.0     
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  574   0.0     
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             573   0.0     
ref|XP_008391275.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       573   0.0     
tpg|DAA37525.1|  TPA: cytokinin-O-glucosyltransferase 2                 573   0.0     
ref|XP_010676253.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    573   0.0     
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    573   0.0     
ref|XP_006652346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       573   0.0     
gb|KGN43734.1|  hypothetical protein Csa_7G063980                       573   0.0     
ref|XP_008357979.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       572   0.0     
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       573   0.0     
ref|XP_008375675.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       572   0.0     
ref|XP_011004479.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    572   0.0     
ref|XP_008455180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       572   0.0     
ref|XP_008362352.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       571   0.0     
ref|XP_009349616.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    572   0.0     
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    572   0.0     
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       571   0.0     
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    572   0.0     
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    571   0.0     
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    571   0.0     
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    571   0.0     
gb|AAV32497.1|  UDP-glucuronosyltransferase                             570   0.0     
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             570   0.0     
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       570   0.0     
ref|XP_004953967.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       570   0.0     
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       570   0.0     
ref|XP_006852717.1|  hypothetical protein AMTR_s00033p00056330          570   0.0     
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       570   0.0     
gb|KCW73114.1|  hypothetical protein EUGRSUZ_E01567                     567   0.0     
ref|XP_009377938.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    570   0.0     
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       569   0.0     
ref|XP_004303933.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       569   0.0     
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             568   0.0     
emb|CDY21359.1|  BnaA09g30680D                                          566   0.0     
ref|XP_004137056.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       577   0.0     
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    568   0.0     
ref|XP_010066660.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    568   0.0     
ref|XP_008224051.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       568   0.0     
ref|XP_004305878.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       568   0.0     
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       568   0.0     
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    567   0.0     
dbj|BAO51834.1|  UDP-glycosyltransferase 85K11                          567   0.0     
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    566   0.0     
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       566   0.0     
emb|CAH67108.1|  H0818E04.25                                            566   0.0     
ref|XP_008455190.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    566   0.0     
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       566   0.0     
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       566   0.0     
ref|XP_002452530.1|  hypothetical protein SORBIDRAFT_04g027470          566   0.0     
ref|XP_004155441.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    565   0.0     
dbj|BAH56949.1|  AT1G22360                                              562   0.0     
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    565   0.0     
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             564   0.0     
ref|XP_008347720.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       564   0.0     
ref|NP_001052946.1|  Os04g0451200                                       564   0.0     
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     563   0.0     
gb|EAY94339.1|  hypothetical protein OsI_16107                          564   0.0     
emb|CDY21360.1|  BnaA09g30670D                                          564   0.0     
ref|XP_009377935.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    563   0.0     
ref|XP_003579871.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    566   0.0     
ref|XP_004306404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       563   0.0     
ref|XP_008224046.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    563   0.0     
gb|KDP33196.1|  hypothetical protein JCGZ_12718                         563   0.0     
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    563   0.0     
gb|KHN26755.1|  UDP-glycosyltransferase 85A7                            566   0.0     
gb|KDP45150.1|  hypothetical protein JCGZ_19350                         562   0.0     
ref|XP_011008540.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    563   0.0     
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                562   0.0     
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    562   0.0     
ref|XP_007151400.1|  hypothetical protein PHAVU_004G043400g             562   0.0     
emb|CAN60444.1|  hypothetical protein VITISV_032467                     561   0.0     
ref|XP_007148403.1|  hypothetical protein PHAVU_006G205600g             562   0.0     
dbj|BAF49299.1|  putative glycosyltransferase                           562   0.0     
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    562   0.0     
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       561   0.0     
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         561   0.0     
ref|XP_002323189.1|  hypothetical protein POPTR_0016s02190g             561   0.0     
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    561   0.0     
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         561   0.0     
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     561   0.0     
dbj|BAJ88498.1|  predicted protein                                      561   0.0     
ref|XP_008347719.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       561   0.0     
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       560   0.0     
gb|KHN42558.1|  UDP-glycosyltransferase 85A2                            559   0.0     
gb|KDP33203.1|  hypothetical protein JCGZ_12725                         559   0.0     
gb|AFJ52994.1|  UDP-glycosyltransferase 1                               558   0.0     
ref|XP_008224047.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    559   0.0     
ref|XP_003545681.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       559   0.0     
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          559   0.0     
ref|XP_010066664.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    559   0.0     
gb|AFJ53003.1|  UDP-glycosyltransferase 1                               559   0.0     
ref|XP_008229744.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       559   0.0     
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       559   0.0     
ref|XP_002307921.2|  hypothetical protein POPTR_0006s02440g             558   0.0     
ref|XP_002310553.1|  hypothetical protein POPTR_0007s05230g             559   0.0     
ref|XP_006853259.1|  hypothetical protein AMTR_s00038p00231120          558   0.0     
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    558   0.0     
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       555   0.0     
dbj|BAO51840.1|  UDP-glycosyltransferase 85K12                          558   0.0     
ref|XP_004953966.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       558   0.0     
ref|XP_010027911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    558   0.0     
dbj|BAJ85429.1|  predicted protein                                      558   0.0     
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    558   0.0     
ref|XP_002530114.1|  UDP-glucuronosyltransferase, putative              558   0.0     
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    558   0.0     
ref|XP_003618644.1|  Cytokinin-O-glucosyltransferase                    557   0.0     
ref|XP_008342456.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       557   0.0     
ref|XP_006647925.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       557   0.0     
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             557   0.0     
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     556   0.0     
ref|XP_008353653.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       556   0.0     
ref|XP_009350114.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    560   0.0     
gb|AFK38894.1|  unknown                                                 556   0.0     
ref|XP_008224050.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       556   0.0     
gb|EAY87581.1|  hypothetical protein OsI_08991                          556   0.0     
gb|KDP33206.1|  hypothetical protein JCGZ_12728                         555   0.0     
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       556   0.0     
gb|ABK95289.1|  unknown                                                 556   0.0     
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             555   0.0     
ref|XP_004485548.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       556   0.0     
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       555   0.0     
ref|NP_001048165.1|  Os02g0755900                                       555   0.0     
ref|XP_006853219.1|  hypothetical protein AMTR_s00038p00218410          554   0.0     
ref|XP_002323188.2|  hypothetical protein POPTR_0016s02200g             556   0.0     
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             555   0.0     
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          554   0.0     
gb|EPS62953.1|  hypothetical protein M569_11835                         554   0.0     
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            554   0.0     
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       554   0.0     
ref|XP_006603934.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       553   0.0     
ref|XP_006366314.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       553   0.0     
gb|KCW56974.1|  hypothetical protein EUGRSUZ_I02647                     553   0.0     
ref|XP_006366313.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       553   0.0     
ref|XP_003575222.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    553   0.0     
gb|AGU14127.1|  UDP-glycosyltransferase                                 553   0.0     
ref|XP_008373152.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       553   0.0     
gb|KCW66114.1|  hypothetical protein EUGRSUZ_G03386                     552   0.0     
ref|XP_004489495.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       554   0.0     
ref|XP_010067875.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    553   0.0     
ref|XP_008799459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       551   0.0     
gb|EAY87578.1|  hypothetical protein OsI_08989                          551   0.0     
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    551   0.0     



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/482 (72%), Positives = 417/482 (87%), Gaps = 4/482 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+S E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRL R+RGPE
Sbjct  1     MGSLSSELDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLERTRGPE  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S++GLPSFRFETIPDGLP SD D TQDI +LCES +  CLGPFKDL+ARLN +     PP
Sbjct  61    SLRGLPSFRFETIPDGLPVSDADVTQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FT+DAAEE GIPE+LFWT  A GFLG++ +  ++DKG++PLKD SY  N
Sbjct  121   VSCIVSDGVMSFTVDAAEELGIPEVLFWTTSACGFLGYMHFTQLLDKGYTPLKDESYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LDWVKGM G+RLRD+PSF+RTTNPD+ ++K+I+  T RA+ ASAI++NTFDALE
Sbjct  181   GYLETELDWVKGMKGIRLRDIPSFLRTTNPDEYMLKFILQETGRARRASAIILNTFDALE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              EAL  LQSMLPPVYA GP QF + QV+DS VRAL  +LWKEDTSC+EWL+T +P SVVY
Sbjct  241   HEALMALQSMLPPVYAVGPLQFLQTQVKDSNVRALASNLWKEDTSCLEWLDTKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VN+GSITVMT DQL+EFAWGLAN+KKPFLWI+RPDLV+GE A++P EF+EET++RGML+S
Sbjct  301   VNYGSITVMTPDQLLEFAWGLANSKKPFLWIVRPDLVTGEAAIIPPEFLEETKDRGMLSS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QEQV++HPA+GGFLTH+GWNSTLESICSGVPM+CWPFFA+QQTNC Y C++WGIG E
Sbjct  361   WCSQEQVLNHPAIGGFLTHNGWNSTLESICSGVPMLCWPFFAEQQTNCHYACSKWGIGKE  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID++VKR EVE+LVRELM GEKG EM++KAME KKLAE+AAT+  GSS+ N++++IN  L
Sbjct  421   IDSNVKRDEVEKLVRELMEGEKGGEMKKKAMEWKKLAEEAATSSIGSSHINIDKLINLHL  480

Query  1505  SP  1510
              P
Sbjct  481   LP  482



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/480 (70%), Positives = 398/480 (83%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI G   KPHAVCIP+PAQGHINPMLKLAKILN+KGFHITFVN+E+NHRRLL+SRGP+
Sbjct  1     MGSI-GNHNKPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGLPSF+FETIPDGLPP D D+TQDI  LCES T+ CLGPFK+L+A+LN +     PP
Sbjct  60    SLKGLPSFQFETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDTCSSNVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCI+SDG M FTL AA+E GIPE+ FWT  A GFLG++ Y  +  KG+ PLKD+S   N
Sbjct  120   VSCIISDGCMSFTLAAAQELGIPEVFFWTPSACGFLGYMHYHELAKKGYFPLKDASDLTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LDW+ GM  +RLRDLPSF+R+TNPDD +  Y++  T R+KS SAI+VNTFD LE
Sbjct  180   GYLETALDWIPGMKDIRLRDLPSFLRSTNPDDFLFNYLIQETNRSKSVSAIVVNTFDPLE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
             +E L  LQ++LPPVYA GP  F  + +ED  +  LG +LWKED   VEWL++  P SVVY
Sbjct  240   KEVLESLQTLLPPVYAIGPLHFLVKHIEDKNLERLGSNLWKEDPKSVEWLDSKKPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMTA+QL+EFAWGLAN++  FLWIIRPD+VSGEEA+LP EFVEET+ERGML S
Sbjct  300   VNFGSITVMTANQLIEFAWGLANSEMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPA+GGFLTHSGWNSTLESI +GVPMICWPFFA+QQTNCW+ CTQWGIGME
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGME  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LVRELM GEKG +M++KAME KKLAE+AA  P GSSY N++++IN+ L
Sbjct  420   IDNNVKRDEVESLVRELMVGEKGKDMKKKAMEWKKLAEEAAAKPAGSSYVNIDKLINEIL  479



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/480 (70%), Positives = 397/480 (83%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI G   KPHAVCIP+PAQGHINPMLKLAKILNHKGFHITFVN+E+NHRRLL+SRGP+
Sbjct  1     MGSI-GNHNKPHAVCIPYPAQGHINPMLKLAKILNHKGFHITFVNNEYNHRRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGLPSF+FETIPDGLPP D D+TQDIA LCES T+ CLGPFK+L+A+LN +     PP
Sbjct  60    SLKGLPSFQFETIPDGLPPCDADSTQDIAALCESTTKTCLGPFKELLAKLNDTCSSNVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCI+SDG M FTL AA+E GIPE+ FWT  A G LG++ Y  +  KG+ PLKD+S   N
Sbjct  120   VSCIISDGCMSFTLAAAQELGIPEVFFWTPSACGLLGYMHYHELAKKGYFPLKDASDLTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LDW+ GM  +RLRDLPSF+R+TNPDD +  Y++  T R+KS SAI++NTFD LE
Sbjct  180   GYLETALDWIPGMKDIRLRDLPSFLRSTNPDDFLFNYLIQETNRSKSVSAIVINTFDPLE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
             +E L  LQ++LPPVY  GP  F  + +ED  +  LG +LWKED   VEWL++  P SVVY
Sbjct  240   KEVLESLQTLLPPVYTIGPLHFLVKHIEDKNLERLGSNLWKEDPKSVEWLDSKKPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMTA+QLVEFAWGLAN++  FLWIIRPD+VSGEEA+LP EFVEET+ERGML S
Sbjct  300   VNFGSITVMTANQLVEFAWGLANSQIQFLWIIRPDIVSGEEAILPPEFVEETKERGMLTS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPA+GGFLTHSGWNSTLESI +GVPMICWPFFA+QQTNCW+ CTQWGIGME
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGME  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LVREL+ GEKG +M++KAME KKL E+AA  PTGSSY N++++IN+ L
Sbjct  420   IDNNVKRDEVESLVRELIVGEKGKDMKKKAMEWKKLTEEAAAKPTGSSYVNIDKLINEIL  479



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/478 (67%), Positives = 398/478 (83%), Gaps = 2/478 (0%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS E  KPHAVCIPFPAQGHINPMLKLAKIL+HKGFHITFVN+E+NHRRLL+SRGP 
Sbjct  1     MGSISAELKKPHAVCIPFPAQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGPN  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             ++ GL SFR+ETIPDGLPP D DATQDI +LCES T  CLGPFKDL+A+LN +   PPVS
Sbjct  61    ALNGLSSFRYETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKDLLAKLNNTLEVPPVS  120

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FT  AA+E G+PE+LFWT  A GFLG++ Y  +I+KG++PLKD+SY  NGY
Sbjct  121   CIVSDGVMSFTFAAAQELGVPEVLFWTTSACGFLGYMHYSTIIEKGYTPLKDASYLTNGY  180

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T LD + GM  +RLRDLPSF+RTTNPD+ +VK+++  TE+A+ ASAI++NTF+ LE E
Sbjct  181   LETTLDCIPGMENIRLRDLPSFLRTTNPDEFMVKFVLQETEKARKASAIVLNTFETLESE  240

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
              L  L+++LPPVY  GP     + V+D  ++ LG SLWKE+  C++WL+T +P SVVYVN
Sbjct  241   VLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEEPECIQWLDTKEPNSVVYVN  300

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGSITVMT +QL+EFAWGLAN+++ FLWIIRPD+VSG+EA+LP EFVEET++RGMLASWC
Sbjct  301   FGSITVMTPNQLIEFAWGLANSQQDFLWIIRPDIVSGDEAILPPEFVEETKKRGMLASWC  360

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
              QE+V++HPA+GGFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+  T+WG+GMEID
Sbjct  361   SQEEVLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWGVGMEID  420

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              +VKR EVE LVRELM GEKG +M++K +E K LA+++A   TGSSY N+E+V+N  L
Sbjct  421   NNVKRDEVESLVRELMVGEKGKQMKKKTIEWKNLAQESAKQSTGSSYVNIEKVVNDIL  478



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/480 (69%), Positives = 395/480 (82%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS +G   KPHAVCIP+PAQGHINPMLKLAKILN+KGFHITFVN+E+NHRRLL+SRGP+
Sbjct  1     MGS-TGNHDKPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGLPSFRFETIPDGLPP D D+TQDI  LCES T+ CLGPFK+L+A+LN +     P 
Sbjct  60    SLKGLPSFRFETIPDGLPPCDADSTQDIPALCESTTKTCLGPFKELLAKLNDTCSSNVPT  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCI+SDG M FTL AA+E GIPE+ FWT  A G LG++ Y  +  KG+ PLKD +   N
Sbjct  120   VSCIISDGCMSFTLAAAQELGIPEVFFWTPSACGSLGYLHYHELAKKGYFPLKDVTDLTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LDW+ GM G+RLRDLPSF+R+TN DD +  +++  T+R+K ASAI++NTFD LE
Sbjct  180   GYLETALDWIPGMKGIRLRDLPSFLRSTNSDDFMFNFLIQETDRSKLASAIVINTFDPLE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
             +E L  LQ +LPPVYA GP  F  + +ED  +  LG +LWKED   VEWL++  P SVVY
Sbjct  240   KEVLESLQPLLPPVYAIGPLHFLVKHIEDKNLEHLGSNLWKEDPKSVEWLDSKKPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMTA+QL+EFAWGLAN++  FLWIIRPD+VSGEEA+LP EFVEET+ERGML S
Sbjct  300   VNFGSITVMTANQLIEFAWGLANSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPA+GGFLTHSGWNSTLESI +GVPMICWPFFA+QQTNCW+ CTQWGIGME
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGME  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LVRELM GEKG +M++KAME KK AE+AA  PTGSSY N++++IN+ L
Sbjct  420   IDNNVKRDEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKPTGSSYVNIDKLINEIL  479



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/481 (67%), Positives = 398/481 (83%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    K HAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNH+RLL+SRGP+
Sbjct  1     MGSISLPE-KHHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN----QSGPP  424
             ++ GLP F+F+TIPDGLPPSDVDATQDI +LCES T  CL PF++L+A LN       PP
Sbjct  60    ALNGLPDFQFKTIPDGLPPSDVDATQDIPSLCESTTTRCLDPFRNLLAELNGPSSSQVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTL+AA E G+PEILFWT  A GFLG++ Y  +I+KG +PLKD+SY  N
Sbjct  120   VSCIVSDGVMSFTLEAAAELGVPEILFWTTSACGFLGYMHYAKLIEKGLTPLKDASYLSN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+  LDW+ GM  +RL+DLPSF+RTTNPDD +VK+++  TERAK ASAI++NTF  LE
Sbjct  180   GYLEQSLDWIPGMKDIRLKDLPSFLRTTNPDDYMVKFVLQETERAKKASAIILNTFQELE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              + +N L ++LPP+Y  GP QF +++V+D  +  LG +LWKE+  C++WL++ DP SVVY
Sbjct  240   DDVINALSAILPPIYTIGPLQFLQKEVKDERLSVLGSNLWKEEPECLDWLDSKDPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT  QLVEFAWGLAN+K+ FLWIIRPDLVSG+ A+LP EF+EET++RG+LAS
Sbjct  300   VNFGSITVMTPGQLVEFAWGLANSKQTFLWIIRPDLVSGDSAILPPEFLEETKDRGLLAS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPA+GGFLTHSGWNSTLESICSGVPMICWPFFA+QQTNCW+CCT+W  G+E
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWYNGLE  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LV ELM GEKG +M++KA+E K  AE+AA +  GSSY+N+E+V+   L
Sbjct  420   IDNNVKRDEVESLVTELMVGEKGMDMKKKALEWKNKAEEAAKSSGGSSYSNLEKVVQVLL  479

Query  1505  S  1507
             S
Sbjct  480   S  480



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/481 (67%), Positives = 398/481 (83%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+S    KPHAVCIP+PAQGHINPMLKLAK+L+HKGFHITFVN+EFNH+RLL+SRGP+
Sbjct  1     MGSMSLPE-KPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             ++ GLP F+F+ IPDGLPPSDVDATQD+ +LCES T +CLGPF+DL+A LN +     PP
Sbjct  60    ALNGLPDFQFKAIPDGLPPSDVDATQDVPSLCESTTTHCLGPFRDLLAELNDTSSSQVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTL+AA E G+PEILFWT  A GFLG++ Y  +I+KG +PLKD+S   N
Sbjct  120   VSCIVSDGVMSFTLEAAAELGVPEILFWTPSACGFLGYMHYAKLIEKGLTPLKDASCLSN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+  +DW+ GM  +RLRDLPSF+RTTNPDD ++K+++  TER+K A AI++NTF+ LE
Sbjct  180   GYLEQAIDWIPGMKDIRLRDLPSFLRTTNPDDYMIKFVLQETERSKKALAIILNTFEELE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              + +N L ++LPP+YA GP QF E++V+D  +  LG +LWKE+  C+EWL++ DP SVVY
Sbjct  240   DDVINALSAILPPIYAIGPLQFLEKEVKDERLSVLGSNLWKEEPECLEWLDSKDPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMTADQLVEFAWGL N+K+ FLWIIRPDLVSG+ A+LP EF+EE ++RG+LAS
Sbjct  300   VNFGSITVMTADQLVEFAWGLVNSKQTFLWIIRPDLVSGDSAILPPEFLEEIKDRGLLAS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPA+GGFLTHSGWNSTLESICSGVPMICWPFFA+QQTNCW+CCT+WG G+E
Sbjct  360   WCPQEQVLSHPAIGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWGNGLE  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR  VE LV ELM   KG +M++KA+E K  AE+AA +  GSSY N+E+V+   L
Sbjct  420   IDNNVKREGVESLVTELMVRGKGKDMKKKALEWKNKAEEAAKSSGGSSYANLEKVVQVLL  479

Query  1505  S  1507
             S
Sbjct  480   S  480



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/471 (69%), Positives = 387/471 (82%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAKI NHKGFHITFVN+E+NHRRLL+SRGP+S+KGLPSFR
Sbjct  12    KPHAVCIPYPAQGHINPMLKLAKIFNHKGFHITFVNTEYNHRRLLKSRGPDSLKGLPSFR  71

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDGG  451
             FETIPDGLPPSD D+TQDI +L +S T  CLGPFK+L+A+LN +     PPVSCIVSDG 
Sbjct  72    FETIPDGLPPSDADSTQDIVSLGKSTTNTCLGPFKELLAKLNNTCSSNVPPVSCIVSDGC  131

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTL AA+E GIPEI FWT  A G LG++ YR + +KG+ PLKD+S   NGYL+T LDW
Sbjct  132   MSFTLAAAQELGIPEIFFWTPSACGLLGYMHYRDLAEKGYFPLKDASDLTNGYLETALDW  191

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             + GM G+RLRDLP+ +R+TNPDD +  Y++  T+R+K ASAI++NTFD LE+E L  LQ 
Sbjct  192   IPGMKGIRLRDLPTLLRSTNPDDFLFNYLIQETDRSKLASAIVINTFDPLEKEVLETLQV  251

Query  812   MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             +LPPVY  GP  F  + +ED  +  LG +LWKE+   VEWL++  P SVVYVNFGSITVM
Sbjct  252   LLPPVYTIGPLHFLLKHIEDRNLECLGSNLWKEEPKTVEWLDSKKPNSVVYVNFGSITVM  311

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             TA+QL EFAWGLAN++  FLWIIRPD VSGE+A LP EF+EET+ERGML SWC QEQV+S
Sbjct  312   TANQLTEFAWGLANSQMDFLWIIRPDTVSGEKATLPSEFMEETKERGMLTSWCAQEQVLS  371

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTHSGWNSTLESI +GVPMICWPFF +QQTNCW+ CTQW IGMEID +VKR E
Sbjct  372   HPAIGGFLTHSGWNSTLESISNGVPMICWPFFTEQQTNCWFKCTQWRIGMEIDNNVKRDE  431

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VERLVR+LM GEKG +M++KAME KKLAE+AA   TGSSY N++++IN+ L
Sbjct  432   VERLVRDLMVGEKGKDMKKKAMEWKKLAEEAAAKSTGSSYVNIDKLINEIL  482



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/479 (67%), Positives = 397/479 (83%), Gaps = 3/479 (1%)
 Frame = +2

Query  77    MGSISGE-GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             M SI+ E   KPHAVC+P+PAQGHI+PMLKLAKILN KGFHITFVN+E NH+RLL+SRGP
Sbjct  1     MCSINAEISDKPHAVCLPYPAQGHISPMLKLAKILNRKGFHITFVNTEHNHKRLLKSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARL-NQSGPPVS  430
             +S+ GLPSFRFE IPDGLPP D DATQDI++LC+S T  CLGPFK+L+A+L N + P VS
Sbjct  61    DSLNGLPSFRFEAIPDGLPPCDPDATQDISSLCKSTTTTCLGPFKELLAKLKNTNVPRVS  120

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTL AA++ GIP++LFWT  A G L ++ YR +++KG++PLKD SY  NGY
Sbjct  121   CIVSDGSMSFTLSAAQDLGIPQVLFWTPSACGLLCYMYYRDLVEKGYTPLKDESYLTNGY  180

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T LDW+ GM G+RLRDLPSF+RTTNP++ ++++I+  TER+K+A+AI++NTF+ LE+E
Sbjct  181   LETSLDWIPGMKGIRLRDLPSFLRTTNPEEYMIEFIIQETERSKNATAIIINTFETLERE  240

Query  791   ALNGLQSMLPPVYAAGPFQFF-EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              +  LQ +LPP+YA GP     E  V D  +  LG +LWKE+T C++WL++    SVVYV
Sbjct  241   VVESLQKLLPPIYAVGPLNLLMEHFVVDKNLEGLGSNLWKEETKCLDWLDSKKANSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL EFAWGL N++  FLWIIRPD+VSGEEA+LP EFVEET+ERGML SW
Sbjct  301   NFGSITVMTANQLTEFAWGLVNSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQ++SHPA+GGFLTHSGWNSTLESI +GVPMICWPFFA+QQTNCW+ CT+WGIGMEI
Sbjct  361   CPQEQILSHPAIGGFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTKWGIGMEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D +VKR EVE LVRELM GEKG +M++KAME KK AE+AA   TGSSY N++++IN+ L
Sbjct  421   DNNVKRAEVESLVRELMVGEKGKDMKKKAMEWKKSAEEAAAKTTGSSYVNIDKLINEIL  479



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/471 (66%), Positives = 389/471 (83%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
              PHAVCIP+PAQGHINPMLKLAK+L+H+GFHITFVN+E+NH+R+LRSRGP S+ GLPSF+
Sbjct  9     NPHAVCIPYPAQGHINPMLKLAKLLHHRGFHITFVNTEYNHKRILRSRGPNSLDGLPSFQ  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDGG  451
             F+ IPDGLPP+  D TQDI +LCES ++ CL PFK+LI  LN +     PPV+CIVSDG 
Sbjct  69    FKAIPDGLPPTSNDVTQDIPSLCESTSKTCLVPFKNLITNLNDTSSSNVPPVTCIVSDGV  128

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTL+AA+E GIPE+LFWT  A GFL +  Y  +I+KG +PLKD SY  NGYLD+V+DW
Sbjct  129   MSFTLEAAQELGIPEVLFWTTSACGFLAYAHYHQLIEKGLTPLKDESYLSNGYLDSVIDW  188

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             + GM G+RLRD+PSF+RTT+P+D ++K++   TERAK ASAI++NT+DALE E L  L S
Sbjct  189   IPGMKGIRLRDIPSFVRTTDPEDFMLKFVKAETERAKKASAIVLNTYDALEHEGLVSLAS  248

Query  812   MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             MLPPVY+ GP      QV DS ++ +G +LW E++ C+EWL++ +P SVVYVNFGSITVM
Sbjct  249   MLPPVYSIGPLHLLLNQVTDSDLKLIGSNLWIEESGCLEWLDSKEPNSVVYVNFGSITVM  308

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T+DQL EFAWGLAN+ + FLW+IRPDLV+G+ A+LP EFV  T+ERG+ +SWC QEQV+S
Sbjct  309   TSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFSSWCSQEQVLS  368

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HP++GGFLTHSGWNST+ESIC GVPMICWPFFA+QQTNC YCCT+WGIGMEI++DVKR E
Sbjct  369   HPSIGGFLTHSGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSDVKRGE  428

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE LVRELMGG+KG EM++K  ELKK+AE+A T+ TGSS  N++++INK L
Sbjct  429   VESLVRELMGGDKGREMKKKTRELKKMAEEAITS-TGSSCMNLDDMINKVL  478



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/480 (67%), Positives = 397/480 (83%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP+
Sbjct  1     MGSIGAEFTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGL SFRFETIPDGLPP D DATQDI +LCES T  CLGPF+DL+A+LN +     PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTSNVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCI+SDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  VI+KG++PLKD+S   N
Sbjct  121   VSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLKDASDLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LD++  M  VRLRDLPSF+RTTNPD+ ++K+++  TERA+ ASAI++NT++ LE
Sbjct  181   GYLETTLDFIPCMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTYETLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L+++LPPVY  GP  F  + V+D  ++ L  SLWKE+  C++WL+T +P SVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHVDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT +QL+EFAWGLAN+++ FLWIIRPD+VSG+ ++LP EFVEET++RGMLAS
Sbjct  301   VNFGSITVMTPNQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLAS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V+SHPA+GGFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+  T+W +GME
Sbjct  361   WCSQEEVLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID DVKR EVE LVRELM G KG +M++KAME K+LAE +A   +GSSY N+E+V+N  L
Sbjct  421   IDCDVKRDEVESLVRELMVGGKGKKMKKKAMEWKELAEASAKEHSGSSYVNIEKVVNDIL  480



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/481 (67%), Positives = 402/481 (84%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++     PHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNH+RLL+SRGP+
Sbjct  1     MGSVAAAIEMPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PPV  427
             S+ GLPSFRFETIPDGLPP+DVDATQDI +LC S T+ CL PFK+L+ +LN      PPV
Sbjct  61    SLNGLPSFRFETIPDGLPPTDVDATQDIPSLCYSTTRTCLAPFKELLHKLNDPSSNVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FT+DAAEE G+PE+LFWT  A GFL ++ +R +IDKG++PLKD SYF NG
Sbjct  121   TCIVSDGVMSFTVDAAEELGVPEVLFWTTSACGFLAYLHFRQLIDKGYTPLKDESYFTNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+TV+DW+ GM G+RL D+PSFIRTTNPDD ++ +++  TER+K ASAI++NT+  LEQ
Sbjct  181   YLNTVIDWIPGMKGIRLSDIPSFIRTTNPDDIMLNFVISETERSKRASAIILNTYRELEQ  240

Query  788   EALNGLQSML-PPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             EAL+ L S+L PPVY+ G  QF   Q+ E+  +  +G +LWKE+T C++WL+T +P SVV
Sbjct  241   EALDALTSLLLPPVYSIGHLQFQLNQIPENDSIMRIGSNLWKEETECIDWLDTKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMTA+QL+EFAWGLAN+K+ F+W+IRPDLV G+ A+LP EFV ET+ER +LA
Sbjct  301   YVNFGSITVMTANQLIEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV++HPA+GGFLTHSGWNSTLESIC GVP+ICWPFFA+QQTNC Y C +WGIGM
Sbjct  361   SWCPQEQVLNHPAIGGFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID++VKR EVE LVR+LM GEKG EM+ KA+ELKK A++AAT P GSSY N+E++I   
Sbjct  421   EIDSNVKREEVEVLVRDLMVGEKGQEMKLKALELKKKAKEAATGPVGSSYVNLEKLITHV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/480 (67%), Positives = 395/480 (82%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP+
Sbjct  1     MGSIGAEFTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGL SFRFETIPDGLPP D DATQDI +LCES T  CLGPF+DL+A+LN +     PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTSNVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCI+SDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  VI+KG++PLKD+S   N
Sbjct  121   VSCIISDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYYKVIEKGYAPLKDASDLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LD++  M  VRLRDLPSF+RTTNPD+ ++K+++  TERA+ ASAI++NT++ LE
Sbjct  181   GYLETTLDFIPCMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTYETLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L+++LPPVY  GP  F  + V+D  ++ L  SLWKE+  C++WL+T +P SVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHVDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT  QL+EFAWGLAN+++ FLWIIRPD+VSG+ ++LP EFVEET++RGMLAS
Sbjct  301   VNFGSITVMTPSQLIEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLAS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V+SHPA+GGFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+  T+W +GME
Sbjct  361   WCSQEEVLSHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID DVKR EVE LVRELM G KG +M++K ME K+LAE +A   +GSSY N+E+V+N  L
Sbjct  421   IDCDVKRDEVESLVRELMVGGKGKKMKKKTMEWKELAEASAKEHSGSSYVNIEKVVNDIL  480



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/481 (67%), Positives = 398/481 (83%), Gaps = 9/481 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI G   KPHAVCIPFPAQGHINPMLKLAK+L+H GFHITFVN+E+NH+RLL+SRGP 
Sbjct  1     MGSI-GILEKPHAVCIPFPAQGHINPMLKLAKLLHHNGFHITFVNTEYNHQRLLKSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG----P  421
             S++GLPSFRFETIPDGLPPSD  DATQDI +LC+S T  CL PF+DL+A+LN +G    P
Sbjct  60    SLEGLPSFRFETIPDGLPPSDAADATQDIPSLCQSTTTTCLAPFRDLLAKLNDTGSSNVP  119

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PVSCIVSDG M FT++AAEE GIPEI FWT  A GF  +  Y  +I+KG+SPL D+S+  
Sbjct  120   PVSCIVSDGVMSFTVEAAEELGIPEIFFWTPSACGFFAYTQYEKLIEKGYSPLPDASFLT  179

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NGYLDT++D +  M G+RLRD+PSFIRTTNPD+ +VK++V  T RA+ ASAI++NTF+ L
Sbjct  180   NGYLDTIIDEIPSMKGIRLRDIPSFIRTTNPDEFMVKFVVDETRRARRASAIVLNTFEDL  239

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E++ L+ L S+LPP+YA GP    E QV+D  +  LG +LWK++  C+EWL++ +  SVV
Sbjct  240   ERDVLDALSSILPPIYAIGPLHLLENQVDDKALEQLGSNLWKDEPQCLEWLDSKEANSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT+DQL+EFAWGLAN+  PFLWIIRPDLVSG++AVLP EF+E T+ERG+LA
Sbjct  300   YVNFGSITVMTSDQLLEFAWGLANSNLPFLWIIRPDLVSGDKAVLPPEFLEATKERGLLA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             +WCPQE+V+ HP+VGGFLTHSGWNSTLESICSGVPMICWPFFA+QQTNCWYCCT+W IGM
Sbjct  360   NWCPQERVLRHPSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWNIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID++VKR EVE LVR+LM GE+G EM+R+AME KKLA  +A +   SS  N+E+VI++ 
Sbjct  420   EIDSNVKRDEVEILVRKLMIGEEGQEMKRRAMEWKKLAVASAQS---SSSENLEKVISRV  476

Query  1502  L  1504
             L
Sbjct  477   L  477



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/480 (67%), Positives = 396/480 (83%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP+
Sbjct  1     MGSIGAELTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGL SFRFETIPDGLPP + DATQDI +LCES T  CL PF+DL+A+LN +     PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCEADATQDIPSLCESTTNTCLAPFRDLLAKLNDTNTSNVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  VI+KG++PLKD+S   N
Sbjct  121   VSCIVSDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYMHYCKVIEKGYAPLKDASDLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LD++ GM  VRLRDLPSF+RTTNPD+ ++K+++  TERA+ ASAI++NTF+ LE
Sbjct  181   GYLETTLDFIPGMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTFETLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L+++LPPVY  GP  F  + V+D  ++ L  SLWKE+  C++WL+T +P SVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHVDDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT +QL+EFAWGLAN+++ FLWIIRPD+VSG+ ++LP EFVEET+ RGMLAS
Sbjct  301   VNFGSITVMTPNQLIEFAWGLANSQQTFLWIIRPDIVSGDASILPPEFVEETKNRGMLAS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V+SHPA+ GFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+  T+W +GME
Sbjct  361   WCSQEEVLSHPAIVGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID+DVKR EVE LVRELM G KG +M++KAME K+LAE +A   +GSSY N+E+++N  L
Sbjct  421   IDSDVKRDEVESLVRELMVGGKGKKMKKKAMEWKELAEASAKEHSGSSYVNIEKLVNDIL  480



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/476 (64%), Positives = 384/476 (81%), Gaps = 4/476 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVCIP+PAQGHINPMLKLAK+L+ +GF ITFVN+EFNH RLL+++GP 
Sbjct  1     MGSME----KPHAVCIPYPAQGHINPMLKLAKLLHFRGFRITFVNTEFNHTRLLKAQGPN  56

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             S+ GLP+F+FETIPDGLPPS+VDATQDI +LC S  +NCL PF+ L+A+LN  GPPV+CI
Sbjct  57    SLNGLPTFQFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRGPPVTCI  116

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
              SD  M FTLDAA+E GIP++L WT  A GF+ +V YR +IDKGF+PLKD SY  NGYLD
Sbjct  117   FSDAVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLD  176

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             TV+DW+ GM G+RL+DLPSFIRTT+PDD ++ + +   ERA+ ASAI+ NTFDALEQE L
Sbjct  177   TVVDWIPGMKGIRLKDLPSFIRTTDPDDIMLDFAMGELERARKASAIIFNTFDALEQEVL  236

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             + +  M PP+Y  GP Q    Q+ DS ++ +G +LWKE+  C++WL++ +P SVVYVN+G
Sbjct  237   DAIAPMYPPIYTIGPLQLLPDQIHDSELKLIGSNLWKEEPECLKWLDSKEPNSVVYVNYG  296

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITVMT  QL+EFAWGLAN+ + FLWI+RPDLVSGE A+LP EFV ET +RG+LA WCPQ
Sbjct  297   SITVMTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCPQ  356

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQV++H A+GGFLTH+GWNST+E +C+GVPMICWPFFA+QQTNC YCCT+WG+GMEID+D
Sbjct  357   EQVLTHQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSD  416

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR EV +LVRELM GEKG  M++K ME K  AE A T P GSSY N+E++  + L
Sbjct  417   VKRDEVAKLVRELMVGEKGKVMKKKTMEWKHRAEVATTGPDGSSYLNLEKIFEQVL  472



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/471 (66%), Positives = 387/471 (82%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
              PHAVCIP+PAQGHINPMLKLAK+L+HKGFHITFVN+E+NH+R+LRSRG  S+ GLPSF+
Sbjct  9     NPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRILRSRGLNSLDGLPSFQ  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDGG  451
             F+ IPDGLPP+  D TQDI +LCES ++ C+ PFKDLI  LN +     PPV+CIVSDG 
Sbjct  69    FKAIPDGLPPTSNDVTQDIPSLCESTSKTCMVPFKDLITNLNDTSSSNVPPVTCIVSDGV  128

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTL+AA+E GIPE+LFWT  A GFL +   R +I+KG +PLKD SY  NGYLD+V+DW
Sbjct  129   MSFTLEAAQELGIPEVLFWTTSACGFLAYAHCRQLIEKGLTPLKDESYLSNGYLDSVIDW  188

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             + GM G+RLRD+PSF+RTT+P+D ++K+I   +ERAK ASAI++NT+DALE E L  L S
Sbjct  189   IPGMKGIRLRDIPSFVRTTDPEDFMLKFIKAESERAKKASAIVLNTYDALEHEGLVSLAS  248

Query  812   MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             MLPPVY+ GP      QV DS ++ +G +LW E++ C+EWL++ +P SVVYVNFGSITVM
Sbjct  249   MLPPVYSIGPLHLLLNQVTDSDLKLIGSNLWIEESGCLEWLDSKEPNSVVYVNFGSITVM  308

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T+DQL EFAWGLAN+ + FLW+IRPDLV+G+ A+LP EFV  T+ERG+ ASWC QEQV+S
Sbjct  309   TSDQLTEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFASWCSQEQVLS  368

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HP++GGFLTH+GWNST+ESIC GVPMICWPFFA+QQTNC YCCT+WGIGMEI++DVKR E
Sbjct  369   HPSIGGFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSDVKRGE  428

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE LVRELMGGEKG EM++K  E KK+AE+A T+ TGSS  N++++INK L
Sbjct  429   VESLVRELMGGEKGSEMKKKTREWKKMAEEAITS-TGSSCMNLDDMINKVL  478



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/481 (67%), Positives = 396/481 (82%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGL-KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             M SIS E L KPHAVCIP+PAQGHI+PMLKLAKIL+H GFHITFVN+E NH+RLL+SRGP
Sbjct  1     MYSISAEDLDKPHAVCIPYPAQGHISPMLKLAKILHHNGFHITFVNTEHNHKRLLKSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----P  421
             +SVKGLPSF+FETIPDGLPP D D TQDI +L ES T +C GPFK+L+ +LN +     P
Sbjct  61    DSVKGLPSFQFETIPDGLPPCDPDTTQDIFSLSESTTNSCSGPFKELLTKLNNTSLSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PVSCIVSDG M FTL AA++ GIP++ FWT  A G L ++ YR +++KG++PLKD SY  
Sbjct  121   PVSCIVSDGAMSFTLAAAQDLGIPQVFFWTPSACGLLSYMHYRDLVEKGYTPLKDESYLT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NGYL+T LDW+ GM GVRLRDLPSFIRTTNP++ ++K+++  TER+K ASAI++NTF+ L
Sbjct  181   NGYLETTLDWIPGMKGVRLRDLPSFIRTTNPEEYMIKFLIQETERSKMASAIVLNTFEPL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E+E L  LQ++LPPVYA GP     + V+D  +  LG +LWKED  C+EWL++  P SVV
Sbjct  241   EREVLKSLQALLPPVYAIGPLHLLMEHVDDKNLEKLGSNLWKEDPKCLEWLDSKKPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSIT MT +QL+EFAWGLAN++  FLWIIRPD+VSG +AVLP EF+EET+ERGMLA
Sbjct  301   YVNFGSITPMTPNQLIEFAWGLANSQVDFLWIIRPDIVSGNKAVLPPEFLEETKERGMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC Q+QV+SH AVGGFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+CCTQW IGM
Sbjct  361   SWCQQQQVLSHVAVGGFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFCCTQWEIGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EV+ LVREL+  EKG+EM++KA+E KKLA++AA  P GSSY N++++IN+ 
Sbjct  421   EIDNNVKRDEVKSLVRELLTWEKGNEMKKKALEWKKLAKEAAKKPGGSSYVNIDKLINEI  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 384/476 (81%), Gaps = 4/476 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVCIP+PAQGHINPMLK+AK+L+ +GF ITFVN+EFNH RLL+++GP 
Sbjct  1     MGSME----KPHAVCIPYPAQGHINPMLKVAKLLHFRGFRITFVNTEFNHTRLLKAQGPN  56

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             S+ GLP+F+FETIPDGLPPS+VDATQDI +LC S  +NCL PF+ L+A+LN  GPPV+CI
Sbjct  57    SLNGLPTFQFETIPDGLPPSNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRGPPVTCI  116

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
              SD  M FTLDAA+E GIP++L WT  A GF+ +V YR +IDKGF+PLKD SY  NGYLD
Sbjct  117   FSDAVMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLD  176

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             TV+DW+ GM G+RL+DLPSFIRTT+PDD ++ + +   ERA+ ASAI+ NTFDALEQE L
Sbjct  177   TVVDWIPGMKGIRLKDLPSFIRTTDPDDIMLDFAMGELERARKASAIIFNTFDALEQEVL  236

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             + +  M PP+Y  GP Q    Q+ DS ++ +G +LWKE+  C++WL++ +P SVVYVN+G
Sbjct  237   DAIAPMYPPIYTIGPLQLLPDQIHDSELKLIGSNLWKEEPECLKWLDSKEPNSVVYVNYG  296

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITVMT  QL+EFAWGLAN+ + FLWI+RPDLVSGE A+LP EFV ET +RG+LA WCPQ
Sbjct  297   SITVMTPQQLIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCPQ  356

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQV++H A+GGFLTH+GWNST+E +C+GVPMICWPFFA+QQTNC YCCT+WG+GMEID+D
Sbjct  357   EQVLTHQAIGGFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSD  416

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR EV +LVRELM GEKG  M++K ME K  AE A T P GSSY N+E++  + L
Sbjct  417   VKRDEVAKLVRELMVGEKGKVMKKKTMEWKHRAEVATTGPDGSSYLNLEKIFEQVL  472



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/480 (68%), Positives = 395/480 (82%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS E  KPHAVCIP+PAQGHINPML+LAKIL+ KGFHITFVN+EFNHRRLL+SRGP 
Sbjct  1     MGSISAESQKPHAVCIPYPAQGHINPMLELAKILHQKGFHITFVNTEFNHRRLLKSRGPH  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             ++ GL SFRFETIPDGLPPSD DATQDI +LCES T+ CLGPF+DL+A+LN +     PP
Sbjct  61    ALDGLSSFRFETIPDGLPPSDADATQDIPSLCESTTKTCLGPFRDLLAKLNNTYTSNVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  V +KG+ PLKD+SY  N
Sbjct  121   VSCIVSDGVMTFTLAAAQELGVPEVLFWTTSACGFLGYMHYSTVTEKGYVPLKDASYLSN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LD + GM GVRLRDLPSF+RTTNPD+ ++K+++  TERA+ ASAI++NTF+ LE
Sbjct  181   GYLETTLDCIPGMKGVRLRDLPSFLRTTNPDEYMIKFVLQETERARKASAIILNTFETLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L+++L PVY+ GP     + V+D  ++ LG SLWKE+  C++WL+T +P SVVY
Sbjct  241   NEVLESLRTLLQPVYSIGPLNLLVKDVDDENLKGLGSSLWKEEPECIQWLDTKEPKSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT DQL+EFAWGLAN+++ FLWIIRPD+VSG E++LP +FVEET+ RGMLA 
Sbjct  301   VNFGSITVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPDFVEETKNRGMLAG  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V++HPA+GGFLTH+GWNSTLESICSGVPMICWPFFA+QQTNCWY  T+W IGME
Sbjct  361   WCSQEEVLNHPAIGGFLTHNGWNSTLESICSGVPMICWPFFAEQQTNCWYTVTKWDIGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LVRELM GEKG EM++KAM+ K LAE +A    GSSY N+E+V+N  L
Sbjct  421   IDNNVKRDEVECLVRELMVGEKGKEMKKKAMKWKTLAEISAQKSEGSSYVNIEKVVNDIL  480



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/477 (65%), Positives = 382/477 (80%), Gaps = 5/477 (1%)
 Frame = +2

Query  74    KMGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             KMGS      KPHAVCIP+PAQGHINPMLKLAK+L+ +GF ITFVN+EFNH RLL ++GP
Sbjct  20    KMGS-----EKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGP  74

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSC  433
               + GLP+F+FETIPDGLPPSDVDATQDI +LC S  +NCL PF+ L+A+LN  GPPV+C
Sbjct  75    NCLSGLPTFQFETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDGPPVTC  134

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             I SD  M FTLDAA+E GIP++L WT  A GF+ +V YR +IDKGF+PLKD SY  NGYL
Sbjct  135   IFSDAIMSFTLDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYL  194

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             DTV+DW+ GM G+RL+DLPSFIRTT+PDD ++ + +   ERA+ ASAI+ NTFDALE E 
Sbjct  195   DTVVDWIPGMKGIRLKDLPSFIRTTDPDDVMLDFAMGELERARKASAIIFNTFDALEHEV  254

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L+ +  M PP+Y   P Q    Q+ DS ++ +G +LWKED  C++WL++  P +VVYVNF
Sbjct  255   LDAIAPMYPPIYTIAPLQLLLDQIHDSELQLIGSNLWKEDEECLQWLDSKGPNTVVYVNF  314

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITVM  + L+EFAWGL+N+K+ FLWIIRPDLVSG  A+LP EF+ ET++RG+LASWC 
Sbjct  315   GSITVMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWCS  374

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV+ HPAVGGFLTH+GWNS LES+C GV MICWPFFA+QQTNC YCCT+WGIGMEID 
Sbjct  375   QEQVLGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEIDG  434

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             DVKR +VERLVRELM GEKG EM++K ME KK+A +A TAP+GSS+ N++ +I + L
Sbjct  435   DVKRDDVERLVRELMEGEKGEEMKKKTMEWKKIAHEATTAPSGSSFFNLDRMIKQLL  491



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/481 (67%), Positives = 397/481 (83%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP 
Sbjct  1     MGSISTEINKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPH  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----P  421
             S+ GL SFRFETIPDGLP  D DATQDI +LC+S T+ CL PF+DL+A+LN +      P
Sbjct  61    SLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTSNTSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PV+CIVSDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  VI+KG++PLKD SYF 
Sbjct  121   PVTCIVSDGVMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYSTVIEKGYAPLKDESYFT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NG+++  LD++ GM  VRLRDLPSF+RTTNP++ ++K+++  TERAK+ASAI++NTF+ L
Sbjct  181   NGHVEKPLDFIPGMKDVRLRDLPSFLRTTNPEEYMIKFVLQETERAKNASAIILNTFETL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E E L  LQ++LPPVY  GP     + V+D  ++ LG SLWKE+  C++WL++ +P SVV
Sbjct  241   ESEVLESLQTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEEPECLQWLDSKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVN+GSITVMT DQL+EFAWGLAN++  FLWIIRPD+VSG E++LP EFVEET+ RGMLA
Sbjct  301   YVNYGSITVMTPDQLIEFAWGLANSQHEFLWIIRPDIVSGYESILPPEFVEETKNRGMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC QE+V++HPA+GGFLTHSGWNSTLESI SGVPM+CWPFFA+QQTNCW+  T+WGIGM
Sbjct  361   SWCSQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGIGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE LVRELM GEKG EM++KAME KKLAE +A   TGSSY N+++VIN  
Sbjct  421   EIDNNVKRDEVESLVRELMVGEKGKEMKKKAMEWKKLAEISAQKSTGSSYGNIDKVINDV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_002285767.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 395/476 (83%), Gaps = 1/476 (0%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++    KPHAVCIP+PAQGHINPMLKLAK L+ +GFHITFVN+E+NH RLL+SRGP+
Sbjct  1     MGSLAS-AEKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             S+KG+PSF+F+TIPDGLPPS+VDATQD   LC S T++CL PF+DL++ LN  GPPV+CI
Sbjct  60    SLKGIPSFQFKTIPDGLPPSNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDGPPVTCI  119

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSDG M FTLDAA+E G+PE+LFWT  A GF+G+V YR +IDKG +PLKD SY  NGYLD
Sbjct  120   VSDGAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLD  179

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             TV+DW+ GM G+RLRD+PSFIRTT+P+D ++++ +   ERA+ ASA++ NTFDALE E L
Sbjct  180   TVIDWIPGMKGIRLRDIPSFIRTTDPNDIMLEFPLREAERARKASALIFNTFDALEHEVL  239

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             + L  M PP+Y  GP      Q++D+ ++ +  +LWKE+  C+EWL++ +P SVVYVNFG
Sbjct  240   DALSQMFPPIYTIGPLHKLMSQIQDNDLKLMESNLWKEEPECLEWLDSKEPNSVVYVNFG  299

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             S+TVMT+ QL EFAWGL N+ + FLWIIRPDLVSG+ A+LP EFV ET+ERG+LA WCPQ
Sbjct  300   SVTVMTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAGWCPQ  359

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQV+SHPAVGGFLTH+GWNST+ES+ +GVPMICWPFFA+QQTNC YCCT+WGIGMEID+D
Sbjct  360   EQVLSHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSD  419

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR E+ERLV+ELM GEKG E+++KA+E K LAE+A   P GSS++N++++I + L
Sbjct  420   VKRDEIERLVKELMEGEKGKELKKKALEWKALAEEATRGPNGSSFSNLDKMITQAL  475



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/480 (68%), Positives = 398/480 (83%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP+
Sbjct  1     MGSIGAEFSKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+KGL SFRFETIPDGLPP D DATQDI +LCES T  CLGPF+DL+A+LN +     PP
Sbjct  61    SLKGLSSFRFETIPDGLPPCDADATQDIPSLCESTTNTCLGPFRDLLAKLNNTNTSNVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTL AA+E G+PEILFWT  A GFLG++ Y  VI+KG++PLKD++   N
Sbjct  121   VSCIVSDGVMSFTLAAAQELGVPEILFWTTSACGFLGYMHYYKVIEKGYAPLKDAADLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T LD++ GM  VRLRDLPSF+RTTNPD+ ++K+++  TERA+ ASAI++NTF+ LE
Sbjct  181   GYLETTLDFIPGMKDVRLRDLPSFLRTTNPDEFMIKFVLQETERARKASAIILNTFETLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L+++LPPVY  GP  F  +  +D  ++ L  SLWKE+  C++WL+T +P SVVY
Sbjct  241   AEVLESLRNLLPPVYPIGPLHFLVKHADDENLKGLRSSLWKEEPECIQWLDTKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT +QLVEFAWGLAN+++ FLWIIRPD+V G+ ++LP EFVEET+ RGMLAS
Sbjct  301   VNFGSITVMTPNQLVEFAWGLANSQQTFLWIIRPDIVLGDASILPPEFVEETKNRGMLAS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V+SHPA+GGFLTHSGWNSTLESI SG+PMICWPFFA+QQTNCW+  T+W +GME
Sbjct  361   WCSQEEVLSHPAIGGFLTHSGWNSTLESISSGLPMICWPFFAEQQTNCWFSVTKWDVGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID+DVKR EVE LVRELM GEKG +M++KAMELK+LAE +A   +GSSY N+E+V+N  L
Sbjct  421   IDSDVKRDEVESLVRELMVGEKGKKMKKKAMELKELAEASAIEHSGSSYENIEKVVNDIL  480



>sp|F8WLS6.1|UGT6_CATRO RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Iridoid 1-O-glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 6; Short=CrUGT6; AltName: Full=UDP-glycosyltransferase 
85A23 [Catharanthus roseus]
 dbj|BAK55749.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/478 (66%), Positives = 396/478 (83%), Gaps = 6/478 (1%)
 Frame = +2

Query  77    MGSISGEGL--KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRG  250
             MGS+S      KPHAVCIP+PAQGHINPMLKLAK+L++KGFHITFVN+EFNH+RLL+SRG
Sbjct  1     MGSLSSSDYSKKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRG  60

Query  251   PESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----  418
              +S+KGL SF+F+TIPDGLPPSDVDATQDI +LCES T +CL PFK L+ +LN +     
Sbjct  61    SDSLKGLHSFQFKTIPDGLPPSDVDATQDIPSLCESTTTHCLVPFKQLLQKLNDTSSSEV  120

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSD  M FT+ AA+E  IPE+LFWT  A G LG++ Y  +IDKG +PLKD+SYF
Sbjct  121   PPVSCVVSDAVMSFTISAAQELDIPEVLFWTPSACGVLGYMHYAQLIDKGLTPLKDASYF  180

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              NG+LD VLDW+ GM G+RLRDLP+F+RTTNPD+ ++K+I+  TER+K ASAI++NTF  
Sbjct  181   SNGFLDQVLDWIPGMEGIRLRDLPTFLRTTNPDEYMIKFILQETERSKKASAIVLNTFQE  240

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE E ++ L ++LPP+Y  GP Q  + QV+D  ++ LG +LWKE+  C+EWL+T DP SV
Sbjct  241   LESEVIDSLSTLLPPIYPIGPLQILQNQVDDESLKVLGSNLWKEEPECLEWLDTKDPNSV  300

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVMT DQL+EFAWGLAN+K+ FLWIIRPDL+SGE ++L  EFVEET+ERG++
Sbjct  301   VYVNFGSITVMTNDQLIEFAWGLANSKQNFLWIIRPDLISGESSILGEEFVEETKERGLI  360

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWC QEQVI+HPA+GGFLTH+GWNST+ESI SGVPMICWPFFA+QQTNC +CC +WGIG
Sbjct  361   ASWCHQEQVINHPAIGGFLTHNGWNSTIESISSGVPMICWPFFAEQQTNCRFCCNKWGIG  420

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             MEI++DVKR EVE LV+ELM GEKG EM++KA+E K +AE   T P GSSY+N+E++I
Sbjct  421   MEINSDVKRDEVESLVKELMVGEKGKEMKKKALEWKNIAEVTTTKPDGSSYSNLEKLI  478



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/481 (68%), Positives = 396/481 (82%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEG-LKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGSI   G  KPHAVCIP+P QGHINPMLKLAKIL+HKGFHITFVN+E+NHRRLL+SRGP
Sbjct  1     MGSIKTHGQAKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN----QSGP  421
             +S+ G PSFRFETIPDGLPP D DATQDI +LCES T  CL PFK+L+A+LN     + P
Sbjct  61    DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLRPFKELLAKLNTISSSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
              VSCIVSDG M FTLDAA++ GIPE+LFWT  A G LG++ YR + DKG+ PLKD+S   
Sbjct  121   RVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGLLGYMHYRDLSDKGYFPLKDASNLT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NGYL+T LDW+ GM G+RLRDLPSF+R+TNPD+ + K++V  TER+K ASAI++NTF+ L
Sbjct  181   NGYLETALDWIPGMKGIRLRDLPSFLRSTNPDEYMFKFLVEETERSKFASAIVINTFEPL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E+E L  L+++LPP+YA GP  F  + +ED  +  LG +LWKED  C+EWL++  P SVV
Sbjct  241   EKEVLESLRTLLPPIYAIGPLHFLVKHIEDKNLECLGSNLWKEDLQCLEWLDSKKPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT +QL+EFAWGLAN++  FLWIIRPD+V+GE+A+LP EFVE+T+ERGMLA
Sbjct  301   YVNFGSITVMTPNQLIEFAWGLANSQMEFLWIIRPDIVTGEQAILPSEFVEQTKERGMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+SH A+GGFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+  TQWGIGM
Sbjct  361   SWCPQEQVLSHSAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EV+ LVRELM GEKG EM++K+ME KKLAE+A   P GSS+  ++++IN+ 
Sbjct  421   EIDNNVKRDEVKSLVRELMAGEKGKEMKKKSMEWKKLAEEATQKPEGSSFVAIDKLINEI  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/476 (64%), Positives = 384/476 (81%), Gaps = 3/476 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVCIPFPAQGHI PML LAK+L+ +GFHITFVN+EFNHRRLL++RGP 
Sbjct  1     MGSVEK---KPHAVCIPFPAQGHIKPMLNLAKLLHFRGFHITFVNTEFNHRRLLKARGPN  57

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             S+ GLPSF+FETIPDGL PSDV+ATQDI +LC S   N L PF+ L+++LN +GPPV+CI
Sbjct  58    SLDGLPSFQFETIPDGLQPSDVNATQDIPSLCVSTKNNLLPPFRCLLSKLNHNGPPVTCI  117

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSD  +  TLDAA+E GIP +LFWT  A GF+G+  YR +++KGF PLKD+SY  NGYLD
Sbjct  118   VSDSSLTSTLDAAQELGIPGLLFWTASACGFMGYAHYRTLVNKGFIPLKDASYLTNGYLD  177

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             TV+DW+ GM G+RL+D+PSF+RTT+PDD ++ + +   ERA+ ASAI+ NTFDALE E L
Sbjct  178   TVIDWIPGMKGIRLKDMPSFVRTTDPDDVMLGFAMGEIERARKASAIIFNTFDALEHEVL  237

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             + + +M PP+Y  GP      Q++D  ++++G +LWKED  C++WL++  P +VVYVNFG
Sbjct  238   DAISTMYPPIYTIGPISLLMNQIQDKDLKSIGSNLWKEDEECLQWLDSKGPNTVVYVNFG  297

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITVM  + L+EFAWGL+N+K+ FLWIIRPDLVSG  A+LP EF+ ET++RG+LASWC Q
Sbjct  298   SITVMKPEHLIEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWCSQ  357

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQV+ HPAVGGFLTH+GWNS LES+C GV MICWPFFA+QQTNC YCCT+WGIGMEID D
Sbjct  358   EQVLGHPAVGGFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEIDGD  417

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR +VERLVRELM GEKG EM++K ME KK+A +A TAP+GSS+ N++ +I + L
Sbjct  418   VKRDDVERLVRELMEGEKGEEMKKKTMEWKKIAHEATTAPSGSSFFNLDRMIKQLL  473



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/482 (65%), Positives = 383/482 (79%), Gaps = 6/482 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M S   E  KPHAVC+P+PAQGHINPMLKLAKILNHKGFHITFVN+E+NHRRLL+SRGP 
Sbjct  1     MASTGAELDKPHAVCVPYPAQGHINPMLKLAKILNHKGFHITFVNTEYNHRRLLKSRGPH  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
               K LPSFRFE IPDGLPP D DATQDI  LC+S    CLGPF++L+A+LN +     PP
Sbjct  61    GFKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNTCSSKVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG   +TL AA+E GIP++ FWT  A G L ++ Y  ++DKG+ PLKD SY  N
Sbjct  121   VSCIVSDGSNSYTLTAAQELGIPQVHFWTFAACGTLSYMHYCNLVDKGYIPLKDESYLTN  180

Query  605   GYLD-TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKS-ASAIMVNTFDA  778
             GYL+ T LDW+ GM  VRLRDLPSF++T NPDD ++ +I+  TER+K  ASAI+VN+F+A
Sbjct  181   GYLEKTTLDWIPGMKDVRLRDLPSFLKTANPDDFMLNFIICKTERSKKYASAIVVNSFEA  240

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE+E L  LQ+++PPVY  GP     + V+D  +  LG +LWKE+  C+EWL++  P SV
Sbjct  241   LEKEVLESLQTLVPPVYVIGPLNLLVKHVDDKDLADLGSNLWKEEPKCLEWLDSKKPNSV  300

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVMT + L+EFAWGLAN++  FLWIIRPD+V GEEA+LP EF+EET+ERGML
Sbjct  301   VYVNFGSITVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEEAILPPEFLEETKERGML  360

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWC QE+V++HPA+GGFLTHSGWNSTLESI +GVPMICWPFFA+Q TNCW+CCT+ GIG
Sbjct  361   ASWCQQEKVLNHPAIGGFLTHSGWNSTLESISNGVPMICWPFFAEQPTNCWFCCTKLGIG  420

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEI+ +VKR EVE LVRELM GEKG EM+ KA E KKLAE+AA  P GSSY N++++IN+
Sbjct  421   MEINNNVKRDEVEALVRELMTGEKGKEMKNKATEWKKLAEEAAAKPAGSSYVNIDKLINE  480

Query  1499  FL  1504
              L
Sbjct  481   IL  482



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/481 (67%), Positives = 394/481 (82%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS + E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP 
Sbjct  1     MGSNNVELNKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPH  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----P  421
             S+ GL SFRFETIPDGLP  D DATQDI +LC+S T+ CL PF+DL+A+LN++      P
Sbjct  61    SLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNETSNTSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PV+CIVSDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  +I+KGF+PLKD SY  
Sbjct  121   PVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGFTPLKDPSYLT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NGYL+T LD + GM  VRLRDLPSF+RTTNPDD +VK+++  TERA+ ASAI++NTF+ L
Sbjct  181   NGYLETTLDCIPGMKDVRLRDLPSFLRTTNPDDFMVKFVLQETERARKASAIVLNTFETL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E E L  L+++LPPVY  GP     + V+D  ++ L  SLWKE+  C++WL+  +P SVV
Sbjct  241   ESEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLESSLWKEEPECIQWLDNKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVN+GSITVMT DQL+EFAWGLAN+++ FLWIIRPD+VSG E++LP EFVEET+ RGMLA
Sbjct  301   YVNYGSITVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSGYESILPPEFVEETKNRGMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC QE+V++HPA+GGFLTHSGWNSTLESI SGVPM+CWPFFA+QQTNCW+  T+WG+GM
Sbjct  361   SWCSQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWFSETKWGVGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE LVRELM GEKG EM++KAME K+LAE +A   TGSSY N+E+VIN  
Sbjct  421   EIDNNVKRDEVESLVRELMVGEKGKEMKKKAMEWKELAEISAKKSTGSSYVNIEKVINDV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/482 (65%), Positives = 387/482 (80%), Gaps = 11/482 (2%)
 Frame = +2

Query  89    SGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKG  268
             S   +KPHAVCIPFPAQGHINPMLKLAK+L++ GFHITFVN+E+NH RLL+SRGP+S+ G
Sbjct  3     SAGKVKPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTG  62

Query  269   LPSFRFETIPDGLPP---SDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPV  427
             LPSFRFETIPDGLPP    D DATQDI +LCES T  CL PF+DL+A+LN +     PPV
Sbjct  63    LPSFRFETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSEVPPV  122

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FT DAAEE GIPEILFWT  A GF  +  Y  V  KG++PL D+S F NG
Sbjct  123   SCIVSDGVMSFTADAAEELGIPEILFWTTSACGFYAYTQYEYVFQKGYAPLADTSCFTNG  182

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+TV++ +  M G+R++D+PSF+RTTN DD ++++I   T+RAK  SAI++NTF+ LE+
Sbjct  183   YLETVIEGIPSMEGIRMKDMPSFVRTTNEDDFMIQFIFAETKRAKRVSAIVLNTFEELER  242

Query  788   EALNGLQSMLPPVYAAGPFQFFEQ-QVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
             + ++ L S LPP+Y  GP    E+  ++D G++ LG +LWKED  C+EWL+T +P SVVY
Sbjct  243   DTIDALSSFLPPIYPIGPLNLIEKYHIKDEGLKELGSNLWKEDQECLEWLDTKEPNSVVY  302

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT DQL EFAWGLAN+K+PFLWIIRP+LVSGE+AVLP  F++ T+ERGMLA+
Sbjct  303   VNFGSITVMTPDQLNEFAWGLANSKQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLAN  362

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SH +VGGFLTHSGWNSTLESICSGVPMICWPFFA+QQTNCWYCCT+WG+GME
Sbjct  363   WCPQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGME  422

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID+DVKR  VE LV +LM GE+G +MR KA+E K LA D+A    GSSY N++ +I++ L
Sbjct  423   IDSDVKRNGVETLVTKLMVGEEGRQMRNKAVEWKNLARDSA---EGSSYRNLKNLIDQVL  479

Query  1505  SP  1510
              P
Sbjct  480   LP  481



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/477 (64%), Positives = 386/477 (81%), Gaps = 3/477 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++    KPHAVC+P+PAQGH+NPMLK+AK+L+ KGFHITFVN+E+NH+RLL+SRGP 
Sbjct  1     MGSLTARN-KPHAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-PPVSC  433
             ++ G+P FRFETIPDGLPP D+DATQDI  LC+S ++NCL PF+ L+A+LN SG PPV+C
Sbjct  60    ALDGVPDFRFETIPDGLPPPDIDATQDIPALCDSTSKNCLAPFRQLLAKLNSSGVPPVTC  119

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTL AAEE GIPE+LFWT  A GFLG++ Y  +I++GF+PLKD +Y  NGYL
Sbjct  120   IVSDGVMSFTLKAAEELGIPEVLFWTTSACGFLGYMHYPRLIERGFTPLKDETYLTNGYL  179

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             DTV+DW+ GM  +R+RDLPSF+RTT+ +D ++ ++ + +ERA  ASA++VNTFD  E + 
Sbjct  180   DTVIDWIPGMKNIRIRDLPSFVRTTDRNDIMLNFLAVESERAAKASAVIVNTFDEFEHDV  239

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             +  L SMLP +Y  GP Q    Q+  + + ++G +LWKE+  C++WLN+ +P SVVYVNF
Sbjct  240   VKALSSMLPRIYTIGPLQLLLNQIPQTPLESIGSNLWKEEPECLQWLNSKEPKSVVYVNF  299

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITVMTA QLVEFAWGLAN+K  FLWIIRPDLV G+ ++LP EF+EET ERG++ASWCP
Sbjct  300   GSITVMTAQQLVEFAWGLANSKHTFLWIIRPDLVRGDSSILPPEFLEETEERGLMASWCP  359

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV++HPA+ GFLTHSGWNST+ESI  GVPMI WPFFA+QQTNC + CT+WG+GMEID 
Sbjct  360   QEQVLNHPAIAGFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWGVGMEIDN  419

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +VKR EVERLVRELM GEKG  MR KAME KK AE AA+ P GSS+ N+E++I   L
Sbjct  420   NVKREEVERLVRELMEGEKGKGMRNKAMEWKKKAEQAAS-PNGSSFLNLEKLIKDVL  475



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/476 (65%), Positives = 394/476 (83%), Gaps = 1/476 (0%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++    KPHAVCIP+PAQGHINPMLKLAK L+ +GFHITFVN+E+NH RLL+SRGP+
Sbjct  1     MGSLAS-AEKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             S+KG+PSF+F+TIPDGL PS+VDATQDI  LC S  ++CL PF+DL++ LN  GPPV+CI
Sbjct  60    SLKGIPSFQFKTIPDGLLPSNVDATQDIPALCVSTRKHCLPPFRDLLSNLNHDGPPVTCI  119

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSDG M FTLDAA+E G+PE+LFWT  A GF+G+V YR +IDKG +PLKD SY  NGYLD
Sbjct  120   VSDGAMSFTLDAAQELGVPEVLFWTTSACGFMGYVQYRNLIDKGLAPLKDESYLTNGYLD  179

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             TV+DW+ GM G+RLRD+PSFIRTT+P++ ++++ +   ERA+ ASA++ NTFDALE E L
Sbjct  180   TVIDWIPGMKGIRLRDIPSFIRTTDPNEIMLEFPLREAERARKASALIFNTFDALEHEVL  239

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             + L  M PP+Y  GP      Q++D+ ++ +  +LWKE+  C+EWL++ +P SVVYVNFG
Sbjct  240   DALSQMFPPIYTIGPLHQLMSQIQDNDLKLMESNLWKEEPECLEWLDSKEPNSVVYVNFG  299

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITVMT+ QL EFAWGL N+ + FLWIIRPDLVSG+ A+LP EFV ET+ERG+LA WCPQ
Sbjct  300   SITVMTSQQLNEFAWGLVNSNQTFLWIIRPDLVSGDAAILPPEFVAETKERGLLAGWCPQ  359

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQV+SHPAVGGFLTH+GWNST+ES+ +GVPMICWPFFA+QQTNC YCCT+WGIGMEID+D
Sbjct  360   EQVLSHPAVGGFLTHNGWNSTIESVSAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSD  419

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR E+ERLV+ELM GEKG E+++KA+E K LAE+A   P GSS++N++++I + L
Sbjct  420   VKRDEIERLVKELMEGEKGKELKKKALEWKTLAEEATRGPKGSSFSNLDKMITQAL  475



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/481 (67%), Positives = 392/481 (81%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS + E  KPHAVCIP+PAQGHINPMLKLAKIL+HKGFHITFVN+EFNHRRLL+SRGP 
Sbjct  1     MGSNNVELNKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPH  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----P  421
             S+ GL SFRFETIPDGLP  D DATQDI +LC+S T+ CL PF+DL+A+LN +      P
Sbjct  61    SLDGLSSFRFETIPDGLPTCDADATQDIPSLCKSTTETCLAPFRDLLAKLNGTNNTSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PV+CIVSDG M FTL AA+E G+PE+LFWT  A GFLG++ Y  +I+KG+ PLKD SY  
Sbjct  121   PVTCIVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYMHYTTLIEKGYIPLKDVSYLT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NGYL+T LD + GM  VRLRDLP+F+RTTNPDD + K+++  TERA++ASAI++NTFD L
Sbjct  181   NGYLETTLDCIPGMKDVRLRDLPTFLRTTNPDDFMFKFVLQETERARNASAIILNTFDTL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E E L  L+++LPPVY  GP     + V+D  ++ LG SLWKE+  C++WL+T +P SVV
Sbjct  241   ESEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEEPECIQWLDTKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVN+GSITVMT DQL+EFAWGLAN+K  FLWIIRPD+VSG E++LP EFVEET+ RGMLA
Sbjct  301   YVNYGSITVMTPDQLIEFAWGLANSKLEFLWIIRPDIVSGYESILPPEFVEETKNRGMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC QE+V++HPA+GGFLTHSGWNSTLESI SGVPM+CWPFFA+QQTNCWY  T+W +GM
Sbjct  361   SWCSQEEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWYSETKWDVGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE LVRELM GEKG EM++KAME KKLAE +A   TGSSY N+++V+N  
Sbjct  421   EIDNNVKRDEVESLVRELMVGEKGKEMKKKAMEWKKLAEISAQKSTGSSYGNIDKVVNDV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/481 (68%), Positives = 395/481 (82%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGL-KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             M SI   G  KPHAVCIP+P QGHINPMLKLAKIL+HKGFHITFVN+E+NHRRLL+SRGP
Sbjct  1     MDSIRIHGQDKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----P  421
             +S+ G PSFRFETIPDGLPP D DATQDI +LCES T  CLGPFK+L+A+LN +     P
Sbjct  61    DSLNGFPSFRFETIPDGLPPCDADATQDIPSLCESTTTTCLGPFKELLAKLNTTSSSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
              VSCIVSDG M FTLDAA++ GIPE+LFWT  A G LG++ YR + +KG+ PLKD+S   
Sbjct  121   RVSCIVSDGCMSFTLDAAQDLGIPEVLFWTPSACGSLGYMHYRDLSEKGYFPLKDASDLT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NGYL+T LDW+  M G+RLRDLPSF+R+TNPD+ + K++V  T+R+K ASAI++NTF+ L
Sbjct  181   NGYLETALDWIPSMKGIRLRDLPSFLRSTNPDEYMFKFLVQETDRSKFASAIVINTFERL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E+E L  L+++LPP+YA GP  F  + +ED  +  LG +LWKED  C++WL++  P SVV
Sbjct  241   EKEVLESLRTLLPPIYAIGPLHFLVKHIEDKNLECLGSNLWKEDVQCLDWLDSKKPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT +QL+EFAWGLAN++  FLWIIRPD+VSGE+A+LP EFV ET+ERGMLA
Sbjct  301   YVNFGSITVMTPNQLIEFAWGLANSQMEFLWIIRPDIVSGEQAILPPEFVGETKERGMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+SHPA+GGFLTHSGWNSTLESI SGVPMICWPFFA+QQTNCW+  TQWGIGM
Sbjct  361   SWCPQEQVLSHPAIGGFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE LVRELM GEKG EM++KAME KKLAE+A   P GSS+  ++++IN+ 
Sbjct  421   EIDNNVKRDEVESLVRELMAGEKGKEMKKKAMEWKKLAEEATQKPEGSSFVAIDKLINEI  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 386/481 (80%), Gaps = 6/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    KPHAVCIP+PAQGHINPMLKLAK+L+HKGFHITFV++E+NH+RLLRSRG +
Sbjct  1     MGSISILE-KPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             SV GLPSF+F TIPDGLPP+D D TQDI +LC+S ++ CL PFK+L++ LN +     PP
Sbjct  60    SVIGLPSFQFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FT+DAA+E  IP +LFWT  A GF+G+V YR +I++G SPLKD SY  N
Sbjct  120   VSCIVSDGVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTV+DW+ GM  +RLRD+PSFIRTT+P D ++ +++  T R + A+A+++NTFD LE
Sbjct  180   GYLDTVIDWIPGMKNIRLRDIPSFIRTTDPKDGMIDFVLSETARLQKATAVILNTFDLLE  239

Query  785   QEALNGLQS-MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
              + L  L S +LPPVY+ G  Q     ++D  ++++  +LWKED  C++WL++ +P SVV
Sbjct  240   HDVLAALSSSLLPPVYSIGSLQLLLNNIKDENLKSIESNLWKEDADCLQWLDSKEPNSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT  QL+EFAWGLAN+ K FLW+IRPDLV+G+ AVLP EFV  T+ERG LA
Sbjct  300   YVNFGSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+SH ++GGFLTHSGWNSTLE IC+GVPMICWPFFA+QQTNC Y C +WGIGM
Sbjct  360   SWCPQEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI++DVKR EVE LVRELM G KG EM++KAME KK+AE+A T P GSS+ N+++ IN  
Sbjct  420   EINSDVKRDEVEILVRELMVGVKGQEMKKKAMEWKKMAEEAITCPNGSSFQNLDKFINHH  479

Query  1502  L  1504
             L
Sbjct  480   L  480



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 394/480 (82%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++    KPHAVCIP+PAQGHI PMLKLAK+L++KGFHITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGSVALTK-KPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLPSF+FETIPDGLPPSD +ATQDI +LC S ++NCL PF DL+++LN     PPV+
Sbjct  60    SLDGLPSFQFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFGDLLSKLNSLPHSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             C+VSDGGM F+LDAA+EFGIP +LF T  A G LG++ Y  +++KG  PLKD+SY  NGY
Sbjct  120   CLVSDGGMTFSLDAAQEFGIPCVLFETMSACGSLGYLQYLPLMEKGLIPLKDASYMTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM  +RLRDLP+F+RTT+P+D ++KY+V   ERA+ ASAI+ NTFDALE E
Sbjct  180   LDTVIDWIPGMRHIRLRDLPTFVRTTDPNDIMLKYLVSEFERAQKASAIIFNTFDALELE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              L+ L ++LPP+Y  GP Q    Q+  + + ++++  +LW+E+T C+EWL++ +P SVVY
Sbjct  240   VLDALSTLLPPIYCIGPLQLQVSQIPPDYNNLKSIESNLWREETECLEWLDSKEPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT++QL+EF WGLAN+ K FLW+IRPDLV GE AV+P EF+EET+ERG+ AS
Sbjct  300   VNFGSITVMTSEQLIEFVWGLANSNKAFLWVIRPDLVCGESAVVPPEFLEETKERGLFAS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPAVGGFLTHSGWNS+LES+C GVPMICWPFFA+QQTNC +CC +WG+G+E
Sbjct  360   WCPQEQVLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCREWGVGIE  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I+ DVKR  +E LVR LM GEKG EMR+KAME KKLAE+AAT P G S+  ++ +IN+ L
Sbjct  420   IEGDVKRNYIEDLVRTLMEGEKGKEMRKKAMEWKKLAEEAATGPNGLSFLALDNMINRVL  479



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/481 (66%), Positives = 393/481 (82%), Gaps = 6/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+ G   KPHAVCIP+PAQGHINPMLKLAKIL+H+GFHITFVN+EFNH+RLL++RGP+
Sbjct  1     MGSL-GFADKPHAVCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             ++ GLPSFRFETIPDGLPP+DVDATQDI +LCES  + CL  FK L+ +LN S     PP
Sbjct  60    ALNGLPSFRFETIPDGLPPTDVDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSANVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTLDAAEE G+PE+LFWT  A GFLG+V YR +++KG++PLKD SY  N
Sbjct  120   VSCIVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYVHYRQLMEKGYTPLKDESYLTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTV+DW+  M G+RLRDLP+FIRTT+P+  ++ ++ + TERA  ASAI++NTFD LE
Sbjct  180   GYLDTVIDWIPAMEGIRLRDLPTFIRTTDPNFIMLDFVFVETERALKASAIILNTFDDLE  239

Query  785   QEALNGLQSMLPPVYAAGPFQF-FEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
              E L  L  MLPP+Y+ GP        V D+ ++ LG +LWKE+  C++WL++ +P SVV
Sbjct  240   HEMLGALSPMLPPIYSVGPLHLALNHHVHDNDLKQLGSNLWKEEPECIQWLDSKEPNSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSI VMTADQL EFAWGLAN+ + FLW+IRPDLV GE AV+P EFV ET++RG++A
Sbjct  300   YVNFGSIAVMTADQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPAEFVAETKDRGLMA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             +WCPQEQV+SHP+VGGFLTHSGWNST+ESI  GVPMICWPFFA+QQTNC Y CT+WGIGM
Sbjct  360   TWCPQEQVLSHPSVGGFLTHSGWNSTIESISGGVPMICWPFFAEQQTNCRYSCTKWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI++DVKR EVE LVRELM GEKG EM++KA+E K+ AE+A  +  GSSY N++++IN+ 
Sbjct  420   EINSDVKRDEVEGLVRELMEGEKGKEMKKKALEWKRKAEEATGSSKGSSYKNLDQMINQV  479

Query  1502  L  1504
             L
Sbjct  480   L  480



>ref|XP_004299647.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 389/471 (83%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPMLKLAK+L+HKGFHITFVN+E+NH+RLL+SRGP S+ GLPSF 
Sbjct  7     KPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRLLKSRGPNSLDGLPSFT  66

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPP+D +ATQDI +LC S    CL  F+DL+++LN S   PPVSCIVSDG M 
Sbjct  67    FETIPDGLPPTDANATQDILSLCVSTRTKCLPHFRDLLSKLNSSSNIPPVSCIVSDGVMS  126

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FT++AA+E GIPE+LFWT  A GF+G++ Y+ +ID+G  PLKD+S   NGYL+T +DW+ 
Sbjct  127   FTVEAAQELGIPEVLFWTTSACGFMGYMQYQNLIDEGLIPLKDASCLTNGYLETEIDWLP  186

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM G+RLRDLP+FIRTT+P+D ++K +++ TERAK ASAI++NT D LE E L+ L+++L
Sbjct  187   GMRGIRLRDLPAFIRTTDPEDGMMKTMLIETERAKRASAIILNTIDDLEHEVLDALKNLL  246

Query  818   PPVYAAGPFQFFEQQVEDSG--VRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PP+Y+ GP      QV+  G  ++++  +LWK++  C+EWL++  P SVVYVNFGSITVM
Sbjct  247   PPIYSIGPLHLQLDQVQSEGTDLKSIQSNLWKDEPECLEWLDSRAPNSVVYVNFGSITVM  306

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T++QL+EFAWGLAN+ K FLW+IRPDLV GE AV+P EFVEET+ER +L +WCPQEQV++
Sbjct  307   TSEQLIEFAWGLANSSKTFLWVIRPDLVGGESAVVPPEFVEETKERSLLTTWCPQEQVLN  366

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTHSGWNSTLES+C+GVPM+CWPFFA+QQTNC YCC +WGIGMEI+ DV R  
Sbjct  367   HPAIGGFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEIEGDVHRSN  426

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +E LV +LM GE+G EMR+KAME KKLA++AAT P G S+ ++++++N+ L
Sbjct  427   IEELVTKLMEGEEGKEMRKKAMEWKKLAKEAATGPNGLSFLDLDKMVNEVL  477



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 375/471 (80%), Gaps = 6/471 (1%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSFRF
Sbjct  10    PHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSFRF  69

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDGG  451
              TIPDGLPPSD DATQD+  LC+S  ++CL  F+DL+ +LN+       PPVSC+VSDG 
Sbjct  70    RTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGSPPVSCVVSDGV  129

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLDAAE   +PE+LFWT    GF+G+V YR +ID+G +PLKD+SY  NGYLDT +DW
Sbjct  130   MSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYLTNGYLDTAVDW  189

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             + GM  +RLRDLPSFIRTT+PDDP+V + ++ TERAK ASAI+ NTFD LE E L+ L++
Sbjct  190   IPGMTNIRLRDLPSFIRTTDPDDPMVDFCLVETERAKRASAIVFNTFDQLEHEVLDALKA  249

Query  812   MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             MLPP+Y  GP     +Q+  +  R++G +LWKED  C+EWL+   P SVVYVNFGS+TVM
Sbjct  250   MLPPIYTLGPLHLLTEQLPSNDTRSIGSNLWKEDQGCLEWLDLKSPSSVVYVNFGSVTVM  309

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             +  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EF   TRER +LASWCPQ QV+ 
Sbjct  310   SPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWCPQVQVLR  369

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             H A+GGFLTHSGWNST+ESI +GVP++CWPFFA+QQ NC Y C +WGIGMEID DVKR E
Sbjct  370   HQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEIDGDVKRDE  429

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VER VRELM GE+G EM+RKAME K++A + AT P+GSS  N++EVI+K L
Sbjct  430   VERQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDKVL  479



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 393/480 (82%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++    KPHAVCIP+PAQGHI PMLKLAK+L++KGFHITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGSVALTK-KPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLPSF+FETIPDGLPPSD +ATQDI +LC S ++NCL PF+DL+++LN     PPV+
Sbjct  60    SLDGLPSFQFETIPDGLPPSDDNATQDIPSLCLSTSKNCLAPFRDLLSKLNSLPHSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             C+VSDGGM F+LDAA+EFGIP +LF T  A G LG++ Y  +++KG  PLKD+SY  NGY
Sbjct  120   CLVSDGGMTFSLDAAQEFGIPCVLFETTSACGSLGYLQYLPLMEKGLIPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM  +RLRDLP+F+RTT+P+D ++KY+V   ERA+ ASAI+ NTFDALE E
Sbjct  180   LDTVIDWIPGMRHIRLRDLPTFVRTTDPNDIMLKYLVSEYERAQKASAIIFNTFDALELE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              L+ L ++LPP+Y  GP Q    Q+  + + ++++  +LW+E+T C+EWL++ +P SVVY
Sbjct  240   VLDALSTLLPPIYCIGPLQLQVSQIPPDYNNLKSIESNLWREETECLEWLDSKEPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT++QL+EF WGLAN+ K FLW+IRPDLV GE AV+P EF+EET ERG+ +S
Sbjct  300   VNFGSITVMTSEQLIEFVWGLANSNKAFLWVIRPDLVLGESAVVPPEFLEETEERGLFSS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+SHPAVGGFLTHSGWNS+LES+C GVPMICWPFFA+QQTNC +CC +WG+G+E
Sbjct  360   WCPQEQVLSHPAVGGFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCKEWGVGIE  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I+ DVKR  +E LVR LM GEKG EMR+KA E KKLAE+AAT P G S+  ++ +IN+ L
Sbjct  420   IEGDVKRNYIEDLVRTLMEGEKGKEMRKKATEWKKLAEEAATGPNGLSFLALDNMINRVL  479



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 387/482 (80%), Gaps = 8/482 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  +  KPHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP 
Sbjct  1     MGSID-KIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLPSFRF TIPDGLPPSDV DATQDI  LC+S ++ CL  F+DL+ RLN+       
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTLGS  119

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSDG M FTLDAAE  G+PE+LFWT  A GF+G+V YR +IDKG +PLKD+SY 
Sbjct  120   PPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYL  179

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              NGYLDT++DW+ GM  ++LRDLPSFI+TT+PDD ++ +++  TERAK ASAI+ NTFD 
Sbjct  180   TNGYLDTIIDWIPGMRNIQLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE E L+ L++M P +   GP     +Q+ D   +++G +LWKED  C+EWL++  P SV
Sbjct  240   LEHEVLDALKAMFPSICTLGPLHLLTEQLPDDDTKSIGSNLWKEDLGCLEWLDSKPPGSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVM+  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EF   TRER +L
Sbjct  300   VYVNFGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLL  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V++HPAVGGFLTHSGWNST+ESI +GVP++CWPFFA+QQTNC Y C +WGIG
Sbjct  360   ASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEID DVKR +VER VRELM GE+G EM+RKAME +++A + AT P+GSSY N++EV++K
Sbjct  420   MEIDGDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMARE-ATRPSGSSYLNLDEVMDK  478

Query  1499  FL  1504
              L
Sbjct  479   VL  480



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/479 (63%), Positives = 391/479 (82%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP+PAQGHI PML+LAK+L++KGFHITFV++EFNHRRLL+SRGP 
Sbjct  1     MGSIDLTE-KPHAVCIPYPAQGHITPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLPSF+FETIPDGLPP+D +ATQDI  LC S ++NCL PF+DL++++N     PPV+
Sbjct  60    SLDGLPSFQFETIPDGLPPTDPNATQDITALCLSTSKNCLAPFRDLLSKVNSVPDSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDGGM FTLDAA+E GIPE++F T  A G + ++ YR +I+KG  P KD SY  NGY
Sbjct  120   CIVSDGGMTFTLDAAQELGIPEVIFETLSACGLMCYLQYRPLIEKGLMPPKDPSYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+ GM G+RLRD+PSFIRTT+P+D ++ Y+++   RAK ASAI++NTFDAL+ E
Sbjct  180   LDTEIDWIPGMRGIRLRDIPSFIRTTDPNDFMLDYLLVEIARAKRASAIILNTFDALDHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+GL ++LPPVY+ GP      Q+  D+ ++++G +LW E+  C+EWL++ +P SVVYV
Sbjct  240   VLHGLSTLLPPVYSVGPLHLQLNQIPADNKLKSIGSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EF+WGLAN+ + F W+IRPDLV GE AV+P EF++ET+ERG+LASW
Sbjct  300   NFGSITVMTAEQLIEFSWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+Q  NC +CC +WGIGMEI
Sbjct  360   CPQEQVLSHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G EMRRKA+E KKLA++A T P G S+  +E+++N+ L
Sbjct  420   EGDVKRNYVEELVRKLMEGEEGKEMRRKALEWKKLAKEATTGPNGLSFVGLEKLVNQVL  478



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/479 (63%), Positives = 391/479 (82%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI G   KPHAVCIP+PAQGHI PML+L K+L++KGFHITFVN+EFNHRRLL+SRGP 
Sbjct  1     MSSI-GLTKKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLPSFRFETIPDGLPP+D++ATQD+  LC S ++NCL PF+DL+++LN     PPV+
Sbjct  60    SLDGLPSFRFETIPDGLPPTDINATQDVTALCVSTSKNCLAPFRDLLSKLNSLPDSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDGGM FTLDAA+E GIPE++  T  A GF+ ++  R +I+KG  PL+D+SY  NGY
Sbjct  120   CIVSDGGMTFTLDAAQELGIPEVILQTLSACGFMCYLQCRPLIEKGLIPLRDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+ GM G+RLRD+PSFIR T+P+D ++ +I++   RAK ASAI++NTFDALE E
Sbjct  180   LDTEIDWIPGMRGIRLRDIPSFIRITDPNDFMLDFILVEIARAKRASAIILNTFDALEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+GL ++LPPVY+ GP       +  D+ ++++G +LW E+  C++WL++ +P SVVYV
Sbjct  240   VLDGLSTLLPPVYSVGPLHLQLNHIPADNELKSIGSNLWTEEPVCLDWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EFAWGLAN+ + F W++RPDLV GE AV+P EF+EET+ERG+LASW
Sbjct  300   NFGSITVMTAEQLIEFAWGLANSNQTFFWVVRPDLVGGEAAVVPPEFMEETKERGLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SH AVGGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIGMEI
Sbjct  360   CPQEQVLSHAAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCREWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G EMR+KA+E KKLA++A T P G S+  +++++N+ L
Sbjct  420   EGDVKRNYVEGLVRKLMAGEEGKEMRKKALEWKKLAKEATTGPNGFSFVGLDKLVNQML  478



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/469 (65%), Positives = 374/469 (80%), Gaps = 6/469 (1%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSFRF
Sbjct  10    PHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSFRF  69

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDGG  451
              TIPDGLPPSD DATQD+  LC+S  ++CL  F+DL+ +LN+       PPVSC+VSDG 
Sbjct  70    RTIPDGLPPSDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGSPPVSCVVSDGV  129

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLDAAE   +PE+LFWT    GF+G+V YR +ID+G +PLKD+SY  NGYLDT +DW
Sbjct  130   MSFTLDAAEAVSVPEVLFWTTSLCGFMGYVQYRSLIDRGLAPLKDASYLTNGYLDTAVDW  189

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             + GM  +RLRDLPSFIRTT+PDDP+V + ++ TERAK ASAI+ NTFD LE E L+ L++
Sbjct  190   IPGMTNIRLRDLPSFIRTTDPDDPMVDFCLVETERAKRASAIVFNTFDQLEHEVLDALKA  249

Query  812   MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             MLPP+Y  GP     +Q+  +  R++G +LWKED  C+EWL+   P SVVYVNFGS+TVM
Sbjct  250   MLPPIYTLGPLHLLTEQLPSNDTRSIGSNLWKEDQGCLEWLDLKSPSSVVYVNFGSVTVM  309

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             +  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EF   TRER +LASWCPQ QV+ 
Sbjct  310   SPTQLVEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWCPQVQVLR  369

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             H A+GGFLTHSGWNST+ESI +GVP++CWPFFA+QQ NC Y C +WGIGMEID DVKR E
Sbjct  370   HQAIGGFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEIDGDVKRDE  429

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             VER VRELM GE+G EM+RKAME K++A + AT P+GSS  N++EVI+K
Sbjct  430   VERQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  477



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/477 (63%), Positives = 386/477 (81%), Gaps = 2/477 (0%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVCIP+PAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL++RGP+
Sbjct  1     MGSLGTINNKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSC  433
             S+ GL SFRFETIPDGLP +D+DATQDI +LCE+  + C   FK+L+ ++N S  PPVSC
Sbjct  61    SLNGLSSFRFETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLTKINNSDAPPVSC  120

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTLDAAEE G+PE+LFWT  A GF+ +V Y  +I+KG +PLKDSSY  NGYL
Sbjct  121   IVSDGVMSFTLDAAEELGLPEVLFWTTSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYL  180

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T +DW+ G+  +RL+DLPSFIRTTNPD+ ++ +I     R + ASAI++NTFDALE + 
Sbjct  181   ETTIDWIPGIKEIRLKDLPSFIRTTNPDEFMLDFIQWECGRTRRASAIILNTFDALEHDV  240

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L    S+LPPVY+ GP     + V+D  + A+G +LWKE++ CVEWL+T +P SVVYVNF
Sbjct  241   LEAFSSILPPVYSIGPLNLLVKHVDDKDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNF  300

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSI VMT++QL+EFAWGLAN+ K FLW+IRPDLV+GE A+LP EFV++T +RG+L+SWC 
Sbjct  301   GSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCS  360

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV++HPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNCW+CC +WGIG+EI+ 
Sbjct  361   QEQVLTHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEIE-  419

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             DV+R ++E LVRELM GEKG EM+ KA++ K+LA+ AA  P GSS+ N++ ++   L
Sbjct  420   DVERDKIESLVRELMDGEKGKEMKEKALQWKELAKSAAFGPVGSSFANLDNMVRDVL  476



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/485 (65%), Positives = 389/485 (80%), Gaps = 12/485 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVCIPFPAQGHINPMLKLAK+L++ GFHITFVN+E+NH RLL+SRGP+
Sbjct  1     MGSVGNSVHKPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPP---SDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---  418
             S+ GLPSFRFETIPDGLPP    D DATQDI +LCES T  CL PF+DL+A+LN +    
Sbjct  61    SLTGLPSFRFETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSE  120

Query  419   -PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              P VSC+VSDG M FT DAAEE GIPE+LFWT  A GF  +  Y  VI+KG++ L D+S 
Sbjct  121   VPHVSCVVSDGVMSFTADAAEELGIPEVLFWTTSACGFYCYTQYGNVIEKGYASLADTSC  180

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDD-PIVKYIVLITERAKSASAIMVNTF  772
               NGYL+TV++ +  M G+R+RD+PSFIRTTN DD  +VK+++  T+RAK ASAI++NTF
Sbjct  181   LTNGYLETVIEGIPNMEGMRIRDIPSFIRTTNEDDIYMVKFVLQETKRAKRASAIVLNTF  240

Query  773   DALEQEALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDP  949
             + LE+E ++ L S+LPP+Y  GP    E+ V E+ G+  LG +LWKED  C++WL+T +P
Sbjct  241   EELERETIDALSSILPPIYPIGPLNLIEKNVIENKGLNLLGSNLWKEDQECLKWLDTKEP  300

Query  950   ISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRER  1129
              SVVYVNFGSITVMT DQL EFAWGLAN+ +PFLWIIRP+LVSGE+AVLP  F++ T+ER
Sbjct  301   NSVVYVNFGSITVMTPDQLNEFAWGLANSMQPFLWIIRPNLVSGEKAVLPDGFLDATKER  360

Query  1130  GMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQW  1309
             GMLA+WCPQE+V+SH +VGGFLTHSGWNSTLESICSGVPMICWPFFA+QQTNCWYCCT+W
Sbjct  361   GMLANWCPQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKW  420

Query  1310  GIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEV  1489
             G+GMEID+DVKR  VE LV +LM GE+G +MR KA+E K LA D+A    GSSY N++++
Sbjct  421   GVGMEIDSDVKRNGVETLVTKLMVGEEGRQMRNKAVEWKNLARDSA---EGSSYRNLKKL  477

Query  1490  INKFL  1504
             I++ L
Sbjct  478   IDQVL  482



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/479 (63%), Positives = 390/479 (81%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS +G   KPHAVCIP+PAQGHI PML+L K+L++KGFHITFVN+EFNHRRLL+SRGP 
Sbjct  1     MGS-TGLTEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLPSFRFETIPDGLPP+D +ATQD+  LC S  +NCL PF+DL+++LN     PPV+
Sbjct  60    SLDGLPSFRFETIPDGLPPTDTNATQDVTALCVSTRKNCLAPFRDLLSKLNSLPDSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDGGM FTLDAA+E GIPE++F T  A G + ++  R +I++G  PL+D+SY  NGY
Sbjct  120   CIVSDGGMIFTLDAAQELGIPEVIFQTPSACGLMCYLQCRPLIERGLIPLRDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+ GM G+RLRD+PSFIRTT+P D ++ ++++   RAK ASAI++NTFDALE E
Sbjct  180   LDTEIDWIPGMRGIRLRDIPSFIRTTDPHDFMLDFLLVAMARAKRASAIVLNTFDALEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L GL ++LPPVY+ GP      Q+  D+ ++++G +LW E+  C++WL++ +P SVVYV
Sbjct  240   VLEGLSTLLPPVYSVGPLHIQLNQIPADNELKSIGSNLWTEEPVCLDWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EFAWGLAN+ + F W+IRPDLV GE AV+P EF++ET ERG+LASW
Sbjct  300   NFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPAVGGFLTHSGWNSTLES+C GVPMICWPFFA+QQ NC +CC +WGIGMEI
Sbjct  360   CPQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  +E LVR+LM GE+G EMR+KA+E KKLA++A + P GSS+  +++++N+ L
Sbjct  420   EGDVKRNYIEGLVRKLMEGEEGKEMRKKALEWKKLAKEATSGPNGSSFVGLDKLVNQML  478



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 387/480 (81%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS +G   KPHAVC+P+PAQGHI PMLKLAK+L+ KGFH+TFVN+EFNH+RLL+SRGP+
Sbjct  1     MGS-AGMPEKPHAVCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ---SG-PP  424
             S+ GL SFRFETIPDGLP SD+DATQ I +LCES  +NCLGPF+ L+ +LN    SG PP
Sbjct  60    SLTGLSSFRFETIPDGLPESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNNTVSSGVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSC+VSDG M F+LDAAEE GIP++LFWT    GF+ +V YR +I+KG++PLKD SY  N
Sbjct  120   VSCVVSDGVMSFSLDAAEELGIPQVLFWTTSVCGFMAYVHYRNLIEKGYTPLKDVSYVTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTV+DW+ GM G+RL+DLPSF+RTT+P+D ++ +++  T+    +SAI+ NTFD LE
Sbjct  180   GYLDTVIDWIPGMEGIRLKDLPSFLRTTDPNDIMLDFVLSETKNTHRSSAIIFNTFDKLE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              + L  L SM PP+Y  GP      Q+++  ++ +G +LWKE+  C+EWLN+ +P SVVY
Sbjct  240   HQVLEPLASMFPPIYTIGPLNLLMNQIKEESLKMIGSNLWKEEPMCIEWLNSKEPKSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT +QLVEFAWGLAN+ + FLWIIRPDLV GE AVLP EFV  T+ERGMLAS
Sbjct  300   VNFGSITVMTPNQLVEFAWGLANSNQSFLWIIRPDLVVGESAVLPPEFVAVTKERGMLAS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             W PQE+V++H +VGGFLTH GWNSTLESI SGV ++CWPFFA+QQTNCWYCC + GIGME
Sbjct  360   WAPQEEVLAHSSVGGFLTHCGWNSTLESISSGVAVVCWPFFAEQQTNCWYCCGELGIGME  419

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID+DVKR EVERLVRELM GEKG EM+ +AM  K+LAE+A  + +GSS+ N+++++++ L
Sbjct  420   IDSDVKREEVERLVRELMVGEKGKEMKERAMGWKRLAEEATQSSSGSSFLNLDKLVHQVL  479



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 383/482 (79%), Gaps = 8/482 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP 
Sbjct  1     MGSIDMIQ-KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLPSFRF TIPDGLPPSDV DATQDI  LC+S ++ CL  F+DL+ RLN+       
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGS  119

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSDG M FTLDAAE  G+PE+LFWT  A GF+G+V YR ++DKG +PLKD+SY 
Sbjct  120   PPVSCVVSDGAMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLVDKGLTPLKDASYL  179

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              NGYLDT++DW+ GM  +RLRDLPSFI+TTNPDD ++ +++  TERAK ASAI+ NTFD 
Sbjct  180   TNGYLDTIIDWIPGMRNIRLRDLPSFIQTTNPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE E L+ L++  P +   GP     +Q+ D   +++G +LWKED  C+EWL++  P SV
Sbjct  240   LEHEVLDALKATFPSICTLGPLHLLTEQLPDDDTKSIGSNLWKEDLGCLEWLDSKPPGSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVM+  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EF   TRER +L
Sbjct  300   VYVNFGSITVMSPTQLVEFAWGLANSGQMFLWVIRPDLVVGDTAILPSEFSATTRERSLL  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V++HPAVGGFLTHSGWNST+ESI +GVPM+CWPFFA+QQTNC Y C +WGIG
Sbjct  360   ASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPMLCWPFFAEQQTNCRYSCEEWGIG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEID DVKR +VE+ VRELM GE G EM+RKAME +++A + AT P+GSS  N++EV++K
Sbjct  420   MEIDGDVKRDKVEKQVRELMEGETGKEMKRKAMEWQEMARE-ATRPSGSSCLNLDEVMDK  478

Query  1499  FL  1504
              L
Sbjct  479   VL  480



>gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/481 (63%), Positives = 383/481 (80%), Gaps = 6/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+S    KPHAVCI +PAQGHINPMLKLAK+L+HKGFHITFV++E+NH+RLLRSRG +
Sbjct  1     MGSVSILE-KPHAVCISYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             SV GLPSF+F TIPDGLPP+D D TQDI +LC+S ++ CL PFK+L++ LN +     PP
Sbjct  60    SVIGLPSFQFRTIPDGLPPTDSDVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FT+DAA+E  IP +LFWT  A GF+G+V YR +I++G SPLKD SY  N
Sbjct  120   VSCIVSDGVMSFTVDAAQELCIPLVLFWTTSACGFMGYVQYRQLIERGLSPLKDESYLTN  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTV DW+ GM  +RLRD+PSFIRTT+P D ++ +++  T R + A+A+++NTFD LE
Sbjct  180   GYLDTVKDWIPGMKNIRLRDIPSFIRTTDPKDGMIDFVLSETARLQKATAVILNTFDLLE  239

Query  785   QEALNGLQS-MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
              + L  L S +LPPVY+ G  Q     ++D  ++++  +LWKED  C++WL++ +P SVV
Sbjct  240   HDVLAALSSSLLPPVYSIGSLQLLLNNIKDENLKSIESNLWKEDADCLQWLDSKEPNSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT  QL+EFAWGLAN+ K FLW+IRPDLV+G+ AVLP EFV  T+ERG LA
Sbjct  300   YVNFGSITVMTNKQLIEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+SH ++GGFLTHSGWNSTLE IC+GVPMICWPFFA+QQTNC Y C +WGIGM
Sbjct  360   SWCPQEQVLSHSSIGGFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI++DVK  EVE LVRELM G KG EM++KAME KK+AE+A T P GSS+ N+++ IN  
Sbjct  420   EINSDVKGDEVEILVRELMEGVKGKEMKKKAMEWKKMAEEAITCPKGSSFQNLDKFINLL  479

Query  1502  L  1504
             L
Sbjct  480   L  480



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 384/482 (80%), Gaps = 8/482 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHA+CIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP 
Sbjct  1     MGSIDMIQ-KPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLPSFRF TIPDGLPPSDV DATQDI  LC+S ++ CL  F+DL+ RLN+       
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGS  119

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSDG M FTLDAAE  G+PE+LFWT  A GF+G+V YR +IDKG +PLKD+SY 
Sbjct  120   PPVSCVVSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYVQYRNLIDKGLTPLKDASYL  179

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              N YLDT++DW+ GM  +RLRDLPSFI+TT+PDD ++ +++  TERAK ASAI+ NTFD 
Sbjct  180   TNAYLDTIIDWIPGMRNIRLRDLPSFIQTTDPDDLMIHFVLRETERAKRASAIVFNTFDR  239

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE E L+ L++M P +   GP     +Q+ D   +++G +LWKED  C+EWL++  P SV
Sbjct  240   LEHEVLDALKAMFPSICTLGPLHLLTEQLPDDDTKSIGSNLWKEDLGCLEWLDSKPPGSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVM+  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EF   TRER +L
Sbjct  300   VYVNFGSITVMSPTQLVEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLL  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V++HPAVGGFLTHSGWNST+ESI +GVP++CWPFFA+QQTNC Y C +WGIG
Sbjct  360   ASWCPQERVLNHPAVGGFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEID DVKR +VER VRELM GE+G EM+RKAME +++A +A   P+GSSY N++EV++K
Sbjct  420   MEIDGDVKRDKVERQVRELMEGERGKEMKRKAMEWQQMAREAMR-PSGSSYLNLDEVMDK  478

Query  1499  FL  1504
              L
Sbjct  479   VL  480



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/482 (63%), Positives = 390/482 (81%), Gaps = 6/482 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    +PHAVCIP+PAQGHINPMLKLAK+L+  GFHITFVN++FNHRRLL+SRGP 
Sbjct  1     MGSISTSQQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPT  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVS  430
             ++ G+ SF+FE+IPDGLPP+DVDATQDI +LC+S  + CL PFK+L+++LN   + P VS
Sbjct  61    ALDGISSFQFESIPDGLPPTDVDATQDIPSLCQSTRRLCLQPFKELVSKLNCDPNVPQVS  120

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN-G  607
             CIVSDG M FT+DAAEE G+P +LFWT  A GFL ++ Y+ ++++G++P KD SY  N  
Sbjct  121   CIVSDGVMSFTVDAAEELGVPVVLFWTTSACGFLAYLHYQQLVERGYTPFKDESYLSNEQ  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YLDT +DW+ GM  VRLRD+P+FIRTT+P+D ++ +I+  T+RAK A+AI++NT  +LEQ
Sbjct  181   YLDTKIDWIPGMKDVRLRDIPTFIRTTDPEDGMIDFIISETKRAKRANAIVLNTVASLEQ  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQV---EDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             EALN + S+LPPV++ GP Q   QQV   +   ++ LG +LWKEDTSC++WL+   P SV
Sbjct  241   EALNAMSSLLPPVFSIGPLQLLLQQVASHDSDHLKFLGSNLWKEDTSCLQWLDQKSPNSV  300

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVMT DQL EFAWGLAN+ + FLWIIRPDLV+G+ AVLP EF++ T+ERGML
Sbjct  301   VYVNFGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDVTKERGML  360

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
              +WCPQE+V+ HPA+GGFLTH+GWNST ESI +GVPMICWPFFA+QQTNC YCCT+WGIG
Sbjct  361   TNWCPQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIG  420

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             ME+D+DVKR E+E+ V+ELM GEKG EMR +A E KKL  DAAT  +GSS  N+ ++++K
Sbjct  421   MEVDSDVKREEIEKQVKELMEGEKGKEMRNRAEEWKKLVGDAATPHSGSSSRNLNDLVHK  480

Query  1499  FL  1504
              L
Sbjct  481   VL  482



>ref|NP_001277170.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51845.1| UDP-glycosyltransferase 85A30 [Vitis vinifera]
Length=484

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/475 (65%), Positives = 381/475 (80%), Gaps = 4/475 (1%)
 Frame = +2

Query  92    GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGL  271
              E  +PHAVC+PFPAQGHINPM+KLAK+L+HKGFHITFVN+EFNH+RLL+SRGP S++GL
Sbjct  4     AEKPRPHAVCVPFPAQGHINPMMKLAKLLHHKGFHITFVNTEFNHQRLLKSRGPNSLRGL  63

Query  272   PSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIV  439
             PSF+FETI DGLPPSD+DATQD+ +LC S   +CL PF+DL+A+LN +     PPV+CIV
Sbjct  64    PSFQFETIADGLPPSDIDATQDVPSLCASTHNDCLAPFRDLLAKLNDTSSSKVPPVTCIV  123

Query  440   SDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             SDG M FTL AAEE GIPE+ FWT  A GF+G+V YR +ID+GF PLKD S   NG+LDT
Sbjct  124   SDGIMSFTLKAAEELGIPEVFFWTTSACGFMGYVQYRHLIDRGFFPLKDESCLTNGHLDT  183

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+  M GVRLRDLPSFIRTTNPDD +V + +   ERA  ASAI++NTFD LE E L 
Sbjct  184   VVDWIPAMKGVRLRDLPSFIRTTNPDDIVVNFAMGEVERANDASAILLNTFDELEHEVLQ  243

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L +M PP+Y  GP Q    Q+ D+ ++++  +LWKE+  C+EWL+  +P SVVYVNFGS
Sbjct  244   ALSTMFPPIYTIGPLQLLLNQMPDNDLKSIESNLWKEEPGCLEWLDAKEPESVVYVNFGS  303

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             +TVMT  QLVEFAWGLAN    FLWIIRPDLV+G+ A+LP +FV +T+ER +LASWCPQE
Sbjct  304   VTVMTPQQLVEFAWGLANANLKFLWIIRPDLVAGDAAILPADFVAQTKERSLLASWCPQE  363

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V++HPA+GGFLTHSGWNST+E +C GVPMICWPFFA+Q TNC YCCT+WG+GMEI  DV
Sbjct  364   RVLTHPAIGGFLTHSGWNSTIEGLCGGVPMICWPFFAEQMTNCRYCCTEWGVGMEIGNDV  423

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              R EVE LVR LM GEKG EM++KAME K++AE A T P GSSY+N++++IN+ L
Sbjct  424   TRDEVESLVRGLMEGEKGKEMKKKAMEWKRMAEAATTTPAGSSYSNLDKMINQVL  478



>emb|CDP01078.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/480 (67%), Positives = 389/480 (81%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    KPHAVCIPFPAQGHINPML+LAK+L+HKGFHITFVNSEFNH+RLL+SRGP+
Sbjct  1     MGSISLLEKKPHAVCIPFPAQGHINPMLELAKLLHHKGFHITFVNSEFNHKRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+ GLP F+F+TIPDGLPPSDVDATQDIA+LCES  ++ LGPF++L+ARLN +     PP
Sbjct  61    SLNGLPDFQFQTIPDGLPPSDVDATQDIASLCESTDKHGLGPFRELLARLNDTSSSNVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCI+SD  M FTL AAEE GIPEI  WT  A  +L    +  +IDKG +PLKD+SY  N
Sbjct  121   VSCIISDAAMSFTLAAAEELGIPEIYLWTASACSYLAIFHFSQLIDKGITPLKDASYLTN  180

Query  605   GYLDTVLDWV-KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             GYLDTVL+W+  GM G+RLRDLPSF+RTTNPDD I+K+I+ ITE A+ ASAI++NTF+ L
Sbjct  181   GYLDTVLEWIIPGMEGIRLRDLPSFLRTTNPDDFILKFILQITESAQRASAIILNTFEEL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             + + ++ L + LPP+Y  GP    E QV+D  +  LG +LWKE+  C+EWL++ +P SVV
Sbjct  241   DHDVISSLPAYLPPIYPIGPLHVLENQVDDKSLEVLGSNLWKEEPECLEWLDSKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT +QLVEFAWGLAN+K+ FLWIIRPDLV G+ A+LP EFVEET+ RG+ A
Sbjct  301   YVNFGSITVMTPEQLVEFAWGLANSKQTFLWIIRPDLVKGDLAILPDEFVEETKHRGLFA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC Q  V+SH +VGGFLTHSGWNST+ES+ SG+PMICWPFFADQQTNCW CCT+WGIGM
Sbjct  361   SWCNQGTVLSHSSVGGFLTHSGWNSTIESMSSGLPMICWPFFADQQTNCWICCTKWGIGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE LV ELM G+KG EM++KAME KKLAEDAA+  +GSS  N E +I++ 
Sbjct  421   EIDNNVKRDEVESLVIELMSGKKGKEMKKKAMEWKKLAEDAASCSSGSSSVNFENLISQL  480



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/479 (63%), Positives = 389/479 (81%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MG+I G   KPHAVCIP+PAQGH+ PML+LAK+L++KGFHITFV++EFNHRRLL+SRGP 
Sbjct  1     MGTI-GLTEKPHAVCIPYPAQGHVTPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLP FRFETIPDGLPP+D +ATQDI  LC S ++NCL PF+DL++++N     PPV+
Sbjct  60    SLDGLPFFRFETIPDGLPPTDANATQDITALCLSTSKNCLAPFRDLLSKVNSVPDSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
              IVSDGGM FTLDAA+E GIPE++  T  A G + ++ YR +I+KG  PLKD SY  NGY
Sbjct  120   SIVSDGGMTFTLDAAQELGIPEVILETLSACGLMCYLQYRPLIEKGLMPLKDPSYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+ GM G+RLRD+PSFIRTT+P+D ++ Y+++   RAK ASAI++NTFDAL+ E
Sbjct  180   LDTEIDWIPGMRGIRLRDIPSFIRTTDPNDFMLDYLLVEIARAKRASAIILNTFDALDHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+GL ++LPPVY+ GP      Q+  D  ++++G +LW E+  C+EWL++ +P SVVYV
Sbjct  240   VLHGLSTLLPPVYSVGPLHLQLNQIPADDKLKSIGSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EFAWGLAN+ + F W+IRPDLV GE AV+P EF++ET+ERG+LASW
Sbjct  300   NFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPAVGGFLTHSGWNSTLES+C GVPMICWPFFA+Q  NC +CC +WGIGMEI
Sbjct  360   CPQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G EMR+KA+E KKLA++A T P G S+  +++++N+ L
Sbjct  420   EGDVKRNYVEGLVRKLMEGEEGKEMRKKALEWKKLAKEATTGPNGLSFVCLDKLVNQVL  478



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 392/479 (82%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS +G   KPHAVCIPFPAQGHINPMLKLAK+L++KGFHITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGS-NGLIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GLPSFRFETIPDGLPP+D +ATQDI +LCES  ++ L  F+DL+++LN S   PPVS
Sbjct  60    SLDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA E GIPE+LFWT  A GFL +V Y  +I+KG +PLKD++Y  NGY
Sbjct  120   CIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDANYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T +DW+ GM G+RL+D+PSFIRTT+PDD ++ ++V  TER + ASA+++NTF  LE E
Sbjct  180   LETQIDWIPGMRGIRLKDIPSFIRTTDPDDLMLDFLVHETERTRKASAVVLNTFHDLEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             AL+ L ++LPP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYV
Sbjct  240   ALDALSTLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EFAWGLAN+ + F W+IRPDLV G+ AV+P EFVEET+ER +LA W
Sbjct  300   NFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPAVGGFLTHSGWNST+ES+C+GVPMICWPFFA+QQTNC Y   +WGIGMEI
Sbjct  360   CPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              +DVKR  VE LVR+LM GE+G +MR+KA+E KKLA++ AT+P GSS+  ++++IN+ L
Sbjct  420   KSDVKRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVL  477



>ref|XP_004299648.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/475 (64%), Positives = 386/475 (81%), Gaps = 5/475 (1%)
 Frame = +2

Query  95    EGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLP  274
             E  KPHAVCIP+PAQGHINPMLKLAK+L+HKGFH+TFVNSE+NHRRLL SRGP ++ GLP
Sbjct  9     ETNKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHVTFVNSEYNHRRLLNSRGPNALDGLP  68

Query  275   SFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDG  448
             SF+F+TIPDGLPP+D +ATQDI +LCES  + CL  F+ L+  +N  ++ PPVSC+VSDG
Sbjct  69    SFQFKTIPDGLPPTDTNATQDIPSLCESTRKYCLPHFRKLLEEVNSEENSPPVSCVVSDG  128

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTLDAAEE G+PE+LFWT  A GF+ +V Y+ +I+KG++PLKD+SY  NGYLDTV+D
Sbjct  129   VMSFTLDAAEELGVPEVLFWTTSACGFMAYVHYKHLIEKGYTPLKDASYLTNGYLDTVID  188

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERA-KSASAIMVNTFDALEQEALNGL  805
             W+ GM G+RL+D+P+FIRTT+ +  +V +++  TERA K ASAI++NTFD LE + L   
Sbjct  189   WIPGMKGIRLKDIPTFIRTTDTNALMVDFVLHETERAAKKASAIILNTFDDLEHDVLEAF  248

Query  806   QSMLPP-VYAAGPFQFFEQQVE-DSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              ++LPP VY+ GP      Q+   S ++ L  +LWKE++ C+EWL++ DP SVVYVNFGS
Sbjct  249   AALLPPAVYSIGPLSLQLNQIPPGSELQTLKSNLWKEESECLEWLDSKDPDSVVYVNFGS  308

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             ITVMT  QL+EFAWGLAN+KK FLW+IRPDLV G  AV+P EFVEETRER MLA+WCPQE
Sbjct  309   ITVMTETQLIEFAWGLANSKKTFLWVIRPDLVGGSSAVVPAEFVEETRERSMLATWCPQE  368

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V+ HPAVGGFLTHSGWNSTLESIC GVPMICWPFFA+QQTNC +CC +WGIGMEI+ D 
Sbjct  369   EVLRHPAVGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRFCCKEWGIGMEIEGDP  428

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR  VE LVR+LM GE+G EM++KA+E K+LA +AAT P GSS+ N+++++N+ L
Sbjct  429   KRDYVEGLVRKLMEGEEGKEMKKKALEWKRLAMEAATGPKGSSFVNLDKMVNQVL  483



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 392/483 (81%), Gaps = 7/483 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    +PHAVCIP+PAQGHINPMLKLAK+L+  GFHITFVN++FNHRRLL+SRGP+
Sbjct  1     MGSISISEQQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPK  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVS  430
             ++ GL SFRFE+IPDGLPP+DVDATQDI +LC+S  Q CL PFK+L+++LN   + P VS
Sbjct  61    ALDGLSSFRFESIPDGLPPTDVDATQDIPSLCQSTRQFCLQPFKELVSKLNCDPNVPQVS  120

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG-  607
             CIVSDG M FT+DAA+E G+P +LFWT  A GFLG++ Y+ ++++G++P KD SY  N  
Sbjct  121   CIVSDGVMSFTIDAADELGVPVVLFWTTSACGFLGYLHYQQLVERGYTPFKDESYLSNKQ  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YLDT +DW+ GM  VR+RD+P+FIRTT+P D +V +I+  T+RAK A+AI++NT D+LEQ
Sbjct  181   YLDTKIDWIPGMKDVRIRDIPTFIRTTDPKDVMVDFILGETKRAKRANAIVLNTVDSLEQ  240

Query  788   EALNGLQSMLPP-VYAAGPFQFFEQQV---EDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             EALN + S+LPP V++ GP Q   +QV   +   +++LG +LWKEDTSC++WL+     S
Sbjct  241   EALNAMPSLLPPPVFSIGPLQLLLKQVASHDSDSLKSLGSNLWKEDTSCLQWLDQMSANS  300

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVMT DQL EFAWGLAN+ + FLWIIRPDLV+G+ AVLP EF++ T+ERGM
Sbjct  301   VVYVNFGSITVMTKDQLKEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDMTKERGM  360

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             L +WCPQE+V+ HPA+GGFLTH+GWNST ESI +GVPMICWPFFA+QQTNC YCCT+WGI
Sbjct  361   LTNWCPQEEVLQHPAIGGFLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGI  420

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEID+DVKR E+E+ VRELM G+KG EMR++A E KKL  DAA   +GSS+ N+  +++
Sbjct  421   GMEIDSDVKREEIEKQVRELMEGDKGKEMRKRAQEWKKLMADAAEPHSGSSFRNLNHLVH  480

Query  1496  KFL  1504
             K L
Sbjct  481   KVL  483



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/473 (64%), Positives = 375/473 (79%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSF+
Sbjct  9     KPHVVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSLDGLPSFQ  68

Query  284   FETIPDGLPPSD-VDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSD  445
             F TIPDGLPPSD  DATQDI  LC+S ++ CL  F+DL+ RLN+       P VSC+VSD
Sbjct  69    FRTIPDGLPPSDATDATQDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPLVSCVVSD  128

Query  446   GGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVL  625
             GGM FTLDAAE  G+PE+L WT  A  F+G+V YR +IDKG +PLKD++YF NG LDT +
Sbjct  129   GGMTFTLDAAEAIGVPEVLIWTASACSFMGYVQYRSLIDKGLTPLKDANYFTNGCLDTTI  188

Query  626   DWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGL  805
             DW+ GM  +RLRDLP+FI+TT+PDD ++ + +   ERAK ASAI+ NTFD LE E L+ L
Sbjct  189   DWIPGMRNIRLRDLPTFIQTTDPDDLMIPFCLREVERAKRASAIVFNTFDRLEHEVLDAL  248

Query  806   QSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSIT  985
             ++M PP+Y  GP     +Q+ D+  R    +LWKE+  C+EWL++  P SVVYVNFGSIT
Sbjct  249   KAMFPPIYTLGPLHLLTKQLSDNNTRPFRSNLWKEEPGCIEWLDSKQPSSVVYVNFGSIT  308

Query  986   VMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQV  1165
             VM+  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP +F+  TRER +LASWCPQE+V
Sbjct  309   VMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERV  368

Query  1166  ISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKR  1345
             +SH AVGGFLTHSGWNST+ESI +GVP++CWPFF DQQTNCWY C +WGIGMEID+DVKR
Sbjct  369   LSHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVKR  428

Query  1346  CEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              EVER V+ELM GEKG  M+RKAME K++A + AT P+GSS+ N++EVINK L
Sbjct  429   NEVERQVKELMEGEKGKHMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVL  480



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 380/482 (79%), Gaps = 8/482 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP 
Sbjct  1     MGSIDMIQ-KPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLPSFRF TIPDGLPPSD  D TQDI  LC+S ++ CL  F+DL+ RLN+       
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGS  119

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSDG M FTLDAAE  G+PE+LFWT  A GF+G+V YR ++DKG +PLKD+SY 
Sbjct  120   PPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYL  179

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              NGYLDT +DW+ GM  +RLRDLPSF+RTT+ DD ++ + +  T+RAK ASAI+ NTFD 
Sbjct  180   TNGYLDTTIDWIPGMRNIRLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDR  239

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE E L+ L+++ PP+Y  GP     +Q+ D+  +++G +LWKED  C+EWL++  P SV
Sbjct  240   LEHEVLDALKAIFPPIYTLGPLHLLTKQLPDNDTKSIGSNLWKEDLGCLEWLDSKPPSSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVM+  QLVEFAWGLA++ + FLW+IRPDLV G+ A+LP EF   TRER +L
Sbjct  300   VYVNFGSITVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLL  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V+SH AVGGFLTHSGWNST+ESI +GVPM+CWPFF +QQTNC Y C +WGIG
Sbjct  360   ASWCPQERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEID++VKR EV R VRELM GE+G EM+RKAME K++A + AT P+GSS  N++EVI+K
Sbjct  420   MEIDSNVKRDEVSRQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  478

Query  1499  FL  1504
              L
Sbjct  479   VL  480



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/469 (65%), Positives = 381/469 (81%), Gaps = 4/469 (1%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PHA+C+P P QGHINPMLKLAK L+ +GFHITFVN+E+NHRRLL+SRGP+S+KGL SFRF
Sbjct  11    PHAICVPAPTQGHINPMLKLAKFLHFRGFHITFVNTEYNHRRLLKSRGPDSLKGLHSFRF  70

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDGGM  454
             ETIPDGLPPSD D+TQDIA+L +S+T   L PFK+L+A+LN +     PP SCI+SDG M
Sbjct  71    ETIPDGLPPSDADSTQDIASLSKSLTTTGLVPFKELLAKLNHTSSSNVPPASCIISDGVM  130

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTL AA++ GIP + FWT  A G LG++ Y  +I+K ++PLKD SY  NGYL+  LDW+
Sbjct  131   SFTLAAAQDLGIPLVFFWTLCACGLLGYMHYCNLIEKDYTPLKDESYLTNGYLEKTLDWI  190

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
              GM  +RLRDLPSFIRT NPDD ++K+++  TER+K+ASAI+VNTF+ LE+E L  LQ++
Sbjct  191   PGMKDIRLRDLPSFIRTANPDDYMIKFLIQETERSKNASAIVVNTFEPLEKEVLESLQTL  250

Query  815   LPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             LPPVYA GP     + V+D+ +  L L+LWKED  C+EWL++    SVVYVNFGSI V+T
Sbjct  251   LPPVYAIGPLHLILKHVDDNNLEELELNLWKEDEKCLEWLDSKKLNSVVYVNFGSIAVVT  310

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             ++QL+EFAWGLAN++  FLWIIRPD+V GE+A+LP EFVEET++R MLASWCPQEQV+SH
Sbjct  311   SNQLIEFAWGLANSRMEFLWIIRPDIVLGEQAILPPEFVEETKDRAMLASWCPQEQVLSH  370

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PA+GGFLTH  WNS LESI  GVPMICWPFFA+Q TNCW+CCT+ GIGMEID++VKR EV
Sbjct  371   PAIGGFLTHGEWNSILESISCGVPMICWPFFAEQPTNCWFCCTKLGIGMEIDSNVKRDEV  430

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
               LVRELM G+KG EM++KA+E KKLAE+AA  PTGSSY N++++IN+ 
Sbjct  431   ASLVRELMAGDKGKEMKKKALEWKKLAEEAAKKPTGSSYVNIDKIINEI  479



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/474 (63%), Positives = 374/474 (79%), Gaps = 8/474 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSF+
Sbjct  9     KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSFQ  68

Query  284   FETIPDGLPPSDV--DATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVS  442
             F TIPDGLPPSD   D TQD   LC+S ++ CL  F+DL+ RLN+       PPVSC+VS
Sbjct  69    FRTIPDGLPPSDAAADTTQDTLALCQSTSKFCLPYFRDLLHRLNEESATSGSPPVSCVVS  128

Query  443   DGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTV  622
             DG M FTLDAAE  G+PE+L WT  A  F+G+V YR +IDKG +PLKD+SY  NGYLDT 
Sbjct  129   DGAMTFTLDAAEAIGVPEVLLWTASACSFMGYVQYRSLIDKGLAPLKDASYLTNGYLDTT  188

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             +DW+ GM  +RLRDLPSFI+TT+P+D ++ + +   ERAK ASAI+ NTFD LE E L+ 
Sbjct  189   IDWIPGMRNIRLRDLPSFIQTTDPNDLMIPFCLREIERAKRASAIVFNTFDRLEHEVLDA  248

Query  803   LQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
             L++M PP+Y  GP     +Q+ D+  +  G +LWKE+  C+EWL++  P SV+YVNFGSI
Sbjct  249   LKAMFPPIYTVGPLHLLTKQLSDNNTKPFGSNLWKEEPGCIEWLDSKQPGSVMYVNFGSI  308

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
             TVM+  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP +F+  TRER +L SWCPQE+
Sbjct  309   TVMSPVQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQER  368

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V+SH AVGGFLTH+GWNST+ESI +GVP++CWPFF DQQTNCWY C +WGIGMEID +VK
Sbjct  369   VLSHSAVGGFLTHNGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDNNVK  428

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             R EVER V+ELM GEKG +M+RKAME K++A + AT P+GSS+ N++EVINK L
Sbjct  429   RNEVERQVKELMEGEKGKQMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVL  481



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 379/480 (79%), Gaps = 8/480 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP 
Sbjct  1     MGSIDMIQ-KPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLPSFRF TIPDGLPPSD  D TQDI  LC+S ++ CL  F+DL+ RLN+       
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGS  119

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSDG M FTLDAAE  G+PE+LFWT  A GF+G+V YR ++DKG +PLKD+SY 
Sbjct  120   PPVSCVVSDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYVQYRSLVDKGLTPLKDASYL  179

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              NGYLDT +DW+ GM  +RLRDLPSF+RTT+ DD ++ + +  T+RAK ASAI+ NTFD 
Sbjct  180   TNGYLDTTIDWIPGMRNIRLRDLPSFLRTTDKDDLMIDFCLRETKRAKRASAIVFNTFDR  239

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LE E L+ L+++ PP+Y  GP     +Q+ D+  +++G +LWKED  C+EWL++  P SV
Sbjct  240   LEHEVLDALKAIFPPIYTLGPLHLLTKQLPDNDTKSIGSNLWKEDLGCLEWLDSKPPSSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVM+  QLVEFAWGLA++ + FLW+IRPDLV G+ A+LP EF   TRER +L
Sbjct  300   VYVNFGSITVMSPAQLVEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLL  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V+SH AVGGFLTHSGWNST+ESI +GVPM+CWPFF +QQTNC Y C +WGIG
Sbjct  360   ASWCPQERVLSHSAVGGFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEID++VKR EV R VRELM GE+G EM+RKAME K++A + AT P+GSS  N++EVI+K
Sbjct  420   MEIDSNVKRDEVSRQVRELMEGERGKEMKRKAMEWKEMARE-ATRPSGSSCLNLDEVIDK  478



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/479 (63%), Positives = 386/479 (81%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI G   KPHAVCIPFPAQGHINPMLK+AK+L+ KGFHITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGSI-GLAEKPHAVCIPFPAQGHINPMLKVAKLLHCKGFHITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             S  GLPSFRFE IPDGLPP++   TQDI +LC S  ++CL  F++L+++LN S   PPVS
Sbjct  60    SHDGLPSFRFENIPDGLPPTNASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSPASPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAAEE GIPE+LFWT  A GF+ +V Y  +I+KG +PLKD SY  NGY
Sbjct  120   CIVSDGAMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLKDVSYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+TV+DW+ GM  +RLRD+PSF+RTT+P+DPI+ +I+  T RA+ ASAI++NTF  LE E
Sbjct  180   LETVIDWIPGMKDIRLRDIPSFMRTTDPNDPILDFILHETTRARKASAIILNTFYDLEYE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              ++ L ++L P++  GP      Q+  D+ ++++G +LW E+  C+EWL+T +P SVVYV
Sbjct  240   IIDALSTLLSPIHCIGPLHLLLNQIPADNELKSIGSNLWTEEPECLEWLDTKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++QL+EFAWGLAN+   FLW IRPDLV GE AV+P+EFV+ET+ER +LA+W
Sbjct  300   NFGSITVMTSEQLIEFAWGLANSMHTFLWAIRPDLVGGESAVVPKEFVDETKERSLLANW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC + C +WGIG+EI
Sbjct  360   CPQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCREWGIGLEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D DVKR  VE LVR+LM GE+G EMR+K +E KKLA++A T P+G S+ + E+V+++ +
Sbjct  420   DPDVKRDYVEGLVRKLMEGEEGKEMRKKTLEWKKLAKEATTGPSGLSFVDFEKVVSQVI  478



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/479 (64%), Positives = 391/479 (82%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS +G   KPHAVCIPFPAQGHINPMLKLAK+L++KGF+ITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGS-NGLIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GLPSFRFETIPDGLPP+D +ATQDI +LCES  ++ L  F+DL+++LN S   PPVS
Sbjct  60    SLDGLPSFRFETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA E GIPE+LFWT  A G L +V Y  +I+KG +PLKD+SY  NGY
Sbjct  120   CIVSDGVMSFTLDAAHELGIPEVLFWTTSACGLLAYVHYHRLIEKGLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T +DW+ GM G+RL+D+PSFIRTT+PDD ++ ++V  TER + ASA+++NTF  LE E
Sbjct  180   LETEIDWIPGMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVLLNTFHDLEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             AL+ L ++LPP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYV
Sbjct  240   ALDALSTLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EFAWGLA++ + F W+IRPDLV G+ AV+P EFVEET+ER +LA W
Sbjct  300   NFGSITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPAVGGFLTHSGWNST+ES+C+GVPMICWPFFA+QQTNC Y   +WGIGMEI
Sbjct  360   CPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              +DVKR  +E LVR+LM GE+G +MR+KA+E KKLA++ AT+P GSS+  ++++IN+ L
Sbjct  420   KSDVKRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVL  477



>ref|XP_007227474.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
 gb|EMJ28673.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
Length=483

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/471 (64%), Positives = 384/471 (82%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV +PFPAQGHINPML+LAK+LN+KGFHITFVN+EFNH+R+L S+G  ++ GLPSFR
Sbjct  9     KPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMF  457
             FETIPDGLPP+D DA +++  +C+S ++ CL PF+ L+ +LN S   PPV+CIV+DG   
Sbjct  69    FETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSPDSPPVTCIVADGVTS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAE FGIPE+LFWT  A G +G+V Y  +I+KG +P KD+  F NGYLDT +DW+ 
Sbjct  129   FTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDTEIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  VRL+D+PSFIRTT+P+D ++ Y+V  TER+K ASAI++NTFDALEQE ++ L ++L
Sbjct  189   GMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEVVDALSTLL  248

Query  818   PPVYAAGPFQ--FFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PP+Y+ GP Q  + E   E + ++A+G +LW E+T C+ WL+T +P SVVYVNFGS TVM
Sbjct  249   PPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNFGSTTVM  308

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T +QLVEF+WGLAN+KKPFLWIIRP LV+GE AV+P EF+EET+ERGMLASWCPQEQV+ 
Sbjct  309   TNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQVLL  368

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             H A+GGFLTHSGWNSTLE++C GVP+ICWPFFA+QQTN  Y CTQWGIG+EID +VKR  
Sbjct  369   HSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVKRDY  428

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ++ LVR LM GE+G +MR+KA+E KKLAED ATAP GSSY  +E V++K L
Sbjct  429   IDGLVRTLMDGEEGKKMRKKALEWKKLAED-ATAPKGSSYLALENVVSKVL  478



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/475 (63%), Positives = 371/475 (78%), Gaps = 9/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSF+
Sbjct  9     KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPSFQ  68

Query  284   FETIPDGLPPSDV--DATQDIATLCESITQNCLGPFKDLIARLNQSG------PPVSCIV  439
             F TIPDGLPPSD   DATQD   LC+S ++ CL  F+DL+ RLN+        PPVSC+V
Sbjct  69    FRTIPDGLPPSDAASDATQDTLALCQSTSKFCLPYFRDLLQRLNEESATTSGSPPVSCVV  128

Query  440   SDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             SDG M FTLDAAE   +PE+L WT  A  F+G+V YR +IDKG +PLKD+SY  NGYLDT
Sbjct  129   SDGAMTFTLDAAEAINVPEVLLWTASACSFMGYVQYRSLIDKGLTPLKDASYLTNGYLDT  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
              +DW+ GM  +RLRDLPSFI+TT+P+D ++ + +   ERAK ASAI+ NTFD LE E L+
Sbjct  189   TIDWIPGMRNIRLRDLPSFIQTTDPNDLMIPFCLREIERAKRASAIVFNTFDRLEHEVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L++M PP+Y  GP     +Q+ D+  R  G +LWKE+  C+EWL++  P SVVYVNFGS
Sbjct  249   ALKAMFPPIYTLGPLHLLTKQLSDNNTRPFGSNLWKEEPGCIEWLDSKQPSSVVYVNFGS  308

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             ITVM+  QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP +F+  TRER +L SWCPQE
Sbjct  309   ITVMSPAQLVEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQE  368

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V+ H AVGGFLTHSGWNST+ESI +GVP++CWPFF DQQTNCWY C +W IGMEID+DV
Sbjct  369   RVLGHSAVGGFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWRIGMEIDSDV  428

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVER V+ELM GEKG +M+RKAME K++A + AT P G S+ N++EVINK L
Sbjct  429   KRNEVERQVKELMEGEKGKQMKRKAMEWKEMARE-ATRPFGPSFLNLDEVINKVL  482



>gb|ABV68925.1| mandelonitrile glucosyltransferase UGT85A19 [Prunus dulcis]
Length=483

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 384/471 (82%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV +PFPAQGHINPML+LAK+LN+KGFHITFVN+EFNH+R+L S+G  ++ GLPSFR
Sbjct  9     KPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMF  457
             FETIPDGLPP+D DA +++  +C+S ++ CL PF+ L+ +LN S   PPV+CIV+DG   
Sbjct  69    FETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSPDSPPVTCIVADGVSS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAE FGIPE+LFWT  A G +G+V Y  +I+KG +P KD+  F NGYLDT +DW+ 
Sbjct  129   FTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDTEIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  VRL+D+PSFIRTT+P+D ++ Y+V  TER+K ASAI++NTFDALEQE ++ L ++L
Sbjct  189   GMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEVVDALSTLL  248

Query  818   PPVYAAGPFQ--FFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PP+Y+ GP Q  + E   E + ++A+G +LW E+T C+ WL+T +P SVVYVNFGS TVM
Sbjct  249   PPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNFGSTTVM  308

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T +QLVEF+WGLAN+KKPFLWIIRP LV+GE AV+P EF+EET+ERGMLASWCPQEQV+ 
Sbjct  309   TNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQVLL  368

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             H A+GGFLTHSGWNSTLE++C GVP+ICWPFFA+QQTN  Y CTQWGIG+EID +VKR  
Sbjct  369   HSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVKRDY  428

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ++ LVR LM GE+G +MR+KA+E KKLAED AT+P GSSY  +E V++K L
Sbjct  429   IDGLVRTLMDGEEGKKMRKKALEWKKLAED-ATSPKGSSYLALENVVSKVL  478



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/470 (64%), Positives = 385/470 (82%), Gaps = 4/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPML+LAK+L++KGFHITFVN+EFNH+RLL+SRGP S+ GLPSFR
Sbjct  9     KPHAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPP+D +ATQDI +LCES  ++ L  F+DL+++LN S   PPVSCIVSDG M 
Sbjct  69    FETIPDGLPPTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVSCIVSDGVMS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA E GIPE+LFWT  A GFL +V Y  +I+KG +PLKD+SY  NGYL+T +DW+ 
Sbjct  129   FTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM G+RL+D+PSFIRTT+PDD ++ ++V  TER + ASA+++NTF   E E L+ L ++L
Sbjct  189   GMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVILNTFHDFEHEVLDALSTLL  248

Query  818   PPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYVNFGSITVMT
Sbjct  249   PPIYSIGPLHVQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSITVMT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             A+QL+EFAWGLAN+ + F W+IRPDLV G+ AV+P EFVE+T+ER +LA+WCPQEQV+ H
Sbjct  309   AEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEDTKERSLLANWCPQEQVLKH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PAVGGFLTHSGWNST+ES+CSGVPMICWPFFA+QQTNC Y   +WGIGMEI++DVKR  V
Sbjct  369   PAVGGFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIESDVKRNYV  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR+LM G++G EMR+KA+E KKLA + AT+P GSS+  +++++N+ L
Sbjct  429   EGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFLCLDKMVNQVL  477



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/479 (63%), Positives = 386/479 (81%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    KPHAVCIPFPAQGHINPML +AK+L+ KGFHITFVN+EFNH+RLL+SRG  
Sbjct  1     MGSISF-AEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             S+ GLPSF+FETIPDGLPP++ + TQDI +LC S  + CL  F++L+++LN S   PPVS
Sbjct  60    SLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSPDSPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA+E GIPE+LFWT  A G L ++ +  +I+KG +P KD+SY  NGY
Sbjct  120   CIVSDGVMSFTLDAAQELGIPEVLFWTTSACGLLAYMQFYRLIEKGLTPHKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM  +RL+D+PSFIRTT PDD ++ +I++ TERAK ASAI++NTF   E+E
Sbjct  180   LDTVIDWLPGMKDIRLKDIPSFIRTTEPDDQMLDFILVETERAKKASAIILNTFHDFERE  239

Query  791   ALNGLQSMLPPVYAAGPFQF-FEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              LN L ++LPPVY+ GP      Q   D  ++++G +LW E+  C+EWL+T +P SVVYV
Sbjct  240   VLNALSTLLPPVYSIGPLNLQIGQNPVDKELKSIGSNLWTEEPECLEWLDTKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT +QL+EFAWGLAN KK FLW+IRPDLV G+ AV+P EFVEET++R +LASW
Sbjct  300   NFGSITVMTNEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPEFVEETKDRSLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC + C +WGIG+EI
Sbjct  360   CPQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCKEWGIGLEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G EMR+K++E KK A++A++ P G S+ ++++++N+ L
Sbjct  420   EGDVKRKYVEGLVRKLMDGEEGKEMRKKSLEWKKSAKEASSGPNGLSFVDLDKMVNQVL  478



>ref|XP_010676178.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/473 (63%), Positives = 372/473 (79%), Gaps = 6/473 (1%)
 Frame = +2

Query  92    GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGL  271
             G G KPHAVCIP+PAQGHINPML+LAKI + KGFHITFVNSE+NH RLLRSRGP ++   
Sbjct  7     GHGQKPHAVCIPYPAQGHINPMLQLAKIFHFKGFHITFVNSEYNHSRLLRSRGPAALADR  66

Query  272   PSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSD  445
             PSFRF+TIPDGLPP+D D+TQDI+ LC S  Q+CLGPFK+LIA LN++G  PPVSCIVSD
Sbjct  67    PSFRFKTIPDGLPPTDADSTQDISLLCASTEQHCLGPFKELIAHLNEAGDVPPVSCIVSD  126

Query  446   GGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLY-RLVIDKGFSPLKDSSYFENGYLDTV  622
               MFFTL+AA+EFG+PE++ WT  A G LG+  Y +LV + G  P KD+S+  NG LD V
Sbjct  127   VSMFFTLNAAQEFGVPEVMLWTASACGLLGYAQYPKLVDEMGLVPFKDASFITNGELDAV  186

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             +DWV GM  ++LRD+PSFIRTTNP+D ++ ++  +  ++K ASAI+ N+FDAL+   LN 
Sbjct  187   VDWVPGMEDMQLRDIPSFIRTTNPNDIMLNFVQRLLHKSKQASAIVFNSFDALDHAVLNS  246

Query  803   LQSMLPPVYAAGPFQFFEQQV---EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L S  PP+Y  GP Q     +    D  ++ +  +LWKEDT C+ WL++ +P SVVYVNF
Sbjct  247   LSSDFPPLYTLGPLQLLLDSIPGSNDEEIQTISTNLWKEDTHCLGWLDSYEPNSVVYVNF  306

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITVMT DQL+EFAWGLAN+ +PFLWIIRPDLV G+ AVLP EF+EET+ RG++ASWC 
Sbjct  307   GSITVMTNDQLIEFAWGLANSNQPFLWIIRPDLVIGDSAVLPPEFIEETKNRGLIASWCN  366

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             Q+QV++HPAVGGFLTH GWNS +E++ +G P+ICWPFFA+QQTNCW+ C +WGIGMEID 
Sbjct  367   QDQVLAHPAVGGFLTHCGWNSIIETLINGAPIICWPFFAEQQTNCWFSCNKWGIGMEIDV  426

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             +VKR EVER VRELM GEKG EM+RK ME +KL  +A  AP GSSY N+++VI
Sbjct  427   NVKRSEVERQVRELMDGEKGKEMKRKVMEWRKLGHEATAAPNGSSYKNLDKVI  479



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/479 (64%), Positives = 388/479 (81%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS +G   KPHAVCIPFPAQGHINPMLKLAK+L++KGFHITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGS-NGLIEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GLPSFRFETIPDGLP +D +ATQDI +LCES  ++ L  F+DL+++LN S   PPVS
Sbjct  60    SLDGLPSFRFETIPDGLPLTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSSTGCPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA E GIPE+LFWT  A GFL +V Y  +I+ G +PLKD+SY  NGY
Sbjct  120   CIVSDGVMSFTLDAAHELGIPEVLFWTTSACGFLAYVHYHRLIENGLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T +DW+ GM G+RL+D+PSFIRTT+ DD ++ ++V  TER + ASA+++NTF  LE E
Sbjct  180   LETQIDWIPGMRGIRLKDIPSFIRTTDRDDLMLDFLVHETERTRKASAVVLNTFHDLEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             AL+ L ++LPP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYV
Sbjct  240   ALDALSTLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMTA+QL+EFAWGLAN+ + F W+IRPDLV G+ AV+P EFVEET+ER +LA W
Sbjct  300   NFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPAVGGFLTHSGWNST+ES+C+GVPMICWPFFA+QQTNC Y   +WGIGMEI
Sbjct  360   CPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G +MR+KA+E KKLA + AT+P GSS+  ++++IN+ L
Sbjct  420   ENDVKRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAME-ATSPNGSSFVALDKMINQVL  477



>ref|XP_008219457.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 384/471 (82%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV +PFPAQGHINPML+LAK+LN+KGFHITFVN+EFNH+R+L S+G  ++ GLPSF+
Sbjct  9     KPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHALDGLPSFQ  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMF  457
             F+TIPDGLPP+D DA +++  +C+S ++ CL PFK L+ +LN S   PPV+CIV+DG   
Sbjct  69    FKTIPDGLPPADADARRNLPLVCDSTSKTCLAPFKALLTKLNSSPDSPPVTCIVADGVTS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAE FGIPE+LFWT  A G +G+V Y  +I+KG +P KD+  F NGYLDT +DW+ 
Sbjct  129   FTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYLDTEIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  +RL+D+PSFIRTT+P+D ++ Y+V  TER+K ASAI++NTFDALEQE ++ L ++L
Sbjct  189   GMKDIRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEVVDALSTLL  248

Query  818   PPVYAAGPFQ--FFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PP+Y+ GP Q  + E   E + ++A+G +LW E+T C+ WL+T +P SVVYVNFGS TVM
Sbjct  249   PPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYVNFGSTTVM  308

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T +QLVEF+WGLAN+KKPFLWIIRP LV+GE AV+P EF+EET+ERGMLASWCPQEQV+ 
Sbjct  309   TNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQVLL  368

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             H A+GGFLTHSGWNSTLE++C GVP+ICWPFFA+QQTN  Y CTQWGIG+EID +VKR  
Sbjct  369   HSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVKRDY  428

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ++ LVR LM GE+G +MR+KA+E KKLAE+ ATAP GSSY  +E V++K L
Sbjct  429   IDGLVRTLMDGEEGKKMRKKALEWKKLAEE-ATAPKGSSYLALENVVSKVL  478



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/470 (63%), Positives = 382/470 (81%), Gaps = 4/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPMLKLAK+L++KGFHITFVN+EFNH+RLL+SRGP S+ G PSFR
Sbjct  9     KPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPP+D +ATQDI +LC+S  +  L  F+DL+++LN S   PPVSC+VSDG M 
Sbjct  69    FETIPDGLPPTDANATQDIPSLCDSTRKRGLPYFRDLLSKLNSSPDCPPVSCVVSDGAMG  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA+E G+PE+LFWT  A GFL +V Y  +I+KG +PLKD+SY  NGYL+T +DW+ 
Sbjct  129   FTLDAAQELGLPEVLFWTTSACGFLAYVHYHRLIEKGLTPLKDASYLTNGYLETEIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM G+RL+D+PSFIRTT+PDD ++ ++V  TER + ASA++ NTF   E E LN L ++L
Sbjct  189   GMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLNALSTLL  248

Query  818   PPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYVNFGSITVMT
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSITVMT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             A+QL+EFAWGLAN+ + F W+IRPDLV G+ AV+P EFVEET+ER +LA+WCPQEQV+SH
Sbjct  309   AEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQVLSH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PAVGGFLTHSGWNST+ES+C+GVPMICWPFFA+QQTNC Y   +W IGMEI++DVKR  V
Sbjct  369   PAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIESDVKRNYV  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR+LM G++G EMR+KA+E KKLA + A +P GSS+  +++++N+ L
Sbjct  429   EGLVRKLMEGDEGKEMRKKALEWKKLATE-AISPNGSSFVGLDKMVNQVL  477



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/480 (65%), Positives = 377/480 (79%), Gaps = 8/480 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI+    KPHAVCIPFPAQGHI PMLKLAK+L+ KGFHITFVN+EFNHRRLL+SRGP+
Sbjct  1     MGSIARPEKKPHAVCIPFPAQGHIKPMLKLAKLLHQKGFHITFVNTEFNHRRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             ++ GLP F+F+ IPDGLPPSDVDATQDI +LCESI +NCLGPF++L+A LN +      P
Sbjct  61    ALNGLPDFQFKAIPDGLPPSDVDATQDILSLCESIDRNCLGPFRELLAELNDTSSSEVAP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG   FTL AA+E GIPE+L WT  A  +L F  +   I+KG  PLKD+SY  N
Sbjct  121   VSCIVSDGATTFTLAAAQELGIPEVLLWTSSAPSYLAFFQFDKFIEKGIIPLKDASYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTVLDW+ G+ G+RL+DLPS +RTTNPDD +VK+ +  T+RA+ ASAI++NTF  LE
Sbjct  181   GYLDTVLDWIPGLEGIRLKDLPSLLRTTNPDDFMVKFAMQETKRARKASAIIINTFQQLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              + L+ L S LPP+Y  GP    E  + D  +  L  +LWKE+  C+EWL+  DP SVVY
Sbjct  241   HDVLDALSSHLPPIYTIGPLHLLENHMHDKSLTDLQSNLWKEEPECLEWLDLKDPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSI VMT +QLVEFAWGLAN+K+ FLWI+RPDLVSG  A+LP EF+EET+ER M A 
Sbjct  301   VNFGSIAVMTPEQLVEFAWGLANSKQNFLWILRPDLVSGNSAILPSEFLEETKERSMFAG  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SHP+VGGFLTHSGWNST+ESI  GVPMICWPFFADQQTNCW+CCT+WGIGME
Sbjct  361   WCPQEKVLSHPSVGGFLTHSGWNSTIESISYGVPMICWPFFADQQTNCWFCCTKWGIGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LV ELM GEKG EM++KAM+ KKLAE A T     S  N+E +I++ L
Sbjct  421   IDNNVKRDEVEGLVSELMAGEKGKEMKKKAMDWKKLAETAVT----DSNLNLENLIHQVL  476



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 376/482 (78%), Gaps = 5/482 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++   LKPHAVC+P+PAQGHINPMLKLAK+L+HKGFHITFVN+E+NH RLL+SRGP 
Sbjct  1     MGSVAANDLKPHAVCVPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHNRLLKSRGPN  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGP---PV  427
             S+ GLP FRFETIPDGLPP+D D+TQDI +LC+S ++ CL PF  L++RLN + P   PV
Sbjct  61    SLDGLPDFRFETIPDGLPPNDADSTQDIPSLCDSTSKTCLAPFSSLLSRLNNAAPDVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FT++AA +FG+PE LFWT  A G LG+  Y  ++++G++PLKD SY  NG
Sbjct  121   TCIVSDGCMSFTVEAAHQFGLPEALFWTPSACGLLGYTQYSHLVERGYTPLKDMSYVTNG  180

Query  608   YLDTVLDWVKGMPG-VRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             YL+T LDW+ GM   +RLRDLPSFIRTT  DD ++ +++         +A+++N+F  LE
Sbjct  181   YLETKLDWIPGMRNDIRLRDLPSFIRTTAADDIMLNFVLHEVNNIPKGTAVVLNSFYELE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              +A + L +M P V++ GP Q    Q++D G++++G +LWKED  C+EWL+  +P SVVY
Sbjct  241   HDAFDALSAMYPRVFSIGPLQLMLNQIQDEGLKSIGSNLWKEDPVCIEWLDDKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMTA QL EFAWGLAN+KK FLWIIRPD+V+G+ A+LP EFV ET+ERG LAS
Sbjct  301   VNFGSITVMTAHQLTEFAWGLANSKKSFLWIIRPDIVAGDTAMLPPEFVTETKERGKLAS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+ HPA+GG LTHSGWNSTLES+C GVP+ICWPFFA+QQTNC Y C +W +GME
Sbjct  361   WCPQEEVLKHPAIGGSLTHSGWNSTLESVCGGVPVICWPFFAEQQTNCRYSCVEWEMGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID DVKR EVE LVRELM GEKG +MR KA+E K  AE AA  P G  + N++++IN  L
Sbjct  421   IDNDVKRDEVELLVRELMDGEKGEKMRNKALEWKSKAE-AAAGPDGPCFQNLDQLINDLL  479

Query  1505  SP  1510
              P
Sbjct  480   LP  481



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/470 (63%), Positives = 383/470 (81%), Gaps = 4/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINP+LKLAK+L++KGFHITFVN+EFNH+RLL+SRGP S+ G PSFR
Sbjct  9     KPHAVCIPFPAQGHINPLLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPP+D +ATQDI +LC+S  +  L  F+DL+++LN S   PPVSC+VSDG M 
Sbjct  69    FETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSPDCPPVSCVVSDGAMG  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA+EFG+PE+LFWT  A GFL +V Y   I+KG +PLKD+SY  NGYL+T +DW+ 
Sbjct  129   FTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYLETEIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM G+RL+D+PSFIRTT+PDD ++ ++V  TER + ASA++ NTF   E E L+ L ++L
Sbjct  189   GMRGIRLKDIPSFIRTTDPDDIMLDFVVHETERTRKASAVIFNTFHDFEHEVLDALSTLL  248

Query  818   PPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYVNFGSITVMT
Sbjct  249   PPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVNFGSITVMT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             A+QL+EFAWGLA++ + F W+IRPDLV G+ AV+P EFVEET+ER +LA WCPQEQV+SH
Sbjct  309   AEQLIEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQVLSH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PAVGGFLTHSGWNST+ES+C+GVPMICWPFFA+QQTNC Y   +WGIGMEI +DVKR  +
Sbjct  369   PAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYI  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR+LM GE+G +MR+KA+E KKLA++ AT+P GSS+  ++++IN+ L
Sbjct  429   EGLVRKLMEGEEGKDMRKKALEWKKLAKE-ATSPNGSSFVPLDKMINQVL  477



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/477 (62%), Positives = 384/477 (81%), Gaps = 3/477 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+ G   KPHAVCIP+PAQGHINPMLKLAK+L+ KGFHITFVNSE+N +RLL+SRG  
Sbjct  1     MGSL-GTTKKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSS  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSC  433
             S+  L SFRFETIPDGLP SDVDATQDI +LCES  + CL  F+ L+A+LN S GPPVSC
Sbjct  60    SLHALSSFRFETIPDGLPDSDVDATQDIPSLCESTRRTCLPHFRKLLAKLNNSDGPPVSC  119

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTLDAA+E G+PE+LFWT  A GF+ ++ Y  +  KG +PLKDSS   +GYL
Sbjct  120   IVSDGVMTFTLDAAQELGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSLVTSGYL  179

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T +DW+ G+  +RL+D+PSFIRTT+ DD ++ ++    +RA+ ASAI++NTFD LE + 
Sbjct  180   ETTIDWIPGIEKIRLKDIPSFIRTTDSDDIMLDFVQWECKRARRASAIILNTFDTLEHDV  239

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L    S+LPPVY+ GP     + V++  + A+  +LWKE++ C+EWLNT +P SVVYVNF
Sbjct  240   LKAFSSILPPVYSIGPLNLLVKNVDNKALNAIESNLWKEESECMEWLNTKEPNSVVYVNF  299

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITVMT++QLVEFAWGL N+ K FLW+IRPDLV+GE A+LP EFV++T+ RG+L+SWC 
Sbjct  300   GSITVMTSEQLVEFAWGLGNSNKSFLWVIRPDLVAGENAILPPEFVKQTKNRGLLSSWCS  359

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV++HPA+GGFLTHSGWNSTLES+C+GVPMICWPFFA+QQTNC +CC +WGIGMEI+ 
Sbjct  360   QEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEIE-  418

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             DVKR ++E LV+ELM GEKG +M+ KA++ KKLA+ AA+ P G+S+ N++ ++++ L
Sbjct  419   DVKRDKIESLVKELMDGEKGKQMKEKALQWKKLAKTAASGPYGTSFLNLDNMVHEVL  475



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/477 (62%), Positives = 377/477 (79%), Gaps = 6/477 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS   +  KPHAVC+P+PAQGHINPML+LAK+L+ KGFHITFVN+E+NH RL+RSRGP 
Sbjct  1     MGS-GAKQQKPHAVCVPYPAQGHINPMLQLAKLLHSKGFHITFVNTEYNHNRLVRSRGPG  59

Query  257   SVKGLPSFRFETIPDGLPPSD-VDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
             +V   PSFRFETI DG+PPSD VD+TQDI +LC S  ++CLGPFK L+ARLN++G  PPV
Sbjct  60    AVANRPSFRFETITDGMPPSDDVDSTQDIPSLCISTEKHCLGPFKRLLARLNEAGDVPPV  119

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SC+VSDG MFFT+DAA+E GIPE+L WT  A GFLG+  +  +I+ G +P KD+++  NG
Sbjct  120   SCVVSDGAMFFTIDAAQELGIPEVLLWTASACGFLGYAQFGKLIELGLAPFKDANFSTNG  179

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
              L+ VLDWV GM  +RLRD+PSFIRTT+P++P V YI  +   +K A+AI+ N+FDALE 
Sbjct  180   DLEAVLDWVPGMKNIRLRDIPSFIRTTDPNEPTVAYIQRLVHHSKRAAAIIFNSFDALED  239

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVE--DSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             + L  + S  PP YA GP     + +E  +   +++  SLWKED  C+EWL++ +P SVV
Sbjct  240   DVLRSISSNFPPTYALGPLHLLLESMEAINEETKSISTSLWKEDPHCLEWLDSYEPNSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT DQL+EFAWGLAN+ +PFLWI RPDLV G+ AVLP +F+EET+ RG++ 
Sbjct  300   YVNFGSITVMTNDQLIEFAWGLANSNQPFLWIARPDLVIGDSAVLPPDFLEETKNRGLIT  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC QE V++HPA+GGFLTH GWNST+E++ +GVP++CWPFFA+QQTNCWY CT+WGIGM
Sbjct  360   SWCDQEHVLAHPAIGGFLTHCGWNSTIETLINGVPIVCWPFFAEQQTNCWYSCTKWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             EID +VKR EVER VRELM GE+G EM+R AM+ KKLA +A    TGSSYNN++EVI
Sbjct  420   EIDANVKRSEVERQVRELMEGEQGKEMKRNAMKWKKLAYEATAVSTGSSYNNLDEVI  476



>ref|XP_004299646.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/472 (62%), Positives = 381/472 (81%), Gaps = 5/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPMLK+AK+L++KGF+ITFVN+EF H+RLL+SRGP S+ G PSFR
Sbjct  10    KPHAVCIPFPAQGHINPMLKVAKLLHYKGFYITFVNTEFIHKRLLKSRGPNSLDGFPSFR  69

Query  284   FETIPDGLPPSDVD-ATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGM  454
             FETIPDGLPP+D + ATQ + +LCES  +NCL PF+DL+ +LN S   PPV+CIV+DG M
Sbjct  70    FETIPDGLPPTDANVATQHMPSLCESTRKNCLAPFRDLLLKLNSSPNSPPVTCIVADGIM  129

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTLDAA+E G+PE++FWT  A GF+G++ Y  +I+KG  PLKD SY  NGYLDTV+DW+
Sbjct  130   NFTLDAAQELGLPEVIFWTTSACGFMGYLQYYNLIEKGLVPLKDDSYLTNGYLDTVIDWI  189

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
              GM G++L+D+P+F+RTT+P+DPI+  I+  TE+ + ASAI++NTFDALE E L  +  +
Sbjct  190   PGMKGIQLKDIPTFMRTTDPNDPILHLILHDTEQVQRASAIILNTFDALEHEVLEAISHL  249

Query  815   LPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             LPP+Y+ GP      Q+  EDS  + +G +LW+E+  C EWL++ +P SV+YVNFGS TV
Sbjct  250   LPPIYSIGPLYLQLNQIPAEDSNFKLIGANLWREEPDCFEWLDSKEPSSVIYVNFGSSTV  309

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             MT +QL+EFAWGLA++ K F W+IRPDLV GE  VLP EF+E+T+ERG+LASWC QEQV+
Sbjct  310   MTDEQLIEFAWGLADSSKTFFWVIRPDLVGGESPVLPPEFIEQTKERGLLASWCCQEQVL  369

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             SHPA+GGFLTHSGWNST+ES+C GVPMICWPF  +QQTNC YCC +WGIG+E++ DVKR 
Sbjct  370   SHPAIGGFLTHSGWNSTIESVCGGVPMICWPFNGEQQTNCRYCCKEWGIGIEMEGDVKRN  429

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              +E +VR+LM GE+G EMR+K+ME KKLAE A T P GSS+ +++ ++N+ L
Sbjct  430   YIESVVRKLMEGEEGKEMRKKSMEWKKLAEKATTGPHGSSFLDLDNMVNQVL  481



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/479 (63%), Positives = 388/479 (81%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS    KPHAVCIPFPAQGHINPML +AK+L+ KGFHITFVN++FNH+RLL+SRG  
Sbjct  1     MGSIS-LAEKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTQFNHKRLLKSRGSN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             S+ GLPSF+FETIPDGLPP++ + TQDI +LC S  + CL  F++L+++LN S   P VS
Sbjct  60    SLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSRDSPSVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA+E GIPE+LFWT  A GFL ++ +  +I+KG +PLKD+SY  NGY
Sbjct  120   CIVSDGVMSFTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM  +RL+D+PSFIRTT PDD ++ +I++ TERAK ASAI++NTF   E+E
Sbjct  180   LDTVVDWIPGMKDIRLKDIPSFIRTTEPDDQMLDFILVETERAKKASAIILNTFHDFERE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+ L ++LPPVYA GP      Q+  D+ ++++G +LW E+  C+EWL++ +P SVVYV
Sbjct  240   VLDALSTLLPPVYAIGPLNLQISQIPADNELKSIGSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++QL+EFAWGLAN KK FLW+IRPDLV G+ AV+P +F+EET++R +LASW
Sbjct  300   NFGSITVMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPKFLEETKDRSLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC   C +WGIG+EI
Sbjct  360   CPQEQVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRVSCKEWGIGLEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G EMR+KA+E KK A++ A+ P G SY ++++++N+ L
Sbjct  420   EGDVKRKYVEGLVRKLMDGEEGKEMRKKALEWKKSAKE-ASCPIGLSYVDLDKMVNQVL  477



>ref|XP_007227225.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
 gb|EMJ28424.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
Length=483

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/479 (63%), Positives = 390/479 (81%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI G   KPHAVCIP+PAQGHINPMLK+AK+L++KGFHITFVN+EFNH+RLL+SRGP 
Sbjct  1     MGSI-GLAEKPHAVCIPYPAQGHINPMLKVAKLLHYKGFHITFVNTEFNHKRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             S+ GLPSFRFE IPDGLPP+D   TQDI +LC S  ++CL  F++L+++LN S   PPVS
Sbjct  60    SLDGLPSFRFENIPDGLPPTDASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSPDSPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAAEE GIPE+LFWT  A GF+ +V Y  +I+KG +PLKD+SY  NGY
Sbjct  120   CIVSDGVMSFTLDAAEELGIPEVLFWTTSACGFMSYVQYHRLIEKGLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+TV+DW+ GM  +RLRD+P+F+RTT+P+DPI+ +IV  T RA+ ASAI++NTF  LE E
Sbjct  180   LETVIDWIPGMKDIRLRDIPTFMRTTDPNDPILDFIVHETTRARKASAIILNTFYELEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              ++ L ++L P++  GP      Q+  D+ ++++G +LW E+  C+EWL+T +P SVVYV
Sbjct  240   VIDALSTLLSPIHCIGPLHLQLSQIPADNELKSIGSNLWTEEPECLEWLDTEEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++QL+EFAWGLAN+K  FLW+IRPDLV GE A++P EFVEET+ER +LA+W
Sbjct  300   NFGSITVMTSEQLIEFAWGLANSKHTFLWVIRPDLVGGESAMVPAEFVEETKERSLLANW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV++HPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC + C +WGIG+EI
Sbjct  360   CPQEQVLNHPAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFSCKEWGIGLEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D DVKR  VE LVR+LM GE+G EMR+K +E KKLA++A T P+G S+ + ++V+N+ +
Sbjct  420   DPDVKRDYVEGLVRKLMEGEEGEEMRKKTLEWKKLAKEATTGPSGLSFVDFDKVVNQVI  478



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/472 (64%), Positives = 374/472 (79%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+PFPAQGHI PML LAK+L+H+GFHITFVN+E+NH+RLLRSRGP ++ GLPSFR
Sbjct  9     KPHAVCVPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             F TIPDGLPPSD DATQDI TLC S    CL  F+DL+  L++       PPVSC+VSDG
Sbjct  69    FRTIPDGLPPSDADATQDIPTLCRSSRDLCLPYFRDLLRTLDEESATSGSPPVSCVVSDG  128

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTLDAAE  G+P +LFWT  A GF+G+V YR ++DKG SPL+D+SY  NGYLDT++D
Sbjct  129   VMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTIID  188

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM  + LRDLPSFIRTT+PDD +V ++ + TERAK ASAI++NTFD LE E ++ L+
Sbjct  189   WIPGMRSISLRDLPSFIRTTDPDDFMVDFLSVETERAKRASAIVLNTFDRLEHEVVDALK  248

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             +M PP+Y  GP   F  Q+ D G  ++G +LWKE+  C++WL++  P SVVYVNFGSITV
Sbjct  249   AMFPPIYTLGPLHLFTAQLPDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSITV  308

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M+  QLVEFAWGLAN+ + FLWIIRPDLV+G+ AVLP EF   T ER +LASWCPQE+V+
Sbjct  309   MSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWCPQERVL  368

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
              H AVGGFLTHSGWNST+ESI +GVP++CWPFFA+Q TNC Y   +WG+GMEID+DVKR 
Sbjct  369   GHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGMGMEIDSDVKRD  428

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVER VRELM G++G EM+RKAME K++A +AA  P+G S+ N++E+IN  L
Sbjct  429   EVERQVRELMEGKRGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELINSVL  479



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/472 (63%), Positives = 371/472 (79%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+PFPAQGHI PML LAK+L+H+GFHITFVN+E+NH+RLLRSRGP ++ GLPSFR
Sbjct  9     KPHAVCMPFPAQGHIKPMLSLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             F TIPDGLPPSD DATQD+ TLC S    CL  F+DL+  L++       PPVSC+VSDG
Sbjct  69    FRTIPDGLPPSDADATQDVPTLCRSSRDLCLPYFRDLLRTLDEESATSGSPPVSCVVSDG  128

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTLDAAE  G+P +LFWT  A GF+G+V YR ++DKG SPL+D+SY  NGYLDT++D
Sbjct  129   VMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTIID  188

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM  + LRDLPSFIRTT+PDD +V +  + TERAK ASAI++NTFD LE E ++ L+
Sbjct  189   WIPGMRSISLRDLPSFIRTTDPDDFMVDFASVETERAKRASAIVLNTFDRLEYEVVDALK  248

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             +M PP+Y  GP      Q+ D G  ++G +LWKE+  C++WL++  P SVVYVNFGS+TV
Sbjct  249   AMFPPIYTLGPLHLLTAQLPDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSVTV  308

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M+  QLVEFAWGLAN+ + FLWIIRPDLV+G+ AVLP EF   TRER +LASWCPQEQV+
Sbjct  309   MSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQEQVL  368

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
              H AVGGFLTHSGWNST+ESI +GVP++CWPFFA+Q  NC Y   +WGIGMEID+DVKR 
Sbjct  369   GHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVKRD  428

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVER VRELM GE+G EM+RK ME K++A + AT P+G S+ N++E+IN  L
Sbjct  429   EVERQVRELMEGERGKEMKRKVMEWKEMARE-ATCPSGPSFLNLDELINSVL  479



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 381/482 (79%), Gaps = 7/482 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP+PAQGHINPMLKLAK+L++KGFH+TFV++E+N RR+++SRGP+
Sbjct  1     MGSIKVVE-KPHAVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVHTEYNLRRMVKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----P  421
             S+KGLP FRFETIPDGLPPSDVDATQDI +LC+S    CL PF  L++RLN S      P
Sbjct  60    SIKGLPGFRFETIPDGLPPSDVDATQDIPSLCDSTRNTCLVPFXSLLSRLNDSSNSDNIP  119

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
              V+CIVSDG M FTLDAA+E GIPE+L W   A  F+ F+ Y  +I++G +PL+D SY  
Sbjct  120   LVTCIVSDGVMSFTLDAAQELGIPEVLLWPTSACSFMSFLHYSHLIERGLTPLRDESYLT  179

Query  602   NGYLDTVLDWVKGM-PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
             NGYLDT +DW+ G+   +RLRDLPSFIRTT+P D ++ ++     R+K A AI++NTFDA
Sbjct  180   NGYLDTTIDWIPGLIKDIRLRDLPSFIRTTDPHDIMLNFLKGEAXRSKRAQAIILNTFDA  239

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
             LEQ+ L+ L SM P VY+ GP      Q+ D+G+ ++G +LW+E+  C+EWL++  P SV
Sbjct  240   LEQDVLDALSSMFPRVYSIGPLPLLHDQISDNGLESIGSNLWQEELGCLEWLDSQKPNSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVMT +QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EF+ +T+ER +L
Sbjct  300   VYVNFGSITVMTREQLVEFAWGLANSNQTFLWVIRPDLVVGDSALLPPEFIRDTKERSLL  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQ+QV++HP+VGGFLTH+GWNST+ESICSGVPMICWPFFADQQT C Y CT+WG+G
Sbjct  360   ASWCPQKQVLNHPSVGGFLTHNGWNSTVESICSGVPMICWPFFADQQTICRYACTEWGVG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             MEID++VKR EVE L+RELM GEKG EM+ KAME K+ AE+AA      S+ N++++IN+
Sbjct  420   MEIDSNVKRDEVESLIRELMEGEKGKEMKYKAMEWKRRAEEAAYQGGXPSHTNLDKMINE  479

Query  1499  FL  1504
              L
Sbjct  480   VL  481



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/482 (62%), Positives = 389/482 (81%), Gaps = 7/482 (1%)
 Frame = +2

Query  86    ISGEGL--KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPES  259
             +S  GL  KPHAVCIPFPAQGHI+PMLKLAK+L++KGFHITFVN+EFNH+RLL+SRGP S
Sbjct  1     MSSNGLIEKPHAVCIPFPAQGHIDPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNS  60

Query  260   VKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSC  433
             + G PSFRFETIPDGLPP+D  ATQDI +LC+S  ++ L  F++L+++LN S   PPVSC
Sbjct  61    LDGFPSFRFETIPDGLPPTDAIATQDIPSLCDSTRKHSLPYFRELLSKLNSSPDCPPVSC  120

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             +VSDG M FTLDAA+EFG+PE+LFWT  A GFL +V Y   I+KG +PLKD+SY  NGYL
Sbjct  121   VVSDGAMGFTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRFIEKGLTPLKDASYLTNGYL  180

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T +DW+ GM G+RL+D+PSFIRTT+PDD ++ ++V  TER + ASA+++NTF   E E 
Sbjct  181   ETEIDWIPGMRGIRLKDIPSFIRTTDPDDIMLDFLVHETERTRKASAVILNTFHDFEHEV  240

Query  794   LNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
             L+ L ++LPP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWL++ +P SVVYVN
Sbjct  241   LDALSTLLPPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLDSKEPNSVVYVN  300

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGSITVMTA+QL+EFAWGLAN+ + F W+IRPDLV G+ AV+P EFVEET+ER +LA+WC
Sbjct  301   FGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWC  360

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
             PQEQV+SH AVGGFLTHSGWNSTLES+C+GVPMICWPFFA+QQTN  Y   +WGIGMEI+
Sbjct  361   PQEQVLSHSAVGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIE  420

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK-FLS  1507
              DVKR  +E LVR+LM G++G EMR+KA+E KKLA + AT+P GSS+  +++++N+  LS
Sbjct  421   RDVKRNYIEGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFVGLDKMVNQVLLS  479

Query  1508  PN  1513
             P+
Sbjct  480   PS  481



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/483 (65%), Positives = 387/483 (80%), Gaps = 7/483 (1%)
 Frame = +2

Query  77    MGSISGEGL-KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             M SI+ E   KPHAVC+P+PAQGHI+PMLKLAKILNHKGFHITFVN+E N +RLL+SRGP
Sbjct  1     MCSINAENSDKPHAVCLPYPAQGHISPMLKLAKILNHKGFHITFVNTEHNQKRLLKSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----P  421
             + +K LPSFRFE IPDGLPP D DATQDI  LC+S    CLGPF++L+A+LN +     P
Sbjct  61    DGLKNLPSFRFEAIPDGLPPCDADATQDIIALCKSTDTTCLGPFRELLAKLNNTCSSKVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PVSCIVSDG + FTL AA+E GIP++ FWT  A G L ++ Y  ++DKG+ PLKD SY  
Sbjct  121   PVSCIVSDGSISFTLTAAQELGIPQVFFWTFAACGTLSYMHYCNLVDKGYIPLKDESYLT  180

Query  602   NGYLD-TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKS-ASAIMVNTFD  775
             NGYL+ T LDW+ GM  VRL+DLPSF+RT NPDD ++ +I+  TER+K  ASAI+VN+F+
Sbjct  181   NGYLEKTTLDWIPGMKDVRLKDLPSFLRTANPDDFMLNFIIRETERSKKYASAIVVNSFE  240

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             ALE+E L  LQ+++PPVY  GP     + V+D  +  LG +LWKE+  C+EWL++  P S
Sbjct  241   ALEKEVLESLQTLVPPVYVIGPLNLLVKHVDDKNLADLGSNLWKEEPKCLEWLDSKKPNS  300

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVMT + L+EFAWGLAN++  FLWIIRPD+V GE+A+LP EFVEET+ERGM
Sbjct  301   VVYVNFGSITVMTMNHLIEFAWGLANSQLDFLWIIRPDVVLGEQAILPPEFVEETKERGM  360

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             LASWC QE+V++HPA+GGFLTHSGWNSTLESI SGVPMICWPFFA+Q TNCW+CCT+ GI
Sbjct  361   LASWCQQEKVLNHPAIGGFLTHSGWNSTLESISSGVPMICWPFFAEQPTNCWFCCTKLGI  420

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEI+ +VKR EVE LVRELM GEKG EM++KAME K LAE+AA  P GSSY N++++IN
Sbjct  421   GMEINNNVKRGEVEALVRELMTGEKGKEMKKKAMEWKILAEEAAAKPAGSSYVNIDKLIN  480

Query  1496  KFL  1504
             + L
Sbjct  481   EIL  483



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/472 (64%), Positives = 370/472 (78%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHI PML LAK+L+H+GFHITFVN+E+NH+RLLRSRGP ++ GLPSFR
Sbjct  9     KPHAVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             F TIPDGLPP D D TQDI TLC S    CL  F+DL+  L++       PPVSC+VSDG
Sbjct  69    FRTIPDGLPPPDADVTQDIPTLCRSSRDLCLPYFRDLLQTLDEESATSGSPPVSCVVSDG  128

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTLDAAE  G+P +LFWT  A GF+G+V YR ++DKG SPL+D+SY  NGYLDT++D
Sbjct  129   VMSFTLDAAEAAGVPLVLFWTTSACGFMGYVQYRSLVDKGLSPLRDASYLTNGYLDTIID  188

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM  + LRDLPSFIRTT+PDD +V +  + TERAK ASAI++NTFD LE E ++ L+
Sbjct  189   WIPGMRSISLRDLPSFIRTTDPDDFMVHFASVETERAKRASAIVLNTFDRLEYEVVDALK  248

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             +M PP+Y  GP      Q+ D G  ++G +LWKE+  C++WL++  P SVVYVNFGSITV
Sbjct  249   AMFPPIYTLGPLHLLTAQLPDDGTGSIGSNLWKEEPGCLKWLDSKPPGSVVYVNFGSITV  308

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M+  QLVEFAWGLAN+ + FLWIIRPDLV+G+ AVLP EF   TRER +LASWCPQE+V+
Sbjct  309   MSPAQLVEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQERVL  368

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
              H AVGGFLTHSGWNST+ESI +GVP++CWPFFA+Q  NC Y   +WGIGMEID+DVKR 
Sbjct  369   GHQAVGGFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVKRD  428

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVER VRELM GE+G EM+RKAME K++A +AA  P+G S+ N++E+IN  L
Sbjct  429   EVERQVRELMEGERGKEMKRKAMEWKEMAREAA-CPSGPSFLNLDELINSVL  479



>ref|XP_009341757.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/479 (62%), Positives = 384/479 (80%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS S    KPHAVCIPFPAQGHINPML +AK+L  KGFHITFVN+EFNH+RLL+SRG  
Sbjct  1     MGSFS-LAEKPHAVCIPFPAQGHINPMLNVAKLLYLKGFHITFVNTEFNHKRLLKSRGSN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             S+ GLPSF+FETIPDGLPP++ + TQDI +LC S T+ CL  F +L+++LN S   PPVS
Sbjct  60    SLDGLPSFQFETIPDGLPPTNANVTQDIPSLCHSTTKTCLPHFSELLSKLNSSPDSPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA++ GIPE+L WT  A GFL +V +  +I+ G +PLKD+SY  NGY
Sbjct  120   CIVSDGIMSFTLDAAQKLGIPEVLLWTTSACGFLAYVQFHHLIENGLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM  +RL+D+PSF+RTT PDD ++ +I++ TERAK ASAI+VNTF   E+E
Sbjct  180   LDTVIDWIPGMKDIRLKDIPSFMRTTEPDDQMLDFILVETERAKRASAIIVNTFHDFERE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+ L ++ PPVY+ GP      Q+  D+ + ++G +LW E+  C+EWL++ +P SVVYV
Sbjct  240   VLDALSTLFPPVYSIGPLNLQIGQIPADNELNSIGSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++QL+EFAWGLAN KK FLW+IRPDLV G+ AV+P EF+EET++R +LASW
Sbjct  300   NFGSITVMTSEQLIEFAWGLANCKKTFLWVIRPDLVGGDSAVIPPEFLEETKDRSLLASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+++PA+GGFLTHSGWNSTLES+C GVP+ICWPFFA+QQTNC + C +WGIG+EI
Sbjct  360   CPQEQVLNNPAIGGFLTHSGWNSTLESVCGGVPIICWPFFAEQQTNCRFSCKEWGIGLEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  VE LVR+LM GE+G EMR+KA+E KKLA++A+  P G S+ + ++++N+ L
Sbjct  420   EGDVKRKYVEGLVRKLMDGEEGKEMRKKALEWKKLAKEASGGPNGLSFVDFDKMVNQVL  478



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/480 (62%), Positives = 372/480 (78%), Gaps = 5/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+     KPH VCIP+PAQGHINPMLKLAK+L+ KG FH+TFVN+E+NH+RLL+SRGP
Sbjct  1     MGSLGTAAKKPHVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PP  424
             +S+ GLPSFRFETIPDGLP +DVD TQDI +LC S  + CL  FK L+++LN      PP
Sbjct  61    DSLNGLPSFRFETIPDGLPETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLNDVSSDVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             V+CIVSDG M FTLDAA E  IPE+LFWT  A GF+G+V YR +I+KG  PLKDSS   N
Sbjct  121   VTCIVSDGCMSFTLDAAIELNIPEVLFWTTSACGFMGYVQYRELIEKGIIPLKDSSDITN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+T ++W+ GM  +RL+DLPSF+RTT+P+D ++ ++    +RA  ASAI++NTFDALE
Sbjct  181   GYLETTIEWLPGMKNIRLKDLPSFLRTTDPNDKMLDFLTGECQRALKASAIILNTFDALE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              + L    S+LPPVY+ GP     + V D  + +LG +LWKED+ C++WL+T +P SVVY
Sbjct  241   HDVLEAFSSILPPVYSIGPLHLLIKDVTDKNLNSLGSNLWKEDSECLKWLDTKEPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSI VMT++Q+VEFAWGLAN+ K FLW+IRPDLV+G+ AVLP EFV  T +RG L+S
Sbjct  301   VNFGSIAVMTSEQMVEFAWGLANSNKTFLWVIRPDLVAGKHAVLPEEFVAATNDRGRLSS  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             W PQE V++HPA+GGFLTHSGWNSTLESIC GVPMICWPFFA+QQTNC YCC +WGIG+E
Sbjct  361   WTPQEDVLTHPAIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRYCCEEWGIGLE  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I+ D KR  VE LVRELM GEKG  M+  A++ KKLA D+A  P GSS+ N+E +    L
Sbjct  421   IE-DAKRDRVESLVRELMDGEKGKLMKENALKWKKLAHDSAVGPKGSSFVNLENMFRGVL  479



>emb|CAN65645.1| hypothetical protein VITISV_012510 [Vitis vinifera]
Length=582

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/462 (65%), Positives = 372/462 (81%), Gaps = 0/462 (0%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAK+L+ +GF ITFVN+EFNH RLL ++GP  + GLP+F+
Sbjct  5     KPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGLPTFQ  64

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCIVSDGGMFFT  463
             FETIPDGLPPSDVDATQDI +LC S  +NCL PF+ L+A+LN  GPPV+CI SD  M FT
Sbjct  65    FETIPDGLPPSDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDGPPVTCIFSDAIMSFT  124

Query  464   LDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGM  643
             LDAA+E GIP++L WT  A GF+ +V YR +IDKGF+PLKD SY  NGYLDTV+DW+ GM
Sbjct  125   LDAAQELGIPDLLLWTASACGFMAYVQYRSLIDKGFTPLKDESYLTNGYLDTVVDWIPGM  184

Query  644   PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPP  823
              G+RL+DLPSFIRTT+PDD ++ + +   ERA+ ASAI+ NTFDALE E L+ +  M PP
Sbjct  185   KGIRLKDLPSFIRTTDPDDVMLDFAMGELERARKASAIIFNTFDALEHEVLDAIAPMYPP  244

Query  824   VYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQ  1003
             +Y   P Q    Q+ DS ++ +  +LWKE+  C++WL++ +P SVVYVN+GSITVMT  Q
Sbjct  245   IYTIAPLQLLLDQIHDSELQLIESNLWKEEPECLKWLDSKEPNSVVYVNYGSITVMTPQQ  304

Query  1004  LVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAV  1183
             L+EFAWGLAN+ + FLWI+RPDLVSGE A+LP EFV ET +RG+LA WC QEQV++H A+
Sbjct  305   LIEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCLQEQVLTHQAI  364

Query  1184  GGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERL  1363
             GGFLTH+GWNS +E +C+GVPMICWPFFA+QQTNC YCCT+WG+GMEID+DVKR EV +L
Sbjct  365   GGFLTHNGWNSIIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSDVKRDEVAKL  424

Query  1364  VRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEV  1489
             VRELM GEKG EM++K ME K  AE A T P GSSY N+E++
Sbjct  425   VRELMEGEKGKEMKKKTMEWKHTAEAATTGPDGSSYLNLEKM  466



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/479 (61%), Positives = 380/479 (79%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+       H VCIPFPAQGHINPMLKLAK+L+ KG FH+TFVN+E+NH+RLL++RGP
Sbjct  1     MGSLDITKNLSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPV  427
              S+ GLPSFRFETIPDGLP SDVD TQDI +LCES    C   FK L+++LN +   PPV
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FTLDAA+E  IPE+LFWT  A GF+ ++ YR +I++G +PLKDSSY  NG
Sbjct  121   TCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DWV G+  +RL+D+PSFIRTTNP+D ++ ++    +RA+ ASAI+ NTFD LE 
Sbjct  181   YLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L    S+LPPVY+ GP     + V +  + ++G +LWKE+  C+EWLN+ +P SVVYV
Sbjct  241   DVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++Q++EFAWGL+N+K PFLW+IRPDLV+GE AVLP EF+EET+ RG+L+SW
Sbjct  301   NFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE+V+ H ++GGFLTH+GWNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIG+EI
Sbjct  361   CPQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + D KR ++E LV+ELM GEKG EM+ KA++ KKLA +AA+ P GSS+ N+E +I+  L
Sbjct  421   E-DAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVL  478



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/481 (61%), Positives = 381/481 (79%), Gaps = 6/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+  +  KPH VC+PFPAQGHINPMLKLAK+L+ K  FH+TFVN+E+NH+RLL++RGP
Sbjct  1     MGSLGKKENKPHVVCVPFPAQGHINPMLKLAKLLHFKSDFHVTFVNTEYNHKRLLKARGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPV  427
              S+ GLPSFRFETIPDGLP SD+D+TQDI +LCES ++ CL  FK LI++LN +   PPV
Sbjct  61    NSLNGLPSFRFETIPDGLPESDLDSTQDIPSLCESTSKTCLPHFKKLISKLNNAIDTPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CI+ DG M FT+DAAEE  IP +LFWT  A GF+ ++ +R +I+KG +PLKDSSY  NG
Sbjct  121   TCIIGDGVMSFTIDAAEELNIPAVLFWTTSACGFMCYMQFRQLIEKGLTPLKDSSYLTNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DWV G+  +RLRD+P+FIRTT+P+D ++ + +   +RA  ASAI++NTFDALE 
Sbjct  181   YLETTIDWVPGIKEIRLRDIPTFIRTTDPNDIVLNFALGECQRALKASAIILNTFDALEH  240

Query  788   EALNGLQSM--LPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
               L    S+  LPPVY+ GP  F  + V D  + ++G +LWK++T C+EWL + +P SVV
Sbjct  241   NVLEAFSSIDNLPPVYSIGPINFLLKNVTDEELNSIGSNLWKDETDCLEWLASKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT DQLVEFAWGLAN+KK FLW+IRPDLVSG+ AVLP+EF+EET+ RG+L+
Sbjct  301   YVNFGSITVMTNDQLVEFAWGLANSKKTFLWVIRPDLVSGKNAVLPQEFLEETKNRGLLS  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQE+V+ H ++GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIG+
Sbjct  361   SWCPQEEVLGHSSIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGL  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI+ D KR ++E LV+ELM GEKG EM+ KA+ LK+LA D A    GSS  N++ +I+  
Sbjct  421   EIE-DAKRDKIEILVKELMEGEKGKEMKEKALRLKELAHDNAYGAFGSSLVNLDNMIHHV  479

Query  1502  L  1504
             L
Sbjct  480   L  480



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/473 (62%), Positives = 382/473 (81%), Gaps = 7/473 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VCIP+PAQGHINPMLKLAK+L++KGFH+TFVN+E+NHRRL++SRGP+SVKGLP FR
Sbjct  9     KPHVVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVNTEYNHRRLVKSRGPDSVKGLPGFR  68

Query  284   FETIPDGLPPSD-VDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDG  448
             FETIPDGLP SD ++ATQ I +LC+S  + CL PF++L+++LN S     PPVSCIVSDG
Sbjct  69    FETIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLNDSSSSDTPPVSCIVSDG  128

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTL AA+E GIPE+LFWT  A GF+ +V Y  +I +G +PLKD +Y  NGYLDT +D
Sbjct  129   VMSFTLTAAQECGIPEVLFWTTSACGFMSYVHYPHLIHRGLTPLKDINYLTNGYLDTTID  188

Query  629   WVKGM-PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGL  805
             W+ G+   +RLRDLPSF+RTT+PDD ++ ++    +RAK A AI++NTFDALE + LN L
Sbjct  189   WIPGLVKDIRLRDLPSFLRTTDPDDIMLDFVKGEVQRAKKAEAIILNTFDALEHDVLNVL  248

Query  806   QSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSIT  985
               M P VY+ GP Q    Q+ ++G++++G +LW+E   C++WL++  P SVVYVNFGSIT
Sbjct  249   SFMFPRVYSIGPLQLLHNQIPENGLKSIGSNLWQEQPGCLDWLDSQKPNSVVYVNFGSIT  308

Query  986   VMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQV  1165
             VMT +QLVEFAWGLAN+   FLW+IRPDLV G+ A+LP +F+ +TRERG+LASWCPQEQV
Sbjct  309   VMTPEQLVEFAWGLANSNXTFLWVIRPDLVVGDSALLPPKFITDTRERGLLASWCPQEQV  368

Query  1166  ISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKR  1345
             ++HP++G FLTH+GWNST+ESIC GVPMICWPFFA+QQTNC Y CT+WG+GMEID++VKR
Sbjct  369   LNHPSIGAFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGMEIDSNVKR  428

Query  1346  CEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              EVE LV+++M GEKG EM+++ +E KK AE+ AT   GSSY+N++++I + L
Sbjct  429   DEVESLVKQIMEGEKGKEMKKRTLEWKKKAEE-ATYQDGSSYSNLDKMIKEVL  480



>ref|XP_010030028.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/475 (62%), Positives = 368/475 (77%), Gaps = 6/475 (1%)
 Frame = +2

Query  98    GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPS  277
             G KPHAVCIPFPAQGHINPMLKLAK+L+HKGFHITFVN+E NH+RLLRS+GP S+ GLP 
Sbjct  7     GEKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPH  66

Query  278   FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVS  442
             FRF+ IPDGLPPSD D+TQDI +LC S++++ L  F+ L+ +L +       PPV+CIVS
Sbjct  67    FRFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLREQSQDGVVPPVTCIVS  126

Query  443   DGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTV  622
             DGGM FT+DAAEE  IPE++FWT  A G  G   YR +++ GF+PLKD +Y  NGYL+T 
Sbjct  127   DGGMAFTVDAAEELKIPEVVFWTPSACGVFGCTKYRRLVEDGFTPLKDPTYLSNGYLETT  186

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             + W  GM  +RLRD+P+FIRT +  D ++ +++   ER+  ASA+++NTFD LE + L  
Sbjct  187   VSWTSGMKSIRLRDIPTFIRTLDHQDIMLNFVIQEVERSSRASAVILNTFDTLEHDVLES  246

Query  803   LQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
             L S+ P +Y  GP Q    Q++D  +R +G +LW+E+  C+ WL++ +P SVVYVNFGSI
Sbjct  247   LSSVFPHIYTIGPLQLLADQIQDEALRLVGGNLWREEPECLSWLDSKEPGSVVYVNFGSI  306

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
             TV+TA QL EFAWGLAN++KPFLWIIRPDLV+ E AVLP EFVEE   RGMLA WC QE+
Sbjct  307   TVITAGQLTEFAWGLANSQKPFLWIIRPDLVATESAVLPPEFVEEIAGRGMLAHWCRQEE  366

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V+ H A+GGFLTHSGWNSTLES+C GVP+ICWPFF DQQTNC Y CT+WGIGMEID DVK
Sbjct  367   VLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFGDQQTNCRYSCTEWGIGMEIDNDVK  426

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLS  1507
             R EVE LVRELM GEKG EMR+KAME K  AE+ A  P G+SYNN+E++I++ LS
Sbjct  427   RDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPGGTSYNNVEKLISEVLS  480



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 379/479 (79%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+       H VCIPFPAQGHINPMLKLAK+L+ KG FH+TFVN+E+NH+RLL++RGP
Sbjct  1     MGSLDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPV  427
              S+ GLPSFRFETIPDGLP SDVD TQDI +LCES    C   FK L+++LN +   PPV
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FTLDAA+E  IPE+LFWT  A GF+ ++ YR +I++G +PLKDSSY  NG
Sbjct  121   TCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DWV G+  +RL+D+PSFIRTTNP+D ++ ++    +RA+ ASAI+ NTFD LE 
Sbjct  181   YLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L    S+LPPVY+ GP     + V +  + ++G +LWKE+  C+EWLN+ +P SVVYV
Sbjct  241   DVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++Q++EFAWGL+N+K PFLW+IRPDLV+GE AVLP EF+EET+ RG+L+SW
Sbjct  301   NFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE+V+ H ++GGFLTH+GWNSTLES+C GVPMICWPFF +QQTNC +CC +WGIG+EI
Sbjct  361   CPQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + D KR ++E LV+ELM GEKG EM+ KA++ KKLA +AA+ P GSS+ N+E +I+  L
Sbjct  421   E-DAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVL  478



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/472 (61%), Positives = 371/472 (79%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL+SRG  S+ GLP F 
Sbjct  9     KPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGSSSLDGLPDFE  68

Query  284   FETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGM  454
             F+TIPDGLPPSD+ DATQDI +LC+S +  CL PF+DLIA+LN S   P V+CI+SD  M
Sbjct  69    FKTIPDGLPPSDIADATQDIPSLCDSTSTTCLAPFRDLIAKLNSSSIVPQVTCIISDACM  128

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTLDAAEEFGIPE LFWT  A G LG+  YR +I++G +PLKD +   NGYL+T +DW+
Sbjct  129   SFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLKDETDLTNGYLETSIDWI  188

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
              GM  +RLRDLPSF+RTT+ +D ++ +++   +R   ASA+++NTFD+ EQ+ L+ L  M
Sbjct  189   PGMKNIRLRDLPSFVRTTDINDFMLHFLIREIDRTSRASAVIINTFDSFEQDVLDALSPM  248

Query  815   LPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
              PP+Y  GP Q    Q+ +  ++ +G +LWK+   C+EWL++  P SVVYVNFGSITV+T
Sbjct  249   FPPIYTLGPLQLLVDQIPNDNLKNIGSNLWKDHPECIEWLDSKGPNSVVYVNFGSITVIT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             A Q++EFAWGLAN+ KPFLWIIRPDL+ GE A+LP EF+  T++R +L SWCPQEQ++ H
Sbjct  309   AQQMIEFAWGLANSNKPFLWIIRPDLIGGEAAMLPPEFLSATKDRSLLVSWCPQEQILKH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             P++GGFL+H GWNSTLESIC GVPM+CWPFF +QQTNCW+ CT+WGIGMEI+ +VKR EV
Sbjct  369   PSIGGFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIENNVKRDEV  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTG-SSYNNMEEVINKFLS  1507
             E+LVRELM GEKG +M+RKAME K  AE+AA   TG +SY N++ ++    S
Sbjct  429   EKLVRELMEGEKGKDMKRKAMEWKTKAEEAAW--TGDASYRNLDRLVKVLAS  478



>ref|NP_001277168.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51843.1| UDP-glycosyltransferase 85A33 [Vitis vinifera]
Length=482

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 384/482 (80%), Gaps = 7/482 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++    KPH V IP+PAQGH+NPMLKLAK+L++KGF ++FVN+E+NH+RLLRSRGP 
Sbjct  1     MGSVTASD-KPHVVLIPYPAQGHVNPMLKLAKLLHNKGFFVSFVNTEYNHKRLLRSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS----GPP  424
             S+ GL  FRFETIPDGLPPSD DATQDI +LC S T+NCL PF  LI +LN      GPP
Sbjct  60    SLDGLSDFRFETIPDGLPPSDADATQDIPSLCVSTTKNCLAPFCALITKLNDPSYSPGPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTLDAAE+FG+PE++FWT  A GFLG+  YR +I +G  PL+D S   N
Sbjct  120   VSCIVSDGVMSFTLDAAEKFGVPEVVFWTTSACGFLGYRHYRNLIRRGLIPLQDESCLSN  179

Query  605   GYLDTVLDWVKGMPG-VRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             GYLDTV+D+V G    +RLRD P+F+RTT+ +D ++ ++ +  ERA  ASA+++NTFDAL
Sbjct  180   GYLDTVVDFVPGKKKTIRLRDFPTFLRTTDLNDIMLNFVRVEAERASRASAVILNTFDAL  239

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E++ L+ L + LPPVY+ GP Q    Q+ D  ++++G +LWKE T C++WL++ +P SVV
Sbjct  240   EKDVLDALSATLPPVYSIGPLQHLVDQISDDRLKSMGSNLWKEQTDCLQWLDSKEPNSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMT+ QL EFAWGLAN+ KPFLWIIRPDLV G+ A+LP EFV ET++RGMLA
Sbjct  300   YVNFGSITVMTSQQLTEFAWGLANSNKPFLWIIRPDLVVGDSALLPPEFVTETKDRGMLA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+ HPA+GGFLTHSGWNST ESIC GVP+ICWPFFA+QQTNC Y C++WGIGM
Sbjct  360   SWCPQEQVLKHPAIGGFLTHSGWNSTSESICGGVPLICWPFFAEQQTNCRYSCSEWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE+LVRELM GEKG EM++K ME KKLAE+ AT P GSSY+N  +++   
Sbjct  420   EIDNNVKRVEVEKLVRELMDGEKGKEMKKKVMEWKKLAEE-ATRPGGSSYDNFNKLLRNV  478

Query  1502  LS  1507
             LS
Sbjct  479   LS  480



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 379/479 (79%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+       H VCIPFPAQGHINPMLKLAK+L+ KG FH+TFVN+E+NH+RLL++RGP
Sbjct  1     MGSLDITKNLSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPV  427
              S+ GLPSFRFETIPDGLP SDVD TQDI +LCES    C   FK L+++LN +   PPV
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FTLDAA+E  IPE+LFWT  A GF+ ++ YR +I++G +PLKDSSY  NG
Sbjct  121   TCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DWV G+  +RL+D+PSFIRTTNP+D ++ ++    +RA+ ASAI+ NTFD LE 
Sbjct  181   YLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L    S+LPPVY+ GP     + V +  + ++G +LWKE+  C+EWLN+ +P SVVYV
Sbjct  241   DVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++Q++EFAWGL+N+K PFLW+IRPDLV+GE AVLP EF+EET+ RG+L+SW
Sbjct  301   NFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE+V+ H ++GGFLTH+ WNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIG+EI
Sbjct  361   CPQEEVLGHSSIGGFLTHNDWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + D KR ++E LV+ELM GEKG EM+ KA++ KKLA +AA+ P GSS+ N+E +I+  L
Sbjct  421   E-DAKRDKIEILVKELMEGEKGKEMKEKALQWKKLAHNAASGPHGSSFMNLENLIHDVL  478



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/480 (63%), Positives = 375/480 (78%), Gaps = 24/480 (5%)
 Frame = +2

Query  101   LKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSF  280
             LKPHAVCIPFPAQGHINPMLKLAK+L++ GFHITFVN+E+NH RLL+SRGP+S+ GLPSF
Sbjct  8     LKPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSF  67

Query  281   RFETIPDGLPPSD-----VDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSC  433
             RFETIPDGLPP        DATQDI +LCES T  CL PF++L+A+LN +     PPVSC
Sbjct  68    RFETIPDGLPPPSEDDADADATQDIPSLCESTTTTCLAPFRNLLAKLNDTASSEVPPVSC  127

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FT DAAEE  IPE+LFWT  A GF  +  Y  V  K ++PL D+S F NGYL
Sbjct  128   IVSDGVMSFTADAAEELAIPEVLFWTTSACGFYAYTQYEYVFQKEYAPLADASCFTNGYL  187

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +TV++ +  M G+R+RD+PSF+RTTN DD +V++I    +RAK ASAI++NTF+ LE++ 
Sbjct  188   ETVIEGIPSMEGIRMRDMPSFVRTTNEDDFMVQFIFAEMKRAKRASAIVLNTFEELERDT  247

Query  794   LNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
             ++ L S+LPP+Y  GP    E  V ED G++ LG +LWKED  C++WL+T +P SVVYVN
Sbjct  248   IDALSSILPPIYPIGPLNLIENLVIEDEGLKELGSNLWKEDQECLKWLDTREPNSVVYVN  307

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGSITVMT DQL EFAWGLAN+K+PFLW+           VLPR F+EET+ERGMLA+WC
Sbjct  308   FGSITVMTPDQLNEFAWGLANSKQPFLWV-----------VLPRGFLEETKERGMLANWC  356

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
             PQE+V+SH +VGGFLTHSGWNSTLESICSGVPMICWPFFA+QQTNCWYCCT+WG+GMEID
Sbjct  357   PQEKVLSHSSVGGFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEID  416

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSP  1510
             +DVKR  VE LV +LM GE+G +MR KA+E K LA D+A    GSSY N++++I++ L P
Sbjct  417   SDVKRNGVETLVTKLMIGEEGRQMRNKAVEWKNLARDSA---EGSSYRNLKKLIDQVLLP  473



>ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48521.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/470 (64%), Positives = 375/470 (80%), Gaps = 4/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K HAVCIP+PAQGHINPMLKLAK L HKGFHITFVNSE+NHRRLL+SRGP+S+ GL SFR
Sbjct  9     KSHAVCIPYPAQGHINPMLKLAKFLYHKGFHITFVNSEYNHRRLLKSRGPDSLDGLSSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN---QSGPPVSCIVSDGGM  454
             FETIPDGLPP+D DATQDI +LC S    CL  FK+++++LN    S PPVSCI+SDG M
Sbjct  69    FETIPDGLPPTDTDATQDIPSLCVSTKNACLPHFKNVLSKLNDTPSSVPPVSCIISDGVM  128

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTLDAA+E GIPE+LFWT  A GFL ++ Y  +I KG++PLKD S   NGYLDTV+DW+
Sbjct  129   SFTLDAAQELGIPEVLFWTTSACGFLAYLHYHQLIKKGYTPLKDESSLTNGYLDTVIDWI  188

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
              G   +RL+D+PSF+RTTNP+D ++ ++V  TERA+ ASAI++NTFDALE + L    S+
Sbjct  189   PGTKDIRLKDIPSFVRTTNPEDIMLNFLVSETERAQKASAIILNTFDALEHDVLAAFPSL  248

Query  815   LPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             +PPVY+ G  Q     ++D+ ++ +G +LWKE+T C+EWL++ +P SVVYVNFG ITVMT
Sbjct  249   IPPVYSVGSLQLLLNNIKDNDLKLIGSNLWKEETGCLEWLDSKEPNSVVYVNFGCITVMT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             + QL EFAWGLAN+ K FLW+IRPDLV G  A LP EFV  TRERG+L SWCPQEQV++H
Sbjct  309   SAQLGEFAWGLANSDKTFLWVIRPDLVDGNTAALPPEFVSMTRERGLLPSWCPQEQVLNH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             P++GGFLTHSGWNSTLESIC GVPMICWPFFA+QQTNC Y C +WGIGMEI++DVKR EV
Sbjct  369   PSIGGFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCKYTCNEWGIGMEINSDVKRNEV  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LV ELM G+KG  M++KAME K++AE+A +   GSSY N++ +I + L
Sbjct  429   ESLVIELMDGDKGKAMKKKAMEWKRIAEEAVST-KGSSYQNLDNMIKQVL  477



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/480 (61%), Positives = 375/480 (78%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M S++ E   PHAVC+PFPAQGHINPMLKLAKIL+ K FHITFVN+EFNHRRLL+SRG  
Sbjct  1     MVSLATEEFPPHAVCLPFPAQGHINPMLKLAKILHRKDFHITFVNTEFNHRRLLKSRGLG  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+ GLP+FRFETIPDGLPPSD D+TQ + +LC+S  +NCL PF+DL++RLN +     PP
Sbjct  61    SLDGLPTFRFETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             V+CIVSD  M FTL AA+E GIP +LFWT    GF+ ++ YR +I+KGF PLKD SY  N
Sbjct  121   VTCIVSDCIMSFTLKAAQELGIPNVLFWTASVCGFMSYLQYRPLIEKGFVPLKDESYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTV+DW+ GM G+ L+ LPSF+RTT+  D ++ + +   E A++ASA++ NTFD LE
Sbjct  181   GYLDTVIDWIPGMEGISLKYLPSFLRTTDSGDIMLNFAIGEVESARNASAVIFNTFDDLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L S LP +Y  GP Q  E Q +++ + ++  +LWKE+  C+EWL+  +P SV+Y
Sbjct  241   SEVLKPLTSTLPHLYTIGPLQLLENQDQENALNSIASNLWKEEPGCIEWLDFKEPDSVIY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGS+TVMT  QL+EFAWGLAN+K  FLW+IRPDLV G+ A++P EFV ET+ERG+LA 
Sbjct  301   VNFGSVTVMTPQQLIEFAWGLANSKCTFLWVIRPDLVVGDSAIVPPEFVAETKERGLLAG  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV+ HP++GGFLTHSGWNSTL+S+C GVPMICWPFFA+QQTNCW+CC + GIGME
Sbjct  361   WCPQEQVLQHPSIGGFLTHSGWNSTLDSLCGGVPMICWPFFAEQQTNCWFCCNKLGIGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID+DVKR E+E LVRELM G++G  M+ KA + K+  E+A  +PTGSS  N+E++INK L
Sbjct  421   IDSDVKRNEIESLVRELMEGDQGQVMKYKAKKWKRKVEEATASPTGSSCLNLEKMINKVL  480



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/473 (63%), Positives = 371/473 (78%), Gaps = 6/473 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAK+L+HKGFHITFVN+E NH+RLLRS+GP S+ GLP FR
Sbjct  16    KPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPHFR  75

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARL---NQSG--PPVSCIVSDG  448
             F+ IPDGLPPSD D+TQDI +LC S++++ L  F+ L+ +L   +Q G  PPV+ IVSDG
Sbjct  76    FDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLQDQSQDGVVPPVTRIVSDG  135

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FT+DAAEE  IPE++FW   A G  G   YR +++ GF+PLKD +YF NGYL+T++ 
Sbjct  136   LMAFTVDAAEELKIPEVVFWPPSACGLFGCTKYRRLVEDGFTPLKDPTYFSNGYLETMVS  195

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W  GM  +RLRD P+FIRT +  D ++ +I+   ER+  ASAI++NTFD LE + L  L 
Sbjct  196   WTSGMKSIRLRDFPTFIRTLDHQDILLNFIIQEVERSSRASAIILNTFDTLEHDVLESLS  255

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             S+ P +Y  GP Q    Q++D  +R++G SLW+E+  C+ WL++ +P SVVYVNFGSITV
Sbjct  256   SVFPHIYTIGPLQLLADQIQDEALRSVGGSLWREEPECLPWLDSKEPGSVVYVNFGSITV  315

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             MTA QL+EFAWGLAN++KPFLWIIRPDLV+ E AVLP EF+EE   RGMLA WC QE+V+
Sbjct  316   MTAGQLIEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWCRQEEVL  375

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
              H A+GGFLTHSGWNSTLES+CSGVP+ICWPFF DQQTNC Y CT+WGIGMEID DVKR 
Sbjct  376   KHQAIGGFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEIDNDVKRD  435

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLS  1507
             EVE LVRELM GEKG EMR+KAME K  AE+ A  P+G+SYNN++++I++ LS
Sbjct  436   EVEGLVRELMEGEKGKEMRKKAMEWKAKAEE-AIMPSGTSYNNVDKLISEVLS  487



>emb|CDP01087.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/480 (64%), Positives = 375/480 (78%), Gaps = 8/480 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI+    KPHAVCIP  AQGHINPMLKLAK+L+H GFHITFVN+EFNHRR L+SRGP+
Sbjct  1     MGSIALLEKKPHAVCIPAAAQGHINPMLKLAKLLHHNGFHITFVNTEFNHRRWLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             ++ GLP F+F+ IPDGLPPSD DATQD A LCES+ + CLGPF++L+A LN +     PP
Sbjct  61    ALNGLPDFQFKAIPDGLPPSDADATQDPAALCESVDRTCLGPFRELLAELNDTSSSKVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSD    FTL AAEE  IPE+LFWT  A  +LG+  Y  +++KG  PLKD+SY  N
Sbjct  121   VSCIVSDAITAFTLAAAEELCIPEVLFWTASACSYLGYFQYAKLMEKGIIPLKDASYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLD VLDW+ G+ G+RL+DLPSF+RTTNPDD +VK+ +  T+RA+ ASAI++NT+  LE
Sbjct  181   GYLDAVLDWIPGLEGIRLKDLPSFLRTTNPDDFMVKFGMQETQRARKASAIIINTYQQLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
                L+ L S LPP+Y  GP  F E  V D+ +  +  +LWKE+  C+EWL++ DP SVVY
Sbjct  241   HGVLDALSSYLPPIYTIGPLHFLENHVHDNSLTDVQSNLWKEEPKCLEWLDSKDPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSI VMT +QLVEFAWGLAN+K+ FLWI+RPDLVSG  A+LP EF+EET+ER M A 
Sbjct  301   VNFGSIAVMTPEQLVEFAWGLANSKQNFLWILRPDLVSGSSAILPSEFLEETKERSMFAG  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V+SHP+VGGFLTHSGWNST+ESI  GVPMICWP FADQQTNCW+CCT+WGIGME
Sbjct  361   WCAQEKVLSHPSVGGFLTHSGWNSTIESISYGVPMICWPCFADQQTNCWFCCTKWGIGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVERLV ELM GEKG EM++KAM+ KKLAE A T     S  N+E +I++ L
Sbjct  421   IDNNVKRDEVERLVSELMAGEKGKEMKKKAMDWKKLAETAVT----DSKLNLENLIHQVL  476



>ref|XP_004252532.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=484

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/481 (64%), Positives = 386/481 (80%), Gaps = 7/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M S + E  KPHAVC+P+PAQGHINPMLKLAKIL+HKGFHITFVN+EF HRRLL+SRGP 
Sbjct  1     MSSNNVEINKPHAVCVPYPAQGHINPMLKLAKILHHKGFHITFVNTEFIHRRLLKSRGPH  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----P  421
             S++ L SFRFETIPDGLP  D DATQDI ++C+S T+ CL PF+DL+A+LN +      P
Sbjct  61    SLECLSSFRFETIPDGLPTCDADATQDIPSVCKSTTETCLAPFRDLLAKLNGTSNTSNVP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PV+CIVSDG M FTL AA+E  +PE+  WT  A GFLG++ Y  +I+KG+ PLKD SY  
Sbjct  121   PVTCIVSDGIMSFTLAAAQELAVPEVQLWTTSACGFLGYMHYTTLIEKGYIPLKDVSYLT  180

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             +GYL+T LD + GM  VRLRDLP+F+RTTN DD + K+++  T RA++ASAI++NTF+ L
Sbjct  181   DGYLETTLDCIPGMKDVRLRDLPTFLRTTNSDDFMFKFVLQETVRARNASAIIMNTFETL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E E L  L+++LPPVY  GP     + V+D  ++ LG SLWKE++ C++WL+T +P SVV
Sbjct  241   ESEVLESLRTLLPPVYPIGPLHLLVKHVDDENLKGLGSSLWKEESECIQWLDTKEPNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVN+G+ TVMT DQL+EFAWGLAN+++ FLWIIRPD+VSG  ++LP EFVEET+ +GMLA
Sbjct  301   YVNYGTTTVMTPDQLIEFAWGLANSQQEFLWIIRPDIVSG--SILPPEFVEETKNKGMLA  358

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWC Q++V++HPA+GGFLTHSGWNSTLESI SGVPM+CWPFFA+QQTNCWY  T+W IGM
Sbjct  359   SWCSQKEVLNHPAIGGFLTHSGWNSTLESITSGVPMLCWPFFAEQQTNCWYSETKWSIGM  418

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR EVE LVRELM GEKG +M++KAME KKLAE +A  PTGSSY N+E+V+N  
Sbjct  419   EIDNNVKRDEVESLVRELMVGEKGKKMKKKAMEWKKLAEISAQKPTGSSYMNIEKVVNDV  478

Query  1502  L  1504
             L
Sbjct  479   L  479



>ref|XP_004305885.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/467 (62%), Positives = 364/467 (78%), Gaps = 1/467 (0%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFP QGHI P+LK AK+L+H+GF ITFVN+E+NHRR L+S GP ++ GL  F 
Sbjct  9     KPHAVCIPFPYQGHIKPLLKFAKLLHHRGFRITFVNTEYNHRRFLKSLGPNTLDGLTDFH  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCIVSDGGMFFT  463
             FETIPDGLPPSD D+TQDI  +C+SI +N L PF+DL+ RLN S  PVSCIVSDG M F+
Sbjct  69    FETIPDGLPPSDSDSTQDITAICDSINKNFLAPFRDLLTRLNSSTFPVSCIVSDGFMSFS  128

Query  464   LDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGM  643
             +DAA++  +P +LF+   A GF+GF  YR +++KGF+P+KD     NGYLDTV+DW+ GM
Sbjct  129   VDAAQDLRLPIVLFFPVAANGFMGFKQYRALVEKGFAPIKDEKCLSNGYLDTVIDWIPGM  188

Query  644   PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPP  823
               +RL+DLPSF RTT+P+D         T+RA  ASA++++TFDALE++ L+ L  MLP 
Sbjct  189   KDIRLKDLPSFFRTTDPNDSPFVLTGEATQRAHKASAVVIHTFDALERDVLDALSFMLPH  248

Query  824   VYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQ  1003
             VYA GP Q    Q+ +  + ++G SLWKEDT C+ WLN   P SVVYVNFGS+ VMT + 
Sbjct  249   VYAIGPLQLLLNQIPEDPLESMGYSLWKEDTECLPWLNAKAPNSVVYVNFGSVVVMTPEH  308

Query  1004  LVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAV  1183
             LVEF WGLAN+K PFLW+IRPDLV GE A+LP EFV ET+ RG++ASWCPQE+V++HP+V
Sbjct  309   LVEFGWGLANSKHPFLWVIRPDLVVGESAILPPEFVAETKGRGIIASWCPQEEVLNHPSV  368

Query  1184  GGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERL  1363
             GGFLTH+GWNST+ES+ +GVPM+CWPFFA+QQTNCWY C   GIGMEID +VKR EVE+L
Sbjct  369   GGFLTHNGWNSTIESVTAGVPMLCWPFFAEQQTNCWYVCNGLGIGMEIDNNVKRDEVEKL  428

Query  1364  VRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VRELM G+ G EMR KA  LKKLAE+AA  P GSSY N+++V+N+ L
Sbjct  429   VRELMEGQNGEEMRNKANVLKKLAEEAAD-PQGSSYKNLDKVVNQVL  474



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/482 (61%), Positives = 372/482 (77%), Gaps = 6/482 (1%)
 Frame = +2

Query  77    MGSISG-EGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MG ++G    KPHAVC+P+PAQGHINPMLK+AK+L+ +GFH+TFVN+EFNHRRLLRSRGP
Sbjct  1     MGLVAGFSSQKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTEFNHRRLLRSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PP  424
              ++  LPSFRFETIPDGLP ++VDATQDI  LC+S  +NCL PFK+L+ R+N +G   PP
Sbjct  61    HALDKLPSFRFETIPDGLPETEVDATQDIPALCDSTRKNCLAPFKELLRRINLAGGEIPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSC+VSDG M FTLDAAEE G+PE+LFWT  A GF  ++ Y  +++KG  PLKD SY  N
Sbjct  121   VSCVVSDGCMSFTLDAAEELGVPEVLFWTTSACGFWAYLHYYQLVEKGLVPLKDESYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDT +DWV  +   RL+D P+F+RTTN DD ++++++  T RAK ASAI++NTF  LE
Sbjct  181   GYLDTEIDWVPSLKNFRLKDFPTFVRTTNTDDVMLRFVIRETHRAKRASAIILNTFHDLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
              + +  +QS+LPPV+  GP      +   +DS +  LG +LWKEDT C+ WL+   P SV
Sbjct  241   HDVIRSMQSILPPVHPVGPLHLLVNREIDKDSEIGRLGSNLWKEDTECLAWLDAKAPNSV  300

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSITVM+  QLVEFAWGLA ++K FLW+IRPDLV G+ AV+P EF+ ET +RGML
Sbjct  301   VYVNFGSITVMSEKQLVEFAWGLAGSRKEFLWVIRPDLVGGDAAVVPPEFMAETADRGML  360

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             A+WCPQE+V+SHPAVGGFLTH+GWNST+ESI  GVPMICWPFFA+QQ NC +CC +WG G
Sbjct  361   ANWCPQEEVLSHPAVGGFLTHNGWNSTIESISGGVPMICWPFFAEQQMNCKFCCDEWGTG  420

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
              EI  DVKR EVE +VRELM GE G +MR KA E ++ AE +  AP+GSS+ N E V+++
Sbjct  421   KEIGGDVKRGEVEAVVRELMDGEMGKKMRNKAEEWRRSAEASVAAPSGSSFVNFEAVVDR  480

Query  1499  FL  1504
              L
Sbjct  481   VL  482



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/480 (60%), Positives = 374/480 (78%), Gaps = 4/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M S++ E   PH VC+PFPAQGHINPMLKLAKIL+ K FHITFVN+EFNHRRLLRSRG +
Sbjct  1     MVSLATEKCPPHVVCLPFPAQGHINPMLKLAKILHQKDFHITFVNTEFNHRRLLRSRGLD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+ GL +FRFETIPDGLPPSD D+TQ + +LC+S  +NCL PF+DL++RLN +     PP
Sbjct  61    SLDGLSTFRFETIPDGLPPSDADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             V+CIVSD  M FTL AA+E GIP + FWT    GF+ ++ YR +I+KG+ PLKD SY  N
Sbjct  121   VTCIVSDCIMSFTLKAAQELGIPNVFFWTASVCGFMSYLQYRPLIEKGYVPLKDESYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTV+DW+ GM G+ L+ LP+FIRTT+P D ++ + +   E A++ASA+++NTFD LE
Sbjct  181   GYLDTVIDWIPGMEGISLKYLPTFIRTTDPGDIMLNFAIGEVESAQNASAVILNTFDDLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              E L  L S LP +Y  GP Q  E Q +++ + ++  +LWKE+   +EWL+  +P SV+Y
Sbjct  241   SEVLKPLTSTLPHLYTIGPLQLLENQDQENALNSIASNLWKEEPGFIEWLDFKEPHSVIY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT  QL+EFAWGLAN+   FLW+IR DLV G+ A++P EFV ET+ERG++A 
Sbjct  301   VNFGSITVMTPQQLIEFAWGLANSMCTFLWVIRSDLVVGDSAIVPPEFVAETKERGLVAG  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+ HP++GGFLTHSGWNSTL+S+C GVP+ICWPFF++QQTNCW+CC + GIGME
Sbjct  361   WCPQERVLQHPSIGGFLTHSGWNSTLDSLCCGVPVICWPFFSEQQTNCWFCCNKLGIGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID+DVKR E+E LVRELM G++G  M+ KA E K+ AE+AA +PTGSS  N+E++INK L
Sbjct  421   IDSDVKRNEIESLVRELMEGDQGQVMKYKAKEWKRKAEEAAASPTGSSCLNLEKMINKVL  480



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/472 (62%), Positives = 363/472 (77%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQ HIN ML LAK+L+ +GFH+TFVN+E+NH RLLRSRGP S+  LPSFR
Sbjct  9     KPHAVCIPFPAQSHINAMLNLAKLLHDRGFHVTFVNTEYNHNRLLRSRGPSSLDSLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             F TIPDGLPPSD DATQDI  LC+S  + CL  F+DL+ RL++       PPVSC+VSD 
Sbjct  69    FRTIPDGLPPSDGDATQDIPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCVVSDV  128

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
                FTLDAAE  G+PE+LFW   A  F+GF+ +R +ID+G +PLKD+SY  NGYLDT++D
Sbjct  129   STTFTLDAAEAVGVPEVLFWPISACAFMGFLQFRSLIDEGLAPLKDASYLTNGYLDTIID  188

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM  +RLRDLPSFIRTT+PDDP++ + ++   RAK ASA + NTF+ LE E L  L+
Sbjct  189   WIPGMRNIRLRDLPSFIRTTDPDDPMLNFCLVEFARAKRASAWVFNTFERLEHEVLEALK  248

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             +M PP+Y  GP     +Q+ D   R +  +LWKED  C+EWL+   P SVVYVNFGSITV
Sbjct  249   AMFPPIYTIGPIHLLLEQLSDDDTRLIRFNLWKEDLGCLEWLDLKPPGSVVYVNFGSITV  308

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M+  QLVEFAWGLAN+ + FLW+IRPDLV G  A+LP +F+  TRER +L SWCPQE+V+
Sbjct  309   MSPAQLVEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQERVL  368

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             SH AVGGFLTH GWNS +ESI + VP+ CWPFFADQQTNC Y C +WGIGMEID+DV+R 
Sbjct  369   SHSAVGGFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVRRD  428

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVER VRELM GE+G EM+RKAME K++A + AT P+GSS+ N++EVI+K L
Sbjct  429   EVERQVRELMEGERGKEMKRKAMEWKEMARE-ATCPSGSSFLNLDEVIDKVL  479



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/469 (62%), Positives = 375/469 (80%), Gaps = 8/469 (2%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PH VCIP+PAQGH+NPM  LAK+L+HKGF++TFV +EFN++RLLRSRGP S+ GLPSFRF
Sbjct  12    PHVVCIPYPAQGHVNPMTNLAKLLHHKGFYVTFVYTEFNYKRLLRSRGPNSLDGLPSFRF  71

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMFF  460
             E+IPDGLP SD DATQDI +LCES ++NCL PF+ L+++LN S   PPVS IVSDG M F
Sbjct  72    ESIPDGLPESDADATQDIPSLCESTSKNCLAPFRQLLSKLNSSPDIPPVSSIVSDGAMTF  131

Query  461   TLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL-DTVLDWVK  637
             TL+AA E G+PE++ WT  A GFL ++ YR +I+KG +PLKD+SY  NGYL +TV++ + 
Sbjct  132   TLEAARELGVPEVVLWTTSACGFLAYLNYRQLIEKGVTPLKDASYMTNGYLENTVINSIP  191

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  +RLRD PSF+RTT+PDD ++ ++ + ++RAK ASA+++NTFD LE++ L+ L S+L
Sbjct  192   GMKDMRLRDFPSFVRTTDPDDIMLNFLDVESQRAKQASAVVLNTFDDLEKDVLDSLSSIL  251

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PPVY  GP      Q+ D  VR++G +LWKED  C+EWLN+  P SVVYVNFGSITVMT+
Sbjct  252   PPVYTVGPLALLVNQIPDKNVRSIGSNLWKEDPYCLEWLNSKKPSSVVYVNFGSITVMTS  311

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
             +QLVEFAWGLAN++K FLWIIRPDLV G+ A++P EFV ET++RG++ SWCPQEQV+ HP
Sbjct  312   EQLVEFAWGLANSQKTFLWIIRPDLVVGDAAIVPPEFVSETKDRGLMPSWCPQEQVLGHP  371

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             A+GGFLTH GWNST+ESI  GVP+ICWPFFA+QQTNC YCC  WGIGMEI+ +V+R  +E
Sbjct  372   AIGGFLTHCGWNSTIESISCGVPVICWPFFAEQQTNCRYCCRAWGIGMEIE-NVERGNIE  430

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             RLVR+LM GEKG EM+++AME KK  ED+      SS  N++++I + L
Sbjct  431   RLVRKLMDGEKGKEMKKRAMEWKKSTEDS----IASSQLNLDKMIEQVL  475



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 380/488 (78%), Gaps = 15/488 (3%)
 Frame = +2

Query  77    MGSI-SGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS+   E  KPHAVCIP+PAQGHI PMLKLAK+L+H+GFH+TFVN+E+NH RL +S   
Sbjct  1     MGSMGHSEKPKPHAVCIPYPAQGHITPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             ++V  LPSFRF TIPDGLPP+D D TQDI +LCES  + CL  FK+L+A+LN        
Sbjct  58    QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  419   -PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPVSC+VSDG M FTLDAAEE G+PE+LFWT  A GFLG++ YR +ID+G  PLKD SY
Sbjct  118   VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLKDESY  177

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSA--SAIMVNT  769
               NGYLDTV+DW+  M  ++L+DLP+F+RTTNPD+ +V++++  TER++S   +AI++NT
Sbjct  178   LTNGYLDTVIDWIPAMSNIKLKDLPTFLRTTNPDEFMVEFVLGETERSRSPKPAAIILNT  237

Query  770   FDALEQEALNGLQSMLP-PVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNT  940
             FDALE + L  L +ML  PVY+ GP Q    +Q + D  V+ +  SLWKE++ C++WL T
Sbjct  238   FDALEHDVLASLSNMLAKPVYSIGPLQLLANDQTITDPSVKNISSSLWKEESECLDWLET  297

Query  941   NDPISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEET  1120
                 SVVYVNFGSITVMT DQLVEFAWGLAN+KK FLW+IRPDLV+GE AVLP EFV +T
Sbjct  298   KPKNSVVYVNFGSITVMTNDQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKT  357

Query  1121  RERGMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCC  1300
             R+RG+LASWCPQEQV++H +V GFLTH+GWNSTLES+ +GVPMICWPFFA+QQTNCW+ C
Sbjct  358   RDRGLLASWCPQEQVLNHESVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFAC  417

Query  1301  TQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNM  1480
              +WG+GMEI++DVKR EVE  VREL+ G KG EMR+KA E K++A +A T   GSS+  +
Sbjct  418   NEWGVGMEINSDVKRDEVEAQVRELVDGRKGGEMRKKAAEWKRIAAEAVTGGGGSSFAGL  477

Query  1481  EEVINKFL  1504
             + +I + L
Sbjct  478   DSLIERVL  485



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/476 (61%), Positives = 376/476 (79%), Gaps = 4/476 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+       H VCIPFPAQGHINPMLKLAK+L+ KG FH+TFVN+E+NH+RLL++RGP
Sbjct  1     MGSLDITKNPSHVVCIPFPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKARGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPV  427
              S+ GLPSFRFETIPDGLP SDVD TQDI +LCES    C   FK L+++LN +   PPV
Sbjct  61    NSLNGLPSFRFETIPDGLPESDVDVTQDIPSLCESTRATCSPHFKKLLSKLNNAIDTPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FTLDAA+E  IPE+LFWT  A GF+ ++ YR +I++G +PLKDSSY  NG
Sbjct  121   TCIVSDGCMSFTLDAAQELNIPEVLFWTTSACGFMCYMQYRKLIEEGLTPLKDSSYITNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DWV G+  +RL+D+PSFIRTTNP+D ++ ++    +RA+ ASAI+ NTFD LE 
Sbjct  181   YLETTIDWVPGIKEIRLKDIPSFIRTTNPNDIMLDFLRGECQRAQKASAIIFNTFDNLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L    S+LPPVY+ GP     + V +  + ++G +LWKE+  C+EWLN+ +P SVVYV
Sbjct  241   DVLEAFSSILPPVYSIGPLHLLIKDVTNKELDSIGSNLWKEEPECLEWLNSKEPNSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT++Q++EFAWGL+N+K PFLW+IRPDLV+GE AVLP EF+EET+ RG+L+SW
Sbjct  301   NFGSITVMTSEQMIEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE+V+ H ++GGFLTH+GWNSTLES+C GVPMICWPFF +QQTNC +CC +WGIG+EI
Sbjct  361   CPQEEVLGHSSIGGFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             + D KR ++E  V+ELM GEKG EM+ KA++ KKLA +AA  P GSS+ N+E +I+
Sbjct  421   E-DAKRDKIEIFVKELMEGEKGKEMKEKALQWKKLAHNAAFGPHGSSFMNLENLIH  475



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/470 (63%), Positives = 378/470 (80%), Gaps = 10/470 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAK+L++KGFHIT+VNSEFN +RLL+SRGP S+ GLPSFR
Sbjct  9     KPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITYVNSEFNLKRLLKSRGPNSLDGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPP+D +ATQDI +LC+S  +  L  F+DL+++LN S   PPVSCIVSDG M 
Sbjct  69    FETIPDGLPPTDANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSPDCPPVSCIVSDGAMG  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA+EFG+PE+LFWT  A GFL +V Y  +I+K      D+SY  NGYL+T +DW+ 
Sbjct  129   FTLDAAQEFGLPEVLFWTTSACGFLAYVHYHRLIEK------DASYLTNGYLETEIDWIP  182

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM G+RL+D+PSFIRTT+PDD ++ + V  TER + ASA++ NTF   E E L+ L ++L
Sbjct  183   GMRGIRLKDIPSFIRTTDPDDIMLDFWVHETERTRKASAVIFNTFHDFEHEVLDALSTLL  242

Query  818   PPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PP+Y+ GP      Q+  DS ++ +  +LW E+  C+EWLN+ +P SVVYVNFGSITVMT
Sbjct  243   PPIYSIGPLHLQINQIPADSELKEIRSNLWTEEPECLEWLNSKEPNSVVYVNFGSITVMT  302

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             A+QL+EFAWGLAN+ + F W+IRPDLV G+ AV+P EFVEET+ER +LA+WCPQEQV+SH
Sbjct  303   AEQLIEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQVLSH  362

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PAVGGFLTHSGWNST+ES+C+GVPMICWPFFA+QQTNC Y   +WGI MEI++DVKR  V
Sbjct  363   PAVGGFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIDMEIESDVKRNHV  422

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR+LM G++G EMR+KA+E KKLA + AT+P GSS+  +++++N+ L
Sbjct  423   EGLVRKLMEGDEGKEMRKKALEWKKLATE-ATSPNGSSFVGLDKMVNEVL  471



>ref|XP_009391314.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/471 (63%), Positives = 359/471 (76%), Gaps = 4/471 (1%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PHAVCIP+PAQGHI PMLKLAK+L+ KGF ITFVN+E+NHRRLL +RGP ++ GLP FRF
Sbjct  9     PHAVCIPYPAQGHITPMLKLAKLLHSKGFRITFVNTEYNHRRLLNARGPSALDGLPDFRF  68

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PPVSCIVSDGGMF  457
             ETIPDGLPPSD DATQDI  LC S    CL PF DL++ LN      PPVSCIVSDG M 
Sbjct  69    ETIPDGLPPSDDDATQDIPALCRSTMTTCLPPFLDLLSELNDPSSERPPVSCIVSDGVMS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA + GIPE+LFWT  A GF+G++ YR ++++G +PLKD     NGYLDT +DWV 
Sbjct  129   FTLDAARQLGIPEVLFWTTSACGFMGYIHYRHLVERGLTPLKDVDELTNGYLDTPVDWVP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  +RLRD PSFIRTT+P+D ++  ++  T RA  ASAI++NTFD LE   LN + ++L
Sbjct  189   GMKNMRLRDFPSFIRTTDPNDTMLHILMAETGRASMASAIVLNTFDELESSVLNAMAAIL  248

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PP+Y  GP Q    Q+  S + A+G +LWKE+ +C+ WL    P SVVYVNFGSITVMT 
Sbjct  249   PPMYTVGPLQLLTSQIPPSPLDAMGSNLWKEEPACLRWLQGKKPGSVVYVNFGSITVMTN  308

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
              QL+EFAWGLAN+   FLWI+RPDLV GE AVLP+EF  ET+ERG+LASWCPQE+V++ P
Sbjct  309   QQLIEFAWGLANSGYEFLWIVRPDLVKGESAVLPQEFTVETKERGLLASWCPQEEVLAQP  368

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             AVGGFLTHSGWNSTLESICSGV M+ WPFFA+QQTNC Y C +WG GMEID+DVKR  VE
Sbjct  369   AVGGFLTHSGWNSTLESICSGVSMLSWPFFAEQQTNCRYVCVEWGSGMEIDSDVKREVVE  428

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSP  1510
              L+RELMGGEKG EM+R+  E K+ A  AA  P GSS  N+E ++ + L P
Sbjct  429   GLIRELMGGEKGKEMKRRMTEWKEAAGRAA-QPGGSSSANLERMVKEVLLP  478



>ref|XP_008386105.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/479 (60%), Positives = 382/479 (80%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS  G   KPHAV IP+PAQGHINPML+LAK+LN+KGFHITFVN+EFNHRRLL++RGP 
Sbjct  1     MGS-KGMIEKPHAVFIPYPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHRRLLKARGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GLPSFRFETIPDGLP +DV+ATQDI  LC S  +NCL PFKDL+++LN   + PPV+
Sbjct  60    SLDGLPSFRFETIPDGLPTTDVNATQDITALCFSTRKNCLEPFKDLLSKLNSLPNSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDGGM FTL+AA+E GIP ++F T  A G +G++  R +I+KG  PLKD+SY  NGY
Sbjct  120   CIVSDGGMTFTLEAAQELGIPVVIFATASACGLMGYLQLRPLIEKGLIPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM G+RLRD+P+FIRTT+P+D +++++ +   R   ASA ++NTF A E E
Sbjct  180   LDTVIDWIPGMRGIRLRDIPTFIRTTDPNDIMLEFLRVEIGRYHRASAFILNTFYAFEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+ L ++LPP+Y+ GP      Q+  ++ ++++G +LW E+  C+EWL++ +P SVVYV
Sbjct  240   VLDALSTLLPPIYSVGPLHLQLNQIPAENELKSIGSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITV+T +QL EFAWGLAN+ + FLW+IRPDL+ GE AV+P EF EET+ER ++ASW
Sbjct  300   NFGSITVLTEEQLTEFAWGLANSNQTFLWVIRPDLLVGESAVVPSEFSEETKERSLVASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQ++V+SHPA+GGFLTHSGWNS LES+C GVPMICWPFFA+QQ NC + C  WGIGMEI
Sbjct  360   CPQQEVLSHPAIGGFLTHSGWNSILESLCGGVPMICWPFFAEQQMNCRFSCKVWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  +E LVR++M GE+G EMR+KA+E KKLA +A T+P G+S+ +++ + ++ L
Sbjct  420   EGDVKRDYIEGLVRKIMEGEEGKEMRKKALEWKKLATEATTSPNGTSFVDLDRMASQVL  478



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 370/472 (78%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPMLKLAK+L+ KGFHITFVN+E+NHRRLL+SRG  S+ GLP F+
Sbjct  9     KPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGLPEFQ  68

Query  284   FETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGM  454
             F+TIPDGLPPSD+ DATQDI +LC+  +  CL PF+DLIA+LN S   P V+CI+SD  M
Sbjct  69    FKTIPDGLPPSDIADATQDIPSLCDCTSTTCLAPFRDLIAKLNSSSIVPQVTCIISDACM  128

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTLDAAEEFGIPE LFWT  A G LG+  YR +I++G +PLKD++   NGYL+T +DW+
Sbjct  129   SFTLDAAEEFGIPEALFWTPSACGVLGYAQYRSLIERGLTPLKDATDLTNGYLETSIDWI  188

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
              GM  +RLRDLPSF+RTT+ +D ++ + +   +R   ASA+++NTFD+ EQ+ L+ L  M
Sbjct  189   PGMKNIRLRDLPSFVRTTDINDFMLHFQIREIDRTSRASAVIINTFDSFEQDVLDALSPM  248

Query  815   LPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
              PP+Y  GP Q    Q+ +  ++ +G +LWK+   C+EWL++  P SVVYVNFGSITV+T
Sbjct  249   FPPIYTLGPLQLLVDQIPNGNLKNIGSNLWKDHPECIEWLDSKGPNSVVYVNFGSITVIT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
             A Q++EF+WGLAN+ KPFLWIIRPDL+ GE A+LP EF+  T++R +L SWCPQEQV+ H
Sbjct  309   AQQMIEFSWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWCPQEQVLKH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             P++GGF+ H GWNSTLESIC GVPMICWPFF +QQTNCW+ CT+WGIGMEI+ +VKR EV
Sbjct  369   PSIGGFVNHMGWNSTLESICGGVPMICWPFFGEQQTNCWFACTKWGIGMEIENNVKRDEV  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTG-SSYNNMEEVINKFLS  1507
             E+LVRELM GEKG +M+RKAME K  AE+AA   TG +S+ N++ ++    S
Sbjct  429   EKLVRELMEGEKGKDMKRKAMEWKTKAEEAAW--TGDASHRNLDRLVKVLAS  478



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/481 (62%), Positives = 367/481 (76%), Gaps = 7/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP PAQGHINPML LAK+L+ +GFH+TFVN+E+NH RLLRSRGP 
Sbjct  1     MGSIDMIQ-KPHAVCIPAPAQGHINPMLNLAKLLHCRGFHVTFVNTEYNHSRLLRSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----P  421
             S+ GLPSFRF TIPDGLPPSD D TQDI  LC+S  + CL  F+DL+ RLN+       P
Sbjct  60    SLDGLPSFRFRTIPDGLPPSDGDTTQDIPALCQSTQRCCLPYFQDLLKRLNEESATSGSP  119

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PVSC+VSD  M FTLDAAE  G+PE+LFW   A  F+GF+ +R +IDKG  PLKD+SY  
Sbjct  120   PVSCVVSDITMTFTLDAAEAIGVPEVLFWPISACAFMGFLQFRSLIDKGLVPLKDASYLT  179

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             NG LDTV+DW+ GM  +RLRDLPSFIRTT+PDDP++ + ++   RAK ASA + NTF+ L
Sbjct  180   NGNLDTVIDWIPGMRNIRLRDLPSFIRTTDPDDPMINFCLVEFARAKRASAWVFNTFERL  239

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E E L  L++M PP+Y  GP     +Q+ D   R +  +LWKED  C+EWL++  P SV+
Sbjct  240   EHEVLEALKAMFPPIYTIGPIHLLLEQLSDDDTRLIRFNLWKEDLGCLEWLDSKPPSSVL  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITV++  QLVEFAWGLAN+ + FLW+IRPDLV G  A+LP +F+  TRER +LA
Sbjct  300   YVNFGSITVISPAQLVEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQE+V+SH AVGGFLTH GWNS +ESI + VP++CWPFFADQQTNC Y C +WGIGM
Sbjct  360   SWCPQERVLSHSAVGGFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID DV+R EVER VRELM G +G EM+RK ME K++A + AT P+GSS+ N++EVINK 
Sbjct  420   EIDNDVRRDEVERQVRELMEGGRGKEMKRKVMEWKEMARE-ATHPSGSSFLNLDEVINKV  478

Query  1502  L  1504
             L
Sbjct  479   L  479



>ref|XP_002525851.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36545.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/479 (61%), Positives = 374/479 (78%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  +  KPH VC+P+PAQGH+NPM+KLAK+L++  FH+TFVN+E+NHRRLL SRGP 
Sbjct  1     MGSIVRDHDKPHVVCVPYPAQGHVNPMVKLAKLLHYNDFHVTFVNTEYNHRRLLNSRGPS  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GLP FRFE I DGLPPSD +ATQDI +LC+S ++N L PF++L+ +L  S   PPV+
Sbjct  61    SLDGLPDFRFEAISDGLPPSDANATQDIPSLCDSTSKNSLAPFRNLLLKLKSSDSLPPVT  120

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CI+SD  M FTLDAAEEFGIPEILFWT  + G LG+  Y  +I+KG +PLKD+SY  NGY
Sbjct  121   CIISDACMSFTLDAAEEFGIPEILFWTPSSCGVLGYSQYHTLIEKGLTPLKDASYLTNGY  180

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T LDW+ GM  +R RDLPSFIRTT+ +D ++ ++V   ER   ASA++ NTF A E++
Sbjct  181   LETTLDWIPGMKDIRFRDLPSFIRTTDRNDIMLNFVVRELERTSRASAVVFNTFYAFEKD  240

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQVE-DSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+ L +M PP+Y+ GP Q    Q+  D  +  +G +LWKE   C++WL+T +P SVVYV
Sbjct  241   VLDVLSTMFPPIYSIGPLQLLVDQIPIDRNLGNIGSNLWKEQPECIDWLDTKEPNSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITV+T  Q++EFAWGLA++KKPFLWIIRPDLV GE A+LP EFV ET++RGMLASW
Sbjct  301   NFGSITVITPQQMIEFAWGLASSKKPFLWIIRPDLVIGENAMLPAEFVSETKDRGMLASW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
              PQEQ++ HPAVGGFL+H GWNSTL+S+  GVPM+CWPFFA+QQTNC + CT+WG+GMEI
Sbjct  361   GPQEQILKHPAVGGFLSHMGWNSTLDSMSGGVPMVCWPFFAEQQTNCRFACTEWGVGMEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D +VKR EV++LV  LM G+KG EM+ KAME K  AE+AA  P GSS+NN++ ++ KF+
Sbjct  421   DNNVKRDEVKKLVEVLMDGKKGKEMKSKAMEWKTKAEEAA-KPGGSSHNNLDRLV-KFI  477



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 384/477 (81%), Gaps = 3/477 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+ G   KPHAVCIP+PAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL++RGP+
Sbjct  1     MGSL-GTINKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSC  433
             S+ GL SFRFETIPDGLP +D+DATQDI +LCE+  + C   FK+L+A++N S  PPVSC
Sbjct  60    SLNGLSSFRFETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDAPPVSC  119

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTLDAAEE G+PE+LFWT  A GF+ +V Y+ +I+K  +PLKDSSY  NGYL
Sbjct  120   IVSDGVMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITNGYL  179

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T +DW+ G+  +RL+D+PSF+RTTNPD+ ++ +I     RA+ ASAI++NTFDALE + 
Sbjct  180   ETTIDWIPGIKEIRLKDIPSFVRTTNPDEFMLDFIQWECGRARRASAIILNTFDALEHDV  239

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L    S+LPPVY+ GP     + V+D  + A+G +LWKE++ CVEWL+T  P SVVYVNF
Sbjct  240   LEAFSSILPPVYSIGPLNLHVKHVDDKELNAIGSNLWKEESKCVEWLDTKQPSSVVYVNF  299

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSI VMT++QL+EFAWGLAN+ K FLW+IR DLV+GE AVLP EFV++T  RG+L+SWC 
Sbjct  300   GSIAVMTSEQLIEFAWGLANSNKNFLWVIRADLVAGENAVLPPEFVKQTENRGLLSSWCS  359

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV++HP+VGGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC  WGIG+EI+ 
Sbjct  360   QEQVLAHPSVGGFLTHSGWNSTLESMCGGVPMICWPFFAEQQTNCRFCCKDWGIGLEIE-  418

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             DV+R ++E LVRELM GEKG EM++KA++ K+LAE AA    GSS+ N++ ++   L
Sbjct  419   DVEREKIESLVRELMDGEKGKEMKKKALQWKELAESAAFRSVGSSFANLDNMVRDVL  475



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 380/477 (80%), Gaps = 3/477 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+ G   KPHAVCIP+PAQGHINPMLKLAK+L+ KGFHITFVNSE+N +RLL+SRG  
Sbjct  1     MGSL-GTTKKPHAVCIPYPAQGHINPMLKLAKLLHLKGFHITFVNSEYNQKRLLKSRGSS  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSC  433
             S+  L SFRFETIPDGLP SDVDATQDI +LCES  + CL  F+ L+A+LN S GPPVSC
Sbjct  60    SLHALSSFRFETIPDGLPDSDVDATQDIPSLCESTVRTCLPHFRKLLAKLNNSDGPPVSC  119

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTLDAA+E G+PE+LFWT  A GF+ ++ Y  +  KG +PLKDSS   NGYL
Sbjct  120   IVSDGVMTFTLDAAQELGLPEVLFWTTSACGFMCYLQYEQLFRKGITPLKDSSDVTNGYL  179

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T +DW+ G+  ++L+D+PSFIRTT+ DD ++ Y     + A  ASAI++NTFD LE + 
Sbjct  180   ETTIDWIPGIKEIQLKDIPSFIRTTDSDDIMLNYFRSECKNAPRASAIILNTFDTLEHDV  239

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L  L S+LPPVY+ GP     + V+D  + A+  +LWKED+ C+EWLNT +P SVVYVNF
Sbjct  240   LEALSSILPPVYSIGPLNLLLKNVDDKELNAIESNLWKEDSECMEWLNTKEPNSVVYVNF  299

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITV+T+ QLVEFAWGL N+ K FLW+IRPDLV+GE  VLP EFVE+T+ RG+L+SWC 
Sbjct  300   GSITVVTSAQLVEFAWGLGNSNKTFLWVIRPDLVAGENVVLPPEFVEQTKNRGLLSSWCS  359

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV++HPA+GGFLTHSGWNSTLES+C+GVPMICWPFFA+QQTNC +CC +WGIGMEI+ 
Sbjct  360   QEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEIE-  418

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             DVKR ++E LV+ELM GEKG +M+ KA++ KKLA+ AA+ P G+S+ N++ ++++ L
Sbjct  419   DVKRDKIESLVKELMDGEKGKQMKEKALQWKKLAKSAASGPYGTSFLNLDNMVHEVL  475



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/465 (62%), Positives = 363/465 (78%), Gaps = 5/465 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+PFPAQGHINPMLKLAKIL+  GFHITFVN+E+NHRRLLRSRG  S+ GLP F+
Sbjct  4     KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGASSLDGLPDFQ  63

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPPSD D+TQDI TLC S ++ CL PF+DLIA+LN S   P V+CIVSD  M 
Sbjct  64    FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLIAKLNSSSVIPQVTCIVSDAIMN  123

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEEFGIP+ LFWT  A G LG+   RL+ ++G +P+KD SY  N +L+T ++W+ 
Sbjct  124   FTLDAAEEFGIPDALFWTPSACGVLGYSKCRLLFERGLTPVKDVSYLTNEFLETAIEWIP  183

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             G   +RLRDLPS + T + D+  +  I+ + ER   ASA++ NTF++ E++ L+ L +M 
Sbjct  184   GKENIRLRDLPSLVTTADVDE--INLIITLIERTSRASAVIFNTFESFERDVLDALSTMF  241

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PP+Y  GP Q    Q  +  ++  G +LWKE+  C+EWL++ +P SVVYVNFGSITV+T 
Sbjct  242   PPIYTLGPLQLLVDQFPNGNLKNFGSNLWKEEPGCIEWLDSKEPNSVVYVNFGSITVITP  301

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
              Q++EFAWGLAN+ KPFLWIIRPDLV GE A+LP EFV ET++RGMLA+WCPQE V+ HP
Sbjct  302   QQMMEFAWGLANSNKPFLWIIRPDLVEGESAMLPSEFVSETKKRGMLANWCPQELVLKHP  361

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             ++GGFL H GWNST++SIC+GVP+ICWPFFADQQTNC + CT+WGIGM+ID +VKR EVE
Sbjct  362   SIGGFLCHMGWNSTMDSICAGVPLICWPFFADQQTNCMFACTEWGIGMQIDNNVKRDEVE  421

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             +LVRELM GEKG +M+RKAME K  AE+  T P GSS+ N+E ++
Sbjct  422   KLVRELMEGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALV  465



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/477 (63%), Positives = 383/477 (80%), Gaps = 3/477 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+ G   KPHAVCIP+PAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL++RGP+
Sbjct  1     MGSL-GTINKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSC  433
             S+ GL SFRFETIPDGLP +D+DATQDI +LCE+  + C   FK+L+A++N S  PPVSC
Sbjct  60    SLNGLSSFRFETIPDGLPETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDSDAPPVSC  119

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTLDAAEE G+PE+LFWT  A GF+ +V Y+ +I+K  +PLKDSSY  NGYL
Sbjct  120   IVSDGVMTFTLDAAEELGVPEVLFWTTSACGFMCYVQYQQLIEKDLTPLKDSSYITNGYL  179

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T +DW+ G+  +RL+D+PSF+RTTNPD+ ++ +I     RA+ ASAI++NTFDALE + 
Sbjct  180   ETTIDWIPGIKEIRLKDIPSFVRTTNPDEFMLDFIQWECGRARRASAIILNTFDALEHDV  239

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L    S+LPPVY+ GP     + V+D  + A+G +LWKE++ CVEWL+T  P SVVYVNF
Sbjct  240   LEAFSSILPPVYSIGPLNLHVKHVDDKELNAIGSNLWKEESKCVEWLDTKQPSSVVYVNF  299

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSI VMT++QL EFAWGLAN+ K FLW+IR DLV+GE AVLP EFV++T  RG+L+SWC 
Sbjct  300   GSIAVMTSEQLSEFAWGLANSNKNFLWVIRADLVAGENAVLPPEFVKQTENRGLLSSWCS  359

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV++HP+VGGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC  WGIG+EI+ 
Sbjct  360   QEQVLAHPSVGGFLTHSGWNSTLESMCGGVPMICWPFFAEQQTNCRFCCKDWGIGLEIE-  418

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             DV+R ++E LVRELM GEKG EM++KA++ K+LAE AA    GSS+ N++ ++   L
Sbjct  419   DVEREKIESLVRELMDGEKGKEMKKKALQWKELAESAAFRSVGSSFANLDNMVRDVL  475



>ref|XP_009145347.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X3 [Brassica 
rapa]
Length=483

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/471 (62%), Positives = 366/471 (78%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K H VC+P+PAQGHINPM+K+AK+L+ KGF++TFVN+ +NH+RLLRSRG  ++ GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +DVD TQDI +LCES  +  L PFK+L+ R+N     PPV+CIVSDG M 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRINAQDEVPPVNCIVSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SPLKD SY    +LDT++DW+ 
Sbjct  131   FTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKDESYLTKEHLDTIIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+PSF+RTTNP+D ++ ++V  TERAK ASAI++NTFD LE + +  +QS++
Sbjct  191   SMKNLRLKDIPSFVRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLEHDVIQSMQSIV  250

Query  818   PPVYAAGPF--QFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP   Q  +Q  EDS +  +G +LWKE+T C++WLNT  P SVVYVNFGSITVM
Sbjct  251   PPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGSITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             TA QLVEFAWGLA T K FLW+IRPDLV+GE +++P EF+ ET +R MLASWCPQE+V+S
Sbjct  311   TAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQEEVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPAVGGFLTH GWNSTLESIC GVPM+CWPFFA+QQTNC +CC +W IG+EI  DV+R E
Sbjct  371   HPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDVRREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA E + LAE A     GSS  N + V+   L
Sbjct  431   VEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVVKVLL  481



>ref|XP_010477495.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 368/481 (77%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS +     KPH VC+P+PAQGHINPM+K+AK+L+ KGFH+TF N+ +NH RLLRSRGP
Sbjct  1     MGSHVVPNAQKPHVVCVPYPAQGHINPMMKMAKLLDAKGFHVTFCNTVYNHNRLLRSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              +V GLPSFRFE+IPDGLP +DVD TQDI +LCES +++CL PFK+L+ ++N     PPV
Sbjct  61    NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTSKHCLAPFKELLRQINAKDDVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCI+SDG M FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SPLKD SY    
Sbjct  121   SCILSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPLKDESYLTKE  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YLDT +DW+  M  +RL+D+PSFIRT NPDD ++ +++  TER K ASAI++NTFD LE 
Sbjct  181   YLDTEIDWIPMMKNLRLKDIPSFIRTANPDDIMLNFLIRETERTKRASAIILNTFDDLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             + +  +QS++PPVY+ GP    E+Q   EDS +  +G +LW+E+  C++WLNT    SVV
Sbjct  241   DVIQSMQSIIPPVYSIGPLHLLEKQEIGEDSEIGQMGSNLWREEAECLDWLNTKAQNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITV+ A QL EFAWGLA T K FLW+IRPDLV+G+EA++P EF+ ET +R MLA
Sbjct  301   YVNFGSITVLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+SHPA+GGFLTH GWNS LES+C GVPM+CWPFFA+QQTNC + C +W +G+
Sbjct  361   SWCPQEQVLSHPAIGGFLTHCGWNSMLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGI  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI  DVKR EVE +VRELM GEKG +MR KA E ++LA++A     GSS  N +  ++K 
Sbjct  421   EIGGDVKREEVEAVVRELMDGEKGKKMRVKAQEWRRLAKEATEHKQGSSVVNFQTFVSKV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_008808008.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/476 (62%), Positives = 369/476 (78%), Gaps = 5/476 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS++ E  KPH VCIP+PAQGH+ PMLKLAK+L+ KGFHITFVN+EFNH RLL+SRGP 
Sbjct  1     MGSVAFE--KPHVVCIPYPAQGHVTPMLKLAKLLHSKGFHITFVNTEFNHCRLLKSRGPS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             ++ GLP FRF TIPDGLPPSD DATQDI +LC S    CL  F+ L++ L+  GPP++CI
Sbjct  59    ALDGLPDFRFATIPDGLPPSDADATQDIPSLCYSTMTTCLPHFRRLLSMLD--GPPLTCI  116

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             +SDG M FTLDAA+E G+PE+LFWT  A GF+ ++ YR +I+KG  PLKD+S   NGYLD
Sbjct  117   ISDGVMSFTLDAAKELGVPEVLFWTTSACGFMSYLHYRHLIEKGLVPLKDASDLTNGYLD  176

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             T LDW+ G+  +RLRD+PSFIRTT+PDD ++ + +   ER   ASAI++NTFD LEQ  L
Sbjct  177   TPLDWIPGLKNMRLRDIPSFIRTTDPDDTMINFALHECERTAMASAIILNTFDELEQPVL  236

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
               + ++LPP+Y  GP     +QV  S V ALG +LWKE+T+C+ WL   +P SVVYVNFG
Sbjct  237   AAMAAVLPPIYTIGPLTLLARQVPTSPVAALGSNLWKEETACLNWLAGKNPKSVVYVNFG  296

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITVMT  QL+EFAWGLANT   FLWI RPDLV G+ AVLP+EF+EET+ERG+LASWCPQ
Sbjct  297   SITVMTNQQLIEFAWGLANTGHEFLWITRPDLVKGDAAVLPQEFLEETKERGLLASWCPQ  356

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             E+++S+PA+GGFLTHSGWNST+ESIC GVPM+ WPFFA+Q TNC Y CT+WGIGMEID++
Sbjct  357   EEILSNPAIGGFLTHSGWNSTVESICEGVPMVSWPFFAEQPTNCRYVCTEWGIGMEIDSN  416

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR  VE ++RELM GEKG EM+ +AM  K+ A   AT P G S  N+E ++ + L
Sbjct  417   VKREVVEGMIRELMRGEKGEEMKERAMGWKESAVR-ATRPGGPSSLNLERLVTEVL  471



>ref|XP_002271368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/481 (61%), Positives = 371/481 (77%), Gaps = 7/481 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI     KPHAVCIP+P+QGH+NP+L++AK+L+ +GF ITFVN+E NH+RLLRS+GP 
Sbjct  1     MASIRASD-KPHAVCIPYPSQGHVNPLLQMAKLLHSRGFFITFVNTEHNHKRLLRSKGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN----QSGPP  424
              + G P FRFETIPDGLPPSD D TQ  A++CES ++N L PF +LI++LN     +GPP
Sbjct  60    YLDGFPDFRFETIPDGLPPSDADITQPTASVCESTSKNSLAPFCNLISKLNDPSSSAGPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             V+CIVSDG M FTLDAAE+FG+PE+LFWT  A GFLG+  YR ++ +G  PLKD S   N
Sbjct  120   VTCIVSDGVMSFTLDAAEKFGVPEVLFWTTSACGFLGYRHYRDLLQRGLIPLKDESCLTN  179

Query  605   GYLDTVLDWVKGM-PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             GYLDT++D + GM   +RLRD P+F +TT+P+D ++ +++   ERA  ASAI++NTFDAL
Sbjct  180   GYLDTIVDSIPGMMKTIRLRDFPAFFKTTDPNDIMLNFLIAEAERANKASAIILNTFDAL  239

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             E++ L+ L++ LPPVY  GP Q    Q+ D  ++  G SLWKE   C++WL++ +P SVV
Sbjct  240   EKDVLDALRATLPPVYTIGPLQHLVHQISDDKLKFFGSSLWKEQPECLQWLDSKEPNSVV  299

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGS+ VMT  QL E AWGLAN+ KPFLWIIRPDLV G+ A LP EFV ETR+RG+LA
Sbjct  300   YVNFGSVIVMTPQQLTELAWGLANSNKPFLWIIRPDLVPGDSAPLPPEFVTETRDRGLLA  359

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+ HPAVGGF+THSGWNST E IC GVP+IC PF A+Q TNC YCC++WGIGM
Sbjct  360   SWCPQEQVLKHPAVGGFVTHSGWNSTSEGICGGVPLICMPFRAEQPTNCRYCCSEWGIGM  419

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EID +VKR +VE+LVRELM GE G +M++KAME KKLAE+ A  P GSSYNN  ++++  
Sbjct  420   EIDGNVKRDKVEKLVRELMDGENGKKMKKKAMEWKKLAEE-AIMPGGSSYNNFNKLLSDV  478

Query  1502  L  1504
             L
Sbjct  479   L  479



>ref|XP_004300654.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 379/479 (79%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS + E  KPHAVCIP+PAQGHINPMLKLAKIL+++GFHITFVN+E+NH RLLRSRGP 
Sbjct  1     MGSNALE--KPHAVCIPYPAQGHINPMLKLAKILHYRGFHITFVNTEYNHERLLRSRGPN  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GLPSFRF++IPDGLPP+D + TQDI  LC SI  N L PF+ L++ LN S   PPV+
Sbjct  59    SLDGLPSFRFKSIPDGLPPTDANVTQDIPALCGSIRNNFLSPFRSLLSELNSSSNSPPVT  118

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CI+SD G  FTLDAA E G+P +LF T  A   + ++ Y  +I+KG  PLK++SY  NGY
Sbjct  119   CIISDFGTTFTLDAAHELGLPVVLFQTASACALMCYLHYAHLIEKGIVPLKEASYLTNGY  178

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ G+  +RLRD+P+FIRTT+PDD ++ Y++ + E+A+ ASAI++NTFDALE +
Sbjct  179   LDTVIDWLPGLGSIRLRDMPTFIRTTDPDDVMLSYLLYMIEQAQRASAIIINTFDALEHK  238

Query  791   ALNGLQSMLPPVYAAGPF-QFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+   S+LPPVY+ GP  Q      ED   + +G +LWKE+  C++WL + +P SVVYV
Sbjct  239   VLDAFSSLLPPVYSIGPLHQQLRHIQEDDDSKRIGANLWKEEPECLDWLESKEPNSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT +QL+EFAWGLAN+   FLW+IRPDLV+G+ AV+P EFVEET+ R  LASW
Sbjct  299   NFGSITVMTDEQLIEFAWGLANSSMTFLWVIRPDLVAGKSAVVPPEFVEETKGRSWLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV++HPA+GGFLTH GWNS +ES+C GVPMICWPFFADQQTNC +CC +WG+ M+I
Sbjct  359   CPQEQVLNHPAIGGFLTHCGWNSMVESLCGGVPMICWPFFADQQTNCRFCCKEWGVAMQI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  +E LVR+LMGG++G +MR+K++E KKLAE+A TAP GSS+ N+ +++N+ L
Sbjct  419   EGDVKRNYIEDLVRKLMGGQEGKQMRKKSLEWKKLAEEAITAPNGSSFLNLNKMVNQVL  477



>ref|XP_007225655.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
 gb|EMJ26854.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
Length=484

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/479 (58%), Positives = 383/479 (80%), Gaps = 3/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI+    K HAV +PFP+QGHINP+++LAK+L++KGFHITFVN+E+NH+RLL+SRGP+
Sbjct  1     MSSIALTSKKSHAVFVPFPSQGHINPLMQLAKLLHYKGFHITFVNTEYNHKRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVS  430
             ++ GLP+FRFETI DGLPP+D DATQDI +LC+S +++ L  F+DL+++LN S   P V+
Sbjct  61    ALNGLPTFRFETISDGLPPTDADATQDIPSLCDSTSKHSLPHFRDLLSKLNSSPDSPRVT  120

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             C+++DG M FTLDAA+E G+P + FWT  A GF+G+V +  +I+KG +P +D+SYF NG+
Sbjct  121   CLITDGVMSFTLDAAQELGVPAVFFWTPSACGFMGYVQFHQLIEKGLTPFEDASYFTNGH  180

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+TVLDWV GM  +RL+DLP+F+RTT PDD ++ ++V  TER K ASA+++NTF  LE E
Sbjct  181   LNTVLDWVPGMRNIRLKDLPTFMRTTEPDDIMLNFLVGETERTKKASAVILNTFHDLEHE  240

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              ++ L ++LPPVY+ GP     +Q+  ++ ++++  +LW E+  C++WL+T +P SVVYV
Sbjct  241   VIDSLSTLLPPVYSIGPLNLQLKQIPAENELKSIVSNLWTEEPECLQWLDTKEPNSVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSI V T +QL+EFAWGLAN+KK FLW+IRPDLV GE AV+P EF+EET++R +LA W
Sbjct  301   NFGSIAVTTNEQLIEFAWGLANSKKKFLWVIRPDLVRGESAVVPAEFLEETKDRSLLAHW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV+SHPAVGGFLTHSGWNSTLES+C GVP+ICW F  +Q TNC Y C +WG+G+E+
Sbjct  361   CPQEQVLSHPAVGGFLTHSGWNSTLESLCGGVPLICWSFCGEQPTNCRYSCREWGVGLEV  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
               DVKR  VE LVR+LM GE+G +MR+KA+E KKLAE+A T P GSS+ ++E+++NK L
Sbjct  421   GDDVKRNYVEELVRKLMEGEEGKKMRKKALEWKKLAEEATTGPYGSSFLDLEQMVNKVL  479



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/479 (58%), Positives = 381/479 (80%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             M S+      PH VC+P+PAQGHINPML +AK+L+ KG FH+TFVN+E+NH+R L++RGP
Sbjct  1     MCSLGTTKNVPHVVCVPYPAQGHINPMLNIAKLLHFKGGFHVTFVNTEYNHKRHLKARGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPV  427
             +S+ GLP+FRFETIPDGLP S+VD+TQDI +LCES  + CL  FK+L+++LN +   PPV
Sbjct  61    DSLNGLPTFRFETIPDGLPESNVDSTQDIPSLCESTRKTCLPHFKNLLSKLNDALDTPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSDG M FTLDAA+E  IP++LFWT  A GF+ +  YR +++KG +PLKD S   NG
Sbjct  121   TCIVSDGVMSFTLDAAQELNIPQVLFWTTSACGFMCYAQYRQLMEKGLTPLKDWSDMTNG  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DWV G+  +RL+DLPSFIRTT+P+DP+++++    +RA+ ASAI++NTFDALE 
Sbjct  181   YLETPIDWVPGIKEIRLKDLPSFIRTTDPNDPMIEFMSRECQRAQKASAIILNTFDALEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L    S+ PP+Y+ GP     + V +  + ++G +LWKED+ C++WLN  +P +VVYV
Sbjct  241   DVLEAFSSIFPPIYSIGPLNLLLKDVTNEELNSIGSNLWKEDSKCLKWLNNKEPNTVVYV  300

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGS+TVMT +Q++EFAWGL+N+KKPFLW+IRPDLV+GE AVLP EF+EET++RG+L+SW
Sbjct  301   NFGSVTVMTKEQMIEFAWGLSNSKKPFLWVIRPDLVAGENAVLPLEFLEETKDRGLLSSW  360

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             C Q +V++H A+GGFLTHSGWNSTLES+C+GVPMICWPFFA+QQTNC +CC +W IG+EI
Sbjct  361   CLQGEVLAHSAIGGFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCNEWEIGLEI  420

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + D KR ++E LV+EL+ GEKG EM+ KA++ KKLA +AA+ P GSS+ N+E +    L
Sbjct  421   E-DAKRDKIESLVKELLDGEKGKEMKAKALQWKKLAHNAASGPHGSSFMNLENLFRDVL  478



>ref|XP_007224375.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
 gb|EMJ25574.1| hypothetical protein PRUPE_ppa021058mg [Prunus persica]
Length=487

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/472 (60%), Positives = 379/472 (80%), Gaps = 5/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+PFPAQGHINPMLKLAK+L+ KGFHITFVN+EF H+RLL+S+GP S+ GLP+FR
Sbjct  11    KPHAVCMPFPAQGHINPMLKLAKLLHFKGFHITFVNTEFIHKRLLKSQGPNSLNGLPTFR  70

Query  284   FETIPDGLPPSDVD-ATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGM  454
             F+ IPDGLPP+D + A Q + +LC+SI ++CL PF+ L+++L  S   PPV+C+VSDG M
Sbjct  71    FKMIPDGLPPADANVAAQHMPSLCQSIRKHCLQPFRGLLSKLKSSPNSPPVTCLVSDGIM  130

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              F+LDAA+E GIP ++FWT  A  F+G++ Y  +I KG  PLKD+ Y  NGYLDTV+DW+
Sbjct  131   NFSLDAAQELGIPGVIFWTTSACAFMGYIQYGPLIQKGLVPLKDARYLTNGYLDTVIDWI  190

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
              GM  +RL+D+PSFIRTT+P+DPI+ +I++ TERAK ASAI++NTFDALE E L+ L ++
Sbjct  191   PGMKSIRLKDIPSFIRTTDPNDPILDFIMVDTERAKRASAIILNTFDALEHEVLDALSTL  250

Query  815   LPPVYAAGPFQF-FEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             LPP+Y  GP     +    D+ ++++G +LW E+T C++WL++ +P SVVYVNFGS TVM
Sbjct  251   LPPIYCIGPLYLQLDHIPADNELKSIGSNLWTEETECLQWLDSKEPNSVVYVNFGSSTVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLV-SGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             T++QL EFAWGLAN+ K F W+IRPDLV  G+  V+  EFVEET+ERG+LASWCPQEQV+
Sbjct  311   TSEQLTEFAWGLANSNKAFFWVIRPDLVCEGKSVVVAPEFVEETKERGLLASWCPQEQVL  370

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
              HPA+GGFLTH GWNST+ES+  GVPMICWPF ADQQTNC +CC++WGIG+EI+ DVKR 
Sbjct  371   IHPAIGGFLTHCGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEIEGDVKRY  430

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              +E LVRELM G +G ++R+KA+E KKLA++A T   GSS+ ++++++NK L
Sbjct  431   YIEGLVRELMEGGEGKKLRKKALEWKKLAKEATTGSNGSSFLDLDQMVNKVL  482



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/469 (62%), Positives = 362/469 (77%), Gaps = 3/469 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHI PMLKLAK+L+ KGFHITFVN+EFNH+RLL+SRG +S+ G PSFR
Sbjct  11    KPHAVCIPYPAQGHITPMLKLAKVLHFKGFHITFVNTEFNHKRLLKSRGADSLNGFPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLP SDVDATQD  TLCES+ + CL PF++L+A+LN S   PPVSCIVSDG M 
Sbjct  71    FETIPDGLPESDVDATQDTPTLCESLRKTCLVPFRNLLAKLNHSRHVPPVSCIVSDGVMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTL A+EE GIPE+ FWT  A G L ++    ++ KG  PLKDSSY  NGYL+T +DW+ 
Sbjct  131   FTLIASEELGIPEVFFWTISACGLLCYLHNGQLVKKGLVPLKDSSYMTNGYLETAIDWLP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             G+  + LRD PSF RT +P D +++ +     RAK ASAI++NTF+ALE + L  L SML
Sbjct  191   GIKEILLRDFPSFFRTIDPHDIMLQVLQEECGRAKHASAIILNTFEALEHDVLEALSSML  250

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PPVY  GP       V D  ++ +G +LWKED  C++WL+TN+P SV+YVNFGSITVMT 
Sbjct  251   PPVYPIGPLTLLLNHVTDEDLKTIGSNLWKEDRECLKWLDTNEPKSVIYVNFGSITVMTN  310

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
              QL+EFAWGLAN+ K FLW+IRPDLV  E  +LP EFV ET++RG L+ WCPQE+V++HP
Sbjct  311   HQLIEFAWGLANSGKTFLWVIRPDLVD-ENTILPYEFVLETKDRGQLSGWCPQEEVLAHP  369

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             A+GGFLTHSGWNST+ES+C+GVPMICWPFFA+Q TNC +CC +WG+GM+I+ DV R  VE
Sbjct  370   AIGGFLTHSGWNSTIESLCNGVPMICWPFFAEQPTNCRFCCKEWGVGMQIEGDVTRDRVE  429

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             RLVRELM G+KG E+  KA+E KKLAEDA     GSS+ N + ++ + L
Sbjct  430   RLVRELMEGQKGKELTMKALEWKKLAEDATILKEGSSFLNYDNMVRQVL  478



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/488 (61%), Positives = 376/488 (77%), Gaps = 15/488 (3%)
 Frame = +2

Query  77    MGSI-SGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS+   E  KPHAVCIP+PAQGH  PMLKLAK+L+H+GFH+TFVN+E+NH RL +S   
Sbjct  1     MGSMGHSEKPKPHAVCIPYPAQGHKTPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKS---  57

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             ++V  LPSFRF TIPDGLPP+D D TQDI +LCES  + CL  FK+L+A+LN        
Sbjct  58    QAVSDLPSFRFATIPDGLPPTDSDVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDG  117

Query  419   -PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPVSC+VSDG M FTLDAAEE G+PE+LFWT  A GFLG++ YR +ID+G  PLKD SY
Sbjct  118   VPPVSCVVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYMHYRDLIDRGIVPLKDESY  177

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSA--SAIMVNT  769
               NGYLDTV+DW+  M  ++L+DLP+F+RTTNP + + +++   TER++S   +AI++NT
Sbjct  178   LTNGYLDTVIDWIPAMSNIKLKDLPTFLRTTNPAEFMAEFVPGETERSRSQNPAAIILNT  237

Query  770   FDALEQEALNGLQSMLP-PVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNT  940
             FDALE + L  L +ML  PVY+ GP Q    +Q + D  V+ +  SLWKE++ C++WL T
Sbjct  238   FDALEHDVLASLSNMLAKPVYSIGPLQLLANDQTITDPSVKNISSSLWKEESECLDWLET  297

Query  941   NDPISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEET  1120
                 SVVYVNFGSITVMT DQLVEFAWGLAN+KK FLW+IRPDLV+GE AVLP EFV +T
Sbjct  298   KPKNSVVYVNFGSITVMTNDQLVEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKT  357

Query  1121  RERGMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCC  1300
             R+RG+LASWCPQEQV++H +V GFLTH+GWNSTLES+ +GVPMICWPFFA+QQTNCW+ C
Sbjct  358   RDRGLLASWCPQEQVLNHESVAGFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFAC  417

Query  1301  TQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNM  1480
              +WG+GMEI++DVKR EVE  VREL+ G KG EMR+KA E K++A +A T   GSS+  +
Sbjct  418   NEWGVGMEINSDVKRDEVEAQVRELVDGRKGGEMRKKAAEWKRIAAEAVTGGGGSSFAGL  477

Query  1481  EEVINKFL  1504
             + +I + L
Sbjct  478   DSLIERVL  485



>ref|XP_011092429.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=478

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/466 (64%), Positives = 368/466 (79%), Gaps = 2/466 (0%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKG-FHITFVNSEFNHRRLLRSRGP  253
             MGS+     KPHAVCIP+PAQGH+NPMLKLAK+L+H G FHITFVN+E+NHRRL++S GP
Sbjct  1     MGSLPRPESKPHAVCIPYPAQGHVNPMLKLAKLLHHHGGFHITFVNTEYNHRRLIKSGGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSC  433
              +V+GL  FRF TIPDGLPPSD D TQD+ +LC S T  CL PF DL+++LN   PPVSC
Sbjct  61    SAVEGLSDFRFHTIPDGLPPSDADTTQDVPSLCVSTTTTCLEPFCDLLSKLNSEAPPVSC  120

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             IVSDG M FTL AAE FG+PE+LFWT  A GFLG+  YR ++++G +PL+D S   NG+ 
Sbjct  121   IVSDGVMSFTLKAAERFGLPEVLFWTTSACGFLGYRQYRRLVEEGHTPLRDMSQVTNGHF  180

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +TV+DWV GM  +RLRD PSFIRTT+P D ++ +++   E A  A A+++NTFDALE++ 
Sbjct  181   ETVIDWVPGMKDIRLRDFPSFIRTTDPKDIMLNFLIQEAEAAPRAKALIINTFDALERDV  240

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
             L+ L +  P +Y  GP Q     V+D  + A+  SLWKED SC+EWL+T +P SVVYVNF
Sbjct  241   LDALSASFPRIYTVGPLQLMMDHVQDERLGAMASSLWKEDLSCMEWLDTKEPESVVYVNF  300

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITVMTADQ+ EFAWGLAN+KKPFLW+IRPDLV+G++A+LP EFV ET++R  L SWCP
Sbjct  301   GSITVMTADQMSEFAWGLANSKKPFLWVIRPDLVAGDKAMLPPEFVTETKDRSRLMSWCP  360

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QEQV+ HPAVGGFLTHSGWNST+ESI  GVP+ICWPFFA+QQTNC + C +WG+GMEID 
Sbjct  361   QEQVLKHPAVGGFLTHSGWNSTIESIVGGVPVICWPFFAEQQTNCRFSCVEWGMGMEIDN  420

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSY  1471
             +VKR EVE LV+ELM GEKG +M+ KA+E K+ AE+AA AP GSSY
Sbjct  421   NVKRGEVEALVKELMDGEKGKKMKEKALEWKRKAEEAA-APGGSSY  465



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/465 (61%), Positives = 364/465 (78%), Gaps = 5/465 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+PFPAQGHINPMLKLAKIL+  GFHITFVN+E+NHRRLLRSRG  S+ GLP F+
Sbjct  4     KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  63

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPPSD D+TQDI TLC S ++ CL PF+DLI++LN S   P V+CIVSD  M 
Sbjct  64    FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSVIPQVTCIVSDAVMN  123

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEEFGIP+ LFWT  A G LG+   R + ++G  P+KD SY  N +L+T ++W++
Sbjct  124   FTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIEWIQ  183

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             G   +RLRDLPS + T + D+  +  I+ + ER   ASA++ NTF++ E++ L+ L +M 
Sbjct  184   GKENIRLRDLPSLVTTADEDE--INLIITLVERTSRASAVIFNTFESFERDVLDALSAMF  241

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PP+Y  GP Q    Q  +  ++ +G +LWKE+  C+EWL++ +P SVVYVNFGSITV+T 
Sbjct  242   PPIYTLGPLQLLVDQFPNGNLKNIGSNLWKEEPECLEWLDSKEPNSVVYVNFGSITVITP  301

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
              Q++EFAWGLAN+  PFLWIIRPDLV GE ++LP EFV ET++RGMLA+WCPQE V+ HP
Sbjct  302   QQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELVLKHP  361

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             ++GGFL+H+GWNST++SIC+GVP+ICWPFFADQQTNC + CT+WGIGM+ID +VKR EVE
Sbjct  362   SIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKRDEVE  421

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             +LVRELM GEKG +M+RKAME K  AE+  T P GSS+ N+E ++
Sbjct  422   KLVRELMKGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALV  465



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/472 (61%), Positives = 363/472 (77%), Gaps = 6/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQ HIN ML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSFR
Sbjct  4     KPHAVCIPFPAQSHINAMLNLAKLLHHRGFHVTFVNTEYNHNRLLRSRGPSSLDGLPSFR  63

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             F TIPDGLPPSD DATQD+  LC+S  + CL  F+DL+ RLN+       PPVSC+VSDG
Sbjct  64    FRTIPDGLPPSDDDATQDVPALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVSDG  123

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
                FTLDAAE  G+PE+LFW   A  F+GF+ +R ++D+G +PLKD+SY  NGYLDT++D
Sbjct  124   WTTFTLDAAEAVGVPEVLFWPISACAFMGFLHFRSLVDEGRAPLKDASYLTNGYLDTIID  183

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM  +RLRDLPSFIRTT+PDDPI+ + ++   R K ASA + NTF+ LE E L+ L+
Sbjct  184   WIPGMRNIRLRDLPSFIRTTDPDDPILNFCLVEFARVKRASAWVFNTFERLEHEVLDALK  243

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             +M PP+Y  GP     +Q+ D   R +  +L +ED  C+EWL++  P SVVYVNFGSI V
Sbjct  244   AMFPPIYTIGPIHLLVEQLSDDDTRPIRSNLLEEDLGCLEWLDSKPPGSVVYVNFGSIIV  303

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M+  QLVEFAWGLAN+ + FLW+IRPDL+ G  A+LP +F+  TRER +LASWCPQE+V+
Sbjct  304   MSPAQLVEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWCPQERVL  363

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             SH AVGGFLTH  WNST+ESI + VP+ CWPFF DQQTNC Y C +WGIGMEID+DV+R 
Sbjct  364   SHSAVGGFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVRRD  423

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVER VRELM GE+G EM+RKAME ++ A + AT P+GSS+ N+E VIN+ L
Sbjct  424   EVERQVRELMEGERGKEMKRKAMEWQETARE-ATRPSGSSFLNLEGVINEVL  474



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/470 (62%), Positives = 379/470 (81%), Gaps = 3/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHINPML +AK+L+ KGFHITFVN+EFNH+RLL+SRG  S+ GLPSF+
Sbjct  9     KPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSFQ  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMF  457
             FETIPDGLPP+  + TQDI +LC S  + CL  F++L+++LN S   PPVSCIVSDG M 
Sbjct  69    FETIPDGLPPTKANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSPDSPPVSCIVSDGVMS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA+E GIPE+LFWT  A GFL ++ +  +I+KG +PLKD+SY  NGYLDTV+DW+ 
Sbjct  129   FTLDAAQELGIPEVLFWTTSACGFLAYMQFYRLIEKGHTPLKDASYLTNGYLDTVIDWIP  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  +RL+D+PSF+RTT PDD ++ +I++ TERAK ASAI++NTF   E+E L+ L ++L
Sbjct  189   GMKDIRLKDIPSFMRTTEPDDQMLDFILVETERAKKASAIILNTFHDFEREVLDTLLTLL  248

Query  818   PPVYAAGPFQFFEQQVE-DSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PPVY+ GP      Q+  D  ++++  +LW E+  C+EWL+T +P SVVYVNFGSITVMT
Sbjct  249   PPVYSIGPLNLQIGQIPVDKELKSIRSNLWIEEPECLEWLHTKEPNSVVYVNFGSITVMT  308

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
              +QL EFAWGLAN KK FLW+IRPDLV G+ AV+P+EFVEET++R ++ASWCPQEQV+SH
Sbjct  309   NEQLTEFAWGLANCKKTFLWVIRPDLVGGDSAVVPQEFVEETKDRSLMASWCPQEQVLSH  368

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC + C + GIG+EI+ DVKR  V
Sbjct  369   PAIGGFLTHCGWNSTLESVCGGVPMVCWPFFAEQQTNCRFSCKELGIGLEIEGDVKRKYV  428

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR+LM G++G EMR+KA+E KKLA++A++ P G S+ + + ++N+ L
Sbjct  429   EGLVRKLMDGKEGKEMRKKALEWKKLAKEASSGPNGLSFVDFDTMVNQVL  478



>ref|XP_010459988.1| PREDICTED: UDP-glycosyltransferase 85A2 [Camelina sativa]
Length=484

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/481 (60%), Positives = 367/481 (76%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS +     KPH VC+P+PAQGHINPM+K+AK+L  KGFH+TF N+ +NH RL RSRGP
Sbjct  1     MGSHVVPNAQKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFCNTVYNHNRLRRSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              +V GLPSFRFE+IPDGLP +DVD TQDI +LCES  ++CL PFK+L+ ++N +   PPV
Sbjct  61    NAVDGLPSFRFESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQINTNDDVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCI+SDG M FTLDAA+E GIPE+LFWT  A GFL ++ Y   I+KG +PLKD SY    
Sbjct  121   SCILSDGCMSFTLDAAKELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLKDESYLTKE  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YLDT +DW+  M  +RL+D+PSFIRT NPDD ++ +++  TER K ASAI++NTFD LE 
Sbjct  181   YLDTEIDWIPMMKNLRLKDIPSFIRTANPDDIMLNFLIRETERTKRASAIILNTFDDLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             + +  +QS++PPVY+ GP    E+Q   EDS +  +G +LWKE+T C++WL+T    SVV
Sbjct  241   DVIQSMQSIIPPVYSVGPLHLLEKQEIGEDSEIGRMGSNLWKEETECLDWLDTKARNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITV+ A QL EFAWGLA T K FLW+IRPDLV+G+EA++P EF+ ET +R MLA
Sbjct  301   YVNFGSITVLNAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQEQV+SHPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC + C +W +G 
Sbjct  361   SWCPQEQVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGN  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI  DVKR EVE +VRELM GEKG +MR KA E ++LA++A     GSS  N E  ++K 
Sbjct  421   EIGGDVKREEVEAVVRELMDGEKGKKMREKAQEWRRLAKEATEHKHGSSVVNFETFVSKV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>emb|CDY38225.1| BnaC05g17420D [Brassica napus]
Length=482

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/471 (62%), Positives = 366/471 (78%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K H VC+P+PAQGHINPM+K+AK+L+ KGF++TFVN+ +NH+RLLRSRG  ++ GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             FE+IPDGLP +DVD TQDI  LCES  +N L PFK+L+ R+N     PPVSCIVSDG M 
Sbjct  71    FESIPDGLPETDVDVTQDIPALCESTVKNSLAPFKELLRRINAQDESPPVSCIVSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE+LFWT  A G L ++ Y   I+KG SPLKD SY    +LDT++DW+ 
Sbjct  131   FTLDAAEELGVPEVLFWTTSACGLLAYLHYHKFIEKGLSPLKDESYLTKEHLDTIIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+PSFIRTTNP+D ++ ++V  TERAK ASAI++NTFD LE + +  +QS++
Sbjct  191   SMKNLRLKDIPSFIRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLELDVIQSMQSIV  250

Query  818   PPVYAAGPF--QFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP   Q  +Q  EDS +  +G +LWKE+T C++WLN+  P SVVYVNFGSITVM
Sbjct  251   PPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNSRAPNSVVYVNFGSITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             TA QLV+FAWGLA T K FLW+IRPDLV+GE +++P EF+ ET +R MLASWCPQE+V+S
Sbjct  311   TAKQLVDFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQEEVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPAVGGFLTH GWNSTLESIC GVPM+CWPFFA+QQTNC +CC +W IG+EI  DV+R E
Sbjct  371   HPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIG-DVRREE  429

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA E + LAE A     GSS  N ++V+   L
Sbjct  430   VEAVVRELMDGEKGKKMREKAEEWRSLAEKATECKRGSSVVNFDKVVKVVL  480



>ref|XP_008455179.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=488

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/486 (58%), Positives = 365/486 (75%), Gaps = 9/486 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+S +  KPHAVCIP+PAQGHI PMLKLAK+L+H+GF+ITFVN+++NHRR L+SRGP 
Sbjct  1     MGSVS-QTEKPHAVCIPYPAQGHITPMLKLAKLLHHRGFYITFVNTDYNHRRFLKSRGPH  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG------  418
             S+ GL  F F+TIPDGLP SD ++TQDI  LCES ++NCL PF+DLI++LN         
Sbjct  60    SLDGLQDFTFQTIPDGLPYSDANSTQDIPALCESTSKNCLAPFRDLISQLNSMAASPSSN  119

Query  419   -PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPVSCIVSD  MFF++  A EF IP    WT  A G+LG+  Y  +ID+G  PLKD S 
Sbjct  120   MPPVSCIVSDAAMFFSMVVANEFKIPYAFLWTASACGYLGYFQYEHLIDQGLIPLKDMSQ  179

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFD  775
               NGYL+T + W +GM  +RLRDLP+F RTT  DD I  +I+   + ++ ASAI++NTFD
Sbjct  180   VTNGYLETTVGWTQGMKNIRLRDLPTFFRTTVRDDMIFNFIIQAMKSSREASAIILNTFD  239

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             A+E +  + L S+L  +Y  GP      Q++D  + A+G +LW E++ C+EWLN+  P S
Sbjct  240   AIEGDVKDSLSSILQSIYTIGPLHMLANQIDDENLTAIGSNLWAEESECIEWLNSKQPNS  299

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVMT  Q++EFAWGLA++ KPFLWI RPDL+ G+ A+LP EFV +T++R +
Sbjct  300   VVYVNFGSITVMTPQQMIEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSL  359

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +A+WC QEQV++HP++GGFLTHSGWNSTLESIC+GVPMI WPFFA+QQTNC YCCT+WGI
Sbjct  360   IANWCCQEQVLNHPSIGGFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGI  419

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEID +VKR EVE LVRELM GEKG +M+   M LK  AE+A   P GS+Y  ++++IN
Sbjct  420   GMEIDNNVKRNEVEELVRELMDGEKGKKMKENVMYLKSKAEEAY-KPDGSAYKQLDKLIN  478

Query  1496  KFLSPN  1513
             + L  N
Sbjct  479   EVLLSN  484



>ref|XP_009145346.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X2 [Brassica 
rapa]
Length=484

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/472 (62%), Positives = 366/472 (78%), Gaps = 5/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K H VC+P+PAQGHINPM+K+AK+L+ KGF++TFVN+ +NH+RLLRSRG  ++ GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +DVD TQDI +LCES  +  L PFK+L+ R+N     PPV+CIVSDG M 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRINAQDEVPPVNCIVSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLK-DSSYFENGYLDTVLDWV  634
             FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SPLK D SY    +LDT++DW+
Sbjct  131   FTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKADESYLTKEHLDTIIDWI  190

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
               M  +RL+D+PSF+RTTNP+D ++ ++V  TERAK ASAI++NTFD LE + +  +QS+
Sbjct  191   PSMKNLRLKDIPSFVRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLEHDVIQSMQSI  250

Query  815   LPPVYAAGPF--QFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             +PPVY+ GP   Q  +Q  EDS +  +G +LWKE+T C++WLNT  P SVVYVNFGSITV
Sbjct  251   VPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGSITV  310

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             MTA QLVEFAWGLA T K FLW+IRPDLV+GE +++P EF+ ET +R MLASWCPQE+V+
Sbjct  311   MTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQEEVL  370

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             SHPAVGGFLTH GWNSTLESIC GVPM+CWPFFA+QQTNC +CC +W IG+EI  DV+R 
Sbjct  371   SHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDVRRE  430

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVE +VRELM GEKG +MR KA E + LAE A     GSS  N + V+   L
Sbjct  431   EVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVVKVLL  482



>ref|XP_007042919.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98750.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=488

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/477 (60%), Positives = 370/477 (78%), Gaps = 8/477 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAK L+HKGFHITFV++E+N++RLLRSRGP SV GLP FR
Sbjct  9     KPHAVCIPYPAQGHINPMLKLAKFLHHKGFHITFVHTEYNYKRLLRSRGPNSVDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCIVS------D  445
             FE I DGLP +D DATQDI +LC+S ++NCL PF+DL+ +LN      S I        D
Sbjct  69    FEAIKDGLPHTDADATQDIPSLCDSTSKNCLAPFRDLLYKLNDVAAASSSIPPVSSIVSD  128

Query  446   GGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVL  625
             GGM FT+ AAEEFGIP++LFWT  A GFL ++    ++++G +P+KD++Y  NGYLD V+
Sbjct  129   GGMSFTVKAAEEFGIPDVLFWTPSACGFLCYLQLPSLVERGLTPVKDANYLTNGYLDKVI  188

Query  626   DWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGL  805
             DW+ GM  +R RDLPSF+RT +P+D +  Y++   ERA  ASAI++NTFD+LEQ+ L+ L
Sbjct  189   DWIPGMKNIRFRDLPSFVRTMDPNDMMFNYLLKEVERAYKASAIVLNTFDSLEQDVLDAL  248

Query  806   QS-MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
                +LPPVY+ GP       + D     +  +LWKE T C+EWLN+ +P SVVYVN+GSI
Sbjct  249   SGVLLPPVYSIGPLHLLVDWIRDDESEDINSNLWKEQTECIEWLNSKEPNSVVYVNYGSI  308

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
             TVMT +QL+EFAWGLAN+++ FLWIIRPDLV+GE A+LP +FV ET++RGMLASWCPQEQ
Sbjct  309   TVMTPEQLIEFAWGLANSQRQFLWIIRPDLVAGETAILPPDFVSETKDRGMLASWCPQEQ  368

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V+ HP++GGFL+H GWNSTLES+C GVPM+CWPFFA+QQ NC + C  WGIGMEIDT+VK
Sbjct  369   VLKHPSIGGFLSHMGWNSTLESLCCGVPMVCWPFFAEQQLNCRFACRNWGIGMEIDTNVK  428

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSPN  1513
             R +VE+LVREL+ GEKG EM+ KAME K+ AE+ A  P GSS+ N+E+++ + L  +
Sbjct  429   REDVEKLVRELLEGEKGMEMKTKAMEWKREAEE-AIRPGGSSFQNLEKLVAEVLQTD  484



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/465 (61%), Positives = 364/465 (78%), Gaps = 5/465 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+PFPAQGHINPMLKLAKIL+  GFHITFVN+E+NHRRLLRSRG  S+ GLP F+
Sbjct  33    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  92

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLPPSD D+TQDI TLC S ++ CL PF+DLI++LN S   P V+CIVSD  M 
Sbjct  93    FETIPDGLPPSDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSSVIPQVTCIVSDAVMN  152

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEEFGIP+ LFWT  A G LG+   R + ++G  P+KD SY  N +L+T ++W++
Sbjct  153   FTLDAAEEFGIPDALFWTPSACGVLGYSKCRSLFERGLIPVKDVSYITNEFLETAIEWIQ  212

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             G   +RLRDLPS + T + D+  +  I+ + ER   ASA++ NTF++ E++ L+ L +M 
Sbjct  213   GKENIRLRDLPSLVTTADEDE--INLIITLVERTSRASAVIFNTFESFERDVLDALSAMF  270

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PP+Y  GP Q    Q  +  ++ +G +LWKE+  C+EWL++ +P SVVYVNFGSITV+T 
Sbjct  271   PPIYTLGPLQLLVDQFPNGNLKNIGSNLWKEEPECLEWLDSKEPNSVVYVNFGSITVITP  330

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
              Q++EFAWGLAN+  PFLWIIRPDLV GE ++LP EFV ET++RGMLA+WCPQE V+ HP
Sbjct  331   QQMMEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELVLKHP  390

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             ++GGFL+H+GWNST++SIC+GVP+ICWPFFADQQTNC + CT+WGIGM+ID +VKR EVE
Sbjct  391   SIGGFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKRDEVE  450

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             +LVRELM GEKG +M+RKAME K  AE+  T P GSS+ N+E ++
Sbjct  451   KLVRELMKGEKGKDMKRKAMEWKTKAEE-VTRPGGSSFENLEALV  494



>ref|XP_010041627.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/481 (61%), Positives = 365/481 (76%), Gaps = 12/481 (2%)
 Frame = +2

Query  98    GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPS  277
             G KPHAVCIPFPAQGHINPMLKLAK+L+HKGFHITFVN+E NH+RLLRS+GP S+ GLP 
Sbjct  7     GEKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEHNHKRLLRSQGPHSLDGLPH  66

Query  278   FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVS  442
             FRF+ IPDGLPPSD D+TQDI +LC S++++ L  F+ L+ +L +       PPV+CIVS
Sbjct  67    FRFDMIPDGLPPSDADSTQDIPSLCASLSEHGLSAFRSLLLKLREQSQDGVVPPVTCIVS  126

Query  443   DGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTV  622
             DGGM FT+DAAEE  IPE++FWT  A G  G   YR +++ GF+PLKD +Y  NGYL+T 
Sbjct  127   DGGMAFTVDAAEELKIPEVVFWTPSACGVFGCTKYRRLVEDGFTPLKDPTYLSNGYLETT  186

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             + W  GM  +RLRD+P+FIRT +  D ++ +I+   ER+  ASA+++NTFD LE + L  
Sbjct  187   VSWTSGMKSIRLRDIPTFIRTLDHQDIMLNFIIQEVERSSRASAVILNTFDTLEHDVLES  246

Query  803   LQSMLPPVYAAGPFQFFEQQVE------DSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
             L S+ P +Y  GP Q             D  +R++G +LW+E+  C+ WL++ +P SVVY
Sbjct  247   LSSVFPHIYTIGPLQLLADWGAGGSPEIDEALRSVGGNLWREEPGCLPWLDSKEPGSVVY  306

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT  QL EFAWGLAN++KPFLWIIRPDLV+ E AVLP EFVEE   RGML S
Sbjct  307   VNFGSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVS  366

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WC QE+V+ H A+GGFLTHSGWNSTLES+C GVP+ICWPFFA+QQTNC Y CT+WGIGME
Sbjct  367   WCQQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGME  426

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID DVKR EVE LVRELM GEKG EMR+KAME K  AE+A     G+SYNN++++I++ L
Sbjct  427   IDNDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAEEAIML-GGTSYNNVDKLISEVL  485

Query  1505  S  1507
             S
Sbjct  486   S  486



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/451 (62%), Positives = 365/451 (81%), Gaps = 2/451 (0%)
 Frame = +2

Query  155   MLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFETIPDGLPPSDVDATQ  334
             MLKLAK+L+ KGFHITFVN+E+NH+RLL++RGP+S+ GL SFRFETIPDGLP +D+DATQ
Sbjct  1     MLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSFRFETIPDGLPETDLDATQ  60

Query  335   DIATLCESITQNCLGPFKDLIARLNQS-GPPVSCIVSDGGMFFTLDAAEEFGIPEILFWT  511
             DI +LCE+  + C   FK+L+ ++N S  PPVSCIVSDG M FTLDAAEE G+PE+LFWT
Sbjct  61    DIPSLCEATRRTCSPHFKNLLTKINNSDAPPVSCIVSDGVMSFTLDAAEELGLPEVLFWT  120

Query  512   CGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGMPGVRLRDLPSFIRTTN  691
               A GF+ +V Y  +I+KG +PLKDSSY  NGYL+T +DW+ G+  +RL+DLPSFIRTTN
Sbjct  121   TSACGFMCYVQYEQLIEKGLTPLKDSSYITNGYLETTIDWIPGIKEIRLKDLPSFIRTTN  180

Query  692   PDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPPVYAAGPFQFFEQQVED  871
             PD+ ++ +I     R + ASAI++NTFDALE + L    S+LPPVY+ GP     + V+D
Sbjct  181   PDEFMLDFIQWECGRTRRASAIILNTFDALEHDVLEAFSSILPPVYSIGPLNLLVKHVDD  240

Query  872   SGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQLVEFAWGLANTKKPFL  1051
               + A+G +LWKE++ CVEWL+T +P SVVYVNFGSI VMT++QL+EFAWGLAN+ K FL
Sbjct  241   KDLNAIGSNLWKEESECVEWLDTKEPNSVVYVNFGSIAVMTSEQLIEFAWGLANSNKTFL  300

Query  1052  WIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAVGGFLTHSGWNSTLESI  1231
             W+IRPDLV+GE A+LP EFV++T +RG+L+SWC QEQV++HPA+GGFLTHSGWNSTLES+
Sbjct  301   WVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIGGFLTHSGWNSTLESV  360

Query  1232  CSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRK  1411
             C GVPMICWPFFA+QQTNCW+CC +WGIG+EI+ DV+R ++E LVRELM GEKG EM+ K
Sbjct  361   CGGVPMICWPFFAEQQTNCWFCCKEWGIGLEIE-DVERDKIESLVRELMDGEKGKEMKEK  419

Query  1412  AMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             A++ K+LA+ AA  P GSS+ N++ ++   L
Sbjct  420   ALQWKELAKSAAFGPVGSSFANLDNMVRDVL  450



>gb|KFK44333.1| hypothetical protein AALP_AA1G244500 [Arabis alpina]
Length=483

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/471 (61%), Positives = 361/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPMLK+AK+L+ KG H+TFVN+ +NH RLLRSRGP+++ GLPSF+
Sbjct  11    KPHVVCVPYPAQGHINPMLKVAKLLHAKGLHVTFVNTVYNHNRLLRSRGPDALHGLPSFQ  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +D D TQDI  LC S  +NCL PF +LI R+N  G  PP+SCIVSDG M 
Sbjct  71    FESIPDGLPETDGDTTQDIPALCVSTKKNCLAPFMELIRRINSGGDVPPISCIVSDGIMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+P +LFWT  A G +GF+ + + I+KG +P +D S     +LDTV+DW+ 
Sbjct  131   FTLDAAEELGVPIVLFWTLSACGLMGFLQFHVFIEKGLAPFQDESNMSKEHLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D PSFI T NPDD ++ +I+   E++K A+AI++NTF+ L+ E +  +QS+L
Sbjct  191   SMESLRLKDFPSFICTANPDDIMLHFIIREVEQSKRATAIILNTFEDLDHEVIQAMQSVL  250

Query  818   PPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP      QV  EDS    +GL+LW+E+T C++WLNT    SVVYVNFGSITVM
Sbjct  251   PPVYSIGPLHLLANQVIKEDSETAQMGLNLWREETKCLDWLNTKTQNSVVYVNFGSITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T  QLVEFAWGLA + K FLW+IRPDLV+GEEA++P +F+ ET  R ML SWCPQE+V+S
Sbjct  311   TTKQLVEFAWGLARSGKEFLWVIRPDLVAGEEAIVPSDFLTETTGRRMLVSWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTHSGWNSTLES+ SGVPM+CWPFFADQQTNC +CC +W +GMEI  DVKR E
Sbjct  371   HPAIGGFLTHSGWNSTLESLSSGVPMVCWPFFADQQTNCKFCCDKWEVGMEIGGDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA E ++LAE A+    GSS  N E ++NK L
Sbjct  431   VEAVVRELMDGEKGKKMREKAEEWRRLAEKASERKLGSSILNFETLVNKVL  481



>ref|XP_008229481.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/480 (61%), Positives = 365/480 (76%), Gaps = 9/480 (2%)
 Frame = +2

Query  92    GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGL  271
             G   KPHAVCIP P QGHI   LKLAKIL+HKGFHITFVN+EFNH+RL++S GP S+ GL
Sbjct  2     GSNSKPHAVCIPVPTQGHIKAHLKLAKILHHKGFHITFVNTEFNHKRLVKSLGPNSLDGL  61

Query  272   PSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--------SGPPV  427
             P FRFETIPDGLP SD DATQD+  LC+SI +N L PF DL+ +LN         + PPV
Sbjct  62    PDFRFETIPDGLPDSDEDATQDLTLLCDSILKNFLAPFLDLLTKLNNDVTSTSNNAPPPV  121

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIVSD  M FT  AAE+ GIP  LF+T  A  F+GF  Y  +++KG +PL D S+  NG
Sbjct  122   TCIVSDPFMPFTTPAAEQLGIPVTLFFTFAASSFMGFKQYPTLVEKGLAPLTDESFLTNG  181

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             +LD V+DWV GM G+RLRDLP+   TTNP+D I   I+ +  R + ASA++V+TFDALE 
Sbjct  182   FLDQVIDWVPGMKGIRLRDLPNNFITTNPNDSIFNGILEVIGRLRKASAVVVHTFDALEP  241

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L+ L SM PPVYA GP Q    Q+ +  +++LG SLWKE+T C++WLN+N   SVVYV
Sbjct  242   DVLDALSSMSPPVYAIGPLQLLLNQIPEHPLKSLGYSLWKEETECLQWLNSNTTNSVVYV  301

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT +QLVEF WGLAN+K  F W+IRPDLV GE A+LP EFVEET+ER ++ASW
Sbjct  302   NFGSITVMTPNQLVEFGWGLANSKLHFFWVIRPDLVIGESAILPPEFVEETKERSLIASW  361

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV++HP+VGGFLTH+GWNST+ES+ +GVPM+CWPFFADQQTNC Y C +WGIGMEI
Sbjct  362   CPQEQVLNHPSVGGFLTHNGWNSTIESLSAGVPMLCWPFFADQQTNCHYTCKEWGIGMEI  421

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLS  1507
             + DVKR +VE+LVRELM GEKG +++ KAME K LAE+ AT+  GSS  N++ + N+  S
Sbjct  422   NNDVKRDDVEKLVRELMEGEKGKKIKNKAMEWKTLAEE-ATSLHGSSSTNLDNLANQMQS  480



>emb|CDP01082.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 374/480 (78%), Gaps = 8/480 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI+    KPHAVCIP  AQGHI PML LAK+L+H GFHITFVN+EFNHRRLL+SRGP+
Sbjct  1     MGSIALLEKKPHAVCIPAAAQGHIGPMLNLAKLLHHNGFHITFVNTEFNHRRLLKSRGPD  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             ++ GLP F+F+ IPDGLPPSDVDATQDI TL ES+ + CLGPF++L+A LN +     PP
Sbjct  61    ALNGLPDFQFKAIPDGLPPSDVDATQDIPTLFESMDRTCLGPFRELLAELNDTSSSKVPP  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSD    FTL AAEE  IPE+LFWT  A  +LG+  Y  +++KG  PLKD+SY  N
Sbjct  121   VSCIVSDAATGFTLAAAEELSIPEVLFWTSSACSYLGYFQYAKLMEKGIIPLKDASYLTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYLDTVLDW+  + G+RL+DLPSF+RTTNPDD +VK+++  T+RA+ ASAI++NT+  LE
Sbjct  181   GYLDTVLDWIPELEGIRLKDLPSFLRTTNPDDFMVKFVLQETQRARKASAIIINTYQQLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
                L+ L S LPP+Y  GP  F +  V    +  +  +LWKE+  C+EWL++ DP SVVY
Sbjct  241   HGVLDALSSYLPPIYTIGPLHFLDNHVHYESLTDIQSNLWKEEPECLEWLDSKDPNSVVY  300

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSI V+T +QLVEFAWGLAN+K+ FLWI+RPDLVSG  A+LP EF+EET+ER M A 
Sbjct  301   VNFGSIAVLTPEQLVEFAWGLANSKQNFLWILRPDLVSGSSAILPSEFLEETKERSMFAG  360

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SHPAVGGFLTHSGWNST+ESI  GVP+ CWPFFADQQTNCW+CCT+WGIGME
Sbjct  361   WCPQEKVLSHPAVGGFLTHSGWNSTIESISYGVPLFCWPFFADQQTNCWFCCTKWGIGME  420

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ID +VKR EVE LV ELM GEKG EM++KAM+ KKLAE A T     S  N+E +I++ L
Sbjct  421   IDNNVKRDEVEGLVSELMAGEKGKEMKKKAMDWKKLAETAVT----DSNLNLENLIHQVL  476



>ref|XP_009334337.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009334338.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/479 (60%), Positives = 375/479 (78%), Gaps = 4/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS  G   KPHAV IP+PAQGHI PML+LAK+LN+KGFH TFVN+EFNHRRLL++RGP 
Sbjct  1     MGS-KGMIEKPHAVFIPYPAQGHIIPMLQLAKLLNYKGFHTTFVNTEFNHRRLLKARGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVS  430
             S+ GL SFRFETIPDGLP +DV+ATQDI  LC S  +NCL PFKDL+++LN   + PPV+
Sbjct  60    SLDGLSSFRFETIPDGLPTTDVNATQDITALCFSTKKNCLAPFKDLLSKLNSLPNSPPVT  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDGGM FTL+AA+E GIP ++F T  A   +G++    +I+KG  PLKD+SY  NGY
Sbjct  120   CIVSDGGMTFTLEAAQELGIPVVIFATASACSLMGYLQLSPLIEKGLIPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ GM G+RLRD+P+F RTT+P+D +++++ +   R   ASA ++NTF ALE E
Sbjct  180   LDTVIDWIPGMRGIRLRDIPTFFRTTDPNDIMLEFLRVEIGRYHRASAFILNTFYALEHE  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+ L ++LPP+Y+ GP      Q+  ++ ++++G +LW E+  C+EWL++ +P SVVYV
Sbjct  240   VLDALSTLLPPIYSVGPLHLQLNQIPAENELKSIGSNLWTEEPECLEWLDSKEPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT +QL EFAWGLAN+ + FLW+IRPDLV GE AV+P EF EET+ER ++ASW
Sbjct  300   NFGSITVMTEEQLTEFAWGLANSNQTFLWVIRPDLVGGESAVVPSEFSEETKERSLVASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             C Q++V+SHPA+GGFLTHSGWNSTLES+C GVPMICWP FADQQ NC + C +WGIGMEI
Sbjct  360   CLQQEVLSHPAIGGFLTHSGWNSTLESVCGGVPMICWPVFADQQMNCRFSCKEWGIGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DVKR  +E LVR+LM GE+G EMR+KA E KKLA +A T+P G S+ +++ + ++ L
Sbjct  420   EGDVKRDYIEGLVRKLMEGEEGKEMRKKAQEWKKLATEATTSPNGMSFVDLDRIASQVL  478



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/471 (61%), Positives = 368/471 (78%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VCIP+PAQGHINPMLK+AK+L+ KGFH+TFVN+ +NH+RLLRSRGP ++ GLPSF+
Sbjct  11    KPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGPNALDGLPSFQ  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             FE IPDGLP ++VDATQDI TLCES  +NCL PFK+L+ ++N  +  PPVSCIVSDG M 
Sbjct  71    FEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQINARKDVPPVSCIVSDGVMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE+LFWT  A G + ++ + L I+KG  P +D S   N +LDT +DW+ 
Sbjct  131   FTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFEDESCLTNEHLDTSIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  ++L+D+P+FIRTTNP+D +V ++V  T+++K ASAI++NTFD L+ + +  +QS+L
Sbjct  191   SMNNLKLKDIPTFIRTTNPNDIMVNFLVHETDQSKRASAIILNTFDDLDHDIIQAMQSIL  250

Query  818   PPVYAAGPFQFFEQQVEDSGVRA--LGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP      +  + G     LG +LW+E+T C++WL+T    SVVYVNFGSITVM
Sbjct  251   PPVYSIGPLHLLVNREIEEGTETERLGSNLWREETECLDWLDTKAQNSVVYVNFGSITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             TA QLVEFAWGLA ++K FLW+IRPDLV+GEEAV+P EF+ ET  R ML SWCPQE+V+S
Sbjct  311   TAKQLVEFAWGLAASRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPAVGGFLTH+GWNSTLESI +GVPM+CWPFFA+QQTN  YCC +WG+GMEI  DVKR E
Sbjct  371   HPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIGEDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG ++R KA E ++LAE A   P GSS  N + V++K L
Sbjct  431   VEAVVRELMDGEKGKKLREKAEEWRRLAEKATEHPCGSSVVNFKTVVDKIL  481



>ref|XP_009145345.1| PREDICTED: UDP-glycosyltransferase 85A2 isoform X1 [Brassica 
rapa]
Length=487

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 366/475 (77%), Gaps = 8/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K H VC+P+PAQGHINPM+K+AK+L+ KGF++TFVN+ +NH+RLLRSRG  ++ GLPSFR
Sbjct  11    KQHVVCVPYPAQGHINPMMKVAKLLHAKGFYVTFVNTIYNHKRLLRSRGSNALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +DVD TQDI +LCES  +  L PFK+L+ R+N     PPV+CIVSDG M 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTPKYSLAPFKELLRRINAQDEVPPVNCIVSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLK----DSSYFENGYLDTVL  625
             FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SPLK    D SY    +LDT++
Sbjct  131   FTLDAAEELGVPEVLFWTTSACGFLAYLHYHKFIEKGLSPLKVDLADESYLTKEHLDTII  190

Query  626   DWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGL  805
             DW+  M  +RL+D+PSF+RTTNP+D ++ ++V  TERAK ASAI++NTFD LE + +  +
Sbjct  191   DWIPSMKNLRLKDIPSFVRTTNPNDIMLNFLVRETERAKRASAIILNTFDDLEHDVIQSM  250

Query  806   QSMLPPVYAAGPF--QFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
             QS++PPVY+ GP   Q  +Q  EDS +  +G +LWKE+T C++WLNT  P SVVYVNFGS
Sbjct  251   QSIVPPVYSIGPLHLQVKQQISEDSELGRMGSNLWKEETECMDWLNTKAPNSVVYVNFGS  310

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             ITVMTA QLVEFAWGLA T K FLW+IRPDLV+GE +++P EF+ ET +R MLASWCPQE
Sbjct  311   ITVMTAKQLVEFAWGLAATGKEFLWVIRPDLVAGEVSMVPPEFLTETADRSMLASWCPQE  370

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V+SHPAVGGFLTH GWNSTLESIC GVPM+CWPFFA+QQTNC +CC +W IG+EI  DV
Sbjct  371   EVLSHPAVGGFLTHCGWNSTLESICGGVPMVCWPFFAEQQTNCKFCCDEWEIGVEIGGDV  430

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +R EVE +VRELM GEKG +MR KA E + LAE A     GSS  N + V+   L
Sbjct  431   RREEVEAVVRELMDGEKGKKMREKAAEWRSLAEKATECKRGSSVVNFDNVVKVLL  485



>ref|XP_008229473.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
 ref|XP_008229474.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=486

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 363/475 (76%), Gaps = 9/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP PAQ HI  MLK AK+L+H+GFHITFVN+EFNH+R L+S GP S+ GLP F+
Sbjct  9     KPHAVCIPVPAQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLPDFQ  68

Query  284   FETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQ------SGPPVSCIVS  442
             FE IPD LP SD DATQD+  LCESI  QN L PF  L+A+LN       + PPV+CIVS
Sbjct  69    FEAIPDSLPDSDEDATQDVTLLCESIRKQNFLAPFLALLAKLNNDAISTSTNPPVTCIVS  128

Query  443   DGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             DG M  FT+ AAEE G+P +LF+T  A  F+GF   R +++KG +PLKD S F NGYLDT
Sbjct  129   DGFMSTFTITAAEEIGVPIVLFYTIAACSFMGFKQIRALVEKGLAPLKDESCFTNGYLDT  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  +RLRDLP+F RTTNPDD +  +I+  T+RA  ASAI+++TF ALE + L+
Sbjct  189   VIDWIPGMRDIRLRDLPTFFRTTNPDDILFNFIMEETDRAHEASAIIIHTFHALEPDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L  MLP VY+ GP Q    ++ +  ++ +G SLWKE+T C+EWLNTN P SVVYVNFGS
Sbjct  249   ALSFMLPRVYSIGPLQLHLNEIPEHPLKMVGYSLWKEETECLEWLNTNTPNSVVYVNFGS  308

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I VMT++QLVEF WGLAN+K PF W+IRPDLV GE A+ P EFV ET+ER ++A WCPQE
Sbjct  309   IAVMTSEQLVEFGWGLANSKLPFFWVIRPDLVIGESAIFPPEFVAETKERSLIAGWCPQE  368

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFF DQQ +C Y C +WGIGMEI  DV
Sbjct  369   QVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDV  428

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LV+ELM GEKG +M+ K ME KKLAE+ AT P GSS  N++ ++N+ L
Sbjct  429   KRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVL  482



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/475 (61%), Positives = 368/475 (77%), Gaps = 8/475 (2%)
 Frame = +2

Query  98    GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPS  277
             G KPH VCIPFPAQGHI PMLKLAK+L+++GFHITFVN+EFNH+RLLRSRGP ++ G+P 
Sbjct  2     GDKPHVVCIPFPAQGHIKPMLKLAKLLHYRGFHITFVNTEFNHKRLLRSRGPHALDGMPG  61

Query  278   FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSD  445
             F FE+IPDGLPP D DATQ I +LCES  ++CL PF+ LIA+LN +     PPV+CIVSD
Sbjct  62    FCFESIPDGLPPVDADATQHIPSLCESTPKSCLIPFQQLIAKLNDAPSSNVPPVTCIVSD  121

Query  446   GGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVL  625
             G M FTL A+EE GIP +LFWT  A GF+ +  +R +ID    PLKD SY  NGYL+T++
Sbjct  122   GSMCFTLKASEELGIPNVLFWTTSACGFMAYKQFRPLIDGVLVPLKDLSYLTNGYLETII  181

Query  626   DWVKGMPGVRLRDLPSFIRTTNPDDP-IVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             DWV GM  +RLRD PSFIRT +P D  ++ +I+  T+ A  AS +++NTF ALE + LN 
Sbjct  182   DWVPGMKNMRLRDFPSFIRTRDPSDHFMLDFIIDTTDSASKASGLILNTFHALEHDVLNP  241

Query  803   LQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
             L SM P +   GP      Q+ D    ++  +LW+E+T C++WLN+  P SVVYVNFGSI
Sbjct  242   LSSMFPTICTVGPLPLLLNQIPDDN--SIESNLWREETECLQWLNSKQPNSVVYVNFGSI  299

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
             TVMT +QLVEFAWGLAN+ KPFLWIIRPDLV G+  +LP EFV ET +RG++A WCPQE+
Sbjct  300   TVMTPEQLVEFAWGLANSHKPFLWIIRPDLVVGDSVILPPEFVNETIQRGLMAGWCPQEK  359

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V++HP+VGGFLTHSGWNST+ESIC+GVPMICWPFFA+QQTNC Y CT+WG+GMEID +V+
Sbjct  360   VLNHPSVGGFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCRYACTEWGVGMEIDNNVE  419

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLS  1507
             R EVE+LV+ELM GEKG  M++ AME +  AE+ ATAP GSSY N++++++  L+
Sbjct  420   RDEVEKLVKELMEGEKGKSMKKAAMEWRTKAEE-ATAPCGSSYLNLDKLVDILLT  473



>ref|XP_004299645.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/479 (60%), Positives = 376/479 (78%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS + E  KPHAVCIP+PAQGHINPMLKLAKIL+++GFHITFVN+E+NH RLLRSRGP 
Sbjct  1     MGSNASE--KPHAVCIPYPAQGHINPMLKLAKILHYRGFHITFVNTEYNHERLLRSRGPN  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GLPSFRF++IPDGLPP+D + TQDI  LC SI  N L PF+ L++ LN S   PPV+
Sbjct  59    SLDGLPSFRFKSIPDGLPPTDANVTQDIPALCGSIRNNFLAPFRSLLSELNSSSNSPPVT  118

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CI+SD G  FTLDA  E G+P +LF T  A   + ++ +  +I+KG  PLK++SY  NGY
Sbjct  119   CIISDLGTTFTLDATHELGLPVVLFQTASACTLMCYLHHAHLIEKGIVPLKEASYLTNGY  178

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDTV+DW+ G+  +RLRD+P+FIRTT+PDD ++ +I+ + E+A+ ASAI++NTFDALE +
Sbjct  179   LDTVIDWLPGLGSIRLRDMPTFIRTTDPDDVMLSFILYMIEQAQRASAIIINTFDALEHK  238

Query  791   ALNGLQSMLPPVYAAGPF-QFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
              L+   S+LPPVY+ GP  Q      ED   + +G +LWKE+  C+EWL + +P SVVYV
Sbjct  239   VLDAFSSLLPPVYSIGPLHQQLSHIQEDDDSKTIGSNLWKEEPECLEWLESKEPNSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVMT +QL+EFAWGLAN+   FLW+IRPDLV+G  AV+P EFVEET+ R  LASW
Sbjct  299   NFGSITVMTDEQLIEFAWGLANSNMTFLWVIRPDLVAGNSAVVPPEFVEETKGRSWLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQEQV++HPA+GGFLTH GWNST+ES+C GVPMICWPFFADQQ NC +CC +WG+ M+I
Sbjct  359   CPQEQVLNHPAIGGFLTHCGWNSTVESLCGGVPMICWPFFADQQINCRFCCKEWGVAMQI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             + DV+R  +E LVR+LM G++G +MR+K++E KKLAE+A TAP GSS+ N+ +++N+ L
Sbjct  419   EGDVRRNYIEVLVRKLMEGQEGKQMRKKSLEWKKLAEEAVTAPNGSSFLNLNKMVNQVL  477



>gb|KCW45340.1| hypothetical protein EUGRSUZ_L00994 [Eucalyptus grandis]
Length=461

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/460 (63%), Positives = 361/460 (78%), Gaps = 8/460 (2%)
 Frame = +2

Query  155   MLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFETIPDGLPPSD-VDAT  331
             ML LAK+L+H+GFH+TFVN+E+NH RLLRSRGP S+ GLPSF+F TIPDGLPPSD  DAT
Sbjct  1     MLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSLDGLPSFQFRTIPDGLPPSDATDAT  60

Query  332   QDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDGGMFFTLDAAEEFGIPE  496
             QDI  LC+S ++ CL  F+DL+ RLN+       P VSC+VSDGGM FTLDAAE  G+PE
Sbjct  61    QDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPLVSCVVSDGGMTFTLDAAEAIGVPE  120

Query  497   ILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGMPGVRLRDLPSF  676
             +L WT  A  F+G+V YR +IDKG +PLKD++YF NG LDT +DW+ GM  +RLRDLP+F
Sbjct  121   VLIWTASACSFMGYVQYRSLIDKGLTPLKDANYFTNGCLDTTIDWIPGMRNIRLRDLPTF  180

Query  677   IRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPPVYAAGPFQFFE  856
             I+TT+PDD ++ + +   ERAK ASAI+ NTFD LE E L+ L++M PP+Y  GP     
Sbjct  181   IQTTDPDDLMIPFCLREVERAKRASAIVFNTFDRLEHEVLDALKAMFPPIYTLGPLHLLT  240

Query  857   QQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQLVEFAWGLANT  1036
             +Q+ D+  R    +LWKE+  C+EWL++  P SVVYVNFGSITVM+  QLVEFAWGLAN+
Sbjct  241   KQLSDNNTRPFRSNLWKEEPGCIEWLDSKQPSSVVYVNFGSITVMSPAQLVEFAWGLANS  300

Query  1037  KKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAVGGFLTHSGWNS  1216
              + FLW+IRPDLV G+ A+LP +F+  TRER +LASWCPQE+V+SH AVGGFLTHSGWNS
Sbjct  301   GQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERVLSHSAVGGFLTHSGWNS  360

Query  1217  TLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERLVRELMGGEKGH  1396
             T+ESI +GVP++CWPFF DQQTNCWY C +WGIGMEID+DVKR EVER V+ELM GEKG 
Sbjct  361   TIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVKRNEVERQVKELMEGEKGK  420

Query  1397  EMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK-FLSPN  1513
              M+RKAME K++A + AT P+GSS+ N++EVINK  LSP 
Sbjct  421   HMKRKAMEWKEMARE-ATRPSGSSFLNLDEVINKVLLSPK  459



>ref|XP_010498706.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/471 (61%), Positives = 364/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPM+K+AK+L  KGFH+TFVN+ +NH RLLRSRGP++V GL SFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFVNTVYNHNRLLRSRGPKAVDGLASFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +DVD TQDI +LCES  ++CL PFK+L+ ++N +   PPVSCI+SDG M 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTAKHCLAPFKELLRQINANDDVPPVSCILSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE GIPE+LFWT  A GFL ++ Y   I+KG +PLKD SY    YLDT +DW+ 
Sbjct  131   FTLDAAEELGIPEVLFWTTSACGFLAYLNYYRFIEKGLAPLKDESYLTKEYLDTEIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+PSFIRT NPDD +  +++  TER K ASAI++NTFD LE + +  +QS++
Sbjct  191   VMKNLRLKDIPSFIRTANPDDIMPNFLIRETERTKRASAIILNTFDDLEHDVIQSMQSII  250

Query  818   PPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP    E+Q   EDS +  +G +LW+E+  C++WL+T    SVVYVNFGSITV+
Sbjct  251   PPVYSIGPLHLLEKQEIGEDSELGRMGSNLWREEAECLDWLDTKARNSVVYVNFGSITVL  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
              A QL EFAWGLA T K FLW+IRPDLV+G+EA++P EF+ ET +R MLASWCPQEQV+S
Sbjct  311   NAKQLAEFAWGLAATGKEFLWVIRPDLVAGDEAMVPHEFLTETEDRRMLASWCPQEQVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC + C +W +G+EI  DVKR E
Sbjct  371   HPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA + ++LA++A     GSS  N +  ++K L
Sbjct  431   VEAVVRELMDGEKGKKMREKAQQWRRLAKEATEHKHGSSVVNFDTFVSKVL  481



>ref|XP_006307366.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
 gb|EOA40264.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
Length=484

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/471 (61%), Positives = 362/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPM+K+AK+L  KGFH+TFVN+ +NH RLL+SRGP +V GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTIYNHNRLLKSRGPNAVDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +DVD TQDI +LCES  ++ L PFK L+  +N     PPVSCIVSDG M 
Sbjct  71    FESIPDGLPETDVDVTQDIPSLCESTVKHSLAPFKKLLREINAKDDVPPVSCIVSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE+LFWT  A GFL ++ +   I+KG SP+KD SY    YLDT +DW+ 
Sbjct  131   FTLDAAEELGVPEVLFWTTSACGFLAYLYFYRFIEKGLSPVKDESYLTKEYLDTEIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  ++L+D+PSFIRT NPDD ++ ++V  TER K ASAI++NTFD LE + +  +QS++
Sbjct  191   MMKNLKLKDIPSFIRTANPDDIMLNFLVRETERTKRASAIILNTFDDLEHDVIQSMQSII  250

Query  818   PPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP    E+Q   EDS +  +G +LWKE+T C++WL+T    SVVYVNFGSITV+
Sbjct  251   PPVYSIGPLHLLEKQEIGEDSEIGRMGSNLWKEETECLDWLDTKAQNSVVYVNFGSITVL  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
              A QL EFAWGLA T K FLW+IRPDLV+G++A++P+EF+ ET +R MLASWCPQEQV+S
Sbjct  311   NAKQLAEFAWGLAATGKEFLWVIRPDLVAGDDAMVPQEFLTETEDRRMLASWCPQEQVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC + C +W +G+E   DV R E
Sbjct  371   HPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIETGGDVNREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA E ++LA++A     GSS  N+E V+ K L
Sbjct  431   VEAVVRELMDGEKGKKMREKAEEWRRLAKEATDHKLGSSIVNLETVVRKIL  481



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 367/471 (78%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VCIP+PAQGHINPMLK+AK+L+ KGFH+TFVN+ +NH+RLLRSRGP ++ GLPSF+
Sbjct  11    KPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGPNALDGLPSFQ  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             FE IPDGLP ++VDATQDI TLCES  +NCL PFK+L+ ++N  +  PP+SCIVSDG M 
Sbjct  71    FEAIPDGLPETEVDATQDIPTLCESTMKNCLTPFKELLRQINARKDVPPISCIVSDGVMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE+LFWT  A G + ++ + L I+KG  P +D S   N +LDT +DW+ 
Sbjct  131   FTLDAAEELGLPEVLFWTPSASGVMAYLHFYLFIEKGLFPFEDESCLTNEHLDTSIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  ++L+D+P+FIRTTNP+D +V  +V  T+++K ASAI++NTFD L+ + +  +QS+L
Sbjct  191   SMNNLKLKDIPTFIRTTNPNDIMVNILVHETDQSKRASAIILNTFDDLDHDIIQAMQSIL  250

Query  818   PPVYAAGPFQFFEQQVEDSGVRA--LGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP      +  + G     LG +LW+E+T C++WL+T    SVVYVNFGSITVM
Sbjct  251   PPVYSIGPLHLLVNREIEEGTETERLGSNLWREETECLDWLDTKAQNSVVYVNFGSITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             TA QLVEFAWGLA ++K FLW+IRPDLV+GEEAV+P EF+ ET  R ML SWCPQE+V+S
Sbjct  311   TAKQLVEFAWGLATSRKEFLWVIRPDLVAGEEAVIPTEFLTETEGRRMLLSWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPAVGGFLTH+GWNSTLESI +GVPM+CWPFFA+QQTN  YCC +WG+GMEI  DVKR E
Sbjct  371   HPAVGGFLTHNGWNSTLESISAGVPMVCWPFFAEQQTNAKYCCDEWGVGMEIGEDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG ++R KA E ++LAE A   P GSS  N + V++K L
Sbjct  431   VEAVVRELMDGEKGKKLREKAEEWRRLAEKATEHPCGSSVVNFKMVVDKIL  481



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/484 (60%), Positives = 379/484 (78%), Gaps = 8/484 (2%)
 Frame = +2

Query  74    KMGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             +MGS+  E L PHAVC+PFPAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL+SRGP
Sbjct  9     QMGSLCPENLPPHAVCVPFPAQGHINPMLKLAKLLHQKGFHITFVNTEYNHQRLLKSRGP  68

Query  254   ESVKGLPSFRFETIPDGLPPS-DVDATQDIATLCESITQNCLGPFKDLIARLNQSG----  418
             +S+ GLPSFRFETIPDGLP S + ++TQD+ +LC S  +NCL PF+ L+++LN S     
Sbjct  69    DSLNGLPSFRFETIPDGLPSSENANSTQDVPSLCYSTKRNCLAPFRYLLSKLNNSASSNV  128

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPV+CIV D  M FTL A +E G+P +LFWT    GF+ ++ YR +++KGF PLKD+SY 
Sbjct  129   PPVTCIVFDCIMSFTLQAGQELGVPVVLFWTASVCGFMAYLHYRPLVEKGFVPLKDASYL  188

Query  599   ENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDA  778
              NGYLDT+++W+ GM G+RL++LPSFIRTT+PDD +V + +   E A++ASA++ NTFD 
Sbjct  189   TNGYLDTLINWIPGMEGIRLKNLPSFIRTTDPDDIMVNFAIGEVENARNASAVIFNTFDD  248

Query  779   LEQEALNGLQSMLP-PVYAAGPFQFFEQQVE-DSGVRALGLSLWKEDTSCVEWLNTNDPI  952
             LE E L  L S+LP P+   GP Q   Q    +S V ++  +LW+E   C+EWL++ +P 
Sbjct  249   LEYEVLTHLCSILPNPILTIGPLQLLLQDQVQESVVNSIKSNLWEEQPGCLEWLDSKEPN  308

Query  953   SVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERG  1132
             SV+YVNFGS+TVMT  QLVEFAWGLAN+KK FLW+IRPDLV+GE A++P EF++ET+ERG
Sbjct  309   SVIYVNFGSVTVMTPQQLVEFAWGLANSKKTFLWVIRPDLVTGESAIIPPEFLKETKERG  368

Query  1133  MLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWG  1312
             +LA+WCPQE+V+ HP++GGFLTHSGWNST+ES+  GVPMICWPFFA+QQTN W+CC +W 
Sbjct  369   LLANWCPQEEVLMHPSIGGFLTHSGWNSTIESLAGGVPMICWPFFAEQQTNSWFCCNKWC  428

Query  1313  IGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             IGMEID D  R E+ERLV+ELM  + G E++ KAME K  AE+ AT+ TGSSY N++++I
Sbjct  429   IGMEIDNDANRTEIERLVKELMNSKPGSEVKNKAMEWKMKAEE-ATSRTGSSYMNLDKMI  487

Query  1493  NKFL  1504
                L
Sbjct  488   TMVL  491



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/468 (61%), Positives = 365/468 (78%), Gaps = 2/468 (0%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP P QGHINPMLKLAK+L+ KGFHITFVN+E+ H+RLL+SRGP+S+KGL SFR
Sbjct  18    KPHAVCIPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSLKGLSSFR  77

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-PPVSCIVSDGGMFF  460
             FETIPDGLP   VDATQDI +LC+S  + CL    +L+ ++N S  PPV+C+V+DG M F
Sbjct  78    FETIPDGLPEPAVDATQDIPSLCDSTRRTCLPHLNNLLTKINSSDVPPVTCLVADGVMSF  137

Query  461   TLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKG  640
             TLDAAEE G+P  LFWT  A GF+ +V    +I KG  PLKDSS   NGYL+T +D + G
Sbjct  138   TLDAAEELGVPLALFWTPSACGFMCYVQLEQLIQKGLIPLKDSSSVTNGYLETKIDSIPG  197

Query  641   MPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLP  820
             +  +RLRD PSF+RTT+ DD +++++     RA+ ASAI++NTFDA+E + L  L S+LP
Sbjct  198   IKEIRLRDFPSFVRTTDSDDFMIEFLQWECGRAREASAIILNTFDAMEHDVLEALSSILP  257

Query  821   PVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTAD  1000
             PVY+ GP     + ++D  +  +  +LWKE+  CVEWL+T +P SV+YVNFGSITVMT++
Sbjct  258   PVYSIGPLNLLVKDIDDEDLNVIRSNLWKEEFECVEWLDTKEPNSVIYVNFGSITVMTSE  317

Query  1001  QLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPA  1180
             QL EFAWGLAN+ K FLW+IRPD+V GE  VLP EFVE+T++RG L+SWCPQEQV++HPA
Sbjct  318   QLNEFAWGLANSNKSFLWVIRPDVVGGENVVLPPEFVEQTKDRGFLSSWCPQEQVLAHPA  377

Query  1181  VGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVER  1360
             +GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIG+EI+ DVKR ++ER
Sbjct  378   IGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEIE-DVKRDKIER  436

Query  1361  LVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             LVRELM GEKG EM+ KA++ K LA  A   P GSS+ N+E +I + L
Sbjct  437   LVRELMDGEKGKEMKEKAIQWKDLAVSATYGPHGSSFLNLENMIREVL  484



>gb|AID16086.1| flavonol-3-O-glucoside L-rhamnosyltransferase, partial [Morus 
alba]
Length=447

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/438 (65%), Positives = 355/438 (81%), Gaps = 5/438 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+S    KPHAVCIPFPAQGH+NPMLKLAK+L+ KGFHITFVN+EFNH+RLL+SRG  
Sbjct  1     MGSLSFLE-KPHAVCIPFPAQGHVNPMLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGAH  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             ++ GLPSFRFE IPDGLPP+D DATQ I  +CES  ++ L PF+DL+ +LN S   PPVS
Sbjct  60    ALDGLPSFRFEAIPDGLPPTDADATQSIPAICESTPKHSLAPFRDLLLKLNSSPEVPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             C+VSDG M FTLDAAEE GIPE+LFWT  A GFLG++ YR +++KG++PLKD SY  N Y
Sbjct  120   CVVSDGAMSFTLDAAEELGIPEVLFWTTSACGFLGYLHYRALVEKGYTPLKDESYLTNEY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+TV+DW+ GM  +RL+D+P+FIRTT+P+D +V +++   ERA+ ASAI++NTF  LE++
Sbjct  180   LNTVIDWIPGMKDIRLKDIPTFIRTTDPNDIMVNFVITEAERAQKASAIILNTFYDLERD  239

Query  791   ALNGLQSM-LPPVYAAGPFQFFEQQVEDS-GVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
             A+N + S+  PPVY  G  Q    Q   +  +++L  +LWKED  C+EWL++ +P SVVY
Sbjct  240   AVNAISSISKPPVYTLGSLQLLLNQFPIAEHLKSLESNLWKEDHKCLEWLDSKEPNSVVY  299

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT++QLVEFAWGLAN+KK FLW++RPDLV GE AVLP EF EET ERG L S
Sbjct  300   VNFGSITVMTSEQLVEFAWGLANSKKEFLWVLRPDLVGGESAVLPPEFSEETSERGFLTS  359

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+ HPAVGGFLTH GWNST+ESICSGVPM+CWPFFA+QQTNCWY C +WGIGME
Sbjct  360   WCPQEKVLGHPAVGGFLTHCGWNSTIESICSGVPMLCWPFFAEQQTNCWYSCGEWGIGME  419

Query  1325  IDTDVKRCEVERLVRELM  1378
             ID D KR E+ER+VREL+
Sbjct  420   IDGDAKREEIERIVRELV  437



>emb|CDP01073.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/469 (62%), Positives = 372/469 (79%), Gaps = 2/469 (0%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHA+ IPFPAQG INPM KLAKIL+HKGFHITFV+SEFN RRLL+SRG  ++ GLPSF+
Sbjct  11    KPHAIFIPFPAQGRINPMFKLAKILHHKGFHITFVHSEFNQRRLLKSRGKNALDGLPSFQ  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FETIPDGLP SD DATQD+ +LC+S ++NCL PF+ L+ RLN S   PPVSCIVSDG M 
Sbjct  71    FETIPDGLPFSDADATQDVPSLCDSTSKNCLAPFRQLVTRLNSSPGVPPVSCIVSDGIMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTL+ A E GIP++ FWT GAGG + ++ YR +++KG++PLKD SY  +GYLDTV+DW+ 
Sbjct  131   FTLEVARELGIPDVFFWTNGAGGVMAYLNYRNLVEKGYTPLKDWSYLTDGYLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM G+RL+DLPSFIRT + +D ++ + +   E+   ASA+++NTFDA+E + L+   S+L
Sbjct  191   GMKGIRLKDLPSFIRTRDRNDIMLNFAINQAEKIHDASALILNTFDAMEPDVLDAFSSIL  250

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             P VY  GP    E Q+ D+ +++LG +LWKE+  C+EWL++ +P SVVYVNFGS+TVMT 
Sbjct  251   PAVYTLGPLHLIEDQLPDNELKSLGSNLWKEELGCIEWLDSKEPNSVVYVNFGSVTVMTP  310

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
              QLVEFAWGLA + + FLWIIRPDLV GE A+LP EFV +T+ERG+LASWCPQ  V+ HP
Sbjct  311   QQLVEFAWGLAKSGRTFLWIIRPDLVIGETAILPPEFVLDTKERGLLASWCPQVDVLKHP  370

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             ++GGFLTH GWNSTLESIC+GV M+CWPFFA+QQTNCWYCC   G  MEID +VK  EVE
Sbjct  371   SIGGFLTHCGWNSTLESICAGVAMVCWPFFAEQQTNCWYCCNHLGTAMEIDNNVKSDEVE  430

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +LV ELM G++G EM++KA ELKKLAE+A TAP+GSS  N+E +++  L
Sbjct  431   KLVNELMFGDRGQEMKKKAAELKKLAEEAITAPSGSSIKNLESLVHNVL  479



>ref|XP_003544799.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=472

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/467 (59%), Positives = 369/467 (79%), Gaps = 12/467 (3%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PHAVCIP+PAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+R+L++RGP S+ GLPSFRF
Sbjct  10    PHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRILKARGPYSLNGLPSFRF  69

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-PPVSCIVSDGGMFFT  463
             ETIPDGLP   V+ATQDI +LC+S  + CL  F++L+A++N S  PPV+CIVSDGGM FT
Sbjct  70    ETIPDGLPEPVVEATQDIPSLCDSTRRTCLPHFRNLLAKINNSDVPPVTCIVSDGGMSFT  129

Query  464   LDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGM  643
             LDAAEE G+P++LFWT  A GF+ ++ Y  +I+KG  PL DSSY  NGYL+T ++WV G+
Sbjct  130   LDAAEELGVPQVLFWTPSACGFMCYLQYEKLIEKGLMPLIDSSYVTNGYLETTINWVPGI  189

Query  644   PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPP  823
               +RL+++PSFIRTTN DD ++ Y++  T+R + ASAI++NTFDALE + L    S+LPP
Sbjct  190   KEIRLKEIPSFIRTTNLDDIMLDYLLSETKRTQRASAIILNTFDALEHDVLEAFSSILPP  249

Query  824   VYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQ  1003
             VY+ GP     + V+D  ++A+G +LWKE+  C++WL+T +P SVVYVNFGSIT+MT +Q
Sbjct  250   VYSIGPLNLLVEDVDDEDLKAIGSNLWKEEPECMKWLDTKEPNSVVYVNFGSITIMTNEQ  309

Query  1004  LVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAV  1183
             L+EF+WGLAN+ K FLW++RPDLV+GE  VL  EFV+ET  RGML+SWCPQEQV++HPA+
Sbjct  310   LIEFSWGLANSNKSFLWVVRPDLVAGENVVLSLEFVKETENRGMLSSWCPQEQVLTHPAI  369

Query  1184  GGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERL  1363
             G FLTHSGWNSTLES+C GVPMICWPFFA+QQ NC +CC +WGIG+           E++
Sbjct  370   GVFLTHSGWNSTLESVCGGVPMICWPFFAEQQINCRFCCKEWGIGL-----------EKM  418

Query  1364  VRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VRELM GE G +M+ K ++ K+LA++A + P GSS+ N++ +++  L
Sbjct  419   VRELMDGENGKKMKDKVLQWKELAKNATSGPNGSSFLNLDNMVHNIL  465



>ref|XP_008380053.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/483 (60%), Positives = 365/483 (76%), Gaps = 8/483 (2%)
 Frame = +2

Query  77    MGSIS-GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS+      KPHAVC+PFP QGHI P+LK AK+L+H+G  ITFVN+E+NHRRLL+S GP
Sbjct  1     MGSMEVAANHKPHAVCLPFPYQGHIKPLLKFAKLLHHRGIRITFVNTEYNHRRLLKSLGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSD-VDATQDIATLCESITQNCLGPFKDLIARLN-----QS  415
              ++ G   F FETIPDGLPPSD  D+TQDI  +C++I  N L PF+ L+A+LN      +
Sbjct  61    NTLDGFKDFHFETIPDGLPPSDSADSTQDIYDICDAIQNNLLAPFQSLLAKLNAVAASNN  120

Query  416   GPPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPV+ IVSDG M F++ AAEE G+P +LF+   A GF+GF  YR + +KGF+PLKD  Y
Sbjct  121   TPPVTSIVSDGFMSFSITAAEELGLPIVLFFPTAACGFMGFKHYRALAEKGFTPLKDERY  180

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFD  775
               NGYLDTV+DW+ GM G+RLRDLP+F+RTTNP+D         TERA  ASA++++TF+
Sbjct  181   LSNGYLDTVIDWIPGMKGIRLRDLPTFLRTTNPNDTAFSLTSEATERAHKASAVVIHTFE  240

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             ALEQ+ L+ + SM+P +Y  GP Q    Q+E+  +++LG SLWKE+  C+ WL+T  P S
Sbjct  241   ALEQDILDAISSMIPHLYPIGPLQLLINQIEEDPLKSLGYSLWKEEAECIPWLDTKAPNS  300

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGS+ VMT + LVEF WGLAN+K  FLW+IRPDLV GE A+LP EFV ET+ER +
Sbjct  301   VVYVNFGSVVVMTPEHLVEFGWGLANSKHHFLWVIRPDLVIGESAILPPEFVAETKERCL  360

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +A WCPQE+V++HP+VGGFLTHSGWNST+ES+ +GVPM+ WPFFA+QQTNCWY C   G 
Sbjct  361   IAGWCPQEEVLNHPSVGGFLTHSGWNSTIESVTAGVPMLSWPFFAEQQTNCWYTCNGLGT  420

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEID DVKR EVE+LVRELM GEKG +M+RKA E KKLAE+ AT P GSS  N++ V+N
Sbjct  421   GMEIDNDVKRDEVEKLVRELMEGEKGKKMKRKANEWKKLAEE-ATGPHGSSIKNLDFVVN  479

Query  1496  KFL  1504
               L
Sbjct  480   NVL  482



>ref|XP_010910271.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=476

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/479 (61%), Positives = 365/479 (76%), Gaps = 7/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP+PAQGH+ P+LKLAK+L+ +GF+ITFVN+ FNH RLLRS    
Sbjct  1     MGSIPE---KPHAVCIPYPAQGHVTPLLKLAKLLHVRGFYITFVNTHFNHNRLLRSGAIS  57

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN---QSGPPV  427
             S+  LP FRFE+IPDGLPPSD DATQD+ +LC+SI +NCL PF+DLI +LN      P V
Sbjct  58    SLDSLPDFRFESIPDGLPPSDEDATQDVPSLCDSIPKNCLPPFRDLITKLNGPSSPTPKV  117

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLDAA+E  IPE+LFWT  A G +G++ Y+ + ++G  PLKD+S   NG
Sbjct  118   SCIVSDGVMSFTLDAAKELQIPEVLFWTTSACGMMGYLHYQHLTERGIFPLKDASDLTNG  177

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YLDT +DW+ GM  VRLRDLP+F+RT +P D +  Y     +R+   SAI++NTFD  E+
Sbjct  178   YLDTPIDWISGMKNVRLRDLPTFLRTLDPKDIMFNYCNREAQRSSMGSAIILNTFDEFER  237

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
               L+ + SMLPP+Y  GP     +Q+    + ++  +LWKEDT+C+EWL   +P SVVYV
Sbjct  238   FVLDAMASMLPPIYTIGPLSLLSRQITTGPLTSISSNLWKEDTTCLEWLQGREPGSVVYV  297

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             N+GSITVMT +QL+EF WGLAN+K  FLW+IRPDLV G+ AVLP+EF+ ET+ERG+LA+W
Sbjct  298   NYGSITVMTNEQLIEFTWGLANSKHDFLWVIRPDLVKGDTAVLPQEFLNETKERGLLANW  357

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE V+SHP++G FLTHSGWNSTLESIC GVP+I WPFFA+QQTNC Y CT+WGIGMEI
Sbjct  358   CPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPVISWPFFAEQQTNCRYACTEWGIGMEI  417

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D +VKR +VERLVRELM GEKG EMRR+A+E K+ A   AT P GSS+ N E ++ + L
Sbjct  418   DNNVKRGDVERLVRELMVGEKGKEMRRRAVEWKESAT-RATQPGGSSFQNFERLVKEAL  475



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 366/480 (76%), Gaps = 11/480 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHI+PMLKLAK+L+ +GFHITFVN+ FNH RLL+SRGP S+ GLP FR
Sbjct  6     KPHAVCIPYPAQGHISPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPDFR  65

Query  284   FETIPDGLPPSD--VDATQDIATLCESITQNCLGPFKDLIARLNQSG-------PPVSCI  436
             FE+IPDGLPP++   DATQDI +LCES  + CL PF+ L+ +LN +        PPVSC+
Sbjct  66    FESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVSCV  125

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSD  M FTL A EEFGIP  LFWT  A G LG+  Y  +++KGF+P KD S F NGYLD
Sbjct  126   VSDASMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGYLD  185

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             T++DW+  +  +RL+DLPSFIRTTNP+D +VKY++ + +   + SAI+ NTFD+LE+  L
Sbjct  186   TLIDWIPAVNDIRLKDLPSFIRTTNPNDFMVKYVIRLIKLMSTGSAIIFNTFDSLERNVL  245

Query  797   NGLQSMLP-PVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
               L SM+P P+Y  GP        +   + ++  +LW E+  C++WL++ D  S+VYVNF
Sbjct  246   EALSSMIPCPIYTLGPLHLLVNNTQPKSLSSIASNLWVEELECLQWLDSKDSKSIVYVNF  305

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSIT +T +QL+EFAWGLAN+KKPF+WIIRPDLV G+ A+LP EFVEETRER +++SWCP
Sbjct  306   GSITAVTPEQLIEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWCP  365

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QE+V+SHPA+GGFLTH GWNSTLES+ +GVPMICWPFFA+QQTNC + C  WG GMEI+ 
Sbjct  366   QEEVLSHPAIGGFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCNYWGSGMEINP  425

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSPN  1513
             +VKR +VE+LVRELM GEKG++MR KAME K  A + AT   GSS  N++ +I+K L P+
Sbjct  426   NVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHE-ATELGGSSLVNLDNIISKVLVPS  484



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/471 (61%), Positives = 362/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  98    GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPS  277
             G KPH VC+P+PAQGHINPM+K+AK+ + +GFH+TFVN+ +NH RLLRSRG  +V GLPS
Sbjct  9     GQKPHVVCVPYPAQGHINPMMKVAKLFHIRGFHVTFVNTVYNHNRLLRSRGAHAVNGLPS  68

Query  278   FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGG  451
             FRFE+IPDGLP +DVD TQDI  LC S  +NCL PFK+L+ ++N     PPVSCI+SDG 
Sbjct  69    FRFESIPDGLPETDVDVTQDITALCASTMKNCLTPFKELLRQINAGDDVPPVSCILSDGC  128

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLDAAEE G+PE+LFWT  A GF+ ++ +   ++ G SPLKD SY    YLDTV+D 
Sbjct  129   MSFTLDAAEELGVPEVLFWTVSACGFMAYLHFYRFVEMGLSPLKDESYLTKEYLDTVIDC  188

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             +  M  ++L+D+PSFIRTTN DD ++ +++  TERAK ASAI++NTFD LE + L  +QS
Sbjct  189   IPSMKNLKLKDIPSFIRTTNSDDIMLNFVLRETERAKRASAIILNTFDDLEHDILLSMQS  248

Query  812   MLPPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSIT  985
             +LPPVY+ GP      +   EDS +  +G +LWKE+T C++WL+     SVVYVNFGSIT
Sbjct  249   ILPPVYSVGPLHLLANREITEDSEIGKMGSNLWKEETECLDWLDNKPQNSVVYVNFGSIT  308

Query  986   VMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQV  1165
             VMTA QLVEFAWGLA + K FLW+IRPDLV+GEEA++P EF+ ET +R MLASWCPQE+V
Sbjct  309   VMTAKQLVEFAWGLAGSGKQFLWVIRPDLVAGEEAMVPPEFLTETADRRMLASWCPQEKV  368

Query  1166  ISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKR  1345
             +SHPA+GGFLTHSGWNSTLES+  GVPM+CWPFFA+QQTNC + C +W +G+EI  DVKR
Sbjct  369   LSHPAIGGFLTHSGWNSTLESLSGGVPMVCWPFFAEQQTNCKFTCDEWEVGIEIGGDVKR  428

Query  1346  CEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
              EVE +VRELM GEKG +MR KA E ++LA++A     GSS  N E V+NK
Sbjct  429   EEVEAVVRELMDGEKGKKMREKAEEWRRLAKEATEHKLGSSVVNFETVVNK  479



>ref|XP_008219458.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=471

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/466 (61%), Positives = 376/466 (81%), Gaps = 5/466 (1%)
 Frame = +2

Query  122   IPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFETIPD  301
             +PFPAQGHINPMLKLAK+L+ KGFHITFVN+EF H+RLL+S+GP S+ GLP+FRFE IPD
Sbjct  1     MPFPAQGHINPMLKLAKLLHFKGFHITFVNTEFIHKRLLKSQGPNSLNGLPTFRFEMIPD  60

Query  302   GLPPSDVD-ATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMFFTLDA  472
             GLPP+D + A Q + +LC+SI ++CL PF+ L+++LN S   PPV+C+VSDG M F+LDA
Sbjct  61    GLPPADANVAAQHMPSLCQSIRKHCLQPFRGLLSKLNCSPNSPPVTCVVSDGIMNFSLDA  120

Query  473   AEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGMPGV  652
             A+E GIP ++FWT  A  F+G++ Y  +I KG  PLKD+SY  NGYLDTV+DW+ GM  +
Sbjct  121   AQELGIPGVIFWTTSACAFMGYIQYGPLIQKGLVPLKDASYLTNGYLDTVIDWIPGMKSI  180

Query  653   RLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPPVYA  832
             RL+D+PSFIRTT+P+D I+  I++ TER+K ASAI++NTFDALE E L+ L ++LPP+Y 
Sbjct  181   RLKDIPSFIRTTDPNDLIMDLIMVDTERSKRASAIILNTFDALEHEVLDALTTLLPPIYC  240

Query  833   AGPFQF-FEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQLV  1009
              GP     +    D+ ++++G +LW E+T C++WL++ +P SVVYVNFGS TVMT++QL 
Sbjct  241   IGPLYLQLDHIPADNELKSIGSNLWTEETECLQWLDSKEPNSVVYVNFGSSTVMTSEQLT  300

Query  1010  EFAWGLANTKKPFLWIIRPDLVS-GEEAVLPREFVEETRERGMLASWCPQEQVISHPAVG  1186
             EFAWGLAN+KK F W+IRPDLV  G+  V+  EFVEET+ERG+LASWCPQEQV+SHPA+G
Sbjct  301   EFAWGLANSKKAFFWVIRPDLVGEGKSVVVAPEFVEETKERGLLASWCPQEQVLSHPAIG  360

Query  1187  GFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERLV  1366
             GFLTH+GWNST+ES+  GVPMICWPF ADQQTNC +CC++WGIG+EI+ DVKR  +E LV
Sbjct  361   GFLTHNGWNSTIESVGGGVPMICWPFNADQQTNCRFCCSEWGIGLEIEGDVKRYYIEGLV  420

Query  1367  RELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             RELM GE+G ++R+KA E KKLA++A T   GSS+ ++++++NK L
Sbjct  421   RELMEGEEGKKLRKKASEWKKLAKEATTGSNGSSFLDLDQMVNKVL  466



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 361/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+PF AQGHINPMLK+AKIL+ KGFH+TFVN+ +NHRRLLRSRGP+++ GLPSF+
Sbjct  11    KPHVVCVPFAAQGHINPMLKVAKILHAKGFHVTFVNTNYNHRRLLRSRGPKALNGLPSFQ  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             +E+IPDGLP ++ DATQDI  LC S  +NCL PFK+L+ R+N  +  PPVSCIVSDG M 
Sbjct  71    YESIPDGLPETNEDATQDIPLLCASTKKNCLAPFKELLRRINTAEDVPPVSCIVSDGTMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+P +  WT  A GFL ++ +  +I+KG SPLKD SY    +LDT +DW+ 
Sbjct  131   FTLDAAEELGVPNVALWTTSACGFLAYLHFHRIIEKGLSPLKDESYLTKEHLDTKIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+P+FIRTTNPDD ++ Y V  T+R K ASAI++NTFD LE + +  ++S++
Sbjct  191   SMRNLRLKDIPTFIRTTNPDDIMLNYFVDETDRIKRASAIILNTFDELEHDTIQSIKSII  250

Query  818   PPVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             P VY+ GP Q     +  +DS    +  +LW+ED  C++WL+T  P SV+YVNFGSITVM
Sbjct  251   PQVYSIGPLQLLVNREMDKDSETGKMETNLWREDRECLDWLDTKSPNSVIYVNFGSITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             +A  LVEFAWGLA TKK FLW+IRPDLV G+ A++P EF+ ET +R MLASWCPQE+V+S
Sbjct  311   SAKHLVEFAWGLAATKKDFLWVIRPDLVVGDVAMVPPEFLIETADRRMLASWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPAVGGFLTHSGWNSTLES+  GVPM+CWPFFA+QQTNC YCC +W +GMEI  DV+R E
Sbjct  371   HPAVGGFLTHSGWNSTLESLSCGVPMLCWPFFAEQQTNCKYCCDEWEVGMEISGDVRREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE L+RELM G+KG +MR KA E ++LAE+A     GSS  + E V+ K L
Sbjct  431   VEELIRELMDGDKGKKMREKAEEWRRLAEEATKHMCGSSERSFEMVVGKVL  481



>ref|XP_008229475.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X1 [Prunus 
mume]
Length=485

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 360/475 (76%), Gaps = 10/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP PAQ HI  MLK AK+L+H+GFHITFVN+EFNH+R L+S G  S+ GLP FR
Sbjct  9     KPHAVCIPVPAQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGSNSLDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQ------SGPPVSCIVS  442
             FE IPD LP SD DATQD+  LCES+  QN L PF  L+A+LN       S PPV+CIVS
Sbjct  69    FEAIPDSLPDSDEDATQDVTLLCESVRKQNLLAPFHALLAKLNNDAISTSSNPPVTCIVS  128

Query  443   DGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             DG M  FT+ AAE+ G P +LF+T  A  F+G   +R V+ KG +PLKD S F NGYLDT
Sbjct  129   DGFMSTFTITAAEQIGAPIVLFYTIAACSFMGCKQFRAVVKKGLAPLKDESCFTNGYLDT  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  +RLRDLP+F++TTN DD +  +I+  T+RA  ASA++++TFDALE + L+
Sbjct  189   VIDWIPGMRDIRLRDLPTFLQTTNADDTMFNFIMEATDRAHEASAVVLHTFDALEPDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L SMLP VY  GP Q    Q+ +  ++ +G SLWKE+T C+EWLNT  P SVVYVNFGS
Sbjct  249   ALSSMLPHVYTVGPLQLHLNQIPEHPLK-MGYSLWKEETECLEWLNTEAPNSVVYVNFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I VMT +QLVEF WGLANTK PF W+IRPDLV GE A+LP EFV ET+ER ++A WCPQE
Sbjct  308   IAVMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFF DQQ +C Y C +WGIGMEI  DV
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LV+ELM GEKG +M+ K ME KKLAE+ AT P GSS  N++ ++N+ L
Sbjct  428   KRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVL  481



>ref|XP_008386293.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=911

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/471 (62%), Positives = 379/471 (80%), Gaps = 9/471 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIPFPAQGHI PML+LAK+LN+KGFHITFVN+EFNH+RLLRSRGP+S+ GLPSFR
Sbjct  441   KPHAVCIPFPAQGHITPMLQLAKLLNYKGFHITFVNTEFNHKRLLRSRGPDSLDGLPSFR  500

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ--SGPPVSCIVSDGGMF  457
             FETIPDGLPP+DV+ATQDI+TLC SI + CL PF+DLI++LN   + PPV+CIVSD GM 
Sbjct  501   FETIPDGLPPTDVNATQDISTLCLSIRKTCLAPFRDLISKLNSLPNSPPVTCIVSDVGMT  560

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
              TLDAA+E GIP+++F T  A G +  + YR +I+KGF PLKD++Y     LDTVLDW+ 
Sbjct  561   LTLDAAQELGIPDVMFQTASACGLMCCLQYRPLIEKGFIPLKDANY-----LDTVLDWIP  615

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERA-KSASAIMVNTFDALEQEALNGLQSM  814
             GM  +RL D+PSF+RT +P+D ++  +++  ERA + ASAI++NTFDALE + ++ L ++
Sbjct  616   GMKNIRLGDVPSFLRTKDPNDIMLDVLMVELERAQRRASAIILNTFDALEHDVVDALLTL  675

Query  815   LPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             LPPVY+ GP      Q+  D+ +  +G +LW  ++ C+EWL++ +P SVVYVNFGSITVM
Sbjct  676   LPPVYSIGPLYLQLNQIPADNKLNLIGSNLWTNESECLEWLDSKEPNSVVYVNFGSITVM  735

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             TA+QL EFAWGLAN+   FLW+IRPDLV G+ +V+P EF  +T+ER +LASWCPQEQV++
Sbjct  736   TAEQLTEFAWGLANSNMTFLWVIRPDLVGGDSSVVPAEFFVQTKERSLLASWCPQEQVLN  795

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTH GWNSTLES+C GVPMI WPFFA+QQTNC +CC +WG+GMEI+ +VKR  
Sbjct  796   HPAIGGFLTHCGWNSTLESLCGGVPMIIWPFFAEQQTNCRFCCKEWGVGMEIEGEVKRDY  855

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE LVR+LM GE+G  MR+KA+E KKLA++A T P G S+ +++++IN+ L
Sbjct  856   VEGLVRKLMEGEEGKVMRKKALEWKKLAKEATTGPNGLSFLDLDKIINQVL  906



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 365/480 (76%), Gaps = 11/480 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAK+L+ +GFHITFVN+ FNH R+L+SRGP S+ GLP FR
Sbjct  6     KPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRILKSRGPNSLDGLPDFR  65

Query  284   FETIPDGLPPSD--VDATQDIATLCESITQNCLGPFKDLIARLNQSG-------PPVSCI  436
             FE+IPDGLPP++   DATQDI +LCES  + CL PF+ L+ +LN +        PPVSC+
Sbjct  66    FESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVSCV  125

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSD  M FTL A EEFGIP  LFWT  A G LG+  Y  +++KGF+P KD S F NGYLD
Sbjct  126   VSDAAMPFTLKAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGYLD  185

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             T++DW+  +  +RL+DLPSFIRTTNP++ +VKY++ + +   + SAI+ NTFDALE   L
Sbjct  186   TLIDWIPVVNDIRLKDLPSFIRTTNPNEFMVKYVIRLIKLTSTGSAIIFNTFDALEHNVL  245

Query  797   NGLQSMLP-PVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
               L SM P P+Y  GP      + +   + ++  +LW E+  C++WL++ D  S+VYVNF
Sbjct  246   EALSSMFPCPIYTLGPLHLLVNKTQPKSLSSIASNLWVEELECLQWLDSKDSKSIVYVNF  305

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSIT +T +QL+EFAWGLAN+KKPF+WIIRPDLV G+ A+LP EFVEETRER +++SWCP
Sbjct  306   GSITAVTPEQLIEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWCP  365

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QE+V+SHPA+GGFLTH GWNSTLES+ +GVPMICWPFFA+QQTNC + C  WG GMEI+ 
Sbjct  366   QEEVLSHPAIGGFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCDYWGSGMEINP  425

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSPN  1513
             +VKR +VE+LVRELM GEKG++MR KAME K  A + AT   GSS  N++ +I+K L P+
Sbjct  426   NVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHE-ATELGGSSLVNLDNIISKVLVPS  484



>ref|NP_173653.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
 sp|Q9ZWJ3.1|U85A2_ARATH RecName: Full=UDP-glycosyltransferase 85A2 [Arabidopsis thaliana]
 gb|AAF87256.1|AC068562_3 Identical to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain. ESTs gb|T46254, gb|R83990, gb|H37246, gb|W43072, 
gb|R90721, gb|R90712, gb|AA712612, gb|AA404770 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48781.1|AF332418_1 putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 dbj|BAA34687.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AEE30232.1| UDP-glucosyl transferase 85A2 [Arabidopsis thaliana]
Length=481

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 365/480 (76%), Gaps = 6/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS   +  K H VC+P+PAQGHINPM+K+AK+L  KGFHITFVN+ +NH RLLRSRGP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             +V GLPSFRFE+IPDGLP +DVD TQDI TLCES  ++CL PFK+L+ ++N     PPVS
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQINARDDVPPVS  118

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SP+KD SY    +
Sbjct  119   CIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTKEH  178

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+  M  +RL+D+PSFIRTTNPDD ++ +I+   +RAK ASAI++NTFD LE +
Sbjct  179   LDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTFDDLEHD  238

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              +  ++S++PPVY+ GP    E+Q   E S +   G +LW+E+T C++WLNT    SVVY
Sbjct  239   VIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSVVY  298

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITV++A QLVEFAWGLA T K FLW+IRPDLV+G+EA++P EF+  T +R MLAS
Sbjct  299   VNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRMLAS  358

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SHPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC +   +W +G+E
Sbjct  359   WCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVGIE  418

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I  DVKR EVE +VRELM  EKG  MR KA E ++LA +A     GSS  N E ++NK L
Sbjct  419   IGGDVKREEVEAVVRELMDEEKGKNMREKAEEWRRLANEATEHKHGSSKLNFEMLVNKVL  478



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/492 (60%), Positives = 381/492 (77%), Gaps = 11/492 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI G   KPHAVCIP+PAQGHINPMLKLAK+LN +GFHITFVN+ +N+RRLL+SRGP 
Sbjct  1     MDSI-GVADKPHAVCIPYPAQGHINPMLKLAKLLNSRGFHITFVNTXYNYRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PP  424
             S+ GL  FRFETIPDGLPPSD DATQDI TLC S   +CL PF+ L+++LN S     PP
Sbjct  60    SLSGLVDFRFETIPDGLPPSDTDATQDIPTLCNSTKNSCLLPFRTLLSKLNNSSSSNIPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             ++CI+SDG M FTLDAAEE GIPE+LFWT  A GF+ +V Y  +I++  +PLKD+SY  N
Sbjct  120   ITCIISDGVMSFTLDAAEELGIPEVLFWTTSACGFMSYVHYPYLIERCLTPLKDASYLTN  179

Query  605   GYLDTVLDWVKG-MPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
             GYL+T +DW+ G M  +RLRDLPSF+RTTNPDD ++ ++    ERAK A  I++NTFD L
Sbjct  180   GYLETTIDWIPGLMKDIRLRDLPSFVRTTNPDDIMLNFLKEEVERAKRAQGIILNTFDTL  239

Query  782   EQEALNGLQSMLPPVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             E++ L+GL SM   VY+ GP   F   Q  E+  ++++  +LWKE+  C+EWL++  P S
Sbjct  240   ERKVLDGLSSMFCRVYSVGPLHLFASNQISENDDLKSIDSNLWKEEAGCMEWLDSKKPNS  299

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVMT +QLVEFAWGLAN+ + FLW+IRPDLV G+ A+LP EFV+ T+ERG+
Sbjct  300   VVYVNFGSITVMTGEQLVEFAWGLANSNQTFLWVIRPDLVKGDSALLPPEFVQHTKERGL  359

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCT--QW  1309
             LA+WCPQEQ+++HP++G FLTH GWNSTLESIC+GVPM+CWPFFA+QQTNC Y CT  +W
Sbjct  360   LANWCPQEQILNHPSIGVFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCRYTCTESEW  419

Query  1310  GIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEV  1489
             GIGMEI+ DVKR +VE LVR+L+ G+KG E++ K ME KK A++A     GSS  N +++
Sbjct  420   GIGMEINNDVKRDDVESLVRQLINGDKGKELKNKVMEWKKKAQEAICL-GGSSRLNFDKM  478

Query  1490  INKFLSPN*NTS  1525
             I++ L  N N++
Sbjct  479   IDQVLLSNSNSN  490



>ref|XP_002308831.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
 gb|EEE92354.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
Length=480

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/471 (60%), Positives = 366/471 (78%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP PAQ HI  MLKL+K+L++KGFHIT+VN+EFNH+RLL+SRGP+++ GLP FR
Sbjct  9     KPHAVCIPSPAQSHIKSMLKLSKLLHYKGFHITYVNTEFNHKRLLKSRGPDAMNGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDGG  451
             FE+IPDGLPPS+ + TQD+A LCE+  +N L PF DL+ +LN S     PPV+CIVSDG 
Sbjct  69    FESIPDGLPPSNENETQDVAALCEAAKKNLLAPFNDLLDKLNDSASSNVPPVTCIVSDGF  128

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M   +DAAE   IP  LF+T  A  F+GF  ++ + +KG +PLKD S+  NGYLD V+DW
Sbjct  129   MPVAIDAAEMRQIPIALFFTISASSFMGFKQFQALREKGLTPLKDESFLTNGYLDKVVDW  188

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             + GM  +RLRDLPSF+RTT+P+D I KY +  T RA   SA++ +TFD LEQE LN L S
Sbjct  189   IPGMRDIRLRDLPSFVRTTDPNDFIFKYCLECTGRASEGSAVIFHTFDVLEQEVLNALYS  248

Query  812   MLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             M P V+A GP Q    Q+++  + ++G +LWKE+  C++WL++N P SV+YVNFGSIT +
Sbjct  249   MFPRVHAIGPLQLLLNQIQEVYLSSIGCNLWKEEVECLQWLDSNKPKSVIYVNFGSITTV  308

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T +QLVEF  GLA +  PFLWIIRPD+V+G+ A+LP EF EET+ER  + SWCPQE+V++
Sbjct  309   TKEQLVEFGMGLAKSGHPFLWIIRPDMVTGDSAILPPEFTEETKERSFICSWCPQEEVLN  368

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HP++GGFLTHSGW ST+ESI SGVPM+CWPFFADQQTNC Y C++WGIGMEID +VKR +
Sbjct  369   HPSIGGFLTHSGWGSTIESISSGVPMLCWPFFADQQTNCRYTCSEWGIGMEIDNNVKRDK  428

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE+LVRELM GEKG  M++KAME KKLAE+ A+ P+GSS  N+++++ + L
Sbjct  429   VEKLVRELMEGEKGKSMKKKAMEWKKLAEE-ASGPSGSSSMNLDKLVKEVL  478



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 367/481 (76%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGSISGEGL-KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS +  G  KPHAVC+P+PAQGHINPMLK+AK+L+ +GFH+TFVN+ +NH RLLRSRG 
Sbjct  1     MGSAAVSGAQKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTIYNHNRLLRSRGA  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              ++ GLPSF+FE+IPDGLP +D +ATQDI  LCES  +NCL PFKDL+ ++N     PPV
Sbjct  61    NALDGLPSFQFESIPDGLPETDAEATQDIPALCESTMKNCLTPFKDLLQQINARDDVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLDAA+E G+PE+LFWT  A GFL ++ +   I+KG SPLKD SY    
Sbjct  121   SCIVSDGCMSFTLDAADELGVPEVLFWTTSACGFLAYLHFYRFIEKGLSPLKDESYLTEE  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             +LDT +DW+  M  +RL+D+P+FIR TN DD ++  ++  T+RAK ASAI++NTFD LE 
Sbjct  181   HLDTKIDWIPSMKNLRLKDIPTFIRATNHDDIMLNCLIRETDRAKRASAIILNTFDDLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSG--VRALGLSLWKEDTSCVEWLNTNDPISVV  961
             + L+ +QS+LP VY+ GP      +  + G  +  +G +LW+E+  C++WLNT    SVV
Sbjct  241   DVLHSIQSILPLVYSIGPLHLLANREIEKGSEIGKMGSNLWREEADCLDWLNTKTRNSVV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVMTA QLVEFAWGLA + K FLW+IRPDLV+GEEA++P EF++ET  R ML 
Sbjct  301   YVNFGSITVMTAKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPEFLKETAGRRMLV  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQE+V+SHPA+GGFLTH+GWNSTLES+C GVPM+CWPFFA+QQTNC + C +W +GM
Sbjct  361   SWCPQEKVLSHPAIGGFLTHNGWNSTLESLCGGVPMVCWPFFAEQQTNCKFTCDEWEVGM  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI  DVKR EVE +VRELM GEKG +MR KA E ++LA +A     GSS  N E V+NK 
Sbjct  421   EIGGDVKREEVEAVVRELMDGEKGKKMREKAEEWRRLAGEATEHKLGSSVVNFETVVNKA  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_006416205.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
 gb|ESQ34558.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
Length=483

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/474 (61%), Positives = 370/474 (78%), Gaps = 10/474 (2%)
 Frame = +2

Query  98    GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPS  277
             G KPHAVC+PFPAQGHI+PM K+AK+L+ KGFH+TFVN+ +NH RLLRSRG  ++ G PS
Sbjct  9     GQKPHAVCVPFPAQGHIDPMQKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGTNALDGFPS  68

Query  278   FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGG  451
             FRFE+IPDGLP  D DATQD  +LCE+  +NCL PFK+L+ R+N     PPVSCIVSDG 
Sbjct  69    FRFESIPDGLPEIDGDATQDPPSLCEATMKNCLAPFKELVRRINAEDDVPPVSCIVSDGV  128

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLD AEE G+PE+LFWT  A GF+ ++ +   I+KG SPLKD S+     LDT +DW
Sbjct  129   MSFTLDVAEELGVPEVLFWTTSACGFMAYLHFYRFIEKGLSPLKDESF-----LDTKIDW  183

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIV-KYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             +  M  +RLRD+PSFIR TNPDD I+  + +  T+RAK ASAI++NTFD LEQ+ +  +Q
Sbjct  184   IPSMRNLRLRDIPSFIRATNPDDHIILNFFLHETDRAKRASAIILNTFDDLEQDVIQSMQ  243

Query  809   SMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
             S+LPPV++ GP     +Q   EDS +  +G +LW+EDT+C++WL+T    SVVYVNFGS+
Sbjct  244   SILPPVHSIGPLHLLAKQEIGEDSEIGRMGSNLWREDTNCLDWLDTKPRNSVVYVNFGSV  303

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
             TVM+A QLVEFAWGLA+T+K FLW+IRPDLV+G+ AV+P EF++ET +R ML+SWCPQ++
Sbjct  304   TVMSAKQLVEFAWGLASTEKDFLWVIRPDLVAGDVAVVPTEFLKETEDRRMLSSWCPQQK  363

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V+SHPA+GGFLTH+GWNSTLESI SGVPM+CWPFFA+QQTNC +CC +W +GMEI  DVK
Sbjct  364   VLSHPAIGGFLTHNGWNSTLESISSGVPMVCWPFFAEQQTNCKFCCDEWEVGMEIGGDVK  423

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             R EVE +VRELM GEKG +MR KA E ++LAE+A     GSS +N + V++K L
Sbjct  424   REEVEAVVRELMDGEKGKKMREKAEEWRRLAENATEHMRGSSGSNFQMVVDKVL  477



>gb|ADV71371.1| glycosyltransferase GT14M03 [Pueraria montana var. lobata]
Length=485

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/478 (61%), Positives = 380/478 (79%), Gaps = 4/478 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVC+PFPAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL+SRGP+
Sbjct  1     MGSLEAIS-KPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+KGL SFRFETIPDGLP  DV+ TQ + +LC+   + CL  F++++++L  S   PPVS
Sbjct  60    SLKGLSSFRFETIPDGLPEPDVEVTQHVPSLCDYTRRTCLPHFRNVLSKLRDSPSVPPVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAA+EFG+P +LFWT  A GF+ +V Y+ +I++G +PLKD+SY  NGY
Sbjct  120   CIVSDGIMSFTLDAAQEFGVPNVLFWTTSACGFMCYVQYQQLIERGLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T +DW+ G+  ++L+D+P+FIRTT+PDD ++ +      RA+ ASAI++NTFDALE +
Sbjct  180   LETAIDWIPGIKEIQLKDIPTFIRTTDPDDIMLNFGRGECIRAQKASAIILNTFDALEHD  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
              L    S+LPPVY+ GP  F    V D  + A+G +LWKE+  C+EWL+T +  +VVYVN
Sbjct  240   ILEAFSSILPPVYSIGPLNFLLNDVTDKDLNAIGSNLWKEEPGCLEWLDTKEANTVVYVN  299

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGS+TVMT DQL+EFAWGLAN+ K F+W+IRPDLV GE AVLP EFV ET+ RG+L+SWC
Sbjct  300   FGSVTVMTNDQLIEFAWGLANSNKTFVWVIRPDLVVGENAVLPPEFVTETKNRGLLSSWC  359

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
             PQEQV++HPA+GGFLTH+GWNSTLES+C GVPMICWPFFA+Q TNC +CC +WGIG+EI 
Sbjct  360   PQEQVLAHPAIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQHTNCRFCCKEWGIGLEIG  419

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              DV+R ++E LVRELM GEKG EM++KA+E K LA+ AA+ P GSS+ + E++I + L
Sbjct  420   -DVERDKIESLVRELMDGEKGKEMKKKALEWKTLAQKAASGPNGSSFVHFEKMIREVL  476



>gb|AAL32657.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAM13356.1| UDP-glucose glucosyltransferase [Arabidopsis thaliana]
Length=481

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 364/480 (76%), Gaps = 6/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS   +  K H VC+P+PAQGHINPM+K+AK+L  KGFHITFVN+ +NH RLLRSRGP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             +V GLPSFRFE+IPDGLP +DVD TQDI TLCES  ++CL PFK+L+ ++N     PPVS
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQINARDDVPPVS  118

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SP+KD SY    +
Sbjct  119   CIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTKEH  178

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+  M  +RL+D+PSFIRTTNPDD ++ +I+    RAK ASAI++NTFD LE +
Sbjct  179   LDTKIDWIPSMKDLRLKDIPSFIRTTNPDDIMLNFIIREANRAKRASAIILNTFDDLEHD  238

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              +  ++S++PPVY+ GP    E+Q   E S +   G +LW+E+T C++WLNT    SVVY
Sbjct  239   VIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSVVY  298

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITV++A QLVEFAWGLA T K FLW+IRPDLV+G+EA++P EF+  T +R MLAS
Sbjct  299   VNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRMLAS  358

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SHPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC +   +W +G+E
Sbjct  359   WCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVGIE  418

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I  DVKR EVE +VRELM  EKG  MR KA E ++LA +A     GSS  N E ++NK L
Sbjct  419   IGGDVKREEVEAVVRELMDEEKGKNMREKAEEWRRLANEATEHKHGSSKLNFEMLVNKVL  478



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/482 (59%), Positives = 367/482 (76%), Gaps = 6/482 (1%)
 Frame = +2

Query  77    MGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS I     KPH VC+P+PAQGHINPM+K+AK+L+ +GFH+TFVN+ +NH R LRSRG 
Sbjct  1     MGSQIVHNSQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSRGS  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              +++GLPSFRFE+IPDGLP +D+DATQDI  LCES  +NCL PF++L+ ++N     PPV
Sbjct  61    NALEGLPSFRFESIPDGLPETDMDATQDITALCESTMKNCLAPFRELLQQINAGDNVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD AEE G+PE+LFWT     FL ++ + L I+KG SPLKD SY    
Sbjct  121   SCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLSPLKDESYLTKE  180

Query  608   YLD-TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             YLD TV+D++  M  ++L+D+PSFIRTTNPDD ++ + +  TERAK ASAI++NTFD LE
Sbjct  181   YLDDTVIDFIPTMKNLKLKDIPSFIRTTNPDDVMINFALHETERAKRASAIILNTFDDLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
              + +  +QS+LPPVY+ GP      +   E S +  +  +LWKE+  C++WL+T    SV
Sbjct  241   HDVVQTMQSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWKEEMECLDWLDTKTKNSV  300

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             +Y+NFGSITV++  QLVEFAWGLA + K FLW+IRPDLV+GEEAV+P EF+ ET++R ML
Sbjct  301   IYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAVVPPEFLTETKDRSML  360

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V+SHPA+GGFLTH GWNS LES+ SGVPM+CWPFFADQQ NC +CC +W +G
Sbjct  361   ASWCPQEKVLSHPAIGGFLTHCGWNSILESLSSGVPMVCWPFFADQQMNCKFCCDEWDVG  420

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             +EI  DVKR EVE +VRELM GEKG +MR+KA+E ++LA  A     GSS  N E VI+K
Sbjct  421   IEIGGDVKREEVETVVRELMDGEKGKKMRQKAVEWRRLARGATEHKLGSSVVNFETVISK  480

Query  1499  FL  1504
             +L
Sbjct  481   YL  482



>gb|AHL38933.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=481

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/480 (60%), Positives = 364/480 (76%), Gaps = 6/480 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS   +  K H VC+P+PAQGHINPM+K+AK+L  KGFHITFVN+ +NH RLLRSRGP 
Sbjct  1     MGSHVAQ--KQHVVCVPYPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPN  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             +V GLPSFRFE+IPDGLP +DVD TQDI TLCES  ++CL PFK+L+ ++N     PPVS
Sbjct  59    AVDGLPSFRFESIPDGLPETDVDVTQDIPTLCESTMKHCLAPFKELLRQINARDDVPPVS  118

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SP+KD SY    +
Sbjct  119   CIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLYYYRFIEKGLSPIKDESYLTKEH  178

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+  M  +RL+D+PSFIRTTNPDD ++ +I+   +RAK ASAI++NT D LE +
Sbjct  179   LDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTLDDLEHD  238

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              +  ++S++PPVY+ GP    E+Q   E S +   G +LW+E+T C++WLNT    SVVY
Sbjct  239   VIQSMKSIVPPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSVVY  298

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITV++A QLVEFAWGLA T K FLW+IRPDLV+G+EA++P EF+  T +R MLAS
Sbjct  299   VNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRMLAS  358

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SHPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC +   +W +G+E
Sbjct  359   WCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVGIE  418

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I  DVKR EVE +VRELM  EKG  MR KA E ++LA +A     GSS  N E ++NK L
Sbjct  419   IGGDVKREEVEAVVRELMDEEKGKNMREKAEEWRRLANEATEHKHGSSKLNFEMLVNKVL  478



>ref|XP_006304493.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
 gb|EOA37391.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
Length=488

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/481 (58%), Positives = 364/481 (76%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS + G   KPH VC+P+PAQGHINPM+K+AK+L+ +GFH+TFVN+ +NH+R LRSRG 
Sbjct  1     MGSHVVGNTQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTIYNHKRFLRSRGS  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              ++ GLPSFRFE+IPDGLP +D+D TQDI  LCES  +NCL PF++LI R+N     PPV
Sbjct  61    NALDGLPSFRFESIPDGLPETDMDTTQDITALCESTMKNCLAPFQELIQRINAGDNVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD AEE G+PE+LFWT     FL ++ + L I+KG SP+KD SY    
Sbjct  121   SCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGISPMKDESYLTKE  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             +LDTV+D++  M  ++L+D+PSFIRTTNPDD ++K+ +  TERA+ ASAI++NTFD LE 
Sbjct  181   HLDTVIDFIPSMKNLKLKDIPSFIRTTNPDDAVLKFALHETERARRASAIILNTFDDLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
               +  +Q +LPPVY+ GP      +   E S V  +  +LWKE+  C++WL+T    SV+
Sbjct  241   GVIQAMQPLLPPVYSVGPLHLLANREIEEGSEVGMMNSNLWKEEMKCLDWLDTKTQNSVI  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             Y+NFGSITV++ +QL+EFAWGLA + K FLW+IRPDLV GEEAV+P EF+ ET +R MLA
Sbjct  301   YINFGSITVLSREQLIEFAWGLAGSGKEFLWVIRPDLVGGEEAVVPSEFLTETADRRMLA  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQE+V+SHPAVGGFLTH GWNS LES+  GVPM+CWPFFADQQTNC +CC +W +G+
Sbjct  361   SWCPQEKVLSHPAVGGFLTHCGWNSILESLSGGVPMVCWPFFADQQTNCKFCCDEWEVGI  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             E   DVKR EVE +VRELM G+KG +MR KA E ++L E+A     GSS+ N + V++KF
Sbjct  421   ETGGDVKRGEVEAVVRELMDGDKGKKMREKAGEWRRLVEEATELKLGSSFVNFQTVVSKF  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_010535401.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535409.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/483 (60%), Positives = 363/483 (75%), Gaps = 7/483 (1%)
 Frame = +2

Query  77    MGSISGEG-LKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MG  +  G  KPHAVCIP+PAQGHINPM+K+AK+L+ +GFH+TFVN+EFNHRR LRSRGP
Sbjct  1     MGKHADSGSQKPHAVCIPYPAQGHINPMMKVAKLLHARGFHVTFVNTEFNHRRFLRSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PP  424
              ++ GL SFRFETIPDGLP SD+DATQDI  LC+S  +NCL PF++L+ RLN +G   P 
Sbjct  61    HALDGLRSFRFETIPDGLPESDLDATQDIPALCQSTMKNCLSPFRELLQRLNATGGDIPS  120

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSC+V DG M F +DAA EFGIP ++ WT  A   + +  YR +I KG  PLKD SY  N
Sbjct  121   VSCVVYDGAMSFAVDAAAEFGIPAVMLWTFSASVSMLYFYYRQLIQKGLIPLKDESYMTN  180

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPD-DPIVKYIVLITERAKSASAIMVNTFDAL  781
             GYLDT ++W+  +  +R++DLP    TT  + DPI+++++   +R K ASAI++NTF  L
Sbjct  181   GYLDTEIEWIPSIRNIRVKDLPGLFSTTKLEHDPILQFVLHAMDRVKLASAIVINTFHDL  240

Query  782   EQEALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             E + +  LQS+LPPVY  GP      +    DS +R LG +LWKEDT C++WL+T  P S
Sbjct  241   EHDVILSLQSLLPPVYPVGPLHLLVNRTIDNDSEIRRLGSNLWKEDTECLKWLDTKAPRS  300

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             V+YVNFGSITVM+  QLVEFAWGLA + K FLW+IRPDL+ GE AV+P EFV ET ERG+
Sbjct  301   VIYVNFGSITVMSEKQLVEFAWGLAGSGKEFLWVIRPDLLGGETAVVPPEFVAETAERGL  360

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             LASWCPQE+V+SHPA+GGFLTH GWNSTLESI  GVP+ICWPFFADQ TN  +CC +WG+
Sbjct  361   LASWCPQEKVLSHPAIGGFLTHCGWNSTLESISGGVPVICWPFFADQSTNRRFCCDEWGM  420

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEI +D KR EVE +VRELM GEKG++MR    +L++LAE A T P+GSS+ N E V++
Sbjct  421   GMEIGSDAKREEVEAVVRELMDGEKGNKMRETMEKLRRLAEAATTPPSGSSFVNFETVVD  480

Query  1496  KFL  1504
             K L
Sbjct  481   KVL  483



>ref|XP_009380209.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetin glucosyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=485

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/476 (60%), Positives = 362/476 (76%), Gaps = 3/476 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  E  KPHAVC+P+PAQGHI PMLKLAK+L+  GFH+TFVN+ FNH+RL+RSR   
Sbjct  1     MGSIPAE--KPHAVCVPYPAQGHITPMLKLAKLLHSHGFHVTFVNTLFNHKRLIRSRAIS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCI  436
             ++  LPSFRF +IPDGLPPSD DATQDI +LCE+I +  L PF+ ++ +LN+  PPVSCI
Sbjct  59    ALHALPSFRFASIPDGLPPSDEDATQDIPSLCEAIPRTALPPFRHVLRQLNEESPPVSCI  118

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSDG M FTLDAA+E G+PE++FWT  A GF+G++ Y+ + ++G +PLKD     +GYLD
Sbjct  119   VSDGVMTFTLDAAQELGVPEVVFWTTSACGFMGYLHYQHLRERGLTPLKDEGDITSGYLD  178

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
               +DW+ G   +RLRD PSFIRTT+P D ++ +     +RA  ASA+++NTF+ LE+  L
Sbjct  179   MPVDWIPGFDNMRLRDFPSFIRTTDPKDVMLNFCTREAQRASMASAVILNTFEELERPVL  238

Query  797   NGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
               + S+LP VY  GP     Q+V DS + ++  +LWKED+ C+EWL    P SVVYVNFG
Sbjct  239   EAMASILPAVYTVGPLTLLSQRVADSPLTSIHSNLWKEDSGCMEWLEGRRPGSVVYVNFG  298

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITVM+  QL+EFAWGLAN+   FLW+IRPDLV G+ AVLP+EFVEET+ERG+LASWCPQ
Sbjct  299   SITVMSNTQLLEFAWGLANSGYDFLWVIRPDLVRGDAAVLPQEFVEETKERGLLASWCPQ  358

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             E V+SH +VGGFLTHSGWNST+ESI  GVPM+ WPFFA+QQTNC Y CT+WGI MEID D
Sbjct  359   EAVLSHASVGGFLTHSGWNSTIESISGGVPMLSWPFFAEQQTNCRYACTEWGIAMEIDND  418

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR EVE L+R+LMGG+KG EMR+K ME  + A   AT P GSS+ N+E +I   +
Sbjct  419   VKREEVEALIRKLMGGDKGKEMRKKTMEWNEKAM-RATQPGGSSFVNLERLIKDVM  473



>ref|XP_008229476.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X2 [Prunus 
mume]
Length=485

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/475 (61%), Positives = 359/475 (76%), Gaps = 10/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP P Q HI  MLK AK+L+H+GFHITFVN+EFNH+R L+S GP S+ GLP FR
Sbjct  9     KPHAVCIPLPVQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ------SGPPVSCIVSD  445
             FE IPD LP S+ + TQD  +LCESI  N L PF  L+A+LN       S PPVSCIVSD
Sbjct  69    FEAIPDSLPDSNDNTTQDGTSLCESIRNNFLAPFHALLAKLNNDAIETSSNPPVSCIVSD  128

Query  446   GGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDS-SYFENGYLDT  619
             G M  FT+ AAEE G P +LF+T  A  F+G   +R V++KG +PLKD  S F NGYLDT
Sbjct  129   GLMSMFTITAAEEIGAPIVLFYTIAACSFMGIKQFRAVVEKGLAPLKDDESCFTNGYLDT  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  +RLRDLP+F++TTN DD +  +I+  T+RA  ASA++++TFDALE + L+
Sbjct  189   VIDWIPGMRDIRLRDLPTFLQTTNADDTMFNFIMEATDRAHEASAVVLHTFDALEPDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L SMLP VY  GP Q    Q+ +  ++ +G SLWKE+T C+EWLNT  P SVVYVNFGS
Sbjct  249   ALSSMLPHVYTVGPLQLHLNQIPEHPLK-MGYSLWKEETECLEWLNTEAPNSVVYVNFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I VMT +QLVEF WGLANTK PF W+IRPDLV GE A+LP EFV ET+ER ++A WCPQE
Sbjct  308   IAVMTPEQLVEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFF DQQ +C Y C +WGIGMEI  DV
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LV+ELM GEKG +M+ K ME KKLAE+ AT P GSS  N++ ++N+ L
Sbjct  428   KRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVL  481



>ref|XP_009103240.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=490

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 362/473 (77%), Gaps = 4/473 (1%)
 Frame = +2

Query  98    GLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPS  277
             G KPH +C+P+PAQGHINPMLK+AK+L+ +GFH+TFVN+ +NH RLLRSRGP +V+GLPS
Sbjct  9     GEKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGPHAVEGLPS  68

Query  278   FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGG  451
             FRFE+IPDGLP +DVD TQ+I  LC+S  +NCL PF +L+ R+N     PPVSCIV+DG 
Sbjct  69    FRFESIPDGLPETDVDVTQNITALCDSTMKNCLTPFNELLQRINAGDDVPPVSCIVADGC  128

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLDAAEE G+PE+LFWT GA  F+ ++ + L I+KG +P+K   Y  N YLDTV+D+
Sbjct  129   MSFTLDAAEELGVPEVLFWTTGASAFMIYLHFYLFIEKGLAPIKAEDYLTNEYLDTVIDF  188

Query  632   VKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
             +  M  ++ +D+PSFIRTTNPDD ++K+ +  TER+K ASAI++NTFD L+ + +  + S
Sbjct  189   MPSMKNLKFKDIPSFIRTTNPDDIMLKFALRETERSKRASAIILNTFDDLDHDVIQSMNS  248

Query  812   MLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSIT  985
             +LPPVY  GP      +   E S +  +G +LWKE+T C++WL+T  P S+VYVNFGSIT
Sbjct  249   ILPPVYPVGPLHVLANREIEEGSELGKMGSNLWKEETGCLDWLDTKAPNSIVYVNFGSIT  308

Query  986   VMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQV  1165
             V+TA QL EFAWGLA + K FLW+IRPDLV+G+EA++P EF+ ET +R MLASWCPQE+V
Sbjct  309   VITAKQLTEFAWGLAGSGKEFLWVIRPDLVAGDEAMVPPEFLTETADRRMLASWCPQEKV  368

Query  1166  ISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKR  1345
             + HPA+GGFLTH GWNSTLES+C GVPMICWPFFADQQTNC  CC +W +GME   DV+R
Sbjct  369   LCHPAIGGFLTHCGWNSTLESLCGGVPMICWPFFADQQTNCKNCCDEWEVGMETGGDVRR  428

Query  1346  CEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              E+E+++RELM GEKG +MR KA E  +LAE A     GSS  N E+V+   L
Sbjct  429   EEIEKVIRELMDGEKGKKMREKAAEWGRLAEAATEHERGSSVVNFEKVVKVLL  481



>ref|XP_006304665.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
 gb|EOA37563.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
Length=486

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/471 (60%), Positives = 363/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPMLK+AK+L+++GFH+TFVN+ +NH+RL+RSRG +++  +PSFR
Sbjct  11    KPHVVCVPYPAQGHINPMLKVAKLLHNRGFHVTFVNTVYNHKRLIRSRGTDALGRVPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             FE IPDGLP +DVDATQDI TL ES  +NCL PFK+LI R+N  +  PPVSCIV+DG M 
Sbjct  71    FEAIPDGLPETDVDATQDIPTLSESTEKNCLAPFKELIGRINTREDVPPVSCIVADGAMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLD AEE G+PE+LFWT    GF+ ++ Y L I+KG  P++D S     +LDTV+DW+ 
Sbjct  131   FTLDVAEELGVPEVLFWTPSGCGFMAYLHYYLFIEKGLCPVQDESCLTKEHLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  ++L+D+PSFIRTTNP+D +V +IV  T R K ASA+++NTFD LE + +  +QS+L
Sbjct  191   SMKNLKLKDIPSFIRTTNPNDIMVNFIVRETCRTKRASAVILNTFDDLEHDIIRSMQSIL  250

Query  818   PPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY  GP      +   EDS +  +GL+LWKE+T C+ WL+T    SVVYVNFGSIT+M
Sbjct  251   PPVYPIGPLHLLVNREIDEDSEIGRMGLNLWKEETECLNWLDTKSRNSVVYVNFGSITIM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T  Q++EFAWGLA T K FLW++RPDLV+GEEAV+P EF+ ET +R MLASWCPQE+V+S
Sbjct  311   TVTQILEFAWGLAATGKEFLWVMRPDLVAGEEAVIPTEFLTETADRRMLASWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTH GWNSTLES+  GVPM+CWPFFA+QQTNC + C +W +G+EI  DVKR E
Sbjct  371   HPAIGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA E ++LA+ A   P GSS  N E +++K L
Sbjct  431   VEAVVRELMDGEKGKKMREKAEEWRRLAQKATEQPCGSSVINFETIVSKVL  481



>dbj|BAB86928.1| glucosyltransferase-10 [Vigna angularis]
Length=485

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 368/469 (78%), Gaps = 3/469 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K HAVC+PFPAQGHINPMLKLAK+L+  GF+ITFVN+ +NH+RLL+SRG  S+ GLPSFR
Sbjct  9     KQHAVCVPFPAQGHINPMLKLAKLLHFNGFYITFVNTHYNHKRLLKSRGLNSLNGLPSFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN-QSG-PPVSCIVSDGGMF  457
             FETIPDGLP  +V+ T  + +LC+S +  CL  F++L+++LN +SG P VSCI+SDG M 
Sbjct  69    FETIPDGLPEPEVEGTHHVPSLCDSTSTTCLPHFRNLLSKLNNESGVPAVSCIISDGVMS  128

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDA++E G+P +LFWT  A GF+ +V Y  +I +G  P KD+S   NGYLDT +DWV 
Sbjct  129   FTLDASQELGLPNVLFWTSSACGFMCYVHYHQLIQRGIVPFKDASDLTNGYLDTTIDWVA  188

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             G+  +RL+D+PSFIRTT+P+D ++ +      RA+ ASAI++NTFDALE + L    S+L
Sbjct  189   GIKEIRLKDIPSFIRTTDPEDIMLNFARDECIRAEKASAIILNTFDALEHDVLEAFSSIL  248

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             PPVY+ GP  F    V D  + A+G +LW+E+  C+EWL+T +  +VVYVNFGS+TVMT 
Sbjct  249   PPVYSIGPLSFLLNNVTDKRLNAIGSNLWREEPGCLEWLDTKEANTVVYVNFGSVTVMTN  308

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
             +Q++EFAWGLAN+KK F+W+IRPDLV GE AVLP+EFV +T+ RGML+ WCPQEQV+ HP
Sbjct  309   EQMIEFAWGLANSKKSFVWVIRPDLVVGERAVLPQEFVTQTKNRGMLSGWCPQEQVLGHP  368

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             A+G FLTHSGWNSTLES+C+GVPMICWPFFA+QQTNC +CC +WGIG+EI+ DV+R  +E
Sbjct  369   AIGVFLTHSGWNSTLESLCAGVPMICWPFFAEQQTNCRFCCKEWGIGVEIE-DVERDHIE  427

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             RLVR +M GEKG +M+RKA+  K LAE AA+APTGSS+   +++I + L
Sbjct  428   RLVRAMMDGEKGKDMKRKAVNWKILAEKAASAPTGSSFVQFQKLIREVL  476



>ref|XP_008229792.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=484

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/486 (60%), Positives = 366/486 (75%), Gaps = 10/486 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SIS +  KPHAVCIP P Q HI  MLKLAK+L+HKGFHITFVN+EFNH+R L+S GP 
Sbjct  1     MSSISVDN-KPHAVCIPLPFQSHIKAMLKLAKLLHHKGFHITFVNTEFNHKRFLKSLGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-----GP  421
             S+ GLP FRFETIPDGLP S+ D+ QD   LC+S+ +NCL PF++LI +LN +      P
Sbjct  60    SLDGLPDFRFETIPDGLPDSE-DSAQDPYLLCDSVRKNCLAPFRNLIMKLNDTTSSNVNP  118

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
             PV+CIVSDG M FT+ AAEE  +P  L +T  A  F+G   Y ++++KG +PLKD S   
Sbjct  119   PVTCIVSDGFMTFTITAAEELRLPVTLLFTIAACAFMGSKQYPILVEKGLAPLKDESCLT  178

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTN-PDDPIVKYIVLITERAKSASAIMVNTFDA  778
             NG+LD V+DW+  M G+RLRDLPSF  TTN P+D  + + +   +RA +ASA+M++TFD 
Sbjct  179   NGFLDKVIDWIPAMKGIRLRDLPSFFETTNDPNDIFLNFTIEAMDRAHTASAVMLHTFDV  238

Query  779   LEQEALNGLQSMLPPVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             LE++ L+ L SMLPPVYA GP Q    ++ ++  ++ +G SLWKE+T C +WLN   P S
Sbjct  239   LERDVLDALSSMLPPVYAIGPLQLLLNKIPQEYPLKPMGYSLWKEETECFKWLNDKAPNS  298

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSI VMT + LVEF WGLAN+K PFLWIIRPDLV G  A+LP EFV ET+ER +
Sbjct  299   VVYVNFGSIAVMTPECLVEFGWGLANSKNPFLWIIRPDLVVGASAILPPEFVAETKERAL  358

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +ASWCPQEQV++HP++GGFLTHSGWNST+ES+ +GVPM+CWP FADQ  NCWY C +WG 
Sbjct  359   IASWCPQEQVLNHPSIGGFLTHSGWNSTIESLSAGVPMVCWPLFADQPINCWYTCNEWGC  418

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEID +VKR EVE+LVRELM GEKG +M+ KAME KKLAE+ AT P GSS  N++ ++N
Sbjct  419   GMEIDKNVKREEVEKLVRELMEGEKGKKMKNKAMEWKKLAEE-ATGPHGSSSTNLDNLVN  477

Query  1496  KFLSPN  1513
             + L  N
Sbjct  478   QVLLKN  483



>ref|XP_008455196.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=485

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/486 (58%), Positives = 369/486 (76%), Gaps = 9/486 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSIS +  KPHAVCIP+PAQGHI PMLKLAK+L+HKGF+ITFVN+++NHRRLL+SRGP 
Sbjct  1     MGSIS-QTKKPHAVCIPYPAQGHITPMLKLAKLLHHKGFYITFVNTDYNHRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ-------S  415
             S+ GL  F F TIPDGLP SD + TQDI  L +S ++NCL P  DLI++LN        +
Sbjct  60    SLDGLQDFTFRTIPDGLPYSDENCTQDIRALSQSTSKNCLAPLCDLISQLNSIAASPSSN  119

Query  416   GPPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPVSCIVSDG M F++ AA EF IP  LFWT  A G+LG++ +  ++++G  PLKD S 
Sbjct  120   MPPVSCIVSDGVMSFSMLAANEFNIPYALFWTASACGYLGYLKFLDLVNQGLIPLKDMSQ  179

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFD  775
               +G+L+  ++W +GM  +RL+D+P+FIRTT+ DD ++ +I+   +R++ ASAIM+NTFD
Sbjct  180   IIDGFLENTIEWTQGMKNIRLKDIPTFIRTTDLDDIMLDFILQEMKRSREASAIMINTFD  239

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             ALE +A + L S+   +Y  GP      Q++D  + A+G +LW E++ C+EWLN+  P S
Sbjct  240   ALEGDAKDSLSSIFQSIYTIGPIHMLANQIDDENLTAIGSNLWAEESECIEWLNSKQPNS  299

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVMT+ Q++EFAWGLA++ KPFLWI RPDL+ G+ A+LP EFV +T++R +
Sbjct  300   VVYVNFGSITVMTSQQMIEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSL  359

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +ASWC QEQV+SHP+ GGFLTHSGWNSTLESIC+GVPMICWPF A+QQTNC+YCC  WGI
Sbjct  360   IASWCCQEQVLSHPSTGGFLTHSGWNSTLESICAGVPMICWPFIAEQQTNCYYCCNVWGI  419

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEID +VKR EVE LVRELM GEKG +M+ K M LK  AE+A     GS++  +++VI+
Sbjct  420   GMEIDNNVKRNEVEELVRELMDGEKGRKMKEKVMSLKSKAEEAYKL-GGSAWKQLDKVID  478

Query  1496  KFLSPN  1513
             + L  N
Sbjct  479   EVLLSN  484



>dbj|BAO51839.1| UDP-glycosyltransferase 85A34 [Humulus lupulus]
Length=487

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/480 (59%), Positives = 364/480 (76%), Gaps = 11/480 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP+PAQGHINPMLKLAK+L+ +GFHITFVN+ FNH RLL+SRGP S+ GLP FR
Sbjct  6     KPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPDFR  65

Query  284   FETIPDGLPPSD--VDATQDIATLCESITQNCLGPFKDLIARLNQSG-------PPVSCI  436
             FE+IPDGLPP++   DATQDI +LCES  + CL PF+ L+ +LN +        PPVSC+
Sbjct  66    FESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVSCV  125

Query  437   VSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLD  616
             VSD  M FTL A EEFGIP  LFWT  A G LG+  Y  +++KGF+P KD S F NGYLD
Sbjct  126   VSDPAMPFTLTAGEEFGIPVALFWTISACGLLGYTQYENLVNKGFTPFKDESSFTNGYLD  185

Query  617   TVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEAL  796
             T++DW+  +  +RL+DLPSFIRTTNP++ +VKY++ + +   + +A++ NTFD+LE   L
Sbjct  186   TLIDWIPAVNDIRLKDLPSFIRTTNPNEFMVKYVIRLIKLTSTGNAMIFNTFDSLEHNVL  245

Query  797   NGLQSMLP-PVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNF  973
               L SM P P+Y  GP      + +   + ++  +LW E+  C++WL++ D  S+VYVNF
Sbjct  246   EALSSMFPCPIYTLGPLHVLVNKTQSKSLSSIASNLWVEELECLQWLDSKDSKSIVYVNF  305

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSIT +T +QLVEFAWGLAN+KKPF+WIIRPDLV G+ A+LP EFVEETRER +++SWCP
Sbjct  306   GSITAVTPEQLVEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWCP  365

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QE+V+SHPA+GGFLTH GWNSTLES+ +GVP ICWPFFA+QQTNC + C  WG GMEI+ 
Sbjct  366   QEEVLSHPAIGGFLTHCGWNSTLESLSAGVPTICWPFFAEQQTNCKFLCDYWGSGMEINP  425

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSPN  1513
             +VKR +VE+LVRELM GEKG++MR KAME K  A + AT   GSS  N++ +I+K L P+
Sbjct  426   NVKRDDVEKLVRELMDGEKGNDMRNKAMEWKHKAHE-ATELGGSSLVNLDNIISKVLVPS  484



>gb|KFK44329.1| hypothetical protein AALP_AA1G244100 [Arabis alpina]
Length=483

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 365/471 (77%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPMLK+AK+L+ KGFH+TFVN+ +NH RLLRSRGP ++ GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPHALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +DVDAT+DI  LCES  +NCL PFK+L+ R+N     PPVSCIVSDG M 
Sbjct  71    FESIPDGLPETDVDATRDIPALCESTVKNCLTPFKELLRRINAGDDVPPVSCIVSDGCMT  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FT+DAAEE GIPE+LF T  A GFL ++ +   I+KG SPLKD S +   +LDT +DW+ 
Sbjct  131   FTIDAAEELGIPEVLFRTTSACGFLAYLHFYRFIEKGLSPLKDVSCWTKEHLDTKIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+PSFIR TNP+D ++ + V  ++RAK ASAI++NTFD LE + +  +QS+L
Sbjct  191   SMRNLRLKDIPSFIRATNPEDILLNFFVRESDRAKRASAIILNTFDDLEHDVIQYMQSIL  250

Query  818   PPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP    E +   +DS +  +G +LW+E+T C++WL+T    SVVY+NFGS+TVM
Sbjct  251   PPVYSIGPLHLLENRHIDKDSDMGRMGSNLWREETECLDWLDTKSRNSVVYINFGSLTVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             +   LVEFAWGLA + K FLW+IRPDLV GE+A++P +F++ET  R MLASWCPQE+V+S
Sbjct  311   SVKHLVEFAWGLAGSGKDFLWVIRPDLVVGEDAMVPSDFLKETAGRRMLASWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             H A+GGFLTHSGWNSTLES+ SGVPM+CWPFFA+QQTNC +CC +W +GMEI  DVKR E
Sbjct  371   HQAIGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKFCCDEWEVGMEIGGDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE ++RELM GEKG +MR KA E ++LAE+A     GSS  N E ++NK L
Sbjct  431   VETVIRELMDGEKGKKMREKAEEWRRLAEEAVEHKLGSSNVNFETLVNKVL  481



>ref|XP_004303932.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=479

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/473 (61%), Positives = 359/473 (76%), Gaps = 4/473 (1%)
 Frame = +2

Query  95    EGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLP  274
             + +KPHAV IP PAQ HI  MLKLAKIL+H+GFHITFVN+EFNH+R L+S GP S+ GLP
Sbjct  2     DSIKPHAVFIPVPAQSHIKAMLKLAKILHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLP  61

Query  275   SFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSCIVSDGG  451
              FRFE IPDGLP SD DATQD+A LC+ I +N L  F  LI +LN S  PPVSCIVSDG 
Sbjct  62    DFRFEAIPDGLPESDEDATQDVALLCDCINKNFLATFCALIMKLNNSTNPPVSCIVSDGF  121

Query  452   M-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
             M  FT+ AAEEFG+P  LF+T  A   +GF  Y  +IDKG +PLKD S F NG+LDTV+D
Sbjct  122   MSTFTITAAEEFGVPVALFYTIAACSLMGFTQYPSLIDKGLAPLKDESCFTNGFLDTVID  181

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLIT-ERAKSASAIMVNTFDALEQEALNGL  805
             W+ GM  +RLRDLPSF RTTNPDD I  Y +  T  R + ASAI+++TFDALEQ  L+ L
Sbjct  182   WIPGMKDIRLRDLPSFFRTTNPDDIIFNYFIEATGPRIQKASAIVLHTFDALEQNVLDAL  241

Query  806   QSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSIT  985
              S LP VYA GP Q    Q+  + + ++G SLWKE+  C+EWL    P SV+YVNFGS+ 
Sbjct  242   SSRLPLVYAIGPIQLLLNQIPQNPLTSMGYSLWKEEPECLEWLKNRAPNSVIYVNFGSVA  301

Query  986   VMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQV  1165
             V+T  QLVEF WGLAN+K PF W+IRPDLV GE A+LP EFV E ++RG+LA WCPQEQV
Sbjct  302   VLTPKQLVEFGWGLANSKFPFFWVIRPDLVVGESAILPPEFVAEIKDRGLLAHWCPQEQV  361

Query  1166  ISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKR  1345
             ++HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFF DQQT+C + C +WG+GMEI  DVKR
Sbjct  362   LNHPSVGGFLTHSGWNSTIESLTAGVPMLCWPFFGDQQTDCHFSCKEWGVGMEISNDVKR  421

Query  1346  CEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              EVE+LV+ELM GEKG +M+ KA+  K+LA++ ATAP G+S  N++ ++N+ L
Sbjct  422   DEVEKLVKELMEGEKGKKMKNKALNWKELAQE-ATAPHGTSSRNLDTLVNQVL  473



>ref|XP_003544213.2| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=488

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/468 (61%), Positives = 376/468 (80%), Gaps = 2/468 (0%)
 Frame = +2

Query  92    GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGL  271
             G  LKPHAVC+P P QGHINPMLKLAK+L+ KGFHITFVN+E+ H+RLL+SRGP+S+KGL
Sbjct  14    GTILKPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSIKGL  73

Query  272   PSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSCIVSDG  448
             PSFRFETIPDGLP   VDATQ I +LC+S  + CL  F++L+ ++N S  PPVSCIVSDG
Sbjct  74    PSFRFETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKINDSDAPPVSCIVSDG  133

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTLDAAEE G+P++LFWT  A GF+ +V +  +++KG  PLKDSS   NGYL+T +D
Sbjct  134   VMSFTLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLVPLKDSSCITNGYLETTID  193

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ G+  +RLRD+PSFIRTT+ DD +++++     RA+ ASAI++NTFDA+E + L+   
Sbjct  194   WIPGIKEIRLRDIPSFIRTTDVDDFMLEFLQWECGRARGASAIILNTFDAIEHDVLDAFS  253

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             S+LPPVY+ GP     + ++D  + A+  +LWKE+  CVEWL+T +  SVVYVNFGSITV
Sbjct  254   SILPPVYSIGPLNLLVKDIDDQDLNAIQSNLWKEELECVEWLDTKESNSVVYVNFGSITV  313

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             +T +QL+EFAWGLA++ K FLW+IRPD+V GE  VLP +FVE+T+ RG+L+SWCPQEQV+
Sbjct  314   LTNEQLIEFAWGLADSNKSFLWVIRPDVVGGENVVLPPKFVEQTKNRGLLSSWCPQEQVL  373

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             +HPA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIG+EI+ DVKR 
Sbjct  374   AHPAIGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEIE-DVKRD  432

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             ++E LVRELM GEKG EM++K ++ K+LA+ AA+ P GSS+ N+E ++
Sbjct  433   KIESLVRELMDGEKGKEMKKKGLQWKELAKSAASGPNGSSFLNLENLV  480



>gb|KHN24339.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=488

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/464 (62%), Positives = 375/464 (81%), Gaps = 2/464 (0%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+P P QGHINPMLKLAK+L+ KGFHITFVN+E+ H+RLL+SRGP+S+KGLPSFR
Sbjct  18    KPHAVCVPHPTQGHINPMLKLAKLLHFKGFHITFVNTEYTHKRLLKSRGPDSIKGLPSFR  77

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS-GPPVSCIVSDGGMFF  460
             FETIPDGLP   VDATQ I +LC+S  + CL  F++L+ ++N S  PPVSCIVSDG M F
Sbjct  78    FETIPDGLPEPLVDATQHIPSLCDSTRRTCLPHFRNLLTKINDSDAPPVSCIVSDGVMSF  137

Query  461   TLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKG  640
             TLDAAEE G+P++LFWT  A GF+ +V +  +++KG  PLKDSS   NGYL+T +DW+ G
Sbjct  138   TLDAAEELGVPQLLFWTPSACGFMCYVQFGQLVEKGLVPLKDSSCITNGYLETTIDWIPG  197

Query  641   MPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLP  820
             +  +RLRD+PSFIRTT+ DD +++++     RA+ ASAI++NTFDA+E + L+   S+LP
Sbjct  198   IKEIRLRDIPSFIRTTDVDDFMLEFLQWECGRARGASAIILNTFDAIEHDVLDAFSSILP  257

Query  821   PVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTAD  1000
             PVY+ GP     + ++D  + A+  +LWKE+  CVEWL+T +  SVVYVNFGSITV+T +
Sbjct  258   PVYSIGPLNLLVKDIDDQDLNAIQSNLWKEELECVEWLDTKESNSVVYVNFGSITVLTNE  317

Query  1001  QLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPA  1180
             QL+EFAWGLA++ K FLW+IRPD+V GE  VLP +FVE+T+ RG+L+SWCPQEQV++HPA
Sbjct  318   QLIEFAWGLADSNKSFLWVIRPDVVGGENVVLPPKFVEQTKNRGLLSSWCPQEQVLAHPA  377

Query  1181  VGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVER  1360
             +GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC +CC +WGIG+EI+ DVKR ++E 
Sbjct  378   IGGFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEIE-DVKRDKIES  436

Query  1361  LVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             LVRELM GEKG EM++KA++ K+LA+ AA+ P GSS+ N+E ++
Sbjct  437   LVRELMDGEKGKEMKKKALQWKELAKSAASGPNGSSFLNLENLV  480



>ref|XP_009349615.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/475 (61%), Positives = 361/475 (76%), Gaps = 10/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP PAQ HI  MLK AK+L+H+GF+ITFVNSEFNH+R L+S GP S+ GLP FR
Sbjct  9     KPHAVCIPVPAQSHIKAMLKFAKLLHHRGFYITFVNSEFNHKRFLKSLGPNSLDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQ------SGPPVSCIVS  442
             F  IPDGLP SD D TQD+  L ++I  QN L PF+DL+ +LN       + PPV+CIVS
Sbjct  69    FAAIPDGLPDSDEDTTQDVTFLVDAIRKQNFLAPFRDLLNKLNNDAITTSNNPPVTCIVS  128

Query  443   DGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             DG M  FT+ AAEE G P +LF+T  A  F+G + +R +I+KG +PLKD SY  NGYLD 
Sbjct  129   DGFMCTFTITAAEEIGAPIVLFYTIAACSFMGIIQFRALIEKGLAPLKDESYLTNGYLDK  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  + L+DLP+F RTTN DD I  +++  T+R+  ASA++V+TFDALE++ L+
Sbjct  189   VIDWIPGMKNICLKDLPTFFRTTNSDDIIFNFVMESTDRSHEASAVVVHTFDALERDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L SMLP VY  GP Q    Q+ +  +  +G SLWKE+T C+EWLNT    SV+YVNFGS
Sbjct  249   SLSSMLPLVYTIGPLQLHLNQIPEHPLN-IGYSLWKEETECLEWLNTKAQNSVLYVNFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             ITVMT   LVEF WGLAN+K PF W+IRPDLV GE A+LP EFV ET+ER ++ASWCPQE
Sbjct  308   ITVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIASWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ES+ SGVPM+CWPFFADQQ +C Y C +WG+GMEI  DV
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCHYTCKEWGVGMEISNDV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LVRELM GEKG +M+ KAME KKLAE+ AT+P GSS  N++ ++++ L
Sbjct  428   KRDEVEKLVRELMAGEKGKKMKNKAMEWKKLAEE-ATSPHGSSSKNLDNLVHQVL  481



>ref|XP_010040276.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=554

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/473 (60%), Positives = 356/473 (75%), Gaps = 6/473 (1%)
 Frame = +2

Query  101   LKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSF  280
             LKPHAVCIPFPAQ HI+ ML LAK+L+H+GFH+TFVN+E+NH RL+RSRGP S+ GLPSF
Sbjct  3     LKPHAVCIPFPAQSHISAMLNLAKLLHHRGFHVTFVNTEYNHNRLMRSRGPSSLDGLPSF  62

Query  281   RFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSD  445
             RF TIPDGLPPS+ D TQDI +LC+S  + CL  F+DLI RLN+       PPVSC+VSD
Sbjct  63    RFRTIPDGLPPSNGDVTQDILSLCQSTQKCCLPHFQDLIERLNEESVMSGSPPVSCVVSD  122

Query  446   GGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVL  625
               M FTLD AE   +PE+LFW      F+ +  +R +IDKG +PLKD SY  NGYLDTV+
Sbjct  123   SSMTFTLDTAEAVSVPEVLFWPMSVCAFMAYAQFRSLIDKGLAPLKDVSYLTNGYLDTVI  182

Query  626   DWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGL  805
             DW+ GM  + LRDLPSF RTT+PDDPI+ + ++   R K ASA++ NTF+ LE E L+ L
Sbjct  183   DWIPGMRNIHLRDLPSFFRTTDPDDPILNFCLVEFARVKRASALVFNTFEGLEHEVLDAL  242

Query  806   QSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSIT  985
             ++M P VY  GP     +Q+ D   R +  ++WKED  C+EWL+   P  VVYVNFGSIT
Sbjct  243   KAMFPTVYTIGPLHLLVEQLSDDDTRPIKSNMWKEDLGCLEWLDLKPPGLVVYVNFGSIT  302

Query  986   VMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQV  1165
             VM+  QLVEFAWGLA++ + FLW+IRPDLV G+ A+LP +F+  TRER +L SWCPQE+V
Sbjct  303   VMSQAQLVEFAWGLASSSQVFLWVIRPDLVVGDAAILPPDFLAATRERSLLVSWCPQERV  362

Query  1166  ISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKR  1345
             +SHPAVGGF TH GWNST+ESI +GV ++CWPF  DQQT+C Y   +WGIGMEID+DVKR
Sbjct  363   LSHPAVGGFPTHCGWNSTIESIATGVLVVCWPFMGDQQTSCRYSYHEWGIGMEIDSDVKR  422

Query  1346  CEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              E ER VRELM GE+G EM+RK ME K++A + AT P+GSS+ N++EVI+K L
Sbjct  423   DEGERQVRELMEGERGKEMKRKVMEWKEMARE-ATHPSGSSFLNLDEVIDKVL  474



>ref|XP_010060021.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=499

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 364/485 (75%), Gaps = 20/485 (4%)
 Frame = +2

Query  107   PHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRF  286
             PHAVCIP+PAQGHINPML L K+L+H+GFH+TFVN+E+NH RLLRSR P S+ GLPSF+F
Sbjct  10    PHAVCIPYPAQGHINPMLNLPKLLHHRGFHVTFVNTEYNHSRLLRSRDPSSLDGLPSFQF  69

Query  287   ETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDGG  451
              TIPDGLPPSD DATQD+  LC+S  ++CL   +DL+ RLN+       P VSC+VSDG 
Sbjct  70    RTIPDGLPPSDADATQDVPALCQSTQKSCLPYLRDLLERLNEESATSGSPSVSCVVSDGV  129

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLDAA+   +PE+LFWT  A GF+G+V YR +IDKG +PLKD+SY  N YLDT++DW
Sbjct  130   MSFTLDAAKAVSMPEVLFWTMSACGFMGYVQYRSLIDKGLAPLKDASYLTNVYLDTIVDW  189

Query  632   VKG--------------MPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNT  769
             +                M  + L +L SF+RT +PDD ++ + +  TERAK ASAI+ NT
Sbjct  190   IPSIRNILDTIIDWIPEMRNICLGELLSFLRTPDPDDLMINFCLRETERAKRASAIVFNT  249

Query  770   FDALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDP  949
             FD LE E L+ L++M+PP+Y  GP     +Q+ D   +++G + WKED  C+EWL++N P
Sbjct  250   FDRLEHEVLDALKAMVPPIYTLGPLHILTEQLPDDDTKSIGSNPWKEDLGCLEWLDSNPP  309

Query  950   ISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRER  1129
             +SVVYVNFGSITVM+  QL E AWGLAN+ + FLW+IRPDLV G  A+LP +F+  TR+R
Sbjct  310   VSVVYVNFGSITVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAILPPDFLAATRQR  369

Query  1130  GMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQW  1309
              +L SWCPQE+V++HPAVGGFLTH GW ST+ESI +GVP++CWPFF +QQ NCWY C +W
Sbjct  370   SLLVSWCPQERVLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQQRNCWYSCEEW  429

Query  1310  GIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEV  1489
             GIG+EID DVKR EVER VRELM GE+G  M+RK ME +++A +AA  P+GSS +N++EV
Sbjct  430   GIGLEIDDDVKRDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-PSGSSCSNLDEV  488

Query  1490  INKFL  1504
             I+K L
Sbjct  489   IDKVL  493



>ref|NP_173655.2| UDP-glucosyl transferase 85A3 [Arabidopsis thaliana]
 sp|Q9LMF1.2|U85A3_ARATH RecName: Full=UDP-glycosyltransferase 85A3 [Arabidopsis thaliana]
 gb|AEE30236.1| UDP-glucosyl transferase 85A3 [Arabidopsis thaliana]
 gb|AHL38931.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=488

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/482 (60%), Positives = 364/482 (76%), Gaps = 7/482 (1%)
 Frame = +2

Query  77    MGS--ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRG  250
             MGS  +S E  KPH VC+P+PAQGHINPM+K+AK+L+ KGFH+TFVN+ +NH RLLRSRG
Sbjct  1     MGSRFVSNEQ-KPHVVCVPYPAQGHINPMMKVAKLLHVKGFHVTFVNTVYNHNRLLRSRG  59

Query  251   PESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARL--NQSGPP  424
               ++ GLPSF+FE+IPDGLP + VDATQDI  L ES T+NCL PFK L+ R+   +  PP
Sbjct  60    ANALDGLPSFQFESIPDGLPETGVDATQDIPALSESTTKNCLVPFKKLLQRIVTREDVPP  119

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTLD AEE G+PEI FWT  A GF+ ++ + L I+KG  P+KD+S    
Sbjct  120   VSCIVSDGSMSFTLDVAEELGVPEIHFWTTSACGFMAYLHFYLFIEKGLCPVKDASCLTK  179

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
              YLDTV+DW+  M  V+L+D+PSFIRTTNP+D ++ ++V    R K ASAI++NTFD LE
Sbjct  180   EYLDTVIDWIPSMNNVKLKDIPSFIRTTNPNDIMLNFVVREACRTKRASAIILNTFDDLE  239

Query  785   QEALNGLQSMLPPVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
              + +  +QS+LPPVY  GP       +  EDS +  +G +LWKE+T C+ WLNT    SV
Sbjct  240   HDIIQSMQSILPPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECLGWLNTKSRNSV  299

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             VYVNFGSIT+MT  QL+EFAWGLA T K FLW++RPD V+GEEAV+P+EF+ ET +R ML
Sbjct  300   VYVNFGSITIMTTAQLLEFAWGLAATGKEFLWVMRPDSVAGEEAVIPKEFLAETADRRML  359

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
              SWCPQE+V+SHPAVGGFLTH GWNSTLES+  GVPM+CWPFFA+QQTNC + C +W +G
Sbjct  360   TSWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEVG  419

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             +EI  DVKR EVE +VRELM GEKG +MR KA+E ++LAE A   P GSS  N E ++NK
Sbjct  420   IEIGGDVKRGEVEAVVRELMDGEKGKKMREKAVEWRRLAEKATKLPCGSSVINFETIVNK  479

Query  1499  FL  1504
              L
Sbjct  480   VL  481



>ref|XP_008229788.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/475 (61%), Positives = 361/475 (76%), Gaps = 10/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP PAQ HI  MLK AK+L+H+GFHITFVN+EFNH+R L+S GP S+ GLP F+
Sbjct  9     KPHAVCIPVPAQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLPDFQ  68

Query  284   FETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQ------SGPPVSCIVS  442
             F++IPD +P SD DATQDI  LCES+  QN L PF  L+A+LN       S PPV+CIVS
Sbjct  69    FKSIPDSIPDSDEDATQDITLLCESVRKQNFLAPFLALLAKLNNDAISTSSNPPVTCIVS  128

Query  443   DGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             DG M  FT  AAEE G P +LF+T  A  F+GF   R V++KG +PLKD S F NGYL+T
Sbjct  129   DGFMSTFTSIAAEEIGAPIVLFYTIAACSFMGFKQLRAVVEKGLAPLKDESCFTNGYLET  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  +RLRDLP+F+RTTN DD ++ +++  T+ A  +SA++++TFDALE + L+
Sbjct  189   VIDWIPGMRDIRLRDLPTFLRTTNSDDIMLNFVMEATDGAHESSAVLLHTFDALEPDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L SMLP VY  GP Q    Q+ +  ++ +G SLWKE+T C+EWLNT  P SVVYVNFGS
Sbjct  249   ALSSMLPHVYTVGPLQLHLNQIPEHPLK-MGYSLWKEETECLEWLNTRAPNSVVYVNFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I ++T  QLVEF WGLAN+K PF W+IRPDLV GE A+LP EFV ETRER ++A WCPQE
Sbjct  308   IAIVTPQQLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETRERSLIAGWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ESI +GVPM+CWPFF DQQ +C Y C +WGIGMEI  DV
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESITAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LV+ELM GEKG +M+ K ME KKLAE+ AT P GSS  N++ ++N+ L
Sbjct  428   KRDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVL  481



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/471 (60%), Positives = 359/471 (76%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P PAQGHINPMLK+AK+L+ KGFH+TFVN+ +NH RLLRSRGP+++ GLPSFR
Sbjct  11    KPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPDALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP SD D TQDI  LC S T+NCL PF +L+ R+N     PPVSCI+SDG M 
Sbjct  71    FESIPDGLPESDGDTTQDIPALCVSTTKNCLAPFMELLRRINTRDDVPPVSCIISDGVMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+P++ FWT  A GF+  + +   I+KG +P KD SY    +LDTV+DW+ 
Sbjct  131   FTLDAAEELGVPDVFFWTPSACGFMALLQFPHFIEKGVAPFKDESYMSKEHLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+PSFIRTTNPDD ++ +IV   E++K A+AI++NTF+ L+ E +  +QS+L
Sbjct  191   SMNNLRLKDIPSFIRTTNPDDIMLNFIVQEVEQSKRATAIILNTFEDLDHEVIKAMQSIL  250

Query  818   PPVYAAGPFQFFEQQVEDSG--VRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP      Q  D G  +  +GL+LWKE+T C++WL+T    SV+Y++FG I VM
Sbjct  251   PPVYSIGPLHLLANQDIDEGSEIARMGLNLWKEETECLDWLDTKSRNSVMYISFGCIAVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             +A QLVEFAWGLA + K FLW+IRPDLV+G+ AV+P EF+ ET +R MLASWCPQE+V+S
Sbjct  311   SAKQLVEFAWGLAASGKDFLWVIRPDLVAGDAAVIPPEFLAETEDRRMLASWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GGFLTH GWNSTLES+C GVPMICWPFFA+Q TNC +CC +WG+GMEI  +VKR E
Sbjct  371   HPAIGGFLTHCGWNSTLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGNVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +E +VRELM GEKG +MR KA E + LAE+A     GSS  N   ++NK L
Sbjct  431   LETVVRELMDGEKGKKMREKAEEWRHLAEEATKDKLGSSVVNFNTLVNKVL  481



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/476 (58%), Positives = 364/476 (76%), Gaps = 9/476 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             +PHAVC+P PAQGHINPM +LAK+L+HKGFHITFVN+EFN RRLL+S+GP+S+  +P+FR
Sbjct  69    RPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTFR  128

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             FETIPDGLPPSD DATQDI +LC+S  + C  PF++L+ RLN S      PPV+CIVSD 
Sbjct  129   FETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNVNPPVTCIVSDW  188

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTL A+++  IP +LF+T  A GF G+V YR +++K   PLKD SY  NGY+D+V+D
Sbjct  189   AMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPLKDLSYLTNGYMDSVID  248

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM G++L+ LPSFIR+T+ DD +V +++   E A +ASA++ NTFD LE E L  L 
Sbjct  249   WIPGMEGIQLKYLPSFIRSTDRDDFMVNFVITEIENAHNASALIFNTFDDLEPEVLEELS  308

Query  809   SMLPPVYAAGPFQFF----EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             S+ P ++  GP        E    DS +  +G +LWKE   C+EWL++ +  SVVYVNFG
Sbjct  309   SIYPNIFTIGPLNQLVLNNEVSAHDSALSLIGSNLWKEQPGCLEWLDSKEQNSVVYVNFG  368

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SITV+T +QLVEFAWGLAN+K+PFLW+IRPD+V+   AV+ +EFVEET++RGMLASWCPQ
Sbjct  369   SITVLTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQ  428

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQ++ HPAVGGFLTH GWNST+ES+CSGV M+CWPFFA+QQTNCW+C T+WG+G+E++  
Sbjct  429   EQILRHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPR  488

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
               R E+E+ VRELM G+ G  M+ KA+E K LAE AA  P GSSY N++++IN  L
Sbjct  489   ADRVEIEKRVRELMEGDSGKLMKEKALEWKLLAEKAAAGPNGSSYVNLDKLINDVL  544



>ref|XP_003635298.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=478

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/469 (59%), Positives = 359/469 (77%), Gaps = 3/469 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+P+P+QGH+ P+++LAK+++ +GFHITFVN+EFNHRRL+RS GP+SV+GL  FR
Sbjct  8     KPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDFR  67

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE IPDGLPPSD+DATQD+  LC+S  +NCL PF+DL+ARLN S   PPVSCI+SDG M 
Sbjct  68    FEAIPDGLPPSDLDATQDVPALCDSTRKNCLAPFRDLLARLNSSSDVPPVSCIISDGVMS  127

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             F ++AAEE GIPE+ FWT  A  F+G++ YR  I +G  P KD S+  +G LDT +DW+ 
Sbjct  128   FAIEAAEELGIPEVQFWTASACSFMGYLHYREFIRRGIFPFKDESFRSDGTLDTPIDWIP  187

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GMP +RLRD+PS I+TT+P+  +  ++    +   ++ AI+ NTFDA E E L  +    
Sbjct  188   GMPNIRLRDIPSHIQTTDPNSIMFDFMGEEAQNCLNSPAIIFNTFDAFEDEVLQAIAQKF  247

Query  818   PPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTA  997
             P +Y AGP    E+ + D  V++L  SLWKED++C+EWL+  +P SVVYVN+GS+TVMT 
Sbjct  248   PRIYTAGPLPLLERHMLDGQVKSLRSSLWKEDSTCLEWLDQREPNSVVYVNYGSVTVMTD  307

Query  998   DQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHP  1177
               L EFAWGLAN+K  FLWIIRPD+V G+ AVLP EF++ET++RG+L SWCPQEQV+SHP
Sbjct  308   RHLKEFAWGLANSKYSFLWIIRPDIVMGDSAVLPEEFLKETKDRGLLVSWCPQEQVLSHP  367

Query  1178  AVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVE  1357
             +VG FLTH GWNS LE+IC GVP+ICWPFFADQQTNC Y CT WGIG+E+D DVKR E+E
Sbjct  368   SVGVFLTHCGWNSMLEAICGGVPVICWPFFADQQTNCRYACTTWGIGVEVDHDVKRDEIE  427

Query  1358  RLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              LV+E+MGG+KG +MR+KA E K  AE+ AT   GSSY N ++ I + L
Sbjct  428   ELVKEMMGGDKGKQMRKKAQEWKMKAEE-ATDVGGSSYTNFDKFIKEAL  475



>ref|XP_008375649.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=490

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 362/480 (75%), Gaps = 10/480 (2%)
 Frame = +2

Query  89    SGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKG  268
             +    KPHAVCIP PAQGHI PMLK AK+L+H+GFHITFVNS++NHRR L+S GP S+ G
Sbjct  4     TAAATKPHAVCIPAPAQGHIKPMLKFAKLLHHRGFHITFVNSKYNHRRFLKSLGPNSLDG  63

Query  269   LPSFRFETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQSG------PPV  427
             LP F+FE IPDGLP SD D TQD+  LC+SI  Q  L PF++L+  +N +       PPV
Sbjct  64    LPDFQFEAIPDGLPDSDEDTTQDVLLLCDSIRKQKLLAPFRELLMNINNNATSTPINPPV  123

Query  428   SCIVSDGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             +CIVSDG M  FTL AAEE  +P +LF+T  A  F+G + +R +I+KG  PLK+ S   N
Sbjct  124   TCIVSDGLMSTFTLTAAEEIDVPMVLFYTIAACSFMGTIQFRALIEKGLVPLKEESCLTN  183

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             GYL+ V+DW+ GM  +RLR+LP+FIRT++PDD +  +++ +T+RA  ASA++++TFDALE
Sbjct  184   GYLEKVIDWIPGMKDIRLRELPTFIRTSDPDDIMFNFLMEVTDRAHEASAVVLHTFDALE  243

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              + L  L SMLP VY  GP Q    Q+ D  +  +G SLWKE+T C++WLNT  P S+VY
Sbjct  244   PDVLEALSSMLPLVYPIGPLQLHLNQIPDHPLN-IGYSLWKEETDCLDWLNTKAPNSIVY  302

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITVMT + LVEF WGLAN+K PF W+IRPDLV G+ A+LPREFV+ET+ER ++AS
Sbjct  303   VNFGSITVMTPEHLVEFGWGLANSKVPFFWVIRPDLVIGQSALLPREFVDETKERSLIAS  362

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQEQV++HP+V GFLTHSGWNST ES+ +GVPM+CWPFF DQQ +C Y C +WGIGME
Sbjct  363   WCPQEQVLNHPSVAGFLTHSGWNSTFESLTAGVPMLCWPFFGDQQMDCRYSCNEWGIGME  422

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I  DVKR EVERLVRELM GEKG +M+ K M  KKLAE+ AT P GSS  N++ ++N+ L
Sbjct  423   ISNDVKRDEVERLVRELMDGEKGKKMKNKVMVWKKLAEE-ATGPHGSSSKNLDTLVNQVL  481



>ref|XP_002893221.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69480.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 362/480 (75%), Gaps = 18/480 (4%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS   +  KPH VC+P+PAQGHINPM+K+AK+L  KGFH+TFVN+ +NH RLLRSRG  
Sbjct  1     MGSHVAQ--KPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGSN  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             +V GLPSFRFE+IPDGL  +DVD TQDI TLCES  ++CL PFK+L+ ++N     PPVS
Sbjct  59    AVDGLPSFRFESIPDGLSETDVDVTQDIPTLCESTMKHCLAPFKELLRQINAGDDVPPVS  118

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             CIVSDG M FTLDAAEE G+PE+LFWT  A GFL ++ Y   I+KG SP+KD SY    +
Sbjct  119   CIVSDGCMSFTLDAAEELGVPEVLFWTTSACGFLAYLFYYRFIEKGLSPIKDESYLNKEH  178

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             LDT +DW+  M  +RL+D+PSFIRTTNPDD ++ +I+   +RAK ASAI++NTFD LE +
Sbjct  179   LDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRAKRASAIILNTFDDLEHD  238

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVY  964
              +  +QS++PPVY+ GP    E+Q   EDS +R +G +LW+E+T C+ WLNT    SVVY
Sbjct  239   VIQSMQSIVPPVYSIGPLHLLEKQEISEDSEIRRMGSNLWREETECLNWLNTKARNSVVY  298

Query  965   VNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLAS  1144
             VNFGSITV++A QLVEFAWGLA T K FLW+IRPDLV+G+EA++P EF+ ET +R MLAS
Sbjct  299   VNFGSITVLSAKQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPPEFLTETADRRMLAS  358

Query  1145  WCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGME  1324
             WCPQE+V+SHPA+GGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC + C +W +G+E
Sbjct  359   WCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWELGIE  418

Query  1325  IDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             I  D            LM GEKG++MR KA E ++LA++A     GSS  N E V+NK L
Sbjct  419   IGGD------------LMDGEKGNKMREKAGEWRRLAKEATEHKHGSSKLNFEMVVNKIL  466



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/476 (58%), Positives = 363/476 (76%), Gaps = 9/476 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             +PHAVC+P PAQGHINPM +LAK+L+HKGFHITFVN+EFN RRLL+S+GP+S+  +P+FR
Sbjct  12    RPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTFR  71

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             FETIPDGLPPSD DATQDI +LC+S  + C  PF++L+ RLN S      PPV+CIVSD 
Sbjct  72    FETIPDGLPPSDADATQDIPSLCDSTKRTCSAPFQELLTRLNNSALSNVNPPVTCIVSDW  131

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTL A+++  IP +LF+T  A GF G+V YR +++K   PLKD SY  NGY+D+V+D
Sbjct  132   AMGFTLKASKQLNIPNVLFFTASACGFTGYVHYRHLVEKCIFPLKDLSYLTNGYMDSVID  191

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM G++L+ LPSFIR+T+ DD +V +++   E A +ASA++ NTFD LE E L  L 
Sbjct  192   WIPGMEGIQLKYLPSFIRSTDRDDFMVNFVITEIENAHNASALIFNTFDDLEPEVLKELS  251

Query  809   SMLPPVYAAGPFQFF----EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             S+ P ++  GP        E    DS +  +G +LWKE   C+EWL++ +  SVVYVNFG
Sbjct  252   SIYPNIFTIGPLNQLVLNNEVSAHDSALSLIGSNLWKEQPGCLEWLDSKEQNSVVYVNFG  311

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SIT +T +QLVEFAWGLAN+K+PFLW+IRPD+++   AV+ +EFVEET++RGMLASWCPQ
Sbjct  312   SITALTRNQLVEFAWGLANSKRPFLWVIRPDIINEATAVITQEFVEETKDRGMLASWCPQ  371

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQ++ HP+VGGFLTH GWNST+ES+CSGV M+CWPFFA+QQTNCW+C T+WG+G+E++  
Sbjct  372   EQILRHPSVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPR  431

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
               R ++E+ VRELM GE G  M+ KA+E K LAE AA  P GSSY N++++IN  L
Sbjct  432   ADRVDIEKRVRELMEGESGKLMKEKALEWKLLAEKAAAGPNGSSYVNLDKLINDVL  487



>gb|KFK44334.1| hypothetical protein AALP_AA1G244600 [Arabis alpina]
Length=482

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/476 (61%), Positives = 363/476 (76%), Gaps = 7/476 (1%)
 Frame = +2

Query  92    GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGL  271
             G   KPHAVC+P+PAQGHINPMLK+AK+L+ KGFH++FVN+ +NH RLLRSRGP ++ GL
Sbjct  7     GSKQKPHAVCVPYPAQGHINPMLKVAKLLHSKGFHVSFVNTIYNHNRLLRSRGPNALDGL  66

Query  272   PSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSD  445
             PSF+FE+IPDGLP +DV+ATQ I TLCES  + CL PFKDL+ R+N     PPVSCIVSD
Sbjct  67    PSFQFESIPDGLPETDVEATQHIPTLCESTMKTCLAPFKDLLGRINARDDVPPVSCIVSD  126

Query  446   GGMFFTLDAAEEFGIPEILFWTCGAGGFLGFV-LYRLVIDKGFSPLKDSSYFENGYLDTV  622
             G M FTLDAAEEF +PE+LFWT  A GF  ++ LYR  I+KG SPLKD S      LDT 
Sbjct  127   GCMSFTLDAAEEFEVPEVLFWTTSACGFSTYLHLYRF-IEKG-SPLKDESNLTEEQLDTK  184

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             +DW+  M  ++L+D+PSFI TTNPDD ++ +++   ERAK ASAI++NTFD LE + +  
Sbjct  185   IDWIPSMKNLKLKDIPSFILTTNPDDIMLNFLIREAERAKRASAIILNTFDDLEHDGVQS  244

Query  803   LQSMLPPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             +QSMLPPVY+ GP   F  +   E S +  +G +LW+E+T C++WL+T    SV+YVNFG
Sbjct  245   IQSMLPPVYSIGPLHLFANREIAEGSDIGQMGSNLWREETKCLDWLDTKSRNSVLYVNFG  304

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             S+ VMT  QLVEFAWGLA + K FLW+IRPDLV+G+EA +P EF++ET  R MLASWCPQ
Sbjct  305   SLIVMTTKQLVEFAWGLAGSGKEFLWVIRPDLVAGDEAKVPPEFLKETTGRRMLASWCPQ  364

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             E+V+SHPA+GGFLTHSGWNSTLES+ SGVPM+CWPFFA+QQTNC + C +WG+GM+I  D
Sbjct  365   EKVLSHPAIGGFLTHSGWNSTLESLSSGVPMVCWPFFAEQQTNCKFTCDEWGVGMKIGGD  424

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VKR EVE +VRELM GE+G  MR KA E ++LAE+A     GSS  N E  + K L
Sbjct  425   VKREEVEAVVRELMDGERGRRMREKAEEWQRLAEEATYHKRGSSVVNFETFVTKLL  480



>ref|XP_010459993.1| PREDICTED: UDP-glycosyltransferase 85A3 [Camelina sativa]
Length=491

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 358/471 (76%), Gaps = 4/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+PFPAQGHINPMLK+AK+L+H+GFH+TFVN+ +NH RLLRSRGP ++  +PSFR
Sbjct  11    KPHVVCVPFPAQGHINPMLKVAKLLHHRGFHVTFVNTVYNHNRLLRSRGPNALGRVPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             FE IPDGLP +DVDATQDI  LCES  +N L PFK+LI R+N  +  PPVS IVSDG M 
Sbjct  71    FEAIPDGLPETDVDATQDIPALCESTMKNFLAPFKELIRRINTREDVPPVSSIVSDGAMG  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLD AEEFG+P +LFWT    GF+ ++ + L I+KG  P+KD S     +LDTV+DW+ 
Sbjct  131   FTLDVAEEFGVPLVLFWTTSGCGFMAYLHFYLFIEKGLCPVKDESCLTKEHLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  ++L+D+PSFIRTTNP+D ++ +IV  T R K ASA+++NTFD LE + +  +QS+L
Sbjct  191   SMKNLKLKDIPSFIRTTNPNDIMLNFIVRETCRTKRASAVILNTFDDLEHDVIKSMQSIL  250

Query  818   PPVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY  GP       +  EDS +  +G +LWKE+T C+ WL+T    SVVYVNFGSIT M
Sbjct  251   PPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETQCLNWLDTKSRNSVVYVNFGSITKM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             T  QL EFAWGLA T K FLW++RPDLV+GEEAV+P EF+ ET +R MLASWCPQE+V+S
Sbjct  311   TVTQLEEFAWGLAATGKEFLWVMRPDLVAGEEAVIPAEFLVETEDRRMLASWCPQEKVLS  370

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HPA+GG+LTH GWNSTLES+  GVPM+CWPFFA+QQTNC + C +W +G+EI  DVKR E
Sbjct  371   HPAIGGYLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEVGIEIGGDVKREE  430

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             VE +VRELM GEKG +MR KA E ++LAE A   P GSS  N+E +++K L
Sbjct  431   VEAVVRELMDGEKGKKMREKAEEWRRLAEKATEHPCGSSVVNLETIVSKVL  481



>gb|KDP41398.1| hypothetical protein JCGZ_15805 [Jatropha curcas]
Length=493

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/488 (58%), Positives = 376/488 (77%), Gaps = 12/488 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS   E    HAVCIPFPAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL+SRG  
Sbjct  1     MGSSIVENFGGHAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSN  60

Query  257   SVKGLPSFRFETIPDGLPPSD-VDATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+  L +FRFETIPDGLPPSD  D+TQD+ +LC+S  +NCL PF+DL+ +LN +      
Sbjct  61    SIDCLSTFRFETIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSSSS  120

Query  419   --PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSS  592
               PPV+CIVSD  M FT++AA+E  IP +L WT  A GF+ +  YR +++KGF PLKD+S
Sbjct  121   KVPPVTCIVSDFVMSFTIEAAKELEIPIVLSWTASACGFMAYAHYRQLVEKGFVPLKDAS  180

Query  593   YFENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTF  772
             Y  NG+LDTV+DW+ GM G+ L+ LPSF+RT  P+D +V +++   E A+ ASAI++NTF
Sbjct  181   YLTNGFLDTVIDWIPGMEGISLKYLPSFVRTLEPEDVVVNFVIGEFENARYASAIIINTF  240

Query  773   DALEQEALNGLQSMLP-PVYAAGPFQFFEQQ---VEDSGVRALGLSLWKEDTSCVEWLNT  940
             D LE E L  L  + P P+Y  GP Q F+     V+++ +  +  +LWKE   C+EWL++
Sbjct  241   DELEHEVLMHLPFIFPNPIYTIGPLQQFQDDQDQVKENYLNRIKSNLWKEQPGCLEWLDS  300

Query  941   NDPISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEET  1120
               P SV+YVNFGS+TVM+ +QL+EFAWGLAN+KKPFLW+IRPDLV+G+ A++P EF++ET
Sbjct  301   KKPESVIYVNFGSVTVMSPEQLIEFAWGLANSKKPFLWVIRPDLVNGDSAIIPVEFLQET  360

Query  1121  RERGMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCC  1300
             +ERG+LASW  QE+V+ HP++GGFLTH+GWNSTLES+C GVP+ICWPFFA+QQTNCW+CC
Sbjct  361   KERGLLASWSSQEEVLRHPSIGGFLTHNGWNSTLESLCGGVPLICWPFFAEQQTNCWFCC  420

Query  1301  TQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNM  1480
              +W IG+EI+ DVKR E+ERLV+EL+ G++G E+++K ME K  AE+A  +  GSSY N+
Sbjct  421   NKWKIGIEIEKDVKRNEIERLVQELIDGKQGKELKKKVMEWKLKAEEATASANGSSYANL  480

Query  1481  EEVINKFL  1504
             + VIN+ L
Sbjct  481   DRVINEVL  488



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/476 (58%), Positives = 363/476 (76%), Gaps = 9/476 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             +PHAVC+P+PAQGHINPM +LAK+L+HKGFHITFVN+EFN RRLL+S+GP+S+  +P+FR
Sbjct  12    RPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTFR  71

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             FETIPDGLPPSD DATQDI +LC+S  + C  PF++L+ RLN S      PPV+CIVSD 
Sbjct  72    FETIPDGLPPSDSDATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNVNPPVTCIVSDW  131

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTL A+++  IP +LF+T  A GF+G+V YR +++K   PLKD SY  NGY+D+V+D
Sbjct  132   SMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLVEKCIFPLKDLSYLTNGYMDSVID  191

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+  M G++L+ LPSFIR+T+ DD +V +++   E   +ASA++ NTFD LE E L  L 
Sbjct  192   WIPVMEGIQLKYLPSFIRSTDRDDIMVNFVITEIENTHNASALIFNTFDDLEPEVLKELS  251

Query  809   SMLPPVYAAGPFQFF----EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             S+ P ++  GP        E    DS +  +G +LW+E   C+EWL++ +  SVVYVNFG
Sbjct  252   SIYPNIFTIGPLNQLVLNNEVSAHDSALSLIGSNLWREQPGCLEWLDSKEQNSVVYVNFG  311

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SIT +T +QLVEFAWGLAN+K+PFLW+IRPD+V+   AV+ +EFVEET++RGMLASWCPQ
Sbjct  312   SITALTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQ  371

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQ++SHPAVGGFLTH GWNST+ES+CSGV M+CWPFFA+QQTNCW+C T+WG+G+E++  
Sbjct  372   EQILSHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPR  431

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
               R E+E+ VRELM GE G  M+ KA+E K LAE AA  P GSSY N++ +IN  L
Sbjct  432   GDRVEIEKRVRELMEGESGKLMKEKALEWKLLAEKAAAGPNGSSYVNLDNLINDVL  487



>ref|NP_173656.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 sp|Q9SK82.1|U85A1_ARATH RecName: Full=UDP-glycosyltransferase 85A1; AltName: Full=Cytokinin-O-glucosyltransferase 
2; AltName: Full=Zeatin O-glucosyltransferase 
2; Short=AtZOG2 [Arabidopsis thaliana]
 gb|AAF18537.1|AC006551_23 Putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL91228.1| putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAP49527.1| At1g22400 [Arabidopsis thaliana]
 gb|AEE30237.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 gb|AHL38930.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=489

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 364/482 (76%), Gaps = 6/482 (1%)
 Frame = +2

Query  77    MGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS I     KPH VC+P+PAQGHINPM+++AK+L+ +GF++TFVN+ +NH R LRSRG 
Sbjct  1     MGSQIIHNSQKPHVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLRSRGS  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              ++ GLPSFRFE+I DGLP +D+DATQDI  LCES  +NCL PF++L+ R+N     PPV
Sbjct  61    NALDGLPSFRFESIADGLPETDMDATQDITALCESTMKNCLAPFRELLQRINAGDNVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD AEE G+PE+LFWT     FL ++ + L I+KG  PLKD SY    
Sbjct  121   SCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLCPLKDESYLTKE  180

Query  608   YL-DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
             YL DTV+D++  M  V+L+D+PSFIRTTNPDD ++ + +  TERAK ASAI++NTFD LE
Sbjct  181   YLEDTVIDFIPTMKNVKLKDIPSFIRTTNPDDVMISFALRETERAKRASAIILNTFDDLE  240

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISV  958
              + ++ +QS+LPPVY+ GP      +   E S +  +  +LWKE+  C++WL+T    SV
Sbjct  241   HDVVHAMQSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWKEEMECLDWLDTKTQNSV  300

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             +Y+NFGSITV++  QLVEFAWGLA + K FLW+IRPDLV+GEEA++P +F+ ET++R ML
Sbjct  301   IYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPDFLMETKDRSML  360

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             ASWCPQE+V+SHPA+GGFLTH GWNS LES+  GVPM+CWPFFADQQ NC +CC +W +G
Sbjct  361   ASWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNCKFCCDEWDVG  420

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             +EI  DVKR EVE +VRELM GEKG +MR KA+E ++LAE A     GSS  N E V++K
Sbjct  421   IEIGGDVKREEVEAVVRELMDGEKGKKMREKAVEWQRLAEKATEHKLGSSVMNFETVVSK  480

Query  1499  FL  1504
             FL
Sbjct  481   FL  482



>ref|XP_010030926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=865

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/509 (58%), Positives = 380/509 (75%), Gaps = 14/509 (3%)
 Frame = +2

Query  20    RTKVIGERGRDRR---IH*NLKMG-SISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHK  187
             R  + GE+G++ R   +   +K   +I   G KPHAVCIP+PAQGHINPMLKLAK+L+HK
Sbjct  355   RELMEGEKGKEMRKKAMEWKVKAKEAIMHAGEKPHAVCIPYPAQGHINPMLKLAKLLHHK  414

Query  188   GFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQ  367
             GFHITFVN+E  H+RLLRS+GP S+ GLP FRF+ IPDGLPPSD D+TQDI +LC S+++
Sbjct  415   GFHITFVNTEHIHKRLLRSQGPHSLDGLPHFRFDMIPDGLPPSDPDSTQDIPSLCASLSE  474

Query  368   NCLGPFKDLIARLNQSG-----PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFL  532
             + L  F+ L+ +L +       PPV+CIVSDG M FT+DAAEE  IPE++F T  A G L
Sbjct  475   HGLSAFRSLLLKLQEQSQDAVVPPVTCIVSDGVMTFTVDAAEELKIPEVVFCTPSACGLL  534

Query  533   GFVLYRLVIDKGFSPLK----DSSYFENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDD  700
             G+  YR +++ GF+ LK    D +Y  NGYL+T + W  GM  +RLRD P+FIRT +  D
Sbjct  535   GYTKYRRLVEDGFTLLKGLMTDPTYLLNGYLETTVSWTSGMKSIRLRDFPTFIRTLDHQD  594

Query  701   PIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGV  880
              ++ +++   ER+  ASA+++NTFD LE + L  L S+ P +Y  GP Q    Q++D  +
Sbjct  595   IMLNFVIQEVERSSRASAVILNTFDTLEHDVLESLSSVFPHIYTIGPLQLLADQIQDEAL  654

Query  881   RALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWII  1060
             R++G +LW+E+  C+ WL++ +P SVVYVNFGSITVMT  QL EFAWGLAN++KPFLWII
Sbjct  655   RSVGGNLWREEPGCLPWLDSKEPGSVVYVNFGSITVMTTGQLTEFAWGLANSQKPFLWII  714

Query  1061  RPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSG  1240
             RPDLV+ E AVLP EFVEE   RGML SWC QE+V+ H A+GGFLTHSGWNSTLES+C G
Sbjct  715   RPDLVASESAVLPPEFVEEIAGRGMLVSWCQQEEVLKHRAIGGFLTHSGWNSTLESLCGG  774

Query  1241  VPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAME  1420
             VP+ICWPFFA+QQTNC Y CT+WGIGMEID DVKR EVE LVRELM GEKG EMR+KAME
Sbjct  775   VPVICWPFFAEQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLVRELMEGEKGKEMRKKAME  834

Query  1421  LKKLAEDAATAPTGSSYNNMEEVINKFLS  1507
              K  AE+ A  P G+SYNN++++I++ LS
Sbjct  835   WKAKAEE-AIMPGGTSYNNVDKLISEVLS  862


 Score =   282 bits (721),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 179/461 (39%), Positives = 241/461 (52%), Gaps = 101/461 (22%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K HAV IP+PAQGHINP+LKLAKIL+H+GFHITFV++++N++RLL+SRG  S+ GLP F 
Sbjct  7     KHHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTDYNYKRLLKSRGLTSLDGLPRFH  66

Query  284   FETIPDGLPPSDV--DATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCIVSDGGMF  457
             FETIPDGLP SD   D TQ I +LC+S ++NCL PF DL+ RLN         V D  + 
Sbjct  67    FETIPDGLPTSDSDEDVTQHIPSLCDSTSKNCLAPFMDLLGRLNDKS------VDDTEVP  120

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
               ++ AE   +P                 + +  D G  P+ DS+               
Sbjct  121   KIIEMAENNQVP-----------------FNVPNDLGDVPMVDST---------------  148

Query  638   GMPGVRLRDL----PSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGL  805
                 V + D+    P F+               +     +A+  M    D  E+  + G+
Sbjct  149   ----VAMEDVQPSGPEFVAANATGPWANTNFGGVGTSHTTANGGMSFALDVAEKLGVPGV  204

Query  806   QSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDT--------SCVEWLNTNDPISVV  961
                 P   A G   + +  +    +R  GL   K+ +        + ++W+     I + 
Sbjct  205   LFWTPS--ACGSLVYTQYHM----LRKKGLFPLKDASYLTNGFLDTTIDWIPGMKNIRL-  257

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
               +  S    T +QL+E +WGLAN++KPFLWIIRPDLV+G+  VLP EF+ ET++RGML 
Sbjct  258   -RDLPSFIRTTDEQLIEVSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGML-  315

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
                                                 +CWPFFA+QQTNC Y  T+WGIGM
Sbjct  316   ------------------------------------VCWPFFAEQQTNCQYSYTEWGIGM  339

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDA  1444
             EID DVKR EVE LVRELM GEKG EMR+KAME K  A++A
Sbjct  340   EIDNDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKVKAKEA  380



>ref|XP_010039816.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/475 (59%), Positives = 365/475 (77%), Gaps = 9/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV IP+PAQGHINP+LKLAKIL+H+GFHITFV++E+NH+ LL+SRGP S+ G P FR
Sbjct  8     KPHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTEYNHKPLLKSRGPSSLDGSPRFR  67

Query  284   FETIPDGLPPSDVD--ATQDIATLCESITQNCLGPFKDLIARLNQSG------PPVSCIV  439
             F+TIPDGLP SD D   TQ I +LCES ++NCL PF DL+ RL+         P VSC++
Sbjct  68    FKTIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLSDKSVDDTEVPKVSCVI  127

Query  440   SDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             +DGGM F LDAAE+ G+P +LFWT  A G L +  Y ++ +KG  PLKD+SY  NG+LDT
Sbjct  128   ADGGMSFALDAAEKLGVPGVLFWTPSACGALVYTQYHMLREKGLFPLKDASYLTNGFLDT  187

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
              +DW+ GM  +RLRDLPSFIRTT+ +D +V YI+   ER   ASA+++NTFD LE++ L 
Sbjct  188   TIDWIPGMKNIRLRDLPSFIRTTDGNDIMVNYIIRQMERTNKASAVILNTFDCLEKDVLM  247

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
                S+ P +Y  GP      ++ED     +G +LWKED +C+ WL++ +P SV+++NFGS
Sbjct  248   AFSSIFPNLYTIGPIHLLLNKIEDDNSCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I V+T++QL+EF+WGLAN++KPFLWIIRPDLV+G++ VLP EF+ ET++RGMLA WCPQE
Sbjct  308   IAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V+ HP+VGGFLTH GWNS LESIC GVP++CWPFFA+QQTNC+Y   +WGIGMEID  V
Sbjct  368   RVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEIDNSV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +R EVE+LVRELM GEKG  M++KA+E K+ AE+ AT   GSSY N+E ++++ L
Sbjct  428   RREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQVL  481



>ref|XP_008229743.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Prunus mume]
Length=495

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/483 (58%), Positives = 364/483 (75%), Gaps = 8/483 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI  +G KPHAVCIPFP Q HI  MLKLAK+L+H+GFHITFVN+EFNHRR L+S GP 
Sbjct  1     MSSIEVQGNKPHAVCIPFPIQSHIKAMLKLAKLLHHRGFHITFVNTEFNHRRFLKSLGPN  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ-------S  415
             S+ GLP F+FETIPDGLP SD DA Q+   LC+SI +N L  F++L+ +LN        S
Sbjct  61    SLNGLPDFQFETIPDGLPASDEDAGQNAYLLCDSIRKNFLAVFRNLLLKLNDMATSNNIS  120

Query  416   GPPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPV+CIVSDG M F++ AAEE GIP  LF+T  A GF+GF  Y  +++KG +PLK+ SY
Sbjct  121   NPPVTCIVSDGFMTFSITAAEELGIPVALFFTIAAIGFMGFKQYPTLVEKGLAPLKEESY  180

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFD  775
               NG+LD V+DWV G   +RL+DLP++ +TTNP+D + K I+    R   ASA++++TFD
Sbjct  181   LTNGFLDQVIDWVPGTKAIRLKDLPNYFQTTNPNDILFKLILEAMYRVDKASAVVLHTFD  240

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
              LE +AL+ L SM PPVY  GP Q    Q+    ++++G SLWKE+T   +WLN   P S
Sbjct  241   ELEADALHALSSMPPPVYTIGPLQLLLNQIPQHPLKSMGYSLWKEETEWFQWLNAKVPNS  300

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSI V+ ++ L+EF WGLAN+K PF W++RPDL+ GE A+LP EFV ET+ RG+
Sbjct  301   VVYVNFGSIVVIKSEDLIEFCWGLANSKLPFFWVVRPDLLVGESAILPPEFVAETKGRGL  360

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +ASWCPQEQV+SHP++GGFLTHSGWNST+ES+ +GVPM+CWPFFA+Q+ NC Y C +WGI
Sbjct  361   VASWCPQEQVLSHPSIGGFLTHSGWNSTIESLSAGVPMLCWPFFAEQRINCVYTCNEWGI  420

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             G+EI+ D KR +VE+L++EL+ GEKG +MR KAME KKLAE  A +P GSSY+N++ ++N
Sbjct  421   GLEINNDAKRHQVEKLIKELVEGEKGKKMRTKAMEWKKLAEK-AISPDGSSYSNLDNLVN  479

Query  1496  KFL  1504
             + L
Sbjct  480   QVL  482



>ref|XP_010060022.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
Length=500

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/496 (58%), Positives = 370/496 (75%), Gaps = 22/496 (4%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI     KPHAVCIP+PAQGHINPML LAK+L+H+GFH+TFVN+E+NH RLL SRGP 
Sbjct  1     MGSIDMIQ-KPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGPS  59

Query  257   SVKGLPSFRFETIPDGLPPSDV-DATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLPSFRF TIP+GLPPSDV DATQDI  LC+S ++ CL  F+D + RLN+       
Sbjct  60    SLDGLPSFRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLGS  119

Query  419   PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYF  598
             PPVSC+VSDG M FTLDAA+  G+ E+LFWT    GF+G+V Y  ++DKG +PLKD+SY 
Sbjct  120   PPVSCVVSDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYVQYCNLVDKGLAPLKDASYL  179

Query  599   ENGYLDTVLDWVKG--------------MPGVRLRDLPSFIRTTNPDDPIVKYIVLITER  736
              N YLDT++DW+                M  + L +L SF+RT +PDD ++ + +  TER
Sbjct  180   TNVYLDTIVDWIPSIRNILDTIIDWIPEMRNICLGELLSFLRTPDPDDLMINFCLRETER  239

Query  737   AKSASAIMVNTFDALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDT  916
             AK ASAI+ NTFD LE E L+ L++M+PP+Y  GP     +Q+ D   +++G + WKED 
Sbjct  240   AKRASAIVFNTFDRLEHEVLDALKAMVPPIYTLGPLHILTEQLPDDDTKSIGSNPWKEDL  299

Query  917   SCVEWLNTNDPISVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVL  1096
              C+EWL++N P+SVVYVNFGSITVM+  QL E AWGLAN+ + FLW+IRPDLV G  A+L
Sbjct  300   GCLEWLDSNPPVSVVYVNFGSITVMSPAQLGELAWGLANSGQAFLWVIRPDLVLGNMAIL  359

Query  1097  PREFVEETRERGMLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQ  1276
             P +F+  TR+R +L SWCPQE+V++HPAVGGFLTH GW ST+ESI +GVP++CWPFF +Q
Sbjct  360   PPDFLAATRQRSLLVSWCPQERVLNHPAVGGFLTHGGWKSTIESIVAGVPVVCWPFFVEQ  419

Query  1277  QTNCWYCCTQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAP  1456
             Q NCWY C +WGIG+EID DVKR EVER VRELM GE+G  M+RK ME +++A +AA  P
Sbjct  420   QRNCWYSCEEWGIGLEIDDDVKRDEVERQVRELMEGERGKAMKRKVMEWQEMAREAAR-P  478

Query  1457  TGSSYNNMEEVINKFL  1504
             +GSS +N++EVI+K L
Sbjct  479   SGSSCSNLDEVIDKVL  494



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/475 (60%), Positives = 371/475 (78%), Gaps = 14/475 (3%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K HAVCIP+PAQGHINPMLKLAK+L+ +GFHITFVN+E+NH+RLL+SRG +S+  +PSF+
Sbjct  3     KLHAVCIPYPAQGHINPMLKLAKLLHVRGFHITFVNTEYNHKRLLKSRGSDSLNSVPSFQ  62

Query  284   FETIPDGLPPS-DVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGM  454
             FETIPDGL  + DVDATQD+ +L ES  + CL PFK+L+++LN +   PPV+CIVSDGGM
Sbjct  63    FETIPDGLSDNPDVDATQDVVSLSESTRRTCLTPFKNLLSKLNSASDTPPVTCIVSDGGM  122

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTLDAA+E GIPE++  T  A G++ ++ Y  ++D G + LKDSSY EN      +DWV
Sbjct  123   SFTLDAAQELGIPEVILSTASACGYMCYMKYPRLVDMGLTHLKDSSYLENS-----IDWV  177

Query  635   KGMPGVRLRDLPSFIRTTNPDD-PIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
              G+  +RL+DLPSF+RTTNP D  ++ +I    ERA+ ASAI+VNTFDALE + L+   S
Sbjct  178   PGIKEIRLKDLPSFMRTTNPQDLMMMDFIYSQCERAQKASAIIVNTFDALEHDVLDAFSS  237

Query  812   -MLPPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
              +LPP+Y+ GP           +  ++ +G +LWKE+  C+EWLN+ +P SVVYVNFGSI
Sbjct  238   ILLPPIYSIGPLNLLLNNDVTNNEELKTIGSNLWKEEPKCLEWLNSKEPNSVVYVNFGSI  297

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGE-EAVLPREFVEETRERGMLASWCPQE  1159
              VMT+DQL E AWGLAN+ K FLW+IRPDLV+GE    LP EFV+ET++RGMLASWCPQE
Sbjct  298   MVMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASWCPQE  357

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V++HPAVGGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC +CC +WGIG+EI+ DV
Sbjct  358   EVLAHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEIE-DV  416

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR +VE LVRELM GEKG EM+ +A+E KKLA +AA++P GSS+ NM+ V+ + L
Sbjct  417   KREKVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVL  471



>ref|XP_010098617.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB75356.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=471

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/433 (64%), Positives = 349/433 (81%), Gaps = 4/433 (1%)
 Frame = +2

Query  155   MLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFETIPDGLPPSDVDATQ  334
             MLKLAK+L+ KGFHITFVN+EFNH+RLL+SRG  ++ GLPSFRFE IPDGLPP+D DATQ
Sbjct  1     MLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGAHALDGLPSFRFEAIPDGLPPTDADATQ  60

Query  335   DIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMFFTLDAAEEFGIPEILFW  508
              I  +CES  ++ L PF+DL+ +LN S   PPVSC+VSDG M FTLDAAEE GIPE+LFW
Sbjct  61    SIPAICESTPKHSLAPFRDLLLKLNSSPEVPPVSCVVSDGAMSFTLDAAEELGIPEVLFW  120

Query  509   TCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGMPGVRLRDLPSFIRTT  688
             T  A GFLG++ YR +++KG++PLKD SY  N YL+TV+DW+ GM  +RL+D+P+FIRTT
Sbjct  121   TTSACGFLGYLHYRALVEKGYTPLKDESYLTNEYLNTVIDWIPGMKDIRLKDIPTFIRTT  180

Query  689   NPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM-LPPVYAAGPFQFFEQQV  865
             +P+D +V +++   ERA+ ASAI++NTF  LE++A+N + S+  PPVY  G  Q    Q 
Sbjct  181   DPNDIMVNFVITEAERAQKASAIILNTFYDLERDAVNAMSSISKPPVYTLGSLQLLLNQF  240

Query  866   E-DSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQLVEFAWGLANTKK  1042
                  +++L  +LWKED  C+EWL++ +P SVVYVNFGSITVMT++QLVEFAWGLAN+KK
Sbjct  241   PITEHLKSLESNLWKEDHKCLEWLDSKEPNSVVYVNFGSITVMTSEQLVEFAWGLANSKK  300

Query  1043  PFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAVGGFLTHSGWNSTL  1222
              FLW++RPDLV+GE AVLP EF EET ERG L SWCPQE+V+ HPAVGGFLTH GWNST+
Sbjct  301   EFLWVLRPDLVAGESAVLPPEFSEETSERGFLTSWCPQEKVLGHPAVGGFLTHCGWNSTI  360

Query  1223  ESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERLVRELMGGEKGHEM  1402
             ESICSGVPM+CWPFFA+QQTNCWY C +WGIGMEID D KR E+ER+VRELM GEKG EM
Sbjct  361   ESICSGVPMLCWPFFAEQQTNCWYSCGEWGIGMEIDGDAKREEIERIVRELMDGEKGREM  420

Query  1403  RRKAMELKKLAED  1441
             +R+  + K+LAE+
Sbjct  421   KRRVEKWKRLAEE  433



>ref|XP_008789348.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X1 [Phoenix 
dactylifera]
Length=477

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/479 (60%), Positives = 361/479 (75%), Gaps = 6/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI  E  +PHAV IP PAQGH+ PMLKLAK+L+ +GF+ITFVN+ FN  RLLRS    
Sbjct  1     MASIVPE--RPHAVLIPIPAQGHVTPMLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAIS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPP---V  427
             S+  LP FRFE+IPDGLPPSD DATQD+ +LC+SI + C+ PF+DLI  LN    P   V
Sbjct  59    SLDSLPEFRFESIPDGLPPSDEDATQDVPSLCDSIPKYCIAPFRDLITELNDPSSPTPTV  118

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD A+E  IPE+LFWT  A G +G++ Y+ +I++G  PLKD+S   NG
Sbjct  119   SCIVSDGVMSFTLDVAKELQIPEVLFWTPSACGVMGYLHYQHLIERGIFPLKDASDLTNG  178

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DW+ GM  VRLRDLP+F+RT +  D +  +     +R+  ASAI++NTFD LE+
Sbjct  179   YLETPIDWISGMKNVRLRDLPTFLRTVDSKDIMFHFCNRAAQRSSMASAIILNTFDELER  238

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
               L+ + SMLPP+Y  GP     +Q+  S + ++  +LWKED +C+EWL   +P SVVYV
Sbjct  239   PVLDAMASMLPPIYTIGPLSLLSRQITASPLTSISSNLWKEDPACLEWLQGREPGSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             N+GSITVMT +QL+EFAWGLAN+K  F W+IRPDLV G+ AVLP+EF+ ET+ERG+LASW
Sbjct  299   NYGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE V+SHP++G FLTHSGWNSTLESIC GVP I WPFFA+QQTNC Y CT+WGIGMEI
Sbjct  359   CPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D++VKR EVERLVRELM GEKG EMRR+A+E K+ A   AT P GSS+ N + ++ + L
Sbjct  419   DSNVKREEVERLVRELMEGEKGKEMRRRAVEWKESA-IRATQPGGSSFQNFDRLVKEAL  476



>ref|XP_008779905.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/479 (60%), Positives = 365/479 (76%), Gaps = 6/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+  E  +PHAV IPFPAQGH+ PMLKLAK+L+ +GF+ITFVN+ FN  RLLRS    
Sbjct  1     MGSMVPE--RPHAVLIPFPAQGHVTPMLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAIS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PPV  427
             S+  L  FRF++IPDGLPP+D DATQDI +LC+SI +NC+ PF+DLI  LN      P V
Sbjct  59    SLDSLSEFRFQSIPDGLPPTDKDATQDIPSLCDSIPKNCIPPFRDLITELNDPSSPTPAV  118

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD A+E  IPE+LFWT  A G +G++ Y+ +I++G  PLKD+S   NG
Sbjct  119   SCIVSDGAMSFTLDVAKELRIPEVLFWTPSACGVMGYLHYQHLIERGIFPLKDASDLTNG  178

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DW+ GM  VRLRDLP+F+RT +  D +  +     +RA  ASAI++NTFD LE+
Sbjct  179   YLETPIDWISGMKNVRLRDLPTFLRTLDSKDIMFHFCNREAQRASMASAIILNTFDELER  238

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
               L+ + S+LPP+Y  GP     +Q+  S   ++  +LWKED +C+EWL   +P SVVYV
Sbjct  239   PVLDAMASILPPIYTIGPLSLLSRQITTSPTTSISSNLWKEDPACLEWLQGREPGSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             N+GSIT+MT +QL+EFAWGLAN+K  FLW+IRPDLV G+  VLP+EF+ ET+ERG+LASW
Sbjct  299   NYGSITMMTNEQLIEFAWGLANSKHDFLWVIRPDLVKGDSTVLPQEFLSETKERGLLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE V+SHP++GGFLTHSGWNSTLESICSGVP I WPFFA+QQTNC Y CT+WGIGMEI
Sbjct  359   CPQEAVLSHPSIGGFLTHSGWNSTLESICSGVPTISWPFFAEQQTNCRYACTEWGIGMEI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D++VKR EVERLVRELM GEKG EMRR+A+E K  A  +AT P GSS+ N + ++N+ L
Sbjct  419   DSNVKREEVERLVRELMEGEKGKEMRRRAVEWKGSA-ISATQPGGSSFQNFDRLVNEAL  476



>ref|XP_008804762.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/479 (59%), Positives = 361/479 (75%), Gaps = 6/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  E  +PHAV IP+PAQGH+ PMLKLAK+L  +GF+ITFVN+ FN  RLLRS    
Sbjct  1     MGSIVPE--RPHAVLIPYPAQGHVTPMLKLAKLLRSRGFYITFVNNHFNQNRLLRSGAIS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG---PPV  427
             S+  LP FRF++IPDGLPP+D DATQDI +LC+SI +NC+ PF+DLI  LN      P V
Sbjct  59    SLDSLPDFRFQSIPDGLPPTDTDATQDIPSLCDSIPKNCIPPFRDLITELNDPSSPTPAV  118

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD A+E  IPE+LFWT  A G++G++ Y+ +I++G  PLKD+    NG
Sbjct  119   SCIVSDGAMSFTLDVAKELRIPEVLFWTPSACGYMGYLHYQHLIERGIFPLKDACDLTNG  178

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+  +DW+ GM  VRLRDLP F+RT +  D +  +     +R+  ASAI++NTFD LE+
Sbjct  179   YLERPIDWISGMKNVRLRDLPIFLRTLDSKDIMFHFCNHAAQRSSMASAIILNTFDELER  238

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
               L+ + SMLPP+Y  GP     +Q+  S + ++  +LWKED +C+EWL   +P SVVYV
Sbjct  239   PVLDAMASMLPPIYTIGPLSLLSRQITTSPLTSISSNLWKEDPTCLEWLQGREPGSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             N+GSITVMT +QL+EFAWGLAN+K  F W+IRPDLV G+ AVLP+EF+ ET+ERG+LASW
Sbjct  299   NYGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE V+SHP++G FLTHSGWNSTLESIC GVP I WPFFA+QQTNC Y CT+WGIGMEI
Sbjct  359   CPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D++VKR EVERLVRELM GEKG EMRR+A+E K+ A   AT P GSS+ N + ++ + L
Sbjct  419   DSNVKREEVERLVRELMEGEKGKEMRRRAVEWKESA-IRATQPGGSSFQNFDRLVKEAL  476



>gb|KCW45698.1| hypothetical protein EUGRSUZ_L00502, partial [Eucalyptus grandis]
Length=479

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/473 (59%), Positives = 364/473 (77%), Gaps = 9/473 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV IP+PAQGHINP+LKLAKIL+H+GFHITFV++E+NH+ LL+SRGP S+ G P FR
Sbjct  8     KPHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTEYNHKPLLKSRGPSSLDGSPRFR  67

Query  284   FETIPDGLPPSDVD--ATQDIATLCESITQNCLGPFKDLIARLNQSG------PPVSCIV  439
             F+TIPDGLP SD D   TQ I +LCES ++NCL PF DL+ RL+         P VSC++
Sbjct  68    FKTIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLSDKSVDDTEVPKVSCVI  127

Query  440   SDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             +DGGM F LDAAE+ G+P +LFWT  A G L +  Y ++ +KG  PLKD+SY  NG+LDT
Sbjct  128   ADGGMSFALDAAEKLGVPGVLFWTPSACGALVYTQYHMLREKGLFPLKDASYLTNGFLDT  187

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
              +DW+ GM  +RLRDLPSFIRTT+ +D +V YI+   ER   ASA+++NTFD LE++ L 
Sbjct  188   TIDWIPGMKNIRLRDLPSFIRTTDGNDIMVNYIIRQMERTNKASAVILNTFDCLEKDVLM  247

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
                S+ P +Y  GP      ++ED     +G +LWKED +C+ WL++ +P SV+++NFGS
Sbjct  248   AFSSIFPNLYTIGPIHLLLNKIEDDNSCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I V+T++QL+EF+WGLAN++KPFLWIIRPDLV+G++ VLP EF+ ET++RGMLA WCPQE
Sbjct  308   IAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V+ HP+VGGFLTH GWNS LESIC GVP++CWPFFA+QQTNC+Y   +WGIGMEID  V
Sbjct  368   RVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEIDNSV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             +R EVE+LVRELM GEKG  M++KA+E K+ AE+ AT   GSSY N+E ++++
Sbjct  428   RREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSQ  479



>ref|XP_008229739.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=490

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/478 (60%), Positives = 368/478 (77%), Gaps = 12/478 (3%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVC+P P Q HI  MLKLAK+L+++GFHITFVN+EFNHRR L+S+GP S+ GLP FR
Sbjct  10    KPHAVCVPVPVQSHIKAMLKLAKLLHNRGFHITFVNTEFNHRRFLKSQGPNSLHGLPDFR  69

Query  284   FETIPDGLPPSDVDATQDIATLCESITQN-CLGPFKDLIARL-----NQSGPPVSCIVSD  445
             FETIPDGLP SD  ATQD+ +L E++ ++  L PF++L+ +L     + + PP++CIVSD
Sbjct  70    FETIPDGLPDSDEGATQDVTSLAEAVVKDGFLAPFRNLLIKLMDAATSNNNPPLTCIVSD  129

Query  446   GGMF-FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTV  622
             G M  F + AAEEFG+P  LF+T  A  F+GF  +R +++KG +PLKD S   NG+LD V
Sbjct  130   GFMSPFAIKAAEEFGLPIALFFTIAACSFMGFKQFRALVEKGLAPLKDESCLTNGFLDKV  189

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             +DW+ GM G+RLR+LPSF RTTNPDD ++   ++ T+    A+A+++ TFDALE++ L+ 
Sbjct  190   IDWIPGMEGIRLRNLPSFFRTTNPDDVLLNLSMVATDEVHKATALVLLTFDALEKDVLSA  249

Query  803   LQSMLP---PVYAAGPFQFFEQQV-EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
             L S +P   PVY  GP +    Q+ +D    ++G SLWKE+T C++WLN+  P SVVYVN
Sbjct  250   LSSTMPNIPPVYTIGPIELLLNQIPKDPLENSVGYSLWKEETECLQWLNSKAPNSVVYVN  309

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGSITVMT +QLVEF WGLAN+K PF W+IRPDLV GE A+LP EFV ET+ERG+LASWC
Sbjct  310   FGSITVMTPNQLVEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLLASWC  369

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
             PQEQV++H +VGGFLTHSGWNSTLES+ +GVPM+CWPFFADQQT+C+Y C +WGIGMEID
Sbjct  370   PQEQVLNHASVGGFLTHSGWNSTLESLTAGVPMLCWPFFADQQTDCYYTCNEWGIGMEID  429

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              DVKR EVE+LV+ELM GEKG +M+ KAME KKLAE+ AT P GSS    + ++N+ L
Sbjct  430   NDVKRDEVEKLVKELMEGEKGKKMKNKAMEWKKLAEE-ATGPHGSSSTGFDNLVNQVL  486



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/476 (58%), Positives = 360/476 (76%), Gaps = 9/476 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             +PHAVC+P+PAQGHINPM +LAK+L+HKGFHITFVN+EFN RRLL+S+GP+S+  +P+FR
Sbjct  12    RPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTFR  71

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDG  448
             FETIPDGLPPSD DATQDI +LC+S  + C  PF+ L+  LN S      PPV+CIVSD 
Sbjct  72    FETIPDGLPPSDADATQDIPSLCDSTRRTCSAPFQALLTTLNNSALSNANPPVTCIVSDW  131

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FTL A+++  IP +LF+T  A GF+G+V YR + +K   PLKD SY  NGY+DTV+D
Sbjct  132   SMGFTLKASKQLNIPNVLFFTASACGFMGYVHYRHLAEKCIFPLKDLSYLTNGYMDTVID  191

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM G++L+ LPSFIR+T+ DD +V +++   E   +ASA++ NTFD LE E L  L 
Sbjct  192   WIPGMEGIQLKYLPSFIRSTDRDDVMVNFVITEIENTHNASALIFNTFDDLEPEVLKELS  251

Query  809   SMLPPVYAAGPFQFF----EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFG  976
             S+ P ++  GP        E    DS +  +G +LW+E   C+EWL++ +  SVVYVNFG
Sbjct  252   SIYPNIFTVGPLNQLVLNNEVSAHDSALSLIGSNLWREQPGCLEWLDSKEQNSVVYVNFG  311

Query  977   SITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQ  1156
             SIT +T +QLVEFAWGLAN+K+PFLW+IRPD+V+   AV+ +EFVEET++RGMLASWCPQ
Sbjct  312   SITALTENQLVEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQ  371

Query  1157  EQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTD  1336
             EQ++ HPAVGGFLTH GWNST+ES+CSGV M+CWPFFA+QQTNCW+C T+WG+G+E++  
Sbjct  372   EQILRHPAVGGFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPR  431

Query  1337  VKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
               R E+E+ VRELM GE G  M+ KA E K LAE AA  P GSSY N+++++N  L
Sbjct  432   ADRVEIEKRVRELMEGESGKLMKEKAWEWKLLAEKAAAGPNGSSYVNLDKLMNDVL  487



>ref|XP_006416203.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
 gb|ESQ34556.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
Length=759

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/471 (61%), Positives = 362/471 (77%), Gaps = 5/471 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPMLK+AK+L+ KGFH+TFVN+ +NH RLLRSRGP ++ GLPSF+
Sbjct  11    KPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGPNALDGLPSFQ  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE IPDGLP +DVDATQDI  LCES  +NCL PFK+L+ ++N     PPVSCIVSDG M 
Sbjct  71    FEAIPDGLPETDVDATQDIPALCESTMKNCLAPFKELLRQINARDDVPPVSCIVSDGCMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE GIPE+LFWT  A   + ++ + L I+KG SP  D SY    YLDTV+DW+ 
Sbjct  131   FTLDAAEELGIPEVLFWTPSACATMAYLHFYLFIEKGLSPFIDESYLTKEYLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  ++L+D+PSFIRTTNPDD ++K+++  TER+K ASAI++NTFD LE + +  +QS+L
Sbjct  191   SMKNLKLKDIPSFIRTTNPDDIMLKFVIRETERSKRASAIILNTFD-LEHDIIQSMQSIL  249

Query  818   PPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP      +   E S    +G +LWKE+  C+ WL+T  P SVVYVNFGSITVM
Sbjct  250   PPVYSVGPLHLLANREIQESSETGKMGSNLWKEEVECLAWLDTKAPNSVVYVNFGSITVM  309

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVIS  1171
             +A QL EFAWGLA + K FLW+IRPDLV+GEEAV+  EF+ ET +R MLASWCPQE+V++
Sbjct  310   SAKQLEEFAWGLAGSGKEFLWVIRPDLVAGEEAVVSPEFLTETADRRMLASWCPQEKVLA  369

Query  1172  HPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCE  1351
             HP+VGGFLTH+GWNS LES+  GVPM+CWPFFADQQTNC +CC +W +GMEI  DV+R E
Sbjct  370   HPSVGGFLTHNGWNSMLESLSGGVPMVCWPFFADQQTNCKFCCDEWEVGMEIGGDVRREE  429

Query  1352  VERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +E+++RELM GEKG +MR KA E ++LAE+A     GSS  N E V+ + L
Sbjct  430   IEKVIRELMDGEKGKKMRDKAEEWRRLAEEATEHEHGSSVVNFETVVKEHL  480


 Score =   362 bits (928),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 216/272 (79%), Gaps = 2/272 (1%)
 Frame = +2

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             +LDTV+DW+  M  ++L+D+P+FIRT+NP+D ++ ++V  T R+K ASAI++NTFD LE 
Sbjct  479   HLDTVVDWIPSMKNLKLKDIPTFIRTSNPNDIMLNFLVRETGRSKRASAIILNTFDDLEH  538

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRA--LGLSLWKEDTSCVEWLNTNDPISVV  961
             + +  +QS+LPPVY+ GP      +  + G  A  +G +LW+E+  C++WL+T  P SVV
Sbjct  539   DIIRSMQSILPPVYSIGPLHLIVNKEIEEGSEAGRMGSNLWREEMECLDWLDTKTPNSVV  598

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSITVM+A QLVEFAWGLA T+K FLW+IRPDLV+G+EAV+P EF+ ET  R ML+
Sbjct  599   YVNFGSITVMSAKQLVEFAWGLAATRKDFLWVIRPDLVAGDEAVIPPEFLMETEGRRMLS  658

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQE+V+SHPA+GGFLTH+GWNSTLESI  GVPM+CWPFFA+QQTNC +CC +W +GM
Sbjct  659   SWCPQEKVLSHPAIGGFLTHNGWNSTLESISGGVPMVCWPFFAEQQTNCKFCCDEWEVGM  718

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAM  1417
             EI  DV R EVE +VRELM GEKG +MR KA+
Sbjct  719   EIGGDVMREEVEAVVRELMDGEKGKKMREKAL  750



>gb|AAR06913.1| UDP-glycosyltransferase 85A8 [Stevia rebaudiana]
Length=479

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/478 (59%), Positives = 365/478 (76%), Gaps = 4/478 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI+ E  KPHA+CIP+PAQGHINPM++ AK+L+ KGFHI+FVN+ +NH+RL RSRG  
Sbjct  1     MASIA-EMQKPHAICIPYPAQGHINPMMQFAKLLHFKGFHISFVNNHYNHKRLQRSRGLS  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-PPVSC  433
             +++GLP F F +IPDGLPPS+ +ATQ I  LCESI ++ L PF DLIA LN S  PPVSC
Sbjct  60    ALEGLPDFHFYSIPDGLPPSNAEATQSIPGLCESIPKHSLEPFCDLIATLNGSDVPPVSC  119

Query  434   IVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYL  613
             I+SDG M FTL AAE FG+PE+LFWT  A GFL +  YR ++DK + PLKD++   NGYL
Sbjct  120   IISDGVMSFTLQAAERFGLPEVLFWTPSACGFLAYTHYRDLVDKEYIPLKDTNDLTNGYL  179

Query  614   DTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEA  793
             +T LDW+ GM  +RL+D PSFIRTT+ +D ++ Y ++ TE      AI++NTFDALE+++
Sbjct  180   ETSLDWIPGMKNIRLKDFPSFIRTTDINDIMLNYFLIETEAIPKGVAIILNTFDALEKDS  239

Query  794   LNGLQSMLPPVYAAGPFQFFEQQVE-DSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
             +  + ++ P +Y  GP    +Q V+ D  ++ +G +LWKED SC+ WL+T  P SVVYVN
Sbjct  240   ITPVLALNPQIYTIGPLHMMQQYVDHDERLKHIGSNLWKEDVSCINWLDTKKPNSVVYVN  299

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGSITVMT +QL+EF WGLAN+KK FLWI RPD+V G EA++P EF+EET+ERGM+ SWC
Sbjct  300   FGSITVMTKEQLIEFGWGLANSKKDFLWITRPDIVGGNEAMIPAEFIEETKERGMVTSWC  359

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
              QE+V+ HP++G FLTHSGWNST+ESI +GVPMICWPFFA+QQTNC YCC +W IG+EID
Sbjct  360   SQEEVLKHPSIGVFLTHSGWNSTIESISNGVPMICWPFFAEQQTNCRYCCVEWEIGLEID  419

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             TDVKR EVE  VRE+M G KG  M+ KA+E KK AE+A +   GSSY N E+++   L
Sbjct  420   TDVKREEVEAQVREMMDGSKGKMMKNKALEWKKKAEEAVSI-GGSSYLNFEKLVTDVL  476



>ref|XP_008229477.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X3 [Prunus 
mume]
Length=484

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/474 (60%), Positives = 354/474 (75%), Gaps = 9/474 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP P Q HI  MLK AK+L+H+GFHITFVN+EFNH+R L+S GP S+ GLP FR
Sbjct  9     KPHAVCIPLPVQSHIKAMLKFAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ------SGPPVSCIVSD  445
             FE IPD LP S+ + TQD  +LCESI  N L PF  L+A+LN       S PPVSCIVSD
Sbjct  69    FEAIPDSLPDSNDNTTQDGTSLCESIRNNFLAPFHALLAKLNNDAIETSSNPPVSCIVSD  128

Query  446   GGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTV  622
             G M  FT+ AAEE G P +LF+T  A  F+G   +R V++KG +PLKD S F NGYLDTV
Sbjct  129   GLMSMFTITAAEEIGAPIVLFYTIAACSFMGIKQFRAVVEKGLAPLKDESCFINGYLDTV  188

Query  623   LDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNG  802
             +DW+ GM  +RLRDLP+F+RTTNPDD    +I+  T+RA  ASA++++TFDALE + L  
Sbjct  189   IDWIPGMRDIRLRDLPTFLRTTNPDDNKFNFIMEATDRAHEASAVVLHTFDALESDVLEA  248

Query  803   LQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
             L SMLP V   GP Q    ++ +  ++ +G SLWKE+T C+EWLNT  P SVVYVNFGSI
Sbjct  249   LSSMLPCVCTVGPLQLHLNEIPEHPLK-MGYSLWKEETECLEWLNTKAPNSVVYVNFGSI  307

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
              +MT  QLVEF  GL N+K PF W+IRPDLV GE A+LP EFV ET+ER ++A WCPQEQ
Sbjct  308   ALMTPQQLVEFGRGLENSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQEQ  367

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V++HP+VGGFLTHSGWNST+ES+ +GVPM+CWP FADQQ +C Y C +WGIGME+  DVK
Sbjct  368   VLNHPSVGGFLTHSGWNSTVESLTAGVPMLCWPIFADQQMDCRYACNEWGIGMEVSNDVK  427

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             R EVE+LV+ELM GEKG +M+ K ME KKLAE+ AT P GSS  N++ ++N+ L
Sbjct  428   RDEVEKLVKELMEGEKGKKMKNKVMEWKKLAEE-ATGPHGSSSTNLDNLVNQVL  480



>ref|XP_008372493.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/470 (60%), Positives = 365/470 (78%), Gaps = 7/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV IPFPAQGHINPM +LAK+L++KGFHITFVN+E  H+RL+ S G  S+ GLP+FR
Sbjct  5     KPHAVFIPFPAQGHINPMQQLAKLLHYKGFHITFVNTEVTHKRLINSLGANSLDGLPTFR  64

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMF  457
             FETIPDGLP +     +D+ +LC S  +  LGPF++L+ +LN S   PPV+CI++DG M 
Sbjct  65    FETIPDGLPATH---PRDVPSLCVSTNKTGLGPFRELLKKLNSSPNSPPVTCIIADGVMT  121

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA E GIPE+LFWT  A GFL +  Y  +I++G +PLKD S+F NGYLDTV+DW+ 
Sbjct  122   FTLDAAHELGIPEVLFWTTSACGFLAYAQYHRLIEEGLTPLKDESHFXNGYLDTVVDWLP  181

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  +RL+D+PSFIRTT+P+D +++++V  TER K ASA+++NTF++ E+EAL+ + S+ 
Sbjct  182   GMKDIRLKDIPSFIRTTDPNDVMLEFMVGETERTKKASAVVLNTFESFEKEALDAISSLF  241

Query  818   PPVYAAGPFQF-FEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PP Y+ GP    F Q   D+ ++A+  SLW ED  C++WL+T +P SVVYVNFGS TVMT
Sbjct  242   PPTYSVGPLNLLFSQIPADNELKAIASSLWTEDKECLDWLDTKEPNSVVYVNFGSTTVMT  301

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
              +QLVEF+WGLAN+ K FLWIIRP LV+G+ AV+P EF+EET  RG LASWCPQEQV++H
Sbjct  302   NEQLVEFSWGLANSNKTFLWIIRPGLVAGDSAVVPPEFLEETXGRGKLASWCPQEQVLTH  361

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC Y C  WGIG+EI+ +VKR  +
Sbjct  362   PAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACKHWGIGIEIEDEVKRDYI  421

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR LM GE+G EMR+ A+  KK  E  AT+P GSS  +++ +IN+ L
Sbjct  422   EGLVRRLMEGEEGKEMRKNALGWKKKIEK-ATSPKGSSVLDLDNLINQVL  470



>ref|XP_008789349.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X2 [Phoenix 
dactylifera]
Length=477

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/479 (59%), Positives = 364/479 (76%), Gaps = 6/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+  +  +PHAV +P+PAQGH+ P+LKLAK+L+ +GF+ITFVN+ FN  RLLRS    
Sbjct  1     MGSMVPQ--RPHAVLVPYPAQGHVTPLLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAIS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPP---V  427
             S+  LP FRFE+I DGLPP+D DATQD+ +LC+SI +NC+ PF+DLI  LN    P   V
Sbjct  59    SLDSLPDFRFESIRDGLPPTDKDATQDVPSLCDSIPKNCIAPFRDLIKELNDPSSPTPTV  118

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             S IVSDG M FTLD A+E  IPE+LFWT  A G++G++ Y+ ++++G  PLKD+S   NG
Sbjct  119   SRIVSDGVMSFTLDVAKELQIPEVLFWTPSACGYMGYLHYQHLMERGIVPLKDASDLTNG  178

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DW+ GM  VRLRDLPSF+RT +  D +  Y+    +R+  ASAI++NTFD LE+
Sbjct  179   YLETPIDWISGMKNVRLRDLPSFLRTLDSKDIMFHYLNREAQRSSMASAIILNTFDELER  238

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
               L+ + SMLPP+Y  GP     +Q+  S + ++  +LWKED +C+EWL   +P SVVYV
Sbjct  239   PVLDAMASMLPPIYTIGPLSLLSRQITASPLTSISSNLWKEDPACLEWLQGREPGSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             N+GSITVMT +QL+EFAWGLAN+K  F W+IRPDLV G+ AVLP+EF+ ET+ERG+LASW
Sbjct  299   NYGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE V+SHP++G FLTHSGWNSTLESIC GVP I WPFFA+QQTNC Y CT+WGIGMEI
Sbjct  359   CPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D++VKR EVERLVRELM GEKG EMRR+A+E K+ A   AT P GSS+ N + ++ + L
Sbjct  419   DSNVKREEVERLVRELMEGEKGKEMRRRAVEWKESA-IRATQPGGSSFQNFDRLVKEAL  476



>ref|XP_002893223.1| transcription factor/ transferase, transferring glycosyl groups 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH69482.1| transcription factor/ transferase, transferring glycosyl groups 
[Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/481 (59%), Positives = 359/481 (75%), Gaps = 5/481 (1%)
 Frame = +2

Query  77    MGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS +     KPH VC+P+PAQGHINPMLK+AK+L+ +GFH+TFVN+ +NH RLL+SRG 
Sbjct  1     MGSHVVCNAQKPHVVCVPYPAQGHINPMLKVAKLLHVRGFHVTFVNTVYNHNRLLQSRGA  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
              ++ GLPSFRFE IPDGLP + VDATQDI  LCES  +NCL PFK L+ ++N S   PPV
Sbjct  61    NALDGLPSFRFECIPDGLPENGVDATQDIPALCESTMKNCLVPFKKLLQQINTSEDVPPV  120

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             SCIVSDG M FTLD  EE G+PE++FWT  A GF+ ++ + L I+KG  P+KD S     
Sbjct  121   SCIVSDGSMSFTLDVVEELGVPEVIFWTPSACGFMAYLHFYLFIEKGLCPVKDESCLTKE  180

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YLDTV+DW+  M  ++L+D+PSFIRTTNP+D ++ +IV  T RAK ASAI++NTFD LE 
Sbjct  181   YLDTVIDWIPSMKNLKLKDIPSFIRTTNPNDIMLNFIVRETCRAKRASAIILNTFDDLEH  240

Query  788   EALNGLQSMLPPVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVV  961
             + +  +QS+LPPVY  GP       +  EDS +  +G +LWKE+T C +WL+T  P S+V
Sbjct  241   DIIRSMQSILPPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECFDWLDTKAPNSIV  300

Query  962   YVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLA  1141
             YVNFGSIT MT  QLVEFAWGLA T K FLW++RPDLV+GE AV+P E + ET +R ML 
Sbjct  301   YVNFGSITTMTTTQLVEFAWGLAATGKEFLWVMRPDLVAGEGAVIPSEVLAETADRRMLT  360

Query  1142  SWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGM  1321
             SWCPQE+V+SHPA+GGFLTH GWNSTLES+  GVPM+CWPFFA+QQTNC + C +W +G+
Sbjct  361   SWCPQEKVLSHPAIGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWEVGI  420

Query  1322  EIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             EI  DVKR EVE +VRELM GEKG +MR KA E ++LAE A   P GSS    E ++NK 
Sbjct  421   EIGGDVKREEVEAVVRELMDGEKGKKMREKAEEWQRLAEKATELPCGSSVIGFETIVNKV  480

Query  1502  L  1504
             L
Sbjct  481   L  481



>ref|XP_010459994.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Camelina sativa]
Length=513

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/482 (58%), Positives = 364/482 (76%), Gaps = 5/482 (1%)
 Frame = +2

Query  74    KMGS-ISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRG  250
             KMGS ++    KPH VC+P+PAQGHINPM+K+AK+L+ +GFH+TFVN+ +NH R LRS G
Sbjct  25    KMGSHVALNAQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSHG  84

Query  251   PESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PP  424
               ++ GL SFRFE+IPDGLP +D+D TQDI  LCES  +NCL PF++L+ R+N     PP
Sbjct  85    SIALDGLHSFRFESIPDGLPETDMDTTQDITALCESTMKNCLVPFQELLQRINARDDVPP  144

Query  425   VSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFEN  604
             VSCIVSDG M FTLDAAEE G+PE+LFWT     FL ++ + L I+KG +PLKD SY   
Sbjct  145   VSCIVSDGVMSFTLDAAEELGVPEVLFWTTSGCAFLTYLHFYLFIEKGITPLKDESYLTK  204

Query  605   GYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALE  784
              +LD V+D++  M  ++L+D+PSF+RTT+PDD ++K+    TER+K ASAI++NTFD LE
Sbjct  205   EHLDMVIDFIPTMTNLKLKDIPSFVRTTDPDDFMLKFACRETERSKRASAIILNTFDDLE  264

Query  785   QEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRA--LGLSLWKEDTSCVEWLNTNDPISV  958
                +  +QS+LPPVYA GP      +  + G  A  +  SLWKE+  C+EWL+T    SV
Sbjct  265   HGVIQAMQSLLPPVYAVGPLHLLANREIEEGSEAGMMNSSLWKEEMECLEWLDTKPQNSV  324

Query  959   VYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGML  1138
             +Y+NFGSITV++A+QLVEFAWGLA + K FLW+IRPDLV+GEEA++P EF+ ET +R +L
Sbjct  325   IYINFGSITVLSAEQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPEFLTETADRRLL  384

Query  1139  ASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIG  1318
             A WCPQE+V+SHPAVGGFLTH GWNS LES+  GVPM+CWPFFADQQ NC +CC +WG+G
Sbjct  385   AGWCPQEKVLSHPAVGGFLTHCGWNSILESLSCGVPMVCWPFFADQQINCKFCCDEWGVG  444

Query  1319  MEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             +E   DVKR EVE +VRE+M G+KG +MR KA+E ++LAE+A     GSS  N E V++K
Sbjct  445   IETGGDVKRDEVEAVVREVMDGDKGKKMREKAVEWQRLAEEATEHKLGSSIVNFETVVSK  504

Query  1499  FL  1504
             FL
Sbjct  505   FL  506



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/475 (60%), Positives = 369/475 (78%), Gaps = 14/475 (3%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             K HAVCIP+PAQGHINPMLKLAK+L+ +GFHITFVN+E+NH+RLL+SRG +S+  +PSF+
Sbjct  3     KLHAVCIPYPAQGHINPMLKLAKLLHVRGFHITFVNTEYNHKRLLKSRGSDSLNSVPSFQ  62

Query  284   FETIPDGLPPS-DVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGM  454
             FETIPDGL  + DVDATQD+ +L ES  + CL PFK+L+++LN +   PPV+CIVSD GM
Sbjct  63    FETIPDGLSDNPDVDATQDVVSLSESTRRTCLTPFKNLLSKLNSASDTPPVTCIVSDSGM  122

Query  455   FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWV  634
              FTLDAA+E GIP++   T  A G++ ++ Y  ++D G + LKDSSY EN      +DWV
Sbjct  123   SFTLDAAQELGIPDVFLSTASACGYMCYMKYPRLVDMGLTHLKDSSYLENS-----IDWV  177

Query  635   KGMPGVRLRDLPSFIRTTNPDD-PIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQS  811
              G+  +RL+DLPSF+RTTNP D  ++ +I    ERA+ ASAI+VNTFDALE + L+   S
Sbjct  178   PGIKEIRLKDLPSFMRTTNPQDLMMMDFIYSQCERAQKASAIIVNTFDALEHDVLDAFSS  237

Query  812   -MLPPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
              +LPP+Y+ GP           +  ++ +G +LWKE+  C+EWLN+ +P SVVYVNFGSI
Sbjct  238   ILLPPIYSIGPLNLLLNNDVTNNEELKTIGSNLWKEEPKCLEWLNSKEPNSVVYVNFGSI  297

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGE-EAVLPREFVEETRERGMLASWCPQE  1159
              VMT+DQL E AWGLAN+ K FLW+IRPDLV+GE    LP EFV+ET++RGMLASWCPQE
Sbjct  298   MVMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASWCPQE  357

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V++HPAVGGFLTH GWNSTLES+C GVPM+CWPFFA+QQTNC +CC +WGIG+EI+ DV
Sbjct  358   EVLAHPAVGGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEIE-DV  416

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR +VE LVRELM GEKG EM+ +A+E KKLA +AA++P GSS+ NM+ V+ + L
Sbjct  417   KREKVEALVRELMEGEKGKEMKERALEWKKLAHEAASSPHGSSFVNMDNVVRQVL  471



>ref|XP_002885822.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62081.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/455 (62%), Positives = 355/455 (78%), Gaps = 7/455 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPMLKLAKIL  +GFH+TFVN+ +NH RLLRSRGP ++ GLPSFR
Sbjct  11    KPHVVCVPYPAQGHINPMLKLAKILYVRGFHVTFVNTIYNHNRLLRSRGPNALDGLPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLN--QSGPPVSCIVSDGGMF  457
             FE+IPDGLP ++VDATQDI+ LC+++ +NCL PFK+L+ R+N  Q+ PPVSCIVSDG M 
Sbjct  71    FESIPDGLPETNVDATQDISALCDAVKKNCLTPFKELLRRINSQQNVPPVSCIVSDGTMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE+LFWT  A GF+ ++ + L I+KG  PLKD SY    YLDTV+DW+ 
Sbjct  131   FTLDAAEELGVPEVLFWTTSACGFMAYLHFHLFIEKGLCPLKDESYLTKEYLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERA---KSASAIMVNTFDALEQEALNGLQ  808
              M  + L+D+PSFIRTTNPDD +V Y +  TERA   K ASAI++NTFD LE + +  +Q
Sbjct  191   SMKNLTLKDIPSFIRTTNPDDIMVNYALRETERAMDAKHASAIILNTFDDLEHDVIQSMQ  250

Query  809   SMLPPVYAAGPFQFFEQQV--EDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSI  982
             S+LPPVY+ GP      Q   E+S V  +G +LWKE+  C++WL+T    SVVYVNFGSI
Sbjct  251   SILPPVYSIGPLHLIMNQEIDENSDVGKIGSNLWKEEMDCLDWLDTKTRNSVVYVNFGSI  310

Query  983   TVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQ  1162
             TVM+A  LVEFAWGLA   K FLW+IRPDLV GEEAV+P +F+ E  +R MLA+WCPQE+
Sbjct  311   TVMSAKHLVEFAWGLAGCGKEFLWVIRPDLVVGEEAVVPPDFLTEKVDRRMLANWCPQEK  370

Query  1163  VISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVK  1342
             V+SHP++G FLTHSGWNSTLES+  GVPM+C PFFA+QQTNC +CC +W +GMEI  DV+
Sbjct  371   VLSHPSIGVFLTHSGWNSTLESLSCGVPMVCLPFFAEQQTNCKFCCDEWEVGMEIGEDVR  430

Query  1343  RCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAA  1447
             R E+E +V+EL+ GEKG +MR KA E ++LA++A 
Sbjct  431   REEIETVVKELIDGEKGKKMREKAEEWRRLAKEAT  465



>ref|XP_009349618.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/475 (60%), Positives = 358/475 (75%), Gaps = 10/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP P Q H+  MLK AK+L+++GFHITFVNSEFNH+R L+S GP S+ GLP FR
Sbjct  9     KPHAVCIPIPTQSHVKAMLKFAKLLHYRGFHITFVNSEFNHKRFLKSLGPNSLDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQ------SGPPVSCIVS  442
             F  IPDGLP SD D TQD+  L ++I  +N L PF DLI +LN       + PPV+CIVS
Sbjct  69    FVAIPDGLPDSDEDNTQDVTVLVDAIRKRNFLAPFCDLINKLNNDAITSSNNPPVTCIVS  128

Query  443   DGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             DG M  FT+ AAEE G P +LF+T  A  F+G + +R +++KG +PLKD SY  NGYLD 
Sbjct  129   DGFMSTFTITAAEEIGTPIVLFYTIAACSFMGIIQFRAMVEKGLAPLKDESYLTNGYLDK  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  + L+DLP+F RTTN DD I  +++  T+R+  ASA++V+TFDALE++ L+
Sbjct  189   VIDWIPGMKNICLKDLPAFFRTTNSDDIIFNFVMESTDRSHEASAVVVHTFDALERDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L SMLP VY  GP Q    Q+ +  +  +G SLWKE+T C+EWLNT    SVVYVNFGS
Sbjct  249   ALSSMLPLVYTIGPLQLHLNQIPEHPLN-IGYSLWKEETVCLEWLNTKAQNSVVYVNFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             ITVMT   LVEF WGLAN+K PF W+IRPDLV GE A+LP EFV ET+ER ++ASWCPQE
Sbjct  308   ITVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLVASWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ES+ SGVPM+CWPFFADQQ +C Y C +W +GMEI  DV
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWDVGMEIGNDV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LVRELM GEKG +M+ +AME KKLAE+ AT+P GSS  N++ ++N+ L
Sbjct  428   KRDEVEKLVRELMDGEKGKKMKNRAMEWKKLAEE-ATSPYGSSSKNLDNLVNQVL  481



>ref|NP_173652.1| UDP-glucosyl transferase 85A7 [Arabidopsis thaliana]
 sp|Q9LME8.1|U85A7_ARATH RecName: Full=UDP-glycosyltransferase 85A7 [Arabidopsis thaliana]
 gb|AAF87257.1|AC068562_4 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain [Arabidopsis thaliana]
 gb|ABE65644.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
thaliana]
 gb|AEE30231.1| UDP-glucosyl transferase 85A7 [Arabidopsis thaliana]
 gb|AHL38934.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=487

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/475 (59%), Positives = 361/475 (76%), Gaps = 5/475 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGHINPMLK+AK+L  KGFH+TFVN+ +NH RLLRSRGP ++ G PSFR
Sbjct  11    KPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDGFPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +D D TQ   T+C SI +NCL PFK+++ R+N     PPVSCIVSDG M 
Sbjct  71    FESIPDGLPETDGDRTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPVSCIVSDGVMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAAEE G+PE++FWT  A GF+  + + L I+KG SP KD SY    +LDTV+DW+ 
Sbjct  131   FTLDAAEELGVPEVIFWTNSACGFMTILHFYLFIEKGLSPFKDESYMSKEHLDTVIDWIP  190

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
              M  +RL+D+PS+IRTTNPD+ ++ +++   ER+K ASAI++NTFD LE + +  +QS+L
Sbjct  191   SMKNLRLKDIPSYIRTTNPDNIMLNFLIREVERSKRASAIILNTFDELEHDVIQSMQSIL  250

Query  818   PPVYAAGPFQFF--EQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVM  991
             PPVY+ GP      E+  E S +  +GL+LW+E+  C++WL+T  P SV++VNFG ITVM
Sbjct  251   PPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWLDTKTPNSVLFVNFGCITVM  310

Query  992   TADQLVEFAWGLANTKKPFLWIIRPDLVSGEE-AVLPREFVEETRERGMLASWCPQEQVI  1168
             +A QL EFAWGLA ++K FLW+IRP+LV GE   VLP+EF+ ET +R MLASWCPQE+V+
Sbjct  311   SAKQLEEFAWGLAASRKEFLWVIRPNLVVGEAMVVLPQEFLAETIDRRMLASWCPQEKVL  370

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             SHPA+GGFLTH GWNSTLES+  GVPMICWP F++Q TNC +CC +WG+G+EI  DVKR 
Sbjct  371   SHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGVGIEIGKDVKRE  430

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFLSPN  1513
             EVE +VRELM GEKG ++R KA E ++LAE+A     GSS  N+E +I+K    N
Sbjct  431   EVETVVRELMDGEKGKKLREKAEEWRRLAEEATRYKHGSSVMNLETLIHKVFLEN  485



>ref|XP_010039829.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/475 (58%), Positives = 361/475 (76%), Gaps = 9/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV IP+PAQGHINP++KLAKIL+H+GFHITFV++E+NH+RLL+SRG  S+ G P FR
Sbjct  8     KPHAVVIPYPAQGHINPIMKLAKILHHRGFHITFVHTEYNHKRLLKSRGLSSLDGSPRFR  67

Query  284   FETIPDGLPPSDVD--ATQDIATLCESITQNCLGPFKDLIARLNQSG------PPVSCIV  439
             FETIPDGLP SD D   TQ I +LCES ++NCL PF DL+ RLN         P VSC++
Sbjct  68    FETIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLNDKSVDDTEVPKVSCVI  127

Query  440   SDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             +DGGM F LDAAE+ G+P +LFWT  A G L +  Y ++ +KG  PLKD+SY  NG+LDT
Sbjct  128   ADGGMSFALDAAEKLGVPGVLFWTPSACGALVYTQYHMLREKGLFPLKDASYLTNGFLDT  187

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
              +DW+ GM  +RL+DLPSFIRTT+ +D +V YI+   ER   ASA+++NTFD LE + L 
Sbjct  188   TIDWIPGMKNIRLQDLPSFIRTTDGNDIMVNYIIRQIERTNKASAVILNTFDCLENDVLM  247

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
                S+   +Y  GP      ++ED     +G +LWKED +C+ WL++ +P SV+++NFGS
Sbjct  248   AFSSIFLNLYTIGPIHLLLNKMEDDNWCRIGSNLWKEDFACLGWLDSKEPNSVLFINFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             I V+T++QL+EF+WGLAN++KPFLWIIRPDLV+G+  VLP EF+ ET++RGMLA WCPQE
Sbjct  308   IAVVTSEQLIEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             +V+ HP+VGGFLTH GWNS LESIC GVP++CWPFFA+QQTNC+Y   +WGIGMEID  V
Sbjct  368   RVLRHPSVGGFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +R EVE+LVRELM GEKG  M++KA+E K+ AE+ AT   GSSY N+E +++  L
Sbjct  428   RREEVEKLVRELMDGEKGKAMKKKAVEWKRKAEE-ATELGGSSYENLETLLSHVL  481



>ref|XP_008386104.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=473

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/470 (60%), Positives = 365/470 (78%), Gaps = 7/470 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAV IPFPAQGHINPM +LAK+L++KGFHITFVN+E  H+RL+ S G  S+ GLP+FR
Sbjct  5     KPHAVFIPFPAQGHINPMQQLAKLLHYKGFHITFVNTEVTHKRLINSLGANSLDGLPTFR  64

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQS--GPPVSCIVSDGGMF  457
             FETIPDGLP S     +D+ +LC S  +  L PF++L+ +LN S   PPV+CI++DG M 
Sbjct  65    FETIPDGLPASH---PRDVPSLCVSTNKTGLAPFRELVKKLNSSPNSPPVTCIIADGVMT  121

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVK  637
             FTLDAA E GIPE+LFWT  A GFL +  Y  +I++G +PLKD S+F NGYLDT++DW+ 
Sbjct  122   FTLDAAHELGIPEVLFWTTSACGFLAYAQYHRLIEEGLTPLKDESHFTNGYLDTMVDWLP  181

Query  638   GMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSML  817
             GM  +RL+D+PSFIRTT+P+D +++++V  TER K ASA+++NTF +LEQEAL+ + S+ 
Sbjct  182   GMKDIRLKDMPSFIRTTDPNDVMLEFMVGETERTKKASAVVLNTFKSLEQEALDAISSLF  241

Query  818   PPVYAAGPFQF-FEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMT  994
             PP Y+ GP    F Q  ED+ ++A+  SLW EDT+C++WL+T +P SVVYVNFGS TVMT
Sbjct  242   PPTYSVGPLNLLFSQIPEDNELKAIASSLWTEDTACLDWLDTKEPNSVVYVNFGSTTVMT  301

Query  995   ADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISH  1174
              +QLVEF+WGLAN+ K FLWIIRP LV+G+ AV+P  F+EET  RG LASWCPQEQV++H
Sbjct  302   NEQLVEFSWGLANSNKTFLWIIRPGLVAGDTAVVPPLFLEETEGRGKLASWCPQEQVLTH  361

Query  1175  PAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEV  1354
             PA+GGFLTHSGWNSTLES+C GVPMICWPFFA+QQTNC Y C  WGIG+EI+ +VKR  +
Sbjct  362   PAIGGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRYACEHWGIGIEIEDEVKRDYI  421

Query  1355  ERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             E LVR LM G++G EMR+ A+  KK  E+  T+  GSS  +++ +IN+ L
Sbjct  422   EGLVRRLMEGKEGKEMRKNALGWKKKIEE-VTSRKGSSVLDLDNLINQVL  470



>ref|XP_004136879.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=488

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/486 (57%), Positives = 359/486 (74%), Gaps = 9/486 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+S +  KPHAVCIP+PAQGHI PML LAK+L+HKGF+ITFVN+++NHRRLL+SRGP 
Sbjct  1     MGSVS-QTEKPHAVCIPYPAQGHITPMLMLAKLLHHKGFYITFVNTDYNHRRLLKSRGPN  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG------  418
             S+ GL  F F TIPDGLP SD + TQDI  LCES ++NCL PF DLI++LN         
Sbjct  60    SLDGLQDFTFRTIPDGLPYSDANCTQDIPALCESTSKNCLAPFCDLISQLNSMAASPSSN  119

Query  419   -PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPVSCIVSD  M F++ AA EF IP    WT  A G+LG+  Y  +I +G  PLKD + 
Sbjct  120   MPPVSCIVSDAVMSFSMLAANEFKIPYAFLWTASACGYLGYFQYEHLIKQGLIPLKDMNQ  179

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFD  775
               +GYL+T + W +GM  +RL+DLP+ + T   DD ++ +I+   ER++ AS I++NTFD
Sbjct  180   VTDGYLETTVGWTQGMKNIRLKDLPTLLGTVVEDDIMINFIIQAMERSREASTIILNTFD  239

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             A+E +  + L S+L  +Y  GP      Q++D  + A+G +LW E++ C+EWLN+  P S
Sbjct  240   AIEGDVKDSLSSILQSIYTIGPLHMLSNQIDDENLTAIGSNLWAEESECIEWLNSKQPNS  299

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVMT  Q++EFAWGLA++ KPFLWI RPDL+ G+ A++ +EFV +T++R M
Sbjct  300   VVYVNFGSITVMTPQQMIEFAWGLADSGKPFLWITRPDLIVGDSAIMSQEFVTQTKDRSM  359

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +ASWC QEQV++HP++GGF+THSGWNSTLESIC+GVPMI WPFFA+QQTNC YCCT+WGI
Sbjct  360   IASWCSQEQVLNHPSIGGFVTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGI  419

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             GMEID +V R EVE LV ELM GEKG +M+  AM LK  AE+A   P GS+Y  ++++IN
Sbjct  420   GMEIDNNVIRSEVEELVGELMDGEKGKKMKENAMFLKSKAEEAY-KPGGSAYKQLDKLIN  478

Query  1496  KFLSPN  1513
             + L  N
Sbjct  479   EVLLSN  484



>ref|XP_010521179.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Tarenaya hassleriana]
Length=482

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/483 (59%), Positives = 366/483 (76%), Gaps = 12/483 (2%)
 Frame = +2

Query  77    MGSISG-EGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGP  253
             MGS++G    KPHAVC+P+PAQGHINPMLKLAK+L+ +GFH+TFVN+EFNHRRLLRSRGP
Sbjct  1     MGSLAGSRSQKPHAVCVPYPAQGHINPMLKLAKLLHVRGFHVTFVNTEFNHRRLLRSRGP  60

Query  254   ESVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQN-CLGPFKDLIARLNQSG---P  421
              ++ GLPSFRFETIPDGLP +DVDATQDI  LC+SI +N  L PF++L+ R+N +G   P
Sbjct  61    HALAGLPSFRFETIPDGLPETDVDATQDIPALCKSIMENRMLAPFRELLRRVNFAGKEIP  120

Query  422   PVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFE  601
              VSC+V+DG M FT+DAAEE G+P +L  T  A  F+ ++ Y  +I KG  PLKD ++  
Sbjct  121   AVSCVVADGAMSFTVDAAEELGVPVVLLRTNSACVFMLYLHYHHLIQKGLIPLKDYNH--  178

Query  602   NGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDAL  781
                LD+ +DW+  M   RL+DLPSF +TTNP++   K++  + ER K ASA+++NTFD L
Sbjct  179   ---LDSKIDWIPSMKNFRLKDLPSFYKTTNPNNTNFKFVPHVMERVKRASAVVINTFDDL  235

Query  782   EQEALNGLQSMLPPVYAAGPFQFF-EQQVE-DSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
             E + +  +QS++PPVY  GP      +++E DS +  LG +LWKEDT C+ WL+T  P +
Sbjct  236   EHDVILSMQSIIPPVYPIGPLHLLVNREIEKDSEIGRLGSNLWKEDTECLSWLDTKAPNT  295

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSITVM+  QL+EFAWGLA + K FLW+IRPDL++G+ AV+P EF+ ET ERGM
Sbjct  296   VVYVNFGSITVMSEKQLLEFAWGLAGSGKAFLWVIRPDLIAGKSAVVPPEFMVETAERGM  355

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             LASWCPQE+V+SHPAVGGFLTH GWNSTLESI  GVPMICWPFFADQ TNC +CC +W +
Sbjct  356   LASWCPQEEVLSHPAVGGFLTHCGWNSTLESISGGVPMICWPFFADQPTNCKFCCDEWAV  415

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             G EI  DVKR EVE +VRELM GE G +MR K  E ++LA  A   P+GSS+ N+E V++
Sbjct  416   GKEIGGDVKREEVEAVVRELMEGEMGKKMREKVKEWRRLAVAATATPSGSSFANLETVVD  475

Query  1496  KFL  1504
             K L
Sbjct  476   KVL  478



>ref|XP_009377947.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=476

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/471 (59%), Positives = 357/471 (76%), Gaps = 2/471 (0%)
 Frame = +2

Query  92    GEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGL  271
             GE  +PHAVCIP PAQGHI  ML+L+K+L+HKGF IT+VN+EFNHRR L+S GP+S+ GL
Sbjct  5     GEANQPHAVCIPVPAQGHIKAMLQLSKLLHHKGFRITYVNTEFNHRRFLKSLGPDSLDGL  64

Query  272   PS-FRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCIVSDG  448
             PS F+FETIPDGLP  D D+TQD   L +S+  N L PF DLI +LN++ PPV+ IVSDG
Sbjct  65    PSDFQFETIPDGLPDRDDDSTQDFNLLADSVKNNFLAPFLDLIKKLNRTTPPVTLIVSDG  124

Query  449   GMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLD  628
              M FT  AA++ GIP  LF+T  A   +G++ Y  ++++G +PLKD S F NG+LD ++D
Sbjct  125   FMAFTTTAAQQLGIPITLFFTFSASSSMGYMKYPALVERGLAPLKDESSFTNGFLDQIID  184

Query  629   WVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             W+ GM  +RLRDLP+   TTNPDD I   I+ +  R   AS+I+V+TFDALEQ+ L+GL 
Sbjct  185   WIPGMKHIRLRDLPNDFVTTNPDDKIFNNILEVMSRVHEASSIIVHTFDALEQDVLDGLS  244

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             SM PP+YA GP      Q+    +++LG SLW+E+  C+ WL+   P SVVYVNFGSITV
Sbjct  245   SMYPPIYAIGPLPLLLNQMPQHPLKSLGYSLWREEAECLPWLDDKKPNSVVYVNFGSITV  304

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             MT +QLVEF WGLA +K  F W+IRPDLV G+ A+ P EFV+ET+ R ++ASWCPQEQV+
Sbjct  305   MTPEQLVEFGWGLAKSKLAFFWVIRPDLVIGKSAIFPSEFVDETKGRSLIASWCPQEQVL  364

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             +HP+VGGFLTHSGWNST+ES+ +GVPM+CWPFFADQQTNC   C +WGIG EID +VKR 
Sbjct  365   NHPSVGGFLTHSGWNSTMESVSAGVPMLCWPFFADQQTNCHCTCKEWGIGTEIDKNVKRD  424

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKF  1501
             +VE+LV+ELM GEKG  M+ KAME KKLAE+ A  P GSS  N+E+++N+F
Sbjct  425   DVEKLVKELMQGEKGKRMKHKAMEWKKLAEE-ANGPHGSSSANLEKLVNQF  474



>ref|XP_009145349.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
 ref|XP_009145350.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
Length=482

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/472 (58%), Positives = 359/472 (76%), Gaps = 5/472 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P PAQGHINPMLK+AK+L+ KGFH+TFVN+ +NH+RLLRSRGP ++ G PSFR
Sbjct  11    KPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSFR  70

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIVSDGGMF  457
             FE+IPDGLP +D + TQDI +LC S   NCL PFKDL+ ++N     PPVSCIVSD  M 
Sbjct  71    FESIPDGLPETDGNTTQDIPSLCVSTMNNCLSPFKDLLRKINTGDDVPPVSCIVSDAVMS  130

Query  458   FTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG-YLDTVLDWV  634
             FTLDAAEE G+P+++FWT  A G + F+ ++  I+KG +P KD SY  N  +L+TV+DW+
Sbjct  131   FTLDAAEELGVPDVVFWTASACGLMAFLQFQRFIEKGLTPFKDESYISNKEHLETVIDWI  190

Query  635   KGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSM  814
               M   RL+D PSFI TT+PDD ++ + +   ER K A+AI++NTFD LE + +  ++SM
Sbjct  191   PSMKNFRLKDFPSFILTTDPDDIMLNFSIREVERFKGATAIILNTFDDLEHDVIQSIKSM  250

Query  815   LPPVYAAGPFQFFEQQ--VEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             LPPVY+ GP      Q    DS +  +GL+LW+E+T C++WL+T  P SVV+VNFG ITV
Sbjct  251   LPPVYSIGPLNLLASQEVYVDSDMGQMGLNLWREETECLDWLDTKAPNSVVFVNFGCITV  310

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M+ +QL EFAWGLA + K FLW+IRPDLV+GE A +P EF+ ET +RGM+ASWCPQE+V+
Sbjct  311   MSVEQLDEFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWCPQEKVL  370

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
             SHPA+GGFLTH GWNSTLES+  GVPMICWPFFA+Q TNC +CC +WG+GMEI  DVKR 
Sbjct  371   SHPAIGGFLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGDVKRE  430

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             EVE ++RELM GEKG ++R KA + ++LA++A   P+GSS  + E ++NK L
Sbjct  431   EVEAVIRELMDGEKGKKLREKAEKWQRLAKEATEYPSGSSNVSFETLVNKVL  482



>ref|XP_008789350.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X3 [Phoenix 
dactylifera]
Length=477

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/479 (58%), Positives = 363/479 (76%), Gaps = 6/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+  +  +PHAV +P+PAQGH+ P+LKLAK+L+ +GF+ITFVN+ FN  RLLRS    
Sbjct  1     MGSMVPQ--RPHAVLVPYPAQGHVTPLLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAIS  58

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPP---V  427
             S+  LP FRFE+I DGLPP+D DATQD+ +LC+SI +NC+ PF+DLI  LN    P   V
Sbjct  59    SLDSLPDFRFESIRDGLPPTDKDATQDVPSLCDSIPKNCIAPFRDLIKELNDPSSPTPTV  118

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             S IVSDG M FTLD A+E  IPE+LFWT  A G++G++ Y+ ++++G  PLKD+S   NG
Sbjct  119   SRIVSDGVMSFTLDVAKELQIPEVLFWTPSACGYMGYLHYQHLMERGIVPLKDASDLTNG  178

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DW+ GM  VRLRDLP+F+RT +  D +  +     +R+  ASAI++NTFD LE+
Sbjct  179   YLETPIDWISGMKNVRLRDLPTFLRTVDSKDIMFHFCNRAAQRSSMASAIILNTFDELER  238

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
               L+ + SMLPP+Y  GP     +Q+  S + ++  +LWKED +C+EWL   +P SVVYV
Sbjct  239   PVLDAMASMLPPIYTIGPLSLLSRQITASPLTSISSNLWKEDPACLEWLQGREPGSVVYV  298

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             N+GSITVMT +QL+EFAWGLAN+K  F W+IRPDLV G+ AVLP+EF+ ET+ERG+LASW
Sbjct  299   NYGSITVMTNEQLIEFAWGLANSKHDFFWVIRPDLVKGDSAVLPQEFLSETKERGLLASW  358

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             CPQE V+SHP++G FLTHSGWNSTLESIC GVP I WPFFA+QQTNC Y CT+WGIGMEI
Sbjct  359   CPQEAVLSHPSIGVFLTHSGWNSTLESICGGVPTISWPFFAEQQTNCRYACTEWGIGMEI  418

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             D++VKR EVERLVRELM GEKG EMRR+A+E K+ A   AT P GSS+ N + ++ + L
Sbjct  419   DSNVKREEVERLVRELMEGEKGKEMRRRAVEWKESA-IRATQPGGSSFQNFDRLVKEAL  476



>ref|XP_002323974.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
 gb|EEF04107.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
Length=482

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 361/479 (75%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+  +  K HAVC+P+PAQGHI PMLK+AK+L+HKGFHITFVNSE+NHRRLL+SRG  
Sbjct  1     MGSLP-KSTKAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRN  59

Query  257   SVKGLPSFRFETIPDGLPPS-DVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
             S+  LP F+FETIPDGL    D D TQD + LC+SI++ CL PF++L+A+LN S   PPV
Sbjct  60    SLDVLPDFQFETIPDGLGDQIDADVTQDTSFLCDSISKACLVPFRNLLAKLNSSNVVPPV  119

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIV+D GM F LD  EE  IP + FWT  A G L +  Y+ ++++G++PLK+ S   NG
Sbjct  120   TCIVADSGMSFALDVKEELQIPVVTFWTSSACGTLAYAHYKHLVERGYTPLKEESDLTNG  179

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DW+ GM  +RL+DLP+FIRTT+ +D I+ Y++ I +RA  ASA +VNTFD L+ 
Sbjct  180   YLETKIDWIPGMKDIRLKDLPTFIRTTDRNDVILNYVIRIIDRASKASAALVNTFDDLDH  239

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L  L SM PP+Y+ GP        +   + ++G +LWKE+T C++WL++ DP SVVYV
Sbjct  240   DVLVALSSMFPPIYSVGPLNLLLDHTQKDYLASIGSNLWKEETECLQWLDSKDPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVM   QLVEF+WGLAN+KK FLWIIRPDLV GE AVLP EF+EETRERG++ASW
Sbjct  300   NFGSITVMNPQQLVEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMASW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             C QE+V+ H ++GGFL+H GWNST+ES+ +GV M+CWPFF++QQTNC + C  WG+GMEI
Sbjct  360   CAQEKVLKHSSIGGFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ++D  R +VE+LV EL+ GEKG EM+RKAME K  AE A T   GSS  N ++++N  L
Sbjct  420   ESDANRDDVEKLVIELIDGEKGKEMKRKAMEWKSKAE-ATTGINGSSSMNFDKLVNDVL  477



>gb|KCW66544.1| hypothetical protein EUGRSUZ_F00340 [Eucalyptus grandis]
Length=460

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/455 (61%), Positives = 348/455 (76%), Gaps = 6/455 (1%)
 Frame = +2

Query  155   MLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFETIPDGLPPSDVDATQ  334
             ML LAK+L+ +GFH+TFVN+E+NH RLLRSRGP S+  LPSFRF TIPDGLPPSD DATQ
Sbjct  1     MLNLAKLLHDRGFHVTFVNTEYNHNRLLRSRGPSSLDSLPSFRFRTIPDGLPPSDGDATQ  60

Query  335   DIATLCESITQNCLGPFKDLIARLNQSG-----PPVSCIVSDGGMFFTLDAAEEFGIPEI  499
             DI  LC+S  + CL  F+DL+ RL++       PPVSC+VSD    FTLDAAE  G+PE+
Sbjct  61    DIPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCVVSDVSTTFTLDAAEAVGVPEV  120

Query  500   LFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGMPGVRLRDLPSFI  679
             LFW   A  F+GF+ +R +ID+G +PLKD+SY  NGYLDT++DW+ GM  +RLRDLPSFI
Sbjct  121   LFWPISACAFMGFLQFRSLIDEGLAPLKDASYLTNGYLDTIIDWIPGMRNIRLRDLPSFI  180

Query  680   RTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPPVYAAGPFQFFEQ  859
             RTT+PDDP++ + ++   RAK ASA + NTF+ LE E L  L++M PP+Y  GP     +
Sbjct  181   RTTDPDDPMLNFCLVEFARAKRASAWVFNTFERLEHEVLEALKAMFPPIYTIGPIHLLLE  240

Query  860   QVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQLVEFAWGLANTK  1039
             Q+ D   R +  +LWKED  C+EWL+   P SVVYVNFGSITVM+  QLVEFAWGLAN+ 
Sbjct  241   QLSDDDTRLIRFNLWKEDLGCLEWLDLKPPGSVVYVNFGSITVMSPAQLVEFAWGLANSG  300

Query  1040  KPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAVGGFLTHSGWNST  1219
             + FLW+IRPDLV G  A+LP +F+  TRER +L SWCPQE+V+SH AVGGFLTH GWNS 
Sbjct  301   QVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQERVLSHSAVGGFLTHCGWNSI  360

Query  1220  LESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERLVRELMGGEKGHE  1399
             +ESI + VP+ CWPFFADQQTNC Y C +WGIGMEID+DV+R EVER VRELM GE+G E
Sbjct  361   IESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVRRDEVERQVRELMEGERGKE  420

Query  1400  MRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             M+RKAME K++A + AT P+GSS+ N++EVI+K L
Sbjct  421   MKRKAMEWKEMARE-ATCPSGSSFLNLDEVIDKVL  454



>ref|XP_003544801.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=479

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/478 (58%), Positives = 379/478 (79%), Gaps = 4/478 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGS+     KPHAVC+PFPAQGHINPMLKLAK+L+ KGFHITFVN+E+NH+RLL++RGP+
Sbjct  1     MGSLEAIK-KPHAVCVPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPD  59

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVS  430
             S+ GL SFRFET+ DGLP  D++ TQ + +LC+   + CL  F++L+++LN S   P VS
Sbjct  60    SLNGLSSFRFETLADGLPQPDIEGTQHVPSLCDYTKRTCLPHFRNLLSKLNDSPDVPSVS  119

Query  431   CIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGY  610
             C+VSDG M FTLDAA+E G+P +LFWT  A GF+ +V Y+ ++++  +PLKD+SY  NGY
Sbjct  120   CVVSDGIMSFTLDAAQELGVPNVLFWTTSACGFMCYVQYQQLVERDLTPLKDASYLTNGY  179

Query  611   LDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQE  790
             L+T +DW+ G+  +RL+D+P+FIRTT+PDD ++ +      RA+ ASAI++NTFDALE +
Sbjct  180   LETSIDWIPGIKEIRLKDIPTFIRTTDPDDIMLNFARGECIRAQKASAIILNTFDALEHD  239

Query  791   ALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVN  970
              L    ++LPPVY+ GP  F   +V+D  + A+G +LWKE+  C+EWL+T +  +VVYVN
Sbjct  240   ILEAFSTILPPVYSIGPLNFLLNEVKDKDLNAIGSNLWKEEPGCLEWLDTKEVNTVVYVN  299

Query  971   FGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWC  1150
             FGS+TVMT DQL+EFAWGLA + K F+W+IRPDLV GE A+LP+EFV +T+ RG+L+SWC
Sbjct  300   FGSVTVMTNDQLIEFAWGLAASNKTFVWVIRPDLVIGENAILPKEFVAQTKNRGLLSSWC  359

Query  1151  PQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEID  1330
             PQEQV++HPA+GGFLTH+GWNSTLES+C GVPMICWPFFA+Q TNC +CC +WGIG+EI+
Sbjct  360   PQEQVLAHPAIGGFLTHNGWNSTLESVCGGVPMICWPFFAEQHTNCRFCCKEWGIGLEIE  419

Query  1331  TDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
              D++R ++E LVRELM GEKG EM++KA+E K+LA+ AA++P+G S    E++I + L
Sbjct  420   -DIERGKIESLVRELMDGEKGKEMKKKALEWKRLAKVAASSPSGYSLVQFEKMIREVL  476



>ref|XP_008229795.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Prunus mume]
Length=486

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/483 (57%), Positives = 359/483 (74%), Gaps = 8/483 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M SI  +G KPHAVCIPFP Q HI  MLKLAK+L+H+GFHITFVN+EFNH R L+S GP 
Sbjct  1     MSSIEVQGNKPHAVCIPFPIQSHIKAMLKLAKLLHHRGFHITFVNTEFNHHRFLKSLGPN  60

Query  257   SVKGLPSFRFETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQ-------S  415
             S+ GLP+F+F+TIPDGLP SD DA Q+   LC+SI +N L PF +L+ +LN        S
Sbjct  61    SLNGLPNFQFKTIPDGLPASDEDAGQNAYLLCDSIRKNFLAPFHNLLLKLNDMEISNNIS  120

Query  416   GPPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSY  595
              PPV+CIVSDG M F++ AAEE GIP  LF+T  A GF+GF  Y  +++KG +PLK+  Y
Sbjct  121   NPPVTCIVSDGFMTFSITAAEELGIPVALFFTIAAIGFMGFKQYPTLVEKGLAPLKEERY  180

Query  596   FENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFD  775
               NG+LD V+DWV G   +RL+DLP   +TTNP+D + K  +   +R   ASA++++TFD
Sbjct  181   LTNGFLDQVIDWVPGTKAIRLKDLPKSFQTTNPNDILFKLTLEAMDRVDKASAVVLHTFD  240

Query  776   ALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPIS  955
              LE + L+ L SM PPVY  GP Q    Q+    ++++G SLWKE+T   +WLN   P S
Sbjct  241   ELEADVLHALSSMSPPVYTIGPLQLLLNQIPQHPLKSMGYSLWKEETEWFQWLNAKVPNS  300

Query  956   VVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGM  1135
             VVYVNFGSI V+ ++ L+EF WGLAN+K PF W++RPDL+ GE A+LP EFV ET+ RG+
Sbjct  301   VVYVNFGSIVVIKSEDLIEFCWGLANSKLPFFWVVRPDLLVGESAILPPEFVAETKGRGL  360

Query  1136  LASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGI  1315
             +ASWCPQEQV+SHP++GGFLTHSGWNST+ES+ +GVPM+CWPFFA+Q+ NC Y C +WGI
Sbjct  361   VASWCPQEQVLSHPSIGGFLTHSGWNSTIESLSAGVPMLCWPFFAEQRINCVYTCNEWGI  420

Query  1316  GMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVIN  1495
             G+EI+ D KR +VE+L++EL+ GEKG +MR KAME KKLAE  A +P GSSY N++ ++N
Sbjct  421   GLEINNDAKRDQVEKLIKELVEGEKGKKMRTKAMEWKKLAEK-AISPDGSSYANLDNLVN  479

Query  1496  KFL  1504
             + L
Sbjct  480   QVL  482



>ref|XP_010937416.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=477

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/467 (61%), Positives = 365/467 (78%), Gaps = 3/467 (1%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPH VC+P+PAQGH+ PMLKLAK+L+ KGF+ITFVN+EFNHRRLL+S+GP S+ GLP FR
Sbjct  8     KPHVVCVPYPAQGHVTPMLKLAKLLHSKGFYITFVNTEFNHRRLLKSQGPSSLDGLPDFR  67

Query  284   FETIPDGLPPSDVDATQDIATLCESITQNCLGPFKDLIARLNQSGPPVSCIVSDGGMFFT  463
             F TIPDGLPPSD +ATQD+ +LC S    CL  F+ L++ L+  GPP++CI+SDG M FT
Sbjct  68    FSTIPDGLPPSDANATQDVPSLCYSTMTTCLPHFRRLLSMLD--GPPLTCIISDGVMSFT  125

Query  464   LDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDWVKGM  643
             LDAA+E G+PE+LFWT  A GF+ ++ YR ++D+G  PLKD+S   NGYLDT +DW+ G+
Sbjct  126   LDAAKELGVPEVLFWTTSACGFMAYLHYRHLMDRGLVPLKDASDLSNGYLDTHVDWIPGL  185

Query  644   PGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQSMLPP  823
               +RLRD+PSFIRTT+PDD ++ + +   +RA  ASAI++NTFD LEQ  L+ + ++LPP
Sbjct  186   KNMRLRDIPSFIRTTDPDDTMINFALHECKRATMASAIILNTFDELEQPVLDAMATILPP  245

Query  824   VYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITVMTADQ  1003
             +Y  GP     +Q+  S V ALG +LWKE+ +C  WL   +P SVVYVNFGSITVMT  Q
Sbjct  246   IYPIGPLTLLARQLSASPVSALGSNLWKEEPACSNWLAGKNPNSVVYVNFGSITVMTNQQ  305

Query  1004  LVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVISHPAV  1183
             L+EFAWGLAN+   FLWIIRPDLV G+ AVLP EF+EET+ERG+LASWCPQE+++S+PA+
Sbjct  306   LIEFAWGLANSGHDFLWIIRPDLVKGDAAVLPLEFLEETKERGLLASWCPQEEILSNPAI  365

Query  1184  GGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRCEVERL  1363
             GGFLTHSGWNST+ESIC GVPM+ WPFFA+QQTNC Y CT+WGIGMEID +VKR  VE +
Sbjct  366   GGFLTHSGWNSTVESICEGVPMLSWPFFAEQQTNCRYVCTEWGIGMEIDNNVKREVVEGM  425

Query  1364  VRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             +RELM GEKG EM+++AM  K+ A   A+ P G S  N+E ++ + L
Sbjct  426   IRELMKGEKGKEMKKRAMAWKESAV-GASLPGGPSSLNLERLVKEVL  471



>ref|XP_010676190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/473 (59%), Positives = 362/473 (77%), Gaps = 5/473 (1%)
 Frame = +2

Query  89    SGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKG  268
             S +  KPHAVCIP+PAQGHINP+LKLAK+L+ +GFHITFV++E+N+ RLLRSRGP+++ G
Sbjct  3     SAQEQKPHAVCIPYPAQGHINPLLKLAKLLHSQGFHITFVHTEYNYNRLLRSRGPDALAG  62

Query  269   LPSFRFETIPDGLP-PSDVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPVSCIV  439
             LP+FRFE I DG+P   D +ATQDI +LC S     LGPFK+LI RLN+SG  P VSCIV
Sbjct  63    LPTFRFEAISDGMPCTEDANATQDIPSLCISTEYRSLGPFKELINRLNESGDVPQVSCIV  122

Query  440   SDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             +D  M+FTLDAAEE GIPE+L +T    GFL +  +  +++ G +P KD ++  NG LD 
Sbjct  123   ADAAMYFTLDAAEELGIPEVLQYTASPCGFLAYTQFPKLVELGITPFKDENFLTNGDLDV  182

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             VLDWV  M  ++++ +PSFIRTTNP++ ++  +      AK ASAI+ N+FDAL+ E L 
Sbjct  183   VLDWVPCMKNIQVKYMPSFIRTTNPNEIMLNRLQREIPSAKRASAILFNSFDALDHEILQ  242

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGL--SLWKEDTSCVEWLNTNDPISVVYVNF  973
              L    P ++  GP       +E     A  +  SLWKED++C+EWL+++ P SVVY+NF
Sbjct  243   ALAPDFPSLFTLGPLMLLLDSIEAKEEEATTINPSLWKEDSTCIEWLDSHAPNSVVYINF  302

Query  974   GSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCP  1153
             GSITVMT DQLVEFAWGLAN+ +PFLWI RPDLV+G+ +VLP EF+EET++R ++ASWC 
Sbjct  303   GSITVMTNDQLVEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEETKDRRLIASWCN  362

Query  1154  QEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDT  1333
             QE+V++H A+G FLTHSGWNSTLESI +GVPMICWPFFA+QQTNCW+CC +WGIG+EI+ 
Sbjct  363   QEKVLAHQAIGVFLTHSGWNSTLESISNGVPMICWPFFAEQQTNCWFCCKKWGIGIEINV  422

Query  1334  DVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             +VKR EVE  VRELM GEKG EM+RKA+E KKLA +AA +P GSSY+N++ VI
Sbjct  423   NVKRNEVETQVRELMQGEKGKEMKRKAIEWKKLAHEAAASPNGSSYSNLDNVI  475



>ref|XP_009377941.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/475 (60%), Positives = 358/475 (75%), Gaps = 10/475 (2%)
 Frame = +2

Query  104   KPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFR  283
             KPHAVCIP P Q HI  MLK AK+L+++GFHITFVNSEFNH+R L+S GP S+ GLP FR
Sbjct  9     KPHAVCIPIPTQSHIKAMLKFAKLLHYRGFHITFVNSEFNHKRFLKSLGPNSLDGLPDFR  68

Query  284   FETIPDGLPPSDVDATQDIATLCESI-TQNCLGPFKDLIARLNQ------SGPPVSCIVS  442
             F  IPDGLP SD   TQD+  L ++I  +N L PF DL+ +LN+      + PPV+CIVS
Sbjct  69    FVAIPDGLPDSDEYNTQDVTVLVDAIRKRNFLAPFCDLLNKLNKDAITTSNNPPVTCIVS  128

Query  443   DGGM-FFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDT  619
             DG M  FT+ AAEE G P +LF+T  A  F+G + +R +++KG +PLKD SY  NGYLD 
Sbjct  129   DGFMSTFTITAAEEIGTPIVLFYTIAACSFMGIIQFRALVEKGLAPLKDESYLTNGYLDK  188

Query  620   VLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALN  799
             V+DW+ GM  + L+DLP+F RTTN DD I  +++  T+R+  ASA++V+TFDALE++ L+
Sbjct  189   VIDWIPGMKNICLKDLPAFFRTTNSDDIIFNFVMESTDRSHEASAVVVHTFDALERDVLD  248

Query  800   GLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGS  979
              L SMLP VY  GP Q    Q+ +  +  +G SLWKE+T C+EWLNT    SVVYVNFGS
Sbjct  249   ALSSMLPLVYTIGPLQLHLNQIPEHPLN-IGYSLWKEETVCLEWLNTKAQNSVVYVNFGS  307

Query  980   ITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQE  1159
             ITVMT   LVEF WGLAN+K PF W+IRPDLV GE  +LP EFV ET+ER ++ASWCPQE
Sbjct  308   ITVMTPAHLVEFGWGLANSKLPFFWVIRPDLVIGESMILPPEFVAETKERSLVASWCPQE  367

Query  1160  QVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDV  1339
             QV++HP+VGGFLTHSGWNST+ES+ SGVPM+CWPFFADQQ +C Y C +WG+GMEI  DV
Sbjct  368   QVLNHPSVGGFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEIGNDV  427

Query  1340  KRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             KR EVE+LVRELM GEKG +M+ +AME KKLAE+ AT+P GSS  N++ ++N+ L
Sbjct  428   KRDEVEKLVRELMDGEKGKKMKNRAMEWKKLAEE-ATSPYGSSSKNLDNLVNQVL  481



>ref|XP_006351765.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=499

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 362/470 (77%), Gaps = 9/470 (2%)
 Frame = +2

Query  110   HAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPESVKGLPSFRFE  289
             H VC+P+PAQGHI+PMLKLAK+++H GF+ITFVN+EFNH+RLLRS GP+S+ GLP FRFE
Sbjct  26    HVVCVPYPAQGHISPMLKLAKLVHHNGFYITFVNTEFNHKRLLRSNGPQSLDGLPGFRFE  85

Query  290   TIPDGLPPSD--VDATQDIATLCESITQNCLGPFKDLIARLNQSG----PPVSCIVSDGG  451
             TIPDGLP +D  VDATQ + +LC S ++NCL PF++LI ++N  G    PPV+CIVSD  
Sbjct  86    TIPDGLPSTDHDVDATQHVPSLCASTSKNCLVPFRNLINKINAEGNGVVPPVTCIVSDVI  145

Query  452   MFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENGYLDTVLDW  631
             M FTLDAAEE GIPE+LFWT  A GF+ ++ Y  ++ +G+ PLKD +  +NGYL+ ++DW
Sbjct  146   MSFTLDAAEELGIPEVLFWTASACGFMCYLHYHHLVQRGYIPLKDENDIKNGYLEKMIDW  205

Query  632   VKG-MPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQEALNGLQ  808
             V G +  +RLRD PSFIRTT+P+D ++ + +  TER   ASAI++NTFDA E  ALN L 
Sbjct  206   VPGILKNMRLRDFPSFIRTTDPNDIMLNFFINETERISKASAIVLNTFDAFEHNALNALF  265

Query  809   SMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYVNFGSITV  988
             ++ P +Y  GP Q       D  ++++G +LWKED SC+EWL+T +  SVVYVNFGSITV
Sbjct  266   AIHPHIYTIGPLQLMLNNTIDENLKSIGSNLWKEDLSCIEWLDTKESNSVVYVNFGSITV  325

Query  989   MTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASWCPQEQVI  1168
             M  DQ +E AWGLANTKK FLWIIRPDL++G+   LP +F+ E ++RGM+A+WCPQE+V+
Sbjct  326   MNFDQFIEMAWGLANTKKQFLWIIRPDLITGDSVKLPEDFLSEIKDRGMIANWCPQEKVL  385

Query  1169  SHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEIDTDVKRC  1348
              H A+GGFLTHSGWNSTLES+C+GVP++CWPFFA+QQTNC Y C +W +GMEI  D+KR 
Sbjct  386   KHRAIGGFLTHSGWNSTLESVCAGVPVLCWPFFAEQQTNCRYSCIEWEMGMEI-VDLKRN  444

Query  1349  EVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINK  1498
             EVE LVRELM GEKG +M+ KAM  K+ AE AA+ P GSS  N+  V+N+
Sbjct  445   EVEILVRELMDGEKGKKMKLKAMNWKEEAEKAAS-PGGSSCINLNNVLNE  493



>ref|XP_002323977.2| hypothetical protein POPTR_0017s07900g [Populus trichocarpa]
 gb|EEF04110.2| hypothetical protein POPTR_0017s07900g [Populus trichocarpa]
Length=482

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 360/479 (75%), Gaps = 5/479 (1%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             MGSI  +  K HAVC+P+PAQGHI PMLK+AK+L+H+GFHITFVNSE+NHRRLL+SRG  
Sbjct  1     MGSIP-KSTKAHAVCVPYPAQGHIAPMLKVAKLLHHQGFHITFVNSEYNHRRLLKSRGCN  59

Query  257   SVKGLPSFRFETIPDGLPPS-DVDATQDIATLCESITQNCLGPFKDLIARLNQSG--PPV  427
             S+  LP F+FETIPDGL    D D TQD + LC+SI++ CL PF+ L+A+LN S   PPV
Sbjct  60    SLDVLPDFQFETIPDGLGDQIDADVTQDTSFLCDSISKACLVPFRKLLAKLNSSNVVPPV  119

Query  428   SCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSSYFENG  607
             +CIV+DGGM FT D  EE  IP + FWT  A G L +  Y+ ++++G++PLK+ S   NG
Sbjct  120   TCIVADGGMSFTFDVKEELQIPAVSFWTSSACGTLAYAHYKHLVERGYTPLKEESDLTNG  179

Query  608   YLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTFDALEQ  787
             YL+T +DW+ GM  +RL+DLP+FIRTT+ +D I+ Y++ I +RA  ASA +VNTFD L+ 
Sbjct  180   YLETKIDWIPGMKDIRLKDLPTFIRTTDQNDVILNYVIRIIDRASKASAALVNTFDDLDH  239

Query  788   EALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPISVVYV  967
             + L  L SM PP+Y+ GP        +   + ++G +LWKE+T C++WL++ DP SVVYV
Sbjct  240   DVLVALSSMFPPIYSVGPLNLLLDHTQKDYLASIGSNLWKEETECLQWLDSKDPNSVVYV  299

Query  968   NFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERGMLASW  1147
             NFGSITVM   QLVEF+WGLAN+KK FLWIIRPDLV GE AVLP EF+EETRERG++ SW
Sbjct  300   NFGSITVMNPQQLVEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMTSW  359

Query  1148  CPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWGIGMEI  1327
             C QE+V+ H ++GGFL+H GWNST+ES+ +GV M+CWPFF++QQTNC + C  WG+GMEI
Sbjct  360   CAQEKVLKHSSIGGFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGMEI  419

Query  1328  DTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVINKFL  1504
             ++D  R +VE+LV EL+ GEKG EM+RKAME K  AE A T   GSS  N ++++N  L
Sbjct  420   ESDANRDDVEKLVIELIDGEKGKEMKRKAMEWKSKAE-ATTGINGSSSMNFDKLVNDVL  477



>ref|XP_008378324.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=488

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/487 (58%), Positives = 356/487 (73%), Gaps = 9/487 (2%)
 Frame = +2

Query  77    MGSISGEGLKPHAVCIPFPAQGHINPMLKLAKILNHKGFHITFVNSEFNHRRLLRSRGPE  256
             M S +    K HAVCIP PAQ HI  MLK +K+L+H+GFHITFVN+EFNH R L+S GP 
Sbjct  1     MDSKAAANNKLHAVCIPAPAQSHIKAMLKFSKLLHHRGFHITFVNTEFNHNRFLKSLGPN  60

Query  257   SVKGLPSFRFETIPDGLPP-SDVDATQDIATLCESITQNCLGPFKDLIARLNQSG-----  418
             S+ GLP FRFETIPDGLPP S+ DATQD +   ++I++N L PF+DL+ +LN +      
Sbjct  61    SLDGLPDFRFETIPDGLPPDSNQDATQDTSLASDAISKNLLPPFRDLLIKLNDAAISINN  120

Query  419   --PPVSCIVSDGGMFFTLDAAEEFGIPEILFWTCGAGGFLGFVLYRLVIDKGFSPLKDSS  592
               PPV+CI SDG M FT+ AA+E G+P +LF+   AG F+G+  Y  +++KG +PLKD S
Sbjct  121   VSPPVTCIFSDGFMPFTITAADEIGLPLVLFFPISAGSFMGYKQYPTLVEKGIAPLKDES  180

Query  593   YFENGYLDTVLDWVKGMPGVRLRDLPSFIRTTNPDDPIVKYIVLITERAKSASAIMVNTF  772
                NG+LD V+DW+ GM  +RLRDLP+  RTTNP+D +    +   ER   ASA++V+TF
Sbjct  181   CLTNGFLDKVIDWIPGMKDIRLRDLPTNFRTTNPNDSVFNLSLESVERVDKASAVVVHTF  240

Query  773   DALEQEALNGLQSMLPPVYAAGPFQFFEQQVEDSGVRALGLSLWKEDTSCVEWLNTNDPI  952
             +ALE + LN L SMLP VYA GP Q     +    +  +G SLW+E+T C+EWLN+  P 
Sbjct  241   EALEPDVLNALSSMLPLVYAIGPLQLLLNHLPKDPLNDMGYSLWREETECLEWLNSKPPN  300

Query  953   SVVYVNFGSITVMTADQLVEFAWGLANTKKPFLWIIRPDLVSGEEAVLPREFVEETRERG  1132
             SVVYVNFGSI VMT + LVEFAWGLAN+K PF W+IRPDL  GE A+L  EFV ET+ERG
Sbjct  301   SVVYVNFGSIAVMTPEHLVEFAWGLANSKLPFFWVIRPDLXVGESAILSPEFVAETKERG  360

Query  1133  MLASWCPQEQVISHPAVGGFLTHSGWNSTLESICSGVPMICWPFFADQQTNCWYCCTQWG  1312
             ++ASWCPQEQV+SHP+VGGFLTHSGWNS  ES+C+GVPM+CWPFFADQQTN W  C +W 
Sbjct  361   LIASWCPQEQVLSHPSVGGFLTHSGWNSXXESLCAGVPMLCWPFFADQQTNTWCACNEWD  420

Query  1313  IGMEIDTDVKRCEVERLVRELMGGEKGHEMRRKAMELKKLAEDAATAPTGSSYNNMEEVI  1492
             IGMEI  DVKR EV+ LVRELM GEKG +M+ K M+ KKLAE+ +T+P GSS  N++ ++
Sbjct  421   IGMEISNDVKRVEVQELVRELMEGEKGKKMKIKVMQWKKLAEE-STSPNGSSSTNLDNLV  479

Query  1493  NKFLSPN  1513
             N  L  N
Sbjct  480   NNVLLRN  486



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5203707872428