BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78127_g1_i1 len=1430 path=[1408:0-1429]

Length=1430
                                                                      Score     E

emb|CDP05319.1|  unnamed protein product                                129   5e-31   
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                     124   2e-29   
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg             123   4e-29   
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                   121   1e-28   
ref|XP_011076332.1|  PREDICTED: 21 kDa protein                          120   6e-28   
emb|CDP05320.1|  unnamed protein product                                118   3e-27   
ref|XP_006362110.1|  PREDICTED: 21 kDa protein-like isoform X1          115   2e-26   
ref|XP_002322404.2|  ripening-related family protein                    115   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006362111.1|  PREDICTED: 21 kDa protein-like isoform X2          115   2e-26   
ref|XP_006421706.1|  hypothetical protein CICLE_v10005926mg             115   3e-26   
ref|XP_006490094.1|  PREDICTED: 21 kDa protein-like                     115   6e-26   
gb|ABK96280.1|  unknown                                                 114   7e-26   Populus trichocarpa x Populus deltoides
ref|XP_006367638.1|  PREDICTED: 21 kDa protein-like                     114   8e-26   
ref|XP_009594970.1|  PREDICTED: 21 kDa protein-like                     112   3e-25   
gb|AAX20046.1|  DC1.2-like                                              112   4e-25   Capsicum annuum
gb|ABG47806.1|  pectin methlyesterase inhibitor protein 1               112   4e-25   Capsicum annuum
ref|XP_007038418.1|  DC1.2-like, putative                               111   5e-25   
gb|EYU24972.1|  hypothetical protein MIMGU_mgv1a023170mg                110   7e-25   
ref|XP_002322403.1|  ripening-related family protein                    111   9e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004506603.1|  PREDICTED: 21 kDa protein-like                     110   1e-24   
gb|ABG49144.1|  pectin methylesterase inhibitor isoform                 110   1e-24   Solanum phureja [chaucha]
ref|XP_009779202.1|  PREDICTED: 21 kDa protein-like                     110   2e-24   
emb|CBA10126.1|  PME inhibitor                                          110   2e-24   Nicotiana benthamiana
ref|XP_006362121.1|  PREDICTED: 21 kDa protein-like                     109   2e-24   
ref|XP_002264167.1|  PREDICTED: 21 kDa protein                          109   3e-24   Vitis vinifera
gb|ABY81888.1|  pectin methylesterase inhibitor-like protein            109   4e-24   Capsicum annuum
ref|XP_004307822.1|  PREDICTED: 21 kDa protein-like                     108   8e-24   
ref|XP_004234934.1|  PREDICTED: 21 kDa protein-like                     107   1e-23   
ref|XP_006367807.1|  PREDICTED: 21 kDa protein-like                     107   1e-23   
ref|XP_009597893.1|  PREDICTED: 21 kDa protein-like                     108   1e-23   
ref|XP_002264101.1|  PREDICTED: 21 kDa protein-like                     107   1e-23   Vitis vinifera
ref|XP_002322405.2|  ripening-related family protein                    107   2e-23   Populus trichocarpa [western balsam poplar]
gb|AFK49039.1|  unknown                                                 107   2e-23   
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                    107   2e-23   
ref|XP_009779211.1|  PREDICTED: 21 kDa protein-like                     106   3e-23   
ref|XP_002264028.1|  PREDICTED: 21 kDa protein                          105   8e-23   Vitis vinifera
ref|XP_009112019.1|  PREDICTED: 21 kDa protein-like                     105   1e-22   
ref|NP_001236761.1|  uncharacterized protein LOC100305537 precursor     105   2e-22   
gb|KDP22409.1|  hypothetical protein JCGZ_26240                         104   2e-22   
ref|XP_007039937.1|  Plant invertase/pectin methylesterase inhibi...    104   2e-22   
ref|XP_011010937.1|  PREDICTED: 21 kDa protein-like isoform X2          104   2e-22   
ref|XP_010550579.1|  PREDICTED: 21 kDa protein                          104   2e-22   
gb|AFK47771.1|  unknown                                                 104   2e-22   
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1          104   2e-22   
ref|XP_007039951.1|  Plant invertase/pectin methylesterase inhibi...    104   2e-22   
gb|AFK37116.1|  unknown                                                 104   2e-22   
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                     104   3e-22   
ref|XP_004234935.1|  PREDICTED: 21 kDa protein-like                     104   3e-22   
emb|CDX87244.1|  BnaC09g05590D                                          103   3e-22   
ref|XP_008234384.1|  PREDICTED: 21 kDa protein                          103   3e-22   
ref|XP_008357027.1|  PREDICTED: 21 kDa protein-like                     103   4e-22   
ref|XP_009372895.1|  PREDICTED: 21 kDa protein-like                     103   4e-22   
ref|XP_007218426.1|  hypothetical protein PRUPE_ppa011607mg             103   5e-22   
ref|XP_007131336.1|  hypothetical protein PHAVU_011G005300g             102   1e-21   
ref|XP_007039938.1|  Plant invertase/pectin methylesterase inhibi...    102   1e-21   
gb|AFK35257.1|  unknown                                                 102   1e-21   
ref|XP_009618650.1|  PREDICTED: 21 kDa protein-like                     102   1e-21   
ref|XP_009374503.1|  PREDICTED: 21 kDa protein-like                     101   2e-21   
ref|XP_002510935.1|  21 kDa protein precursor, putative                 101   3e-21   Ricinus communis
ref|XP_009370481.1|  PREDICTED: 21 kDa protein-like                     101   3e-21   
ref|XP_004234936.1|  PREDICTED: 21 kDa protein-like                     101   4e-21   
gb|KHN32444.1|  21 kDa protein                                          100   4e-21   
ref|XP_009796710.1|  PREDICTED: 21 kDa protein-like                     100   4e-21   
gb|KEH29361.1|  plant invertase/pectin methylesterase inhibitor         100   4e-21   
ref|XP_011041731.1|  PREDICTED: 21 kDa protein-like                     100   4e-21   
ref|XP_004307823.1|  PREDICTED: 21 kDa protein-like                     100   7e-21   
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                     100   8e-21   
ref|XP_010062118.1|  PREDICTED: 21 kDa protein-like                   99.8    1e-20   
emb|CDX86901.1|  BnaC03g51710D                                        99.8    1e-20   
ref|XP_010264393.1|  PREDICTED: 21 kDa protein-like                   99.8    1e-20   
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1        99.4    1e-20   
ref|XP_006362112.1|  PREDICTED: 21 kDa protein-like                   99.4    2e-20   
ref|XP_009603391.1|  PREDICTED: 21 kDa protein-like                   99.0    2e-20   
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                   99.0    2e-20   
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                   99.0    2e-20   
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                     100   2e-20   
ref|XP_010259198.1|  PREDICTED: 21 kDa protein-like                   99.0    3e-20   
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...  98.6    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60276.1|  unknown                                               98.6    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370482.1|  PREDICTED: 21 kDa protein-like                   98.6    3e-20   
ref|XP_006490092.1|  PREDICTED: 21 kDa protein-like                   98.6    3e-20   
gb|KDO65436.1|  hypothetical protein CISIN_1g028434mg                 98.6    4e-20   
gb|KDP22408.1|  hypothetical protein JCGZ_26239                       97.8    4e-20   
gb|AIT42250.1|  pectinmethylesterase inhibitor                        98.2    4e-20   
ref|XP_010264194.1|  PREDICTED: 21 kDa protein-like                   98.2    5e-20   
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg           98.6    5e-20   
gb|AIT42255.1|  pectinmethylesterase inhibitor                        97.4    6e-20   
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...  97.4    7e-20   
ref|XP_002263991.1|  PREDICTED: 21 kDa protein                        97.4    7e-20   Vitis vinifera
ref|XP_007131335.1|  hypothetical protein PHAVU_011G005200g           97.4    8e-20   
emb|CAN70288.1|  hypothetical protein VITISV_015784                   97.4    9e-20   Vitis vinifera
emb|CDY00279.1|  BnaA06g21800D                                        97.1    1e-19   
ref|XP_002510934.1|  21 kDa protein precursor, putative               96.7    1e-19   Ricinus communis
gb|AIT42253.1|  pectinmethylesterase inhibitor                        96.7    1e-19   
ref|XP_006421708.1|  hypothetical protein CICLE_v10007178mg           97.1    1e-19   
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                        96.7    2e-19   
gb|ACU13418.1|  unknown                                               96.3    2e-19   Glycine max [soybeans]
ref|XP_006838616.1|  hypothetical protein AMTR_s00002p00229990        96.3    2e-19   
ref|XP_010035021.1|  PREDICTED: 21 kDa protein-like                   95.9    3e-19   
ref|XP_009370516.1|  PREDICTED: 21 kDa protein-like                   95.5    4e-19   
ref|XP_003635233.1|  PREDICTED: 21 kDa protein-like                   95.5    4e-19   
ref|XP_006362116.1|  PREDICTED: 21 kDa protein-like                   95.5    4e-19   
ref|XP_008791710.1|  PREDICTED: 21 kDa protein                        95.5    4e-19   
ref|XP_010919458.1|  PREDICTED: 21 kDa protein                        95.5    4e-19   
ref|NP_001238450.1|  uncharacterized protein LOC100305900 precursor   95.1    5e-19   
ref|XP_006440385.1|  hypothetical protein CICLE_v10023344mg           95.1    6e-19   
ref|XP_008376226.1|  PREDICTED: 21 kDa protein-like                   95.1    6e-19   
ref|XP_003598239.1|  21 kDa protein                                   94.4    7e-19   
ref|XP_010091300.1|  21 kDa protein                                   94.7    8e-19   
gb|AIT42252.1|  pectinmethylesterase inhibitor                        94.4    8e-19   
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg           94.4    9e-19   
ref|XP_004511656.1|  PREDICTED: 21 kDa protein-like                   94.4    9e-19   
ref|XP_002263715.1|  PREDICTED: 21 kDa protein                        94.4    1e-18   Vitis vinifera
ref|XP_008369524.1|  PREDICTED: 21 kDa protein                        94.0    1e-18   
ref|XP_008796852.1|  PREDICTED: 21 kDa protein-like                   94.0    2e-18   
ref|XP_010672019.1|  PREDICTED: 21 kDa protein-like                   93.6    2e-18   
ref|XP_009595798.1|  PREDICTED: 21 kDa protein-like                   94.0    2e-18   
ref|XP_010035020.1|  PREDICTED: 21 kDa protein-like                   94.0    2e-18   
ref|XP_011010938.1|  PREDICTED: 21 kDa protein-like                   93.6    2e-18   
gb|EYU24974.1|  hypothetical protein MIMGU_mgv1a014119mg              93.2    2e-18   
ref|XP_009372896.1|  PREDICTED: 21 kDa protein-like                   93.2    3e-18   
ref|XP_011041732.1|  PREDICTED: 21 kDa protein-like                   93.2    3e-18   
ref|XP_008376261.1|  PREDICTED: 21 kDa protein                        92.8    3e-18   
ref|XP_002264799.1|  PREDICTED: 21 kDa protein-like                   92.8    4e-18   Vitis vinifera
gb|AIT42251.1|  pectinmethylesterase inhibitor                        92.8    4e-18   
ref|XP_004298672.1|  PREDICTED: 21 kDa protein-like                   92.4    4e-18   
ref|XP_009374505.1|  PREDICTED: 21 kDa protein                        92.0    6e-18   
ref|XP_009362113.1|  PREDICTED: 21 kDa protein-like                   91.7    9e-18   
ref|XP_009779184.1|  PREDICTED: 21 kDa protein-like                   92.0    1e-17   
ref|XP_002510932.1|  21 kDa protein precursor, putative               91.3    1e-17   Ricinus communis
ref|XP_010093663.1|  21 kDa protein                                   91.7    1e-17   
ref|XP_007038423.1|  Plant invertase/pectin methylesterase inhibi...  91.7    1e-17   
ref|XP_009799203.1|  PREDICTED: pectinesterase 1-like                 94.0    2e-17   
ref|XP_009370483.1|  PREDICTED: 21 kDa protein-like                   90.9    2e-17   
ref|XP_009370484.1|  PREDICTED: 21 kDa protein-like                   90.5    2e-17   
ref|XP_002264891.1|  PREDICTED: 21 kDa protein                        90.9    2e-17   Vitis vinifera
gb|KGN57276.1|  hypothetical protein Csa_3G176245                     90.5    2e-17   
ref|NP_001235143.1|  uncharacterized protein LOC100527116 precursor   90.5    2e-17   
gb|EYU43527.1|  hypothetical protein MIMGU_mgv1a024700mg              89.7    3e-17   
ref|XP_009372897.1|  PREDICTED: 21 kDa protein-like                   90.1    3e-17   
ref|XP_004148163.1|  PREDICTED: 21 kDa protein-like                   89.4    4e-17   
gb|KDP25617.1|  hypothetical protein JCGZ_20773                       89.7    4e-17   
emb|CAA72315.1|  putative 21kD protein precursor                      89.4    4e-17   Medicago sativa [alfalfa]
ref|XP_008234382.1|  PREDICTED: 21 kDa protein                        89.7    5e-17   
ref|XP_007039950.1|  Plant invertase/pectin methylesterase inhibi...  89.7    5e-17   
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                        89.7    5e-17   
ref|XP_008387667.1|  PREDICTED: 21 kDa protein-like                   89.7    5e-17   
ref|XP_006440386.1|  hypothetical protein CICLE_v10022313mg           89.7    5e-17   
ref|XP_004148138.1|  PREDICTED: 21 kDa protein-like                   89.0    6e-17   
ref|XP_011101127.1|  PREDICTED: 21 kDa protein-like                   89.4    6e-17   
ref|XP_006421710.1|  hypothetical protein CICLE_v10005968mg           89.0    7e-17   
ref|XP_007220475.1|  hypothetical protein PRUPE_ppa011831mg           89.0    7e-17   
gb|KDP22406.1|  hypothetical protein JCGZ_26237                       89.0    7e-17   
ref|XP_008364822.1|  PREDICTED: 21 kDa protein-like                   89.4    8e-17   
ref|XP_011076330.1|  PREDICTED: 21 kDa protein-like                   89.0    8e-17   
gb|ACJ83861.1|  unknown                                               88.6    8e-17   Medicago truncatula
ref|XP_004234937.1|  PREDICTED: 21 kDa protein-like                   88.6    9e-17   
ref|XP_009401795.1|  PREDICTED: 21 kDa protein-like                   89.0    9e-17   
ref|XP_010093661.1|  21 kDa protein                                   89.0    1e-16   
ref|XP_010933727.1|  PREDICTED: 21 kDa protein                        89.0    1e-16   
ref|XP_004147611.1|  PREDICTED: 21 kDa protein-like                   89.0    1e-16   
ref|XP_003598238.1|  21 kDa protein                                   88.2    1e-16   
gb|AFK45022.1|  unknown                                               88.2    1e-16   
ref|NP_001268141.1|  ripening-related protein-like precursor          88.2    1e-16   
ref|XP_002280585.1|  PREDICTED: 21 kDa protein                        88.2    2e-16   Vitis vinifera
ref|XP_008376217.1|  PREDICTED: 21 kDa protein-like                   87.8    2e-16   
ref|XP_007209621.1|  hypothetical protein PRUPE_ppa011699mg           87.0    3e-16   
ref|XP_007039940.1|  Plant invertase/pectin methylesterase inhibi...  87.0    4e-16   
ref|XP_004162668.1|  PREDICTED: 21 kDa protein-like                   87.4    5e-16   
ref|XP_006490090.1|  PREDICTED: 21 kDa protein-like                   86.3    6e-16   
gb|KGN57274.1|  hypothetical protein Csa_3G175740                     87.0    6e-16   
ref|XP_006357906.1|  PREDICTED: 21 kDa protein-like                   86.3    6e-16   
ref|XP_004160872.1|  PREDICTED: 21 kDa protein-like                   86.3    6e-16   
ref|XP_007148704.1|  hypothetical protein PHAVU_005G007600g           86.3    6e-16   
gb|KDP38091.1|  hypothetical protein JCGZ_04734                       86.3    8e-16   
ref|XP_011029962.1|  PREDICTED: 21 kDa protein-like                   85.9    8e-16   
ref|XP_002318283.1|  21K protein precursor                            85.9    9e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011018248.1|  PREDICTED: 21 kDa protein                        86.3    9e-16   
ref|XP_006355502.1|  PREDICTED: 21 kDa protein-like                   85.9    1e-15   
ref|XP_006368687.1|  invertase/pectin methylesterase inhibitor fa...  85.9    1e-15   
ref|XP_004148136.1|  PREDICTED: 21 kDa protein-like                   85.5    1e-15   
ref|XP_010546336.1|  PREDICTED: 21 kDa protein-like                   85.9    1e-15   
ref|XP_004499663.1|  PREDICTED: 21 kDa protein-like                   85.1    2e-15   
gb|ABK94287.1|  unknown                                               85.1    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_007210220.1|  hypothetical protein PRUPE_ppa015829mg           85.1    2e-15   
ref|XP_010056361.1|  PREDICTED: 21 kDa protein-like                   84.7    2e-15   
ref|XP_002318880.1|  invertase/pectin methylesterase inhibitor fa...  84.7    2e-15   Populus trichocarpa [western balsam poplar]
sp|P17407.1|21KD_DAUCA  RecName: Full=21 kDa protein; AltName: Fu...  84.7    2e-15   Daucus carota [carrots]
ref|XP_011041730.1|  PREDICTED: 21 kDa protein-like                   84.7    3e-15   
gb|EPS67841.1|  hypothetical protein M569_06935                       84.0    3e-15   
ref|XP_008439100.1|  PREDICTED: 21 kDa protein-like                   84.3    3e-15   
ref|XP_010555621.1|  PREDICTED: 21 kDa protein                        84.3    3e-15   
ref|XP_007155620.1|  hypothetical protein PHAVU_003G217200g           84.7    3e-15   
gb|ABK21023.1|  unknown                                               84.3    3e-15   Picea sitchensis
emb|CDP05316.1|  unnamed protein product                              84.3    3e-15   
gb|AFK45126.1|  unknown                                               84.0    4e-15   
ref|XP_006385731.1|  hypothetical protein POPTR_0003s11320g           84.0    4e-15   
gb|ACJ83345.1|  unknown                                               84.0    4e-15   Medicago truncatula
gb|KCW77718.1|  hypothetical protein EUGRSUZ_D02018                   84.3    4e-15   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                 88.2    5e-15   
ref|XP_006826916.1|  hypothetical protein AMTR_s00010p00166600        84.0    5e-15   
ref|XP_008377851.1|  PREDICTED: 21 kDa protein                        84.0    5e-15   
ref|XP_002322406.1|  21K protein precursor                            83.6    5e-15   Populus trichocarpa [western balsam poplar]
gb|EYU26823.1|  hypothetical protein MIMGU_mgv1a020375mg              83.2    5e-15   
ref|XP_003611258.1|  Pectinesterase                                   84.0    6e-15   
ref|XP_006385730.1|  hypothetical protein POPTR_0003s11310g           83.6    6e-15   
ref|XP_011010941.1|  PREDICTED: 21 kDa protein-like                   83.2    7e-15   
gb|KFK40568.1|  hypothetical protein AALP_AA2G013000                  83.2    9e-15   
ref|XP_002509585.1|  21 kDa protein precursor, putative               83.2    9e-15   Ricinus communis
ref|XP_004307821.1|  PREDICTED: 21 kDa protein-like                   82.8    1e-14   
ref|XP_010053423.1|  PREDICTED: 21 kDa protein-like                   83.2    1e-14   
ref|XP_006421712.1|  hypothetical protein CICLE_v10007113mg           82.8    1e-14   
ref|XP_009362111.1|  PREDICTED: 21 kDa protein-like                   82.8    1e-14   
ref|XP_006448207.1|  hypothetical protein CICLE_v10016684mg           82.8    1e-14   
ref|XP_006469216.1|  PREDICTED: 21 kDa protein-like                   82.8    1e-14   
ref|XP_009393953.1|  PREDICTED: 21 kDa protein-like                   82.4    2e-14   
ref|XP_007045219.1|  Plant invertase/pectin methylesterase inhibi...  83.2    2e-14   
ref|XP_011081197.1|  PREDICTED: 21 kDa protein-like                   82.0    2e-14   
ref|XP_010264193.1|  PREDICTED: 21 kDa protein-like                   82.0    2e-14   
ref|XP_009589629.1|  PREDICTED: 21 kDa protein-like                   82.0    2e-14   
emb|CBI24572.3|  unnamed protein product                              81.6    2e-14   
ref|XP_011029961.1|  PREDICTED: 21 kDa protein                        81.6    3e-14   
ref|XP_003550896.1|  PREDICTED: 21 kDa protein-like                   82.0    3e-14   
ref|XP_008448897.1|  PREDICTED: 21 kDa protein-like                   81.6    3e-14   
ref|XP_004245727.1|  PREDICTED: 21 kDa protein-like                   81.6    3e-14   
gb|ACJ86212.1|  unknown                                               82.0    3e-14   Medicago truncatula
ref|XP_010931030.1|  PREDICTED: 21 kDa protein-like                   81.6    3e-14   
ref|XP_010062095.1|  PREDICTED: 21 kDa protein-like                   81.3    4e-14   
ref|XP_002312451.2|  hypothetical protein POPTR_0008s13190g           81.3    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007039952.1|  Plant invertase/pectin methylesterase inhibi...  81.3    5e-14   
ref|XP_008779098.1|  PREDICTED: 21 kDa protein-like                   80.9    5e-14   
ref|XP_010934409.1|  PREDICTED: 21 kDa protein-like                   80.9    5e-14   
emb|CDX94463.1|  BnaC01g17210D                                        80.9    5e-14   
ref|XP_002886456.1|  hypothetical protein ARALYDRAFT_893206           80.1    6e-14   
ref|XP_002304431.2|  hypothetical protein POPTR_0003s20640g           80.9    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010273892.1|  PREDICTED: 21 kDa protein-like                   80.9    6e-14   
gb|KDP25618.1|  hypothetical protein JCGZ_20774                       80.5    7e-14   
ref|XP_009370518.1|  PREDICTED: 21 kDa protein-like                   80.5    7e-14   
ref|NP_176463.2|  plant invertase/pectin methylesterase inhibitor...  82.0    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033915.1|  PREDICTED: 21 kDa protein-like                   80.1    8e-14   
ref|XP_002321835.2|  hypothetical protein POPTR_0015s14670g           80.5    8e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009398112.1|  PREDICTED: 21 kDa protein-like                   80.5    1e-13   
ref|XP_003517432.1|  PREDICTED: 21 kDa protein                        80.1    1e-13   
ref|XP_004235096.1|  PREDICTED: 21 kDa protein-like                   79.7    1e-13   
ref|XP_009392885.1|  PREDICTED: 21 kDa protein-like                   79.7    1e-13   
ref|XP_010646817.1|  PREDICTED: 21 kDa protein                        79.7    1e-13   
gb|ACU15105.1|  unknown                                               79.7    1e-13   Glycine max [soybeans]
ref|XP_009780736.1|  PREDICTED: 21 kDa protein-like                   79.7    1e-13   
ref|XP_009139088.1|  PREDICTED: 21 kDa protein                        79.7    1e-13   
ref|XP_010430352.1|  PREDICTED: 21 kDa protein-like                   80.5    1e-13   
ref|XP_011023856.1|  PREDICTED: 21 kDa protein-like                   79.7    1e-13   
ref|XP_006474599.1|  PREDICTED: 21 kDa protein-like                   79.7    1e-13   
ref|XP_010553474.1|  PREDICTED: 21 kDa protein-like                   79.7    2e-13   
gb|KDP25616.1|  hypothetical protein JCGZ_20772                       79.3    2e-13   
ref|XP_002509583.1|  21 kDa protein precursor, putative               79.3    2e-13   Ricinus communis
ref|XP_009763221.1|  PREDICTED: 21 kDa protein-like                   79.0    2e-13   
ref|XP_002527780.1|  21 kDa protein precursor, putative               79.0    2e-13   Ricinus communis
gb|ABS01356.1|  unknown                                               79.0    2e-13   Carica papaya [mamon]
ref|XP_011010939.1|  PREDICTED: 21 kDa protein-like                   79.0    2e-13   
ref|XP_009595818.1|  PREDICTED: 21 kDa protein-like                   79.0    2e-13   
ref|XP_010259039.1|  PREDICTED: 21 kDa protein-like                   78.6    3e-13   
gb|KFK33383.1|  hypothetical protein AALP_AA5G006000                  79.0    3e-13   
ref|XP_009767669.1|  PREDICTED: 21 kDa protein                        79.0    3e-13   
ref|XP_010093662.1|  21 kDa protein                                   78.6    3e-13   
ref|XP_010101980.1|  21 kDa protein                                   78.6    3e-13   
ref|XP_006843218.1|  hypothetical protein AMTR_s00080p00031010        78.6    3e-13   
ref|XP_011010940.1|  PREDICTED: 21 kDa protein-like                   78.6    4e-13   
ref|XP_010418274.1|  PREDICTED: 21 kDa protein-like                   79.0    4e-13   
emb|CDX86904.1|  BnaC03g51740D                                        78.2    4e-13   
ref|XP_004298673.1|  PREDICTED: 21 kDa protein-like                   78.2    4e-13   
ref|XP_010552689.1|  PREDICTED: 21 kDa protein-like                   78.2    5e-13   
ref|XP_006452866.1|  hypothetical protein CICLE_v10009541mg           77.8    5e-13   
gb|KFK44410.1|  hypothetical protein AALP_AA1G253500                  77.8    6e-13   
ref|XP_004147977.1|  PREDICTED: 21 kDa protein-like                   77.8    6e-13   
ref|XP_002304432.2|  invertase/pectin methylesterase inhibitor fa...  77.8    6e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007154555.1|  hypothetical protein PHAVU_003G128500g           77.8    7e-13   
ref|XP_006477257.1|  PREDICTED: 21 kDa protein-like                   77.8    7e-13   
ref|XP_010672011.1|  PREDICTED: 21 kDa protein-like                   77.4    7e-13   
ref|XP_009151354.1|  PREDICTED: 21 kDa protein                        77.4    7e-13   
ref|XP_009610995.1|  PREDICTED: 21 kDa protein                        77.4    7e-13   
emb|CDX89429.1|  BnaA01g14640D                                        77.4    7e-13   
ref|XP_007151983.1|  hypothetical protein PHAVU_004G091900g           77.4    8e-13   
ref|XP_011041729.1|  PREDICTED: 21 kDa protein-like                   77.4    8e-13   
ref|XP_004309057.1|  PREDICTED: 21 kDa protein-like                   77.0    8e-13   
ref|XP_010533759.1|  PREDICTED: 21 kDa protein-like                   77.4    9e-13   
gb|AGJ76633.1|  PMEI/InvI                                             77.0    1e-12   
ref|XP_004244713.1|  PREDICTED: 21 kDa protein-like                   77.0    1e-12   
ref|XP_002867618.1|  invertase/pectin methylesterase inhibitor fa...  77.0    1e-12   
ref|XP_004240754.1|  PREDICTED: 21 kDa protein-like                   76.6    1e-12   
ref|XP_009595808.1|  PREDICTED: 21 kDa protein-like                   77.0    1e-12   
ref|NP_194256.1|  plant invertase/pectin methylesterase inhibitor...  76.6    1e-12   
ref|XP_009372932.1|  PREDICTED: 21 kDa protein-like                   76.6    1e-12   
emb|CDY46918.1|  BnaA09g12760D                                        76.6    1e-12   
ref|XP_002314795.2|  hypothetical protein POPTR_0010s11950g           77.0    1e-12   
ref|XP_006362113.1|  PREDICTED: 21 kDa protein-like                   76.6    1e-12   
ref|XP_002284784.1|  PREDICTED: 21 kDa protein                        76.6    2e-12   
ref|XP_010259553.1|  PREDICTED: 21 kDa protein-like                   76.3    2e-12   
ref|XP_010438899.1|  PREDICTED: 21 kDa protein-like                   76.3    2e-12   
ref|XP_009779277.1|  PREDICTED: 21 kDa protein-like                   76.3    2e-12   
ref|XP_002864786.1|  hypothetical protein ARALYDRAFT_496412           76.3    2e-12   
gb|ABK22631.1|  unknown                                               76.3    2e-12   
ref|XP_011075388.1|  PREDICTED: 21 kDa protein-like                   76.3    2e-12   
ref|XP_008238631.1|  PREDICTED: 21 kDa protein                        76.3    2e-12   
gb|AAF79226.1|AC006917_11  F10B6.30                                   76.3    2e-12   
ref|NP_201041.1|  plant invertase/pectin methylesterase inhibitor...  75.9    2e-12   
gb|AAM67138.1|  ripening-related protein-like                         75.9    3e-12   
ref|XP_011033917.1|  PREDICTED: 21 kDa protein-like                   75.9    3e-12   
ref|XP_010458832.1|  PREDICTED: 21 kDa protein-like                   75.9    3e-12   
ref|XP_010424933.1|  PREDICTED: 21 kDa protein-like                   75.9    3e-12   
ref|NP_563960.2|  plant invertase/pectin methylesterase inhibitor...  75.9    3e-12   
ref|XP_004251705.1|  PREDICTED: 21 kDa protein-like                   75.5    3e-12   
ref|XP_010444080.1|  PREDICTED: 21 kDa protein-like                   75.5    3e-12   
ref|XP_010089668.1|  21 kDa protein                                   75.5    3e-12   
ref|XP_009351520.1|  PREDICTED: 21 kDa protein-like                   75.5    3e-12   
ref|XP_010066596.1|  PREDICTED: 21 kDa protein                        75.5    3e-12   
ref|XP_006358403.1|  PREDICTED: 21 kDa protein-like                   75.5    3e-12   
ref|XP_008784634.1|  PREDICTED: 21 kDa protein-like                   75.5    4e-12   
ref|XP_006284547.1|  hypothetical protein CARUB_v10005764mg           75.5    4e-12   
ref|XP_010055534.1|  PREDICTED: 21 kDa protein-like                   75.5    4e-12   
ref|XP_004147584.1|  PREDICTED: 21 kDa protein-like                   75.1    4e-12   
ref|XP_010433659.1|  PREDICTED: 21 kDa protein-like                   75.1    4e-12   
emb|CDY31839.1|  BnaC09g13100D                                        75.1    4e-12   
ref|XP_008389193.1|  PREDICTED: 21 kDa protein-like                   75.1    5e-12   
ref|XP_010513891.1|  PREDICTED: 21 kDa protein-like                   75.5    5e-12   
ref|XP_010483947.1|  PREDICTED: 21 kDa protein-like                   75.1    5e-12   
gb|KHN04328.1|  21 kDa protein                                        75.1    5e-12   
ref|XP_006358402.1|  PREDICTED: 21 kDa protein-like                   75.1    5e-12   
emb|CDP09903.1|  unnamed protein product                              75.1    5e-12   
ref|XP_011070592.1|  PREDICTED: 21 kDa protein-like                   75.1    5e-12   
ref|XP_009113052.1|  PREDICTED: 21 kDa protein                        75.1    5e-12   
ref|XP_010426179.1|  PREDICTED: 21 kDa protein-like                   74.7    6e-12   
ref|XP_002509582.1|  21 kDa protein precursor, putative               75.1    6e-12   
ref|XP_010502142.1|  PREDICTED: 21 kDa protein-like                   75.1    6e-12   
emb|CDY65618.1|  BnaC02g46740D                                        74.7    6e-12   
ref|XP_004300721.1|  PREDICTED: 21 kDa protein-like                   74.3    7e-12   
ref|XP_003551060.1|  PREDICTED: 21 kDa protein-like                   74.7    7e-12   
ref|XP_006416961.1|  hypothetical protein EUTSA_v10008807mg           74.3    9e-12   
ref|XP_010473498.1|  PREDICTED: 21 kDa protein-like                   75.1    9e-12   
gb|KFK32950.1|  hypothetical protein AALP_AA6G310500                  74.3    9e-12   
gb|KCW73050.1|  hypothetical protein EUGRSUZ_E01498                   73.9    9e-12   
ref|XP_009137508.1|  PREDICTED: 21 kDa protein-like                   74.3    9e-12   
emb|CDX83999.1|  BnaC08g16460D                                        73.9    1e-11   
ref|XP_010503338.1|  PREDICTED: 21 kDa protein-like                   73.9    1e-11   
ref|XP_010919055.1|  PREDICTED: 21 kDa protein-like                   73.6    1e-11   
ref|XP_010550578.1|  PREDICTED: 21 kDa protein-like                   73.6    1e-11   
ref|NP_178270.1|  invertase/pectin methylesterase inhibitor-like ...  73.9    1e-11   
ref|XP_010515044.1|  PREDICTED: 21 kDa protein-like                   73.6    1e-11   
ref|XP_008234383.1|  PREDICTED: 21 kDa protein-like                   73.6    2e-11   
ref|XP_010056360.1|  PREDICTED: 21 kDa protein-like                   73.6    2e-11   
ref|XP_008467116.1|  PREDICTED: 21 kDa protein                        73.6    2e-11   
gb|KDO48403.1|  hypothetical protein CISIN_1g038081mg                 73.2    2e-11   
emb|CDY11066.1|  BnaA03g47250D                                        73.2    2e-11   
ref|XP_006281134.1|  hypothetical protein CARUB_v10027165mg           73.2    2e-11   
ref|XP_007012560.1|  Plant invertase/pectin methylesterase inhibi...  73.2    2e-11   
emb|CDX92687.1|  BnaC07g39450D                                        73.2    2e-11   
ref|XP_006440387.1|  hypothetical protein CICLE_v10022285mg           73.2    2e-11   
ref|XP_010553774.1|  PREDICTED: 21 kDa protein                        73.2    2e-11   
emb|CAN77093.1|  hypothetical protein VITISV_026597                   73.2    2e-11   
ref|XP_004150119.1|  PREDICTED: 21 kDa protein-like                   73.2    2e-11   
gb|EMT21002.1|  21 kDa protein                                        72.8    2e-11   
gb|AFK49081.1|  unknown                                               72.8    3e-11   
ref|XP_006305566.1|  hypothetical protein CARUB_v10010160mg           73.2    3e-11   
ref|XP_002876765.1|  invertase/pectin methylesterase inhibitor fa...  72.8    3e-11   
ref|XP_008783567.1|  PREDICTED: 21 kDa protein-like                   72.8    3e-11   
ref|XP_002529634.1|  21 kDa protein precursor, putative               72.4    3e-11   
ref|XP_008437134.1|  PREDICTED: 21 kDa protein-like                   72.4    4e-11   
ref|XP_007218408.1|  hypothetical protein PRUPE_ppa011478mg           72.4    4e-11   
gb|EEC81299.1|  hypothetical protein OsI_24433                        72.0    4e-11   
ref|XP_002890079.1|  invertase/pectin methylesterase inhibitor fa...  72.0    4e-11   
ref|XP_002321836.1|  hypothetical protein POPTR_0015s14660g           72.0    5e-11   
ref|XP_006413324.1|  hypothetical protein EUTSA_v10027588mg           72.0    5e-11   
gb|KFK27962.1|  hypothetical protein AALP_AA8G453900                  72.0    5e-11   
gb|EPS61559.1|  invertase/pectin methylesterase inhibitor family ...  71.2    6e-11   
ref|XP_006292770.1|  hypothetical protein CARUB_v10019019mg           72.0    6e-11   
ref|XP_006345247.1|  PREDICTED: 21 kDa protein-like                   71.6    6e-11   
gb|KFK29033.1|  hypothetical protein AALP_AA7G080100                  71.6    7e-11   
ref|XP_009793698.1|  PREDICTED: 21 kDa protein-like                   71.6    7e-11   
ref|XP_003525240.1|  PREDICTED: 21 kDa protein-like                   71.6    7e-11   
ref|XP_009130208.1|  PREDICTED: 21 kDa protein-like                   71.6    7e-11   
gb|KCW86259.1|  hypothetical protein EUGRSUZ_B02943                   71.6    7e-11   
emb|CDY30715.1|  BnaA02g33370D                                        71.6    8e-11   
ref|XP_010476566.1|  PREDICTED: 21 kDa protein-like                   71.6    8e-11   
ref|XP_009148876.1|  PREDICTED: 21 kDa protein-like                   71.2    8e-11   
ref|XP_006404390.1|  hypothetical protein EUTSA_v10010734mg           71.2    8e-11   
ref|XP_010044213.1|  PREDICTED: 21 kDa protein-like                   71.2    9e-11   
ref|XP_009801663.1|  PREDICTED: 21 kDa protein-like                   71.6    9e-11   
ref|XP_010062106.1|  PREDICTED: 21 kDa protein                        71.2    1e-10   
ref|XP_006421715.1|  hypothetical protein CICLE_v10005928mg           70.9    1e-10   
ref|XP_010261745.1|  PREDICTED: 21 kDa protein-like                   70.9    1e-10   
ref|XP_007225804.1|  hypothetical protein PRUPE_ppa011318mg           71.2    1e-10   
gb|KHN42712.1|  21 kDa protein                                        70.9    1e-10   
ref|XP_007160400.1|  hypothetical protein PHAVU_002G318700g           70.9    1e-10   
ref|XP_010055533.1|  PREDICTED: 21 kDa protein-like                   70.9    1e-10   
ref|XP_010459004.1|  PREDICTED: 21 kDa protein-like                   70.9    1e-10   
gb|KDO65431.1|  hypothetical protein CISIN_1g029020mg                 70.9    1e-10   
ref|XP_006291874.1|  hypothetical protein CARUB_v10018051mg           70.9    1e-10   
gb|ABK22757.1|  unknown                                               70.5    1e-10   
ref|XP_010496621.1|  PREDICTED: 21 kDa protein-like                   70.9    1e-10   
ref|XP_009400194.1|  PREDICTED: 21 kDa protein-like                   70.5    2e-10   
ref|XP_009605202.1|  PREDICTED: 21 kDa protein-like                   70.9    2e-10   
emb|CDY52309.1|  BnaCnng22160D                                        70.5    2e-10   
gb|ACN40648.1|  unknown                                               70.5    2e-10   
ref|XP_010327317.1|  PREDICTED: 21 kDa protein-like                   70.5    2e-10   
gb|KFK34035.1|  hypothetical protein AALP_AA5G093500                  70.5    2e-10   
ref|XP_002464395.1|  hypothetical protein SORBIDRAFT_01g017510        70.9    2e-10   
ref|XP_006396768.1|  hypothetical protein EUTSA_v10029144mg           70.5    2e-10   
ref|XP_009767771.1|  PREDICTED: 21 kDa protein                        70.1    2e-10   
ref|XP_010055532.1|  PREDICTED: 21 kDa protein-like                   70.5    2e-10   
emb|CDX86708.1|  BnaA09g20980D                                        70.1    2e-10   
ref|XP_009595722.1|  PREDICTED: 21 kDa protein-like                   70.5    2e-10   
ref|XP_010327315.1|  PREDICTED: 21 kDa protein-like                   70.5    2e-10   
ref|XP_009628691.1|  PREDICTED: 21 kDa protein-like                   70.1    2e-10   
ref|XP_002302527.1|  hypothetical protein POPTR_0002s14680g           70.1    2e-10   
ref|XP_010460110.1|  PREDICTED: 21 kDa protein-like                   70.1    2e-10   
ref|XP_009110513.1|  PREDICTED: 21 kDa protein-like                   70.1    2e-10   
ref|XP_006579621.1|  PREDICTED: 21 kDa protein-like                   70.1    3e-10   
ref|NP_173734.1|  plant invertase/pectin methylesterase inhibitor...  69.7    3e-10   
ref|XP_009782675.1|  PREDICTED: 21 kDa protein-like                   69.7    3e-10   
ref|XP_008437716.1|  PREDICTED: 21 kDa protein-like                   69.7    3e-10   
ref|XP_006349456.1|  PREDICTED: 21 kDa protein-like                   69.7    3e-10   
ref|XP_004287664.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-10   
ref|XP_010098934.1|  21 kDa protein                                   69.7    4e-10   
ref|XP_008366992.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-10   
ref|XP_002276089.1|  PREDICTED: 21 kDa protein                        69.3    4e-10   
ref|XP_010240845.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-10   
ref|XP_006353777.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-10   
ref|XP_009382218.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-10   
emb|CDY52024.1|  BnaA08g31370D                                        69.3    4e-10   
ref|XP_009114623.1|  PREDICTED: 21 kDa protein                        69.3    4e-10   
ref|XP_003530773.1|  PREDICTED: 21 kDa protein-like                   69.3    4e-10   
ref|XP_002893269.1|  hypothetical protein ARALYDRAFT_472578           69.3    4e-10   
ref|XP_009127823.1|  PREDICTED: 21 kDa protein                        69.3    4e-10   
ref|XP_011076331.1|  PREDICTED: 21 kDa protein-like                   68.9    5e-10   
ref|XP_008366993.1|  PREDICTED: 21 kDa protein-like                   68.9    5e-10   
dbj|BAJ92900.1|  predicted protein                                    68.9    6e-10   
ref|XP_006416112.1|  hypothetical protein EUTSA_v10008638mg           68.9    6e-10   
ref|XP_004235100.2|  PREDICTED: 21 kDa protein-like                   68.6    6e-10   
gb|AAM63865.1|  unknown                                               68.6    7e-10   
ref|XP_003563551.1|  PREDICTED: 21 kDa protein-like                   68.6    7e-10   
gb|KCW77722.1|  hypothetical protein EUGRSUZ_D02022                   68.2    7e-10   
ref|XP_011039933.1|  PREDICTED: 21 kDa protein                        68.6    7e-10   
ref|XP_009608759.1|  PREDICTED: 21 kDa protein-like                   68.6    7e-10   
emb|CAN79278.1|  hypothetical protein VITISV_005236                   68.6    8e-10   
ref|XP_007038422.1|  Plant invertase/pectin methylesterase inhibi...  68.6    8e-10   
ref|XP_009611479.1|  PREDICTED: 21 kDa protein-like                   68.6    8e-10   
ref|XP_002263511.1|  PREDICTED: 21 kDa protein                        68.6    8e-10   
ref|XP_006390848.1|  hypothetical protein EUTSA_v10019136mg           68.2    9e-10   
ref|NP_001058553.1|  Os06g0711800                                     68.2    9e-10   
ref|NP_190322.1|  plant invertase/pectin methylesterase inhibitor...  68.2    9e-10   
ref|XP_010053424.1|  PREDICTED: 21 kDa protein                        68.2    9e-10   
emb|CDX97343.1|  BnaA02g21340D                                        68.2    1e-09   
ref|XP_004249077.1|  PREDICTED: 21 kDa protein-like                   68.2    1e-09   
gb|EYU33115.1|  hypothetical protein MIMGU_mgv1a026685mg              68.2    1e-09   
ref|XP_004243686.1|  PREDICTED: 21 kDa protein                        67.8    1e-09   
ref|XP_009411399.1|  PREDICTED: 21 kDa protein-like                   67.8    1e-09   
ref|NP_197574.1|  plant invertase/pectin methylesterase inhibitor...  67.8    1e-09   
emb|CDY70789.1|  BnaCnng69780D                                        67.8    1e-09   
dbj|BAD53655.1|  ripening-related protein-like                        67.8    1e-09   
ref|XP_006826917.1|  hypothetical protein AMTR_s00010p00167000        67.8    1e-09   
ref|XP_006395872.1|  hypothetical protein EUTSA_v10004939mg           67.4    1e-09   
emb|CDX99059.1|  BnaA06g17500D                                        67.4    1e-09   
gb|AES90968.2|  plant invertase/pectin methylesterase inhibitor       67.4    2e-09   
emb|CDY25774.1|  BnaA07g10080D                                        67.8    2e-09   
ref|XP_009149923.1|  PREDICTED: 21 kDa protein                        67.4    2e-09   
ref|XP_010498828.1|  PREDICTED: 21 kDa protein-like                   68.2    2e-09   
ref|XP_006394408.1|  hypothetical protein EUTSA_v10004933mg           67.4    2e-09   
ref|XP_006306219.1|  hypothetical protein CARUB_v10011899mg           67.4    2e-09   
ref|XP_010477610.1|  PREDICTED: 21 kDa protein                        67.4    2e-09   
ref|XP_009774407.1|  PREDICTED: 21 kDa protein-like                   67.4    2e-09   
ref|XP_009587354.1|  PREDICTED: 21 kDa protein-like                   67.0    2e-09   
ref|XP_009103189.1|  PREDICTED: 21 kDa protein-like                   67.4    2e-09   
ref|XP_006826919.1|  hypothetical protein AMTR_s00010p00168350        67.0    2e-09   
ref|XP_010533758.1|  PREDICTED: 21 kDa protein                        67.0    2e-09   
ref|XP_010676189.1|  PREDICTED: 21 kDa protein                        67.0    2e-09   
gb|KDP23996.1|  hypothetical protein JCGZ_25384                       67.0    2e-09   
ref|XP_011016775.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-09   
ref|XP_006347997.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-09   
gb|KDP33962.1|  hypothetical protein JCGZ_07533                       66.6    3e-09   
ref|XP_006490091.1|  PREDICTED: 21 kDa protein-like                   66.6    3e-09   
gb|EYU30100.1|  hypothetical protein MIMGU_mgv1a013865mg              66.6    3e-09   
ref|XP_006421709.1|  hypothetical protein CICLE_v10005888mg           66.6    3e-09   
ref|XP_004503384.1|  PREDICTED: 21 kDa protein-like                   66.6    4e-09   
ref|XP_008242280.1|  PREDICTED: 21 kDa protein                        66.6    4e-09   
ref|NP_199965.1|  plant invertase/pectin methylesterase inhibitor...  66.2    4e-09   
gb|AFK44781.1|  unknown                                               66.6    4e-09   
gb|AAM67063.1|  putative ripening-related protein                     66.2    4e-09   
ref|NP_564802.1|  plant invertase/pectin methylesterase inhibitor...  66.2    4e-09   
ref|XP_009359704.1|  PREDICTED: 21 kDa protein                        66.2    4e-09   
ref|XP_007138623.1|  hypothetical protein PHAVU_009G224200g           66.2    4e-09   
gb|KDP28776.1|  hypothetical protein JCGZ_14547                       66.2    4e-09   
ref|XP_010546069.1|  PREDICTED: 21 kDa protein-like                   66.2    4e-09   
ref|XP_004244511.2|  PREDICTED: 21 kDa protein-like                   66.2    4e-09   
ref|XP_003534960.1|  PREDICTED: 21 kDa protein-like                   66.2    4e-09   
ref|XP_010681916.1|  PREDICTED: 21 kDa protein-like                   66.2    5e-09   
ref|XP_004297460.1|  PREDICTED: 21 kDa protein-like                   66.2    5e-09   
gb|ACE97327.1|  pectinesterase inhibitor                              65.9    5e-09   
ref|XP_008337823.1|  PREDICTED: 21 kDa protein-like                   65.9    5e-09   
ref|XP_010520524.1|  PREDICTED: 21 kDa protein isoform X2             65.9    5e-09   
ref|XP_010415758.1|  PREDICTED: 21 kDa protein-like                   65.9    5e-09   
ref|XP_011017475.1|  PREDICTED: 21 kDa protein-like                   65.9    5e-09   



>emb|CDP05319.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEFI+TSC  T YPELC  SL      I  D ELLAHAA++ +LD ++S + M+ K+
Sbjct  39    TTNTEFIRTSCSTTTYPELCYASLSDQATIIRSDPELLAHAALSVSLDTAKSTSSMMVKL  98

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             +Q+  + P     M+ C+E++ DS+ +LK S+ EM  L+ P F   ++ I+  ++ AL D
Sbjct  99    SQSHGMTPREVGAMRDCVEELGDSVDELKKSMGEMPQLRGPNFALTVNDIQTWVSAALTD  158

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D C +G     +N   + AV++QI  VAHMT N L L+  +A+
Sbjct  159   EDTCMDGFAGKAMNGNTKIAVRNQIVNVAHMTSNALALINSYAS  202


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 91/165 (55%), Gaps = 3/165 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+FI++SC  T +P +CYASLS  A  I ++P+ LA  A+S++  T + T   M +++ 
Sbjct  41   NTEFIRTSCSTTTYPELCYASLSDQATIIRSDPELLAHAALSVSLDTAKSTSSMMVKLSQ  100

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              G++P+E  ++  C +    S+  ++ S+  +    +L+G +    ++DI+ W+ +  +
Sbjct  101  SHGMTPREVGAMRDCVEELGDSVDELKKSMGEMP---QLRGPNFALTVNDIQTWVSAALT  157

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + ++C++    + +       V   +  +   +  ALAL +S+A+
Sbjct  158  DEDTCMDGFAGKAMNGNTKIAVRNQIVNVAHMTSNALALINSYAS  202



>ref|XP_006490093.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=196

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 100/166 (60%), Gaps = 0/166 (0%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +  K TA+TEFI+TSC  T YP LC  SL +H   I    +LLAHA++N  L +++S + 
Sbjct  28    VPSKITASTEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSA  87

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT  927
             ++ K++++  + P  A  M+ CLE+++DS+ +L+ S+ EM  +K   FE  ++ I+  ++
Sbjct  88    VMLKISKSLGMKPREAEAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVS  147

Query  926   TALIDYDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              AL D   C +G     +N   V+ QI  +AHMT N L L+  +A+
Sbjct  148   AALTDETTCSDGFEKNTVNGKVVRGQIVKIAHMTSNALALINSYAS  193


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 91/170 (54%), Gaps = 16/170 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P +CY SL+  A  I  +PK LA  ++++T    + T   M +I+ 
Sbjct  35   STEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKISK  94

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINEL---KGIDLHTIIDDIKEWL  423
             +G+ P+E  ++  C E+LS        DS+  L ++I E+   K  +    ++DI+ W+
Sbjct  95   SLGMKPREAEAMQDCLEELS--------DSVDELRKSIGEMGLIKASNFELTMNDIQTWV  146

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  ++  +C +  E   +  KV   V   + ++   +  ALAL +S+A+
Sbjct  147  SAALTDETTCSDGFEKNTVNGKV---VRGQIVKIAHMTSNALALINSYAS  193



>ref|XP_006421707.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
 gb|ESR34947.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
Length=196

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 100/166 (60%), Gaps = 0/166 (0%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +  K TA+TEFI+TSC  T YP LC  SL +H   I    +LLAHA++N  L +++S + 
Sbjct  28    VPSKITASTEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSA  87

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT  927
             ++ K++++  + P  A  M+ CLE+++DS+ +L+ S+ EM  +K   FE  ++ I+  ++
Sbjct  88    VMLKMSKSPGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVS  147

Query  926   TALIDYDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              AL D   C +G     +N   V+ QI  +AHMT N L L+  +A+
Sbjct  148   AALTDDTTCSDGFEKNTVNGKVVRGQIVKIAHMTSNALALINSYAS  193


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 90/170 (53%), Gaps = 16/170 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P +CY SL+  A  I  +PK LA  ++++T    + T   M +++ 
Sbjct  35   STEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSK  94

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINEL---KGIDLHTIIDDIKEWL  423
              G+ P+E  ++  C E+LS        DS+  L ++I E+   K  +    ++DI+ W+
Sbjct  95   SPGMKPREADAMQDCLEELS--------DSVDELRKSIGEMGLIKASNFELTMNDIQTWV  146

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  ++  +C +  E   +  KV   V   + ++   +  ALAL +S+A+
Sbjct  147  SAALTDDTTCSDGFEKNTVNGKV---VRGQIVKIAHMTSNALALINSYAS  193



>gb|KDO65437.1| hypothetical protein CISIN_1g029238mg [Citrus sinensis]
Length=196

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 99/166 (60%), Gaps = 0/166 (0%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +  K TA+TEFI+TSC  T YP LC  SL +H   I    +LLAHA++N  L  ++S + 
Sbjct  28    VPSKITASTEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAKAKSTSA  87

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT  927
             ++ K++++  + P  A  M+ CLE+++DS+ +L+ S+ EM  +K   FE  ++ I+  ++
Sbjct  88    VMLKMSKSPGMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVS  147

Query  926   TALIDYDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              AL D   C +G     +N   V+ QI  +AHMT N L L+  +A+
Sbjct  148   AALTDDTTCSDGFEKNTVNGKVVRGQIVKIAHMTSNALALINSYAS  193


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 90/170 (53%), Gaps = 16/170 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P +CY SL+  A  I  +PK LA  ++++T    + T   M +++ 
Sbjct  35   STEFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAKAKSTSAVMLKMSK  94

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINEL---KGIDLHTIIDDIKEWL  423
              G+ P+E  ++  C E+LS        DS+  L ++I E+   K  +    ++DI+ W+
Sbjct  95   SPGMKPREADAMQDCLEELS--------DSVDELRKSIGEMGLIKASNFELTMNDIQTWV  146

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  ++  +C +  E   +  KV   V   + ++   +  ALAL +S+A+
Sbjct  147  SAALTDDTTCSDGFEKNTVNGKV---VRGQIVKIAHMTSNALALINSYAS  193



>ref|XP_011076332.1| PREDICTED: 21 kDa protein [Sesamum indicum]
Length=201

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 100/168 (60%), Gaps = 4/168 (2%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             AG  T  TEFI+TSC  T YP LC  +L  H   I +D +LLAHAA++ +LD +RS +  
Sbjct  32    AGGAT-NTEFIRTSCSATTYPRLCYSALASHASTIQQDPKLLAHAALSVSLDTARSTSVD  90

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITT  924
             + K++++  + P     M+ C+E+++DS+ +L+ S+ EM  +K   F   +S I+  ++ 
Sbjct  91    MVKLSRSTGMTPRQVGAMRDCVEELSDSVEQLRKSVEEMNLMKGSNFGMMMSDIQTWVSA  150

Query  923   ALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             AL D D C +G     +N   + AV+ +I  VAHMT N L L+  FAA
Sbjct  151   ALTDDDTCMDGFAGKFMNGAVKTAVRGRIVNVAHMTSNALALINSFAA  198


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 96/172 (56%), Gaps = 4/172 (2%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
            G  NT+FI++SC  T +P +CY++L+S A  I  +PK LA  A+S++  T   T   M +
Sbjct  34   GATNTEFIRTSCSATTYPRLCYSALASHASTIQQDPKLLAHAALSVSLDTARSTSVDMVK  93

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            ++   G++P++  ++  C +    S+  ++ S   +E +N +KG +   ++ DI+ W+ +
Sbjct  94   LSRSTGMTPRQVGAMRDCVEELSDSVEQLRKS---VEEMNLMKGSNFGMMMSDIQTWVSA  150

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++ ++C++    + +   V   V   +  +   +  ALAL +SFAA +HG
Sbjct  151  ALTDDDTCMDGFAGKFMNGAVKTAVRGRIVNVAHMTSNALALINSFAA-LHG  201



>emb|CDP05320.1| unnamed protein product [Coffea canephora]
Length=201

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EFI+TSC  T YP+LC  +L      I  D +LLAHAA++A+LD ++S + M+AK++Q+ 
Sbjct  39    EFIRTSCSTTTYPKLCYATLSNQATIIQSDPKLLAHAALSASLDTAKSTSSMMAKLSQSH  98

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E++ +S+ +LK SL EM  L    F   ++ I+  ++ AL D D C
Sbjct  99    GMTPRQGGAMRDCVEELRESVDELKNSLDEMPQLTGSNFALTMNDIQTWVSAALTDDDTC  158

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               G      N   + AV+DQI  VAH+T N L L+  +AA
Sbjct  159   MEGFAGKATNGNTKIAVRDQIVNVAHVTSNALALINSYAA  198


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 96/178 (54%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA    G  N +FI++SC  T +P +CYA+LS+ A  I ++PK LA  A+S +  T + T
Sbjct  28   AARALSGATNAEFIRTSCSTTTYPKLCYATLSNQATIIQSDPKLLAHAALSASLDTAKST  87

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   G++P++  ++  C +   +S+  +++SL  +    +L G +    ++DI
Sbjct  88   SSMMAKLSQSHGMTPRQGGAMRDCVEELRESVDELKNSLDEMP---QLTGSNFALTMNDI  144

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++ ++C+E    +         V   +  +   +  ALAL +S+AA +HG
Sbjct  145  QTWVSAALTDDDTCMEGFAGKATNGNTKIAVRDQIVNVAHVTSNALALINSYAA-LHG  201



>ref|XP_006362110.1| PREDICTED: 21 kDa protein-like isoform X1 [Solanum tuberosum]
 ref|XP_006367637.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=201

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 96/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH +++ +L+ ++S + M+ K++ +
Sbjct  38    TEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQSTSAMMIKLSHS  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++  +K SL EMK L+   F+ K+S I+  ++ AL D D 
Sbjct  98    QGMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMSDIQTWVSAALTDEDT  157

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+++I  VAHMT N L L+   AA
Sbjct  158   CTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLAA  198


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 99/178 (56%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA    G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  ++S++  T + T
Sbjct  28   AARPSAGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQST  87

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   G++P+E  ++  C +    ++  ++ SL  ++   EL+G D    + DI
Sbjct  88   SAMMIKLSHSQGMTPREVGAMRDCVEELSDAVSGIKKSLGEMK---ELRGKDFDLKMSDI  144

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++ ++C E    + +  KV   V   + E+   +  ALAL +S AA +HG
Sbjct  145  QTWVSAALTDEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLAA-LHG  201



>ref|XP_002322404.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06531.2| ripening-related family protein [Populus trichocarpa]
Length=195

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++ EFI+TSC  T YP LC  SL  H R I    +L+A+AA+N  L  ++S + M++K++
Sbjct  30    SSIEFIRTSCSTTTYPRLCYTSLSIHSRTIHTSPKLIANAALNVTLSSAKSTSTMMSKLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q+  L P+  + MK C+E+++D++++L+ S+ EM H+K   FE  IS +   ++ A+ D 
Sbjct  90    QSHGLKPKEVSAMKDCVEELSDAVYELRESIDEMDHVKRSDFEVMISDVRTWVSAAMTDE  149

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G     +N   + AV+ +I  +A +T N L L+  +A
Sbjct  150   STCSDGFAGNAMNGNLKRAVRGRIMNIAQLTSNALALVNNYA  191


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 89/173 (51%), Gaps = 3/173 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +AA    + + +FI++SC  T +P +CY SLS  +  I  +PK +A  A+++T  + + T
Sbjct  22   SAATVTPQSSIEFIRTSCSTTTYPRLCYTSLSIHSRTIHTSPKLIANAALNVTLSSAKST  81

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   GL PKE  ++  C +    ++  +++S   ++ ++ +K  D   +I D+
Sbjct  82   STMMSKLSQSHGLKPKEVSAMKDCVEELSDAVYELRES---IDEMDHVKRSDFEVMISDV  138

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            + W+ +  ++  +C +      +   +   V   +  +   +  ALAL +++A
Sbjct  139  RTWVSAAMTDESTCSDGFAGNAMNGNLKRAVRGRIMNIAQLTSNALALVNNYA  191



>ref|XP_006362111.1| PREDICTED: 21 kDa protein-like isoform X2 [Solanum tuberosum]
Length=201

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 97/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH +++ +L+ ++S + M+ K++ +
Sbjct  38    TEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQSTSAMMIKLSHS  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++  +K SL EMK L+   F+ K++ I+  ++ AL D D 
Sbjct  98    QGMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAALTDEDT  157

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+++I  VAHMT N L L+ + AA
Sbjct  158   CTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINRLAA  198


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 99/178 (56%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA    G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  ++S++  T + T
Sbjct  28   AARPSAGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQST  87

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   G++P+E  ++  C +    ++  ++ SL  ++   EL+G D    ++DI
Sbjct  88   SAMMIKLSHSQGMTPREVGAMRDCVEELSDAVSGIKKSLGEMK---ELRGKDFDLKMNDI  144

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++ ++C E    + +  KV   V   + E+   +  ALAL +  AA +HG
Sbjct  145  QTWVSAALTDEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINRLAA-LHG  201



>ref|XP_006421706.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
 gb|ESR34946.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
Length=200

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 94/164 (57%), Gaps = 0/164 (0%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              K  A   FI+TSC  T YP LC  SL +H   I    +LLAHA++N  L +++S + ++
Sbjct  34    SKIAADRRFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVM  93

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTA  921
              K++++  + P     M+ CLE+++DS+ +L+ S+ EM  +K   FE  +S I+  ++ A
Sbjct  94    LKMSKSPGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAA  153

Query  920   LIDYDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             L D   C +G     +N   V+ QI  +AHMT N L L+  +A+
Sbjct  154   LTDETTCSDGFEKNTVNGKVVRAQIVKIAHMTSNALALINSYAS  197


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 86/167 (51%), Gaps = 16/167 (10%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIK+SC  T +P +CY SL+  A  I  +PK LA  ++++T    + T   M +++   G
Sbjct  42   FIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKSPG  101

Query  578  LSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINEL---KGIDLHTIIDDIKEWLKSV  414
            + P+E  ++  C E+LS        DS+  L ++I E+   K  +    + DI+ W+ + 
Sbjct  102  MKPREVDAMQDCLEELS--------DSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAA  153

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++  +C +  E   +  KV   V   + ++   +  ALAL +S+A+
Sbjct  154  LTDETTCSDGFEKNTVNGKV---VRAQIVKIAHMTSNALALINSYAS  197



>ref|XP_006490094.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65438.1| hypothetical protein CISIN_1g027094mg [Citrus sinensis]
Length=228

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 94/164 (57%), Gaps = 0/164 (0%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              K  A   FI+TSC  T YP LC  SL +H   I    +LLAHA++N  L +++S + ++
Sbjct  62    SKIAADRRFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVM  121

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTA  921
              K++++  + P     M+ CLE+++DS+ +L+ S+ EM  +K   FE  +S I+  ++ A
Sbjct  122   LKMSKSPGMKPREVDAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAA  181

Query  920   LIDYDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             L D   C +G     +N   V+ QI  +AHMT N L L+  +A+
Sbjct  182   LTDETTCSDGFEKNTVNGKVVRAQIVKIAHMTSNALALINSYAS  225


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 86/167 (51%), Gaps = 16/167 (10%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIK+SC  T +P +CY SL+  A  I  +PK LA  ++++T    + T   M +++   G
Sbjct  70   FIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKSPG  129

Query  578  LSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINEL---KGIDLHTIIDDIKEWLKSV  414
            + P+E  ++  C E+LS        DS+  L ++I E+   K  +    + DI+ W+ + 
Sbjct  130  MKPREVDAMQDCLEELS--------DSVDELRKSIGEMGLIKASNFELTMSDIQTWVSAA  181

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++  +C +  E   +  KV   V   + ++   +  ALAL +S+A+
Sbjct  182  LTDETTCSDGFEKNTVNGKV---VRAQIVKIAHMTSNALALINSYAS  225



>gb|ABK96280.1| unknown [Populus trichocarpa x Populus deltoides]
Length=194

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 97/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++ EFI+TSC  T YP LC  SL  H R I    +L+A+AA+N  L  ++S + M++K++
Sbjct  30    SSIEFIRTSCSTTTYPRLCYTSLSIHSRTIHTSPKLIANAALNVTLSSAKSTSTMMSKLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q+  L P+  + MK C+E+++D++++L+ S+ EM H K   FE  IS +   ++ A+ D 
Sbjct  90    QSHGLKPKEVSAMKDCVEELSDAVYELRESIDEMGHAKQSNFEVMISDVRTWVSAAMTDE  149

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G     +N   + A++ +I  +A +T N L L+  +A
Sbjct  150   STCSDGFAGNAMNGNLKRAIRGRIMNIAQLTSNALALVNNYA  191


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 91/178 (51%), Gaps = 13/178 (7%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +AA    + + +FI++SC  T +P +CY SLS  +  I  +PK +A  A+++T  + + T
Sbjct  22   SAATVTPQSSIEFIRTSCSTTTYPRLCYTSLSIHSRTIHTSPKLIANAALNVTLSSAKST  81

Query  614  VRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINEL---KGIDLHT  450
               M +++   GL PKE  ++  C E+LS        D++  L E+I+E+   K  +   
Sbjct  82   STMMSKLSQSHGLKPKEVSAMKDCVEELS--------DAVYELRESIDEMGHAKQSNFEV  133

Query  449  IIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +I D++ W+ +  ++  +C +      +   +   +   +  +   +  ALAL +++A
Sbjct  134  MISDVRTWVSAAMTDESTCSDGFAGNAMNGNLKRAIRGRIMNIAQLTSNALALVNNYA  191



>ref|XP_006367638.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=203

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A +
Sbjct  40    TEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAYS  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++  +K SL EMK L+   F+ K++ I+  ++ AL D D 
Sbjct  100   QGMAPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAALTDEDT  159

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+++I  VAHMT N L L+   AA
Sbjct  160   CTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLAA  200


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 98/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
             G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  +++++  T + T   M 
Sbjct  35   AGETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMML  94

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
            ++A   G++P+E  ++  C +    ++  ++ SL  ++   EL+G D    ++DI+ W+ 
Sbjct  95   KLAYSQGMAPREVGAMRDCVEELSDAVSGIKKSLGEMK---ELRGKDFDLKMNDIQTWVS  151

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +  ++ ++C E    + +  KV   V   + E+   +  ALAL +S AA +HG
Sbjct  152  AALTDEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLAA-LHG  203



>ref|XP_009594970.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=204

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 93/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A  
Sbjct  41    TEFIRTSCKSTTYPNLCFSSLSGRATAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHV  100

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P     M  C+E+++D++ +L+ SL EMK L+   F+ K+S I+  ++ AL D D 
Sbjct  101   QGLTPREVGAMHDCVEELSDTVDELRKSLGEMKQLRGKDFDLKMSDIQTWVSAALTDEDT  160

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VAH+T N L L+   AA
Sbjct  161   CTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAA  201


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 96/174 (55%), Gaps = 3/174 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA    G  NT+FI++SC  T +PN+C++SLS  A  I  +P+ LA  +++++  T + T
Sbjct  31   AARPAAGDTNTEFIRTSCKSTTYPNLCFSSLSGRATAIGVSPQLLAHESLTVSLETAQST  90

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M ++A   GL+P+E  ++H C +    ++  ++ SL  ++   +L+G D    + DI
Sbjct  91   SAMMLKLAHVQGLTPREVGAMHDCVEELSDTVDELRKSLGEMK---QLRGKDFDLKMSDI  147

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + W+ +  ++ ++C E    + +  KV   V   + E+   +  ALAL +S AA
Sbjct  148  QTWVSAALTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAA  201



>gb|AAX20046.1| DC1.2-like [Capsicum annuum]
Length=205

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A  
Sbjct  42    TEFIRTSCKSTSYPNLCFSSLSSRASAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHG  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M  C+E+++D++  L+ SL EMK L+   F+ KI+ I+  ++ AL D D 
Sbjct  102   QGMTPREVGAMHDCVEELSDTVAGLRKSLGEMKQLRGKDFDLKINDIQTWVSAALTDEDT  161

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G +   +N   +  V+ +I  VAH+T N L L+   A+
Sbjct  162   CTEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAS  202


 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 110/199 (55%), Gaps = 9/199 (5%)
 Frame = -1

Query  842  MVAHMTLNGLTLMKKFAA---AGFP--GRENTDFIKSSCDKTPFPNICYASLSSSACDIA  678
            ++  + L  LT    + A   A  P  G  NT+FI++SC  T +PN+C++SLSS A  I 
Sbjct  11   LIGFLILVALTTSSNYLASVSAARPAVGETNTEFIRTSCKSTSYPNLCFSSLSSRASAIG  70

Query  677  ANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSL  498
             +P+ LA  +++++  T + T   M ++A   G++P+E  ++H C +    ++  ++ SL
Sbjct  71   VSPQLLAHESLTVSLETAQSTSAMMLKLAHGQGMTPREVGAMHDCVEELSDTVAGLRKSL  130

Query  497  SNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREME  318
              ++   +L+G D    I+DI+ W+ +  ++ ++C E  + + +  KV   V   + E+ 
Sbjct  131  GEMK---QLRGKDFDLKINDIQTWVSAALTDEDTCTEGFDGKVMNGKVKTVVRGKILEVA  187

Query  317  PFSEIALALFSSFAAGMHG  261
              +  ALAL +S A+ +HG
Sbjct  188  HLTSNALALINSLAS-LHG  205



>gb|ABG47806.1| pectin methlyesterase inhibitor protein 1 [Capsicum annuum]
 gb|ABG81102.1| pectin methlyesterase inhibitor protein 1 [Capsicum annuum]
Length=200

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A  
Sbjct  37    TEFIRTSCKSTTYPNLCFSSLSSRASAIGASPQLLAHESLTVSLETAQSTSSMMLKLAHG  96

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M  C+E+++D++  L+ SL EMK L+   F+ K++ I+  ++ AL D D 
Sbjct  97    QGMTPREIGAMHDCVEELSDTVVGLRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDT  156

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G +   +N   +  V+ +I  VAH+T N L L+ + AA
Sbjct  157   CTEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINRLAA  197


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 101/172 (59%), Gaps = 4/172 (2%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
            G  NT+FI++SC  T +PN+C++SLSS A  I A+P+ LA  +++++  T + T   M +
Sbjct  33   GETNTEFIRTSCKSTTYPNLCFSSLSSRASAIGASPQLLAHESLTVSLETAQSTSSMMLK  92

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +A   G++P+E  ++H C +    +++ ++ SL  ++   +L+G D    ++DI+ W+ +
Sbjct  93   LAHGQGMTPREIGAMHDCVEELSDTVVGLRKSLGEMK---QLRGKDFDLKMNDIQTWVSA  149

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++ ++C E  + + +  KV   V   + E+   +  ALAL +  AA +HG
Sbjct  150  ALTDEDTCTEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINRLAA-LHG  200



>ref|XP_007038418.1| DC1.2-like, putative [Theobroma cacao]
 gb|EOY22919.1| DC1.2-like, putative [Theobroma cacao]
Length=201

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 98/171 (57%), Gaps = 6/171 (4%)
 Frame = -1

Query  1283  AGKKTA---TTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSL  1113
             AG++ A   + EFI+TSC  T YP+LC  +L  H   I    +LLAHAA+N  L  + S 
Sbjct  28    AGRQIAPQSSAEFIRTSCSSTTYPKLCFETLSTHASLIQTSPQLLAHAALNVTLSTTEST  87

Query  1112  TGMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENL  933
             + M+  ++++  L P  A  M+ C+E+++DSI +L+ S+ EM  +K   F   I+ ++  
Sbjct  88    SAMMVTLSKSHGLKPREAEAMQDCVEELSDSIDELRKSISEMGQVKGSNFGLMINDVQTW  147

Query  932   ITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             ++ AL D   C +G     +N   + AV+ +I  +AH+T N L L+  +A+
Sbjct  148   VSAALTDESTCSDGFQGNNMNGNVKTAVRTKILRIAHLTSNALALINNYAS  198


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 102/182 (56%), Gaps = 8/182 (4%)
 Frame = -1

Query  797  FAAAG--FPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTT  624
            F++AG     + + +FI++SC  T +P +C+ +LS+ A  I  +P+ LA  A+++T  TT
Sbjct  25   FSSAGRQIAPQSSAEFIRTSCSSTTYPKLCFETLSTHASLIQTSPQLLAHAALNVTLSTT  84

Query  623  EFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTII  444
            E T   M  ++   GL P+E  ++  C +    SI  ++ S+S +    ++KG +   +I
Sbjct  85   ESTSAMMVTLSKSHGLKPREAEAMQDCVEELSDSIDELRKSISEM---GQVKGSNFGLMI  141

Query  443  DDIKEWLKSVKSNYESCIEELETEQIKEKVTEEV-TRLMREMEPFSEIALALFSSFAAGM  267
            +D++ W+ +  ++  +C +  +   +   V   V T+++R +   +  ALAL +++A+ +
Sbjct  142  NDVQTWVSAALTDESTCSDGFQGNNMNGNVKTAVRTKILR-IAHLTSNALALINNYAS-L  199

Query  266  HG  261
            HG
Sbjct  200  HG  201



>gb|EYU24972.1| hypothetical protein MIMGU_mgv1a023170mg [Erythranthe guttata]
Length=187

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 92/161 (57%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI+TSC  T YP LC  +L  H   I +D +LLAH A++ +LD +R+ +  + ++++ 
Sbjct  24    TRFIRTSCSTTTYPTLCYTALSNHASAIQQDPKLLAHVALSVSLDTARTTSVDMVRISRR  83

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               + P  A  M+ C+E+++DS+ +L  S+ EM  +    F   +S I+  ++ A+ D D 
Sbjct  84    AGITPREAGAMRDCVEELSDSVEQLGRSMSEMNRMNRSNFGRTMSDIQTWVSAAMTDEDT  143

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   + A++ +I  VAHMT N L L+  +AA
Sbjct  144   CMEGFAGKFMNGAAKSAIRTRIVNVAHMTSNALALINSYAA  184


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 94/178 (53%), Gaps = 6/178 (3%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AAAG  G+ +T FI++SC  T +P +CY +LS+ A  I  +PK LA  A+S++  T   T
Sbjct  16   AAAG--GKPDTRFIRTSCSTTTYPTLCYTALSNHASAIQQDPKLLAHVALSVSLDTARTT  73

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M  I+ + G++P+E  ++  C +    S+  +  S+S +   N +   +    + DI
Sbjct  74   SVDMVRISRRAGITPREAGAMRDCVEELSDSVEQLGRSMSEM---NRMNRSNFGRTMSDI  130

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++ ++C+E    + +       +   +  +   +  ALAL +S+AA +HG
Sbjct  131  QTWVSAAMTDEDTCMEGFAGKFMNGAAKSAIRTRIVNVAHMTSNALALINSYAA-VHG  187



>ref|XP_002322403.1| ripening-related family protein [Populus trichocarpa]
 gb|EEF06530.1| ripening-related family protein [Populus trichocarpa]
Length=203

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 93/163 (57%), Gaps = 3/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI+TSC  T YP LC  SL  H   I    +LLA+AA+N  L  ++S + M++ ++
Sbjct  35    SSTEFIRTSCSTTTYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTMISTLS  94

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q   + P   + MK C+E++ D++++L  S+ EM H +   F+  I  ++  ++ AL D 
Sbjct  95    QTHRMKPREVSAMKDCVEELGDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDE  154

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               C +G     +N   + AV+ +I  +A +T N L L+  +A+
Sbjct  155   STCSDGFAGNAMNGNLKTAVRGRIVNIAQLTSNALALINNYAS  197


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 88/185 (48%), Gaps = 25/185 (14%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +AA    + +T+FI++SC  T +P +CY SLS  +  I  +PK LA  A+++T  + + T
Sbjct  27   SAARVTTKSSTEFIRTSCSTTTYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKST  86

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNL-ETINEL-KGID------  459
               +  ++    + P+E              +  M+D +  L + +NEL K +D      
Sbjct  87   STMISTLSQTHRMKPRE--------------VSAMKDCVEELGDAVNELGKSMDEMSHAR  132

Query  458  ---LHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALF  288
                 ++IDD++ W+ +  ++  +C +      +   +   V   +  +   +  ALAL 
Sbjct  133  QSNFQSMIDDVQTWVSAALTDESTCSDGFAGNAMNGNLKTAVRGRIVNIAQLTSNALALI  192

Query  287  SSFAA  273
            +++A+
Sbjct  193  NNYAS  197



>ref|XP_004506603.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 3/164 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A T FI+TSC  T YP LC  SL KH   I  +  LL   A+N  L   +S   M++ +A
Sbjct  33    ANTLFIRTSCSSTTYPRLCYASLVKHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSLA  92

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             + + L P     MK C+E ++DSI +L+ S+ EM  L+   FE  +S I+  ++ AL D 
Sbjct  93    KTRELKPRETAAMKDCIELLSDSIDELRKSINEMSRLRTSNFELTMSDIQTWVSAALTDQ  152

Query  908   DRCPNG---MNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
               C +G   +N TG  +  V+ +I  VA +T N L L+ K A +
Sbjct  153   STCSDGFEEINATGDIKTIVQVKIVQVAQLTSNALALINKLATS  196


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 84/175 (48%), Gaps = 12/175 (7%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + NT FI++SC  T +P +CYASL   A  I  N   L   A+++T  T + T   M  +
Sbjct  32   QANTLFIRTSCSSTTYPRLCYASLVKHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSL  91

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            A    L P+E  ++  C +L   SI  ++ S++ +   + L+  +    + DI+ W+ + 
Sbjct  92   AKTRELKPRETAAMKDCIELLSDSIDELRKSINEM---SRLRTSNFELTMSDIQTWVSAA  148

Query  413  KSNYESCIEELE----TEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +  E    T  IK  V  ++     ++   +  ALAL +  A   HG
Sbjct  149  LTDQSTCSDGFEEINATGDIKTIVQVKIV----QVAQLTSNALALINKLATS-HG  198



>gb|ABG49144.1| pectin methylesterase inhibitor isoform [Solanum phureja]
Length=198

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EFI+TSC+ T YP LC  SL      IG   +LLAH +++ +++ ++S + M+ KVA ++
Sbjct  36    EFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSIETAQSTSTMMIKVAHSQ  95

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E+++D++ +L+ SL EMK L+   F+ K+S I+  ++ AL + D C
Sbjct  96    GMTPREVGAMQDCVEELSDTVSELRKSLGEMKQLRGRDFDMKMSDIQTWVSAALTNEDTC  155

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               G     +N   +  V+++I  VAHMT N L L+ + AA
Sbjct  156   TEGFAGKAMNGKVKTVVREKILEVAHMTSNALALINRLAA  195


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 101/190 (53%), Gaps = 6/190 (3%)
 Frame = -1

Query  824  LNGLTLMKKFAAAGFP--GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKN  651
            L    ++  F  A  P  G  N +FI++SC  T +PN+C++SLSS +  I  +P+ LA  
Sbjct  13   LTVFLILLAFTTAARPDSGETNREFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHE  72

Query  650  AISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINEL  471
            ++S++  T + T   M ++A   G++P+E  ++  C +    ++  ++ SL  ++   +L
Sbjct  73   SLSVSIETAQSTSTMMIKVAHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMK---QL  129

Query  470  KGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALAL  291
            +G D    + DI+ W+ +  +N ++C E    + +  KV   V   + E+   +  ALAL
Sbjct  130  RGRDFDMKMSDIQTWVSAALTNEDTCTEGFAGKAMNGKVKTVVREKILEVAHMTSNALAL  189

Query  290  FSSFAAGMHG  261
             +  AA +HG
Sbjct  190  INRLAA-LHG  198



>ref|XP_009779202.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=206

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 93/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A  
Sbjct  43    TEFIRTSCKSTTYPNLCFSSLSSRSAAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHV  102

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P     M  C+E+++D++ +L+ SL EMK L+   F+ K++ I+  ++ AL D D 
Sbjct  103   QGLTPREVGAMHDCVEELSDTVDELRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDT  162

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VAH+T N L L+   AA
Sbjct  163   CTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALVNSVAA  203


 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 101/178 (57%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA    G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  +++++  T + T
Sbjct  33   AARPAAGDTNTEFIRTSCKSTTYPNLCFSSLSSRSAAIGVSPQLLAHESLTVSLETAQST  92

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M ++A   GL+P+E  ++H C +    ++  ++ SL  ++   +L+G D    ++DI
Sbjct  93   SAMMLKLAHVQGLTPREVGAMHDCVEELSDTVDELRKSLGEMK---QLRGKDFDLKMNDI  149

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++ ++C E    + +  KV   V   + E+   +  ALAL +S AA +HG
Sbjct  150  QTWVSAALTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALVNSVAA-LHG  206



>emb|CBA10126.1| PME inhibitor [Nicotiana benthamiana]
Length=205

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A  
Sbjct  42    TEFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHV  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P     M  C+E+++D++ +++ SL EMK L+   F+ K++ I+  ++ AL D D 
Sbjct  102   RGLTPREVGAMHDCVEELSDTVDEMRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDT  161

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VAH+T N L L+   AA
Sbjct  162   CTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAA  202


 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 105/185 (57%), Gaps = 5/185 (3%)
 Frame = -1

Query  812  TLMKKFAAAG-FPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT  636
            + MK  +AA    G  NT+FI++SC  T +PN+C++SLSS A  I  +P+ LA  +++++
Sbjct  25   SFMKSVSAARPAAGDTNTEFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVS  84

Query  635  QRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDL  456
              T + T   M ++A   GL+P+E  ++H C +    ++  M+ SL  ++   +L+G D 
Sbjct  85   LETAQSTSAMMLKLAHVRGLTPREVGAMHDCVEELSDTVDEMRKSLGEMK---QLRGKDF  141

Query  455  HTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
               ++DI+ W+ +  ++ ++C E    + +  KV   V   + E+   +  ALAL +S A
Sbjct  142  DLKMNDIQTWVSAALTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLA  201

Query  275  AGMHG  261
            A +HG
Sbjct  202  A-LHG  205



>ref|XP_006362121.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=200

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 92/156 (59%), Gaps = 3/156 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A +
Sbjct  40    TEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAYS  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++  +K SL EMK L+   F+ K++ I+  ++ A  D D 
Sbjct  100   QGMAPREVGAMRDCVEELSDTVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAAFADEDT  159

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLM  804
             C  G     +N   +  V+++I  VAHMT N L L+
Sbjct  160   CTEGFAGKVMNGKVKTVVREKILEVAHMTSNSLALI  195


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 91/162 (56%), Gaps = 3/162 (2%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
            G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  +++++  T + T   M +
Sbjct  36   GETNTEFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMMLK  95

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +A   G++P+E  ++  C +    ++  ++ SL  ++   EL+G D    ++DI+ W+ +
Sbjct  96   LAYSQGMAPREVGAMRDCVEELSDTVSGIKKSLGEMK---ELRGKDFDLKMNDIQTWVSA  152

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALAL  291
              ++ ++C E    + +  KV   V   + E+   +  +LAL
Sbjct  153  AFADEDTCTEGFAGKVMNGKVKTVVREKILEVAHMTSNSLAL  194



>ref|XP_002264167.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 92/163 (56%), Gaps = 3/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+TEFI+T+C  T YP+LC  SL  H   I  + +LLA  A++  L  +RS +  ++ + 
Sbjct  35    ASTEFIRTACGTTTYPQLCFTSLAAHASVIQTNPKLLASTALSVTLATARSTSSDMSTLL  94

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             +   L P   + M+ C+E+++DS+ +LK S+ EM  +K   F   I+ I+  ++ AL D 
Sbjct  95    KRHGLTPREVSAMRDCVEELSDSVDQLKKSMGEMSQIKSSNFGLMINDIQTWVSAALTDE  154

Query  908   DRCPNGMNDTGLNE---PAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D C NG  +  + E     V  +I  +AHMT N L L+  +A+
Sbjct  155   DTCANGFTENAMTENVRTVVNARIVNIAHMTSNALALINSYAS  197


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 101/202 (50%), Gaps = 5/202 (2%)
 Frame = -1

Query  869  EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSA  690
             P  +   A++  +    + L+   AA     + +T+FI+++C  T +P +C+ SL++ A
Sbjct  4    SPCTRFLSALLFSLAFTSINLIS--AARPATDKASTEFIRTACGTTTYPQLCFTSLAAHA  61

Query  689  CDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYM  510
              I  NPK LA  A+S+T  T   T   M  +  + GL+P+E  ++  C +    S+  +
Sbjct  62   SVIQTNPKLLASTALSVTLATARSTSSDMSTLLKRHGLTPREVSAMRDCVEELSDSVDQL  121

Query  509  QDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLM  330
            + S+  +   +++K  +   +I+DI+ W+ +  ++ ++C        + E V   V   +
Sbjct  122  KKSMGEM---SQIKSSNFGLMINDIQTWVSAALTDEDTCANGFTENAMTENVRTVVNARI  178

Query  329  REMEPFSEIALALFSSFAAGMH  264
              +   +  ALAL +S+A+  H
Sbjct  179  VNIAHMTSNALALINSYASLHH  200



>gb|ABY81888.1| pectin methylesterase inhibitor-like protein [Capsicum annuum]
Length=205

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 93/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S + M+ K+A  
Sbjct  42    TEFIRTSCKSTSYPNLCFSSLSSRASAIGVAPQLLAHESLTVSLETAQSTSAMMLKLAHG  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M  C+E+++D++  L+ SL EMK L+   F+ KI+ I+  ++ AL D D 
Sbjct  102   QGMTPREVGAMHDCVEELSDTVAGLRKSLGEMKQLRGKDFDLKINDIQTWVSAALTDEDT  161

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G +   +N   +  V+ +I  VAH+T + L L+   A+
Sbjct  162   CTEGFDGKVMNGKVKTVVRGKIFEVAHLTSSALALINSLAS  202


 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 99/172 (58%), Gaps = 4/172 (2%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
            G  NT+FI++SC  T +PN+C++SLSS A  I   P+ LA  +++++  T + T   M +
Sbjct  38   GETNTEFIRTSCKSTSYPNLCFSSLSSRASAIGVAPQLLAHESLTVSLETAQSTSAMMLK  97

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +A   G++P+E  ++H C +    ++  ++ SL  ++   +L+G D    I+DI+ W+ +
Sbjct  98   LAHGQGMTPREVGAMHDCVEELSDTVAGLRKSLGEMK---QLRGKDFDLKINDIQTWVSA  154

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++ ++C E  + + +  KV   V   + E+   +  ALAL +S A+ +HG
Sbjct  155  ALTDEDTCTEGFDGKVMNGKVKTVVRGKIFEVAHLTSSALALINSLAS-LHG  205



>ref|XP_004307822.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=203

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 92/161 (57%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP+LC  SL      I +  +L+A AA+N  L  ++S + M+ +++  
Sbjct  40    TEFIETSCGATTYPKLCLASLSSQASVIQRSPKLIACAALNVTLSSAKSTSAMMLRLSHG  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               + P  A  M+ C+E V+DS+ +++ S+ EM + +  GFE  IS ++  ++ AL D   
Sbjct  100   YGMKPREAAAMRDCVEMVSDSVDEIQRSISEMVNFRSAGFEMMISDVQTWVSAALTDEST  159

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G     LN   +  V+ +I  +A +T N L L+ ++A+
Sbjct  160   CSDGFAGNELNGNLKTVVRGRIVKIAQLTSNALALINRYAS  200


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 93/178 (52%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + NT+FI++SC  T +P +C ASLSS A  I  +PK +A  A+++T  + + T
Sbjct  30   AARDLAPKTNTEFIETSCGATTYPKLCLASLSSQASVIQRSPKLIACAALNVTLSSAKST  89

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M  ++   G+ P+E  ++  C ++   S+  +Q S+S  E +N  +      +I D+
Sbjct  90   SAMMLRLSHGYGMKPREAAAMRDCVEMVSDSVDEIQRSIS--EMVN-FRSAGFEMMISDV  146

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++  +C +     ++   +   V   + ++   +  ALAL + +A+ +HG
Sbjct  147  QTWVSAALTDESTCSDGFAGNELNGNLKTVVRGRIVKIAQLTSNALALINRYAS-VHG  203



>ref|XP_004234934.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=200

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 96/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH +++ +L+ ++S + M+ K++ +
Sbjct  37    TEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMMLKLSHS  96

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++ +L+ SL EMK L+   F+ K+S I+  ++ AL + D 
Sbjct  97    QGMTPREVGAMQDCVEELSDTVSELRKSLGEMKQLRGRDFDMKMSDIQTWVSAALTNEDT  156

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   + A++ +I  VAHMT N L L+    A
Sbjct  157   CTEGFAGKAMNGKVKTAIRGKIVEVAHMTSNALALINTLDA  197


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 96/172 (56%), Gaps = 4/172 (2%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
            G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  ++S++  T + T   M +
Sbjct  33   GHTNTEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMMLK  92

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            ++   G++P+E  ++  C +    ++  ++ SL  ++   +L+G D    + DI+ W+ +
Sbjct  93   LSHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMK---QLRGRDFDMKMSDIQTWVSA  149

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              +N ++C E    + +  KV   +   + E+   +  ALAL ++  A +HG
Sbjct  150  ALTNEDTCTEGFAGKAMNGKVKTAIRGKIVEVAHMTSNALALINTLDA-LHG  200



>ref|XP_006367807.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=198

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH +++ +++ ++S + M+ KVA +
Sbjct  35    TEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHESLSVSIETAQSTSTMMIKVAHS  94

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++ +L+ SL EMK L+   F+ K+S I+  ++ AL + D 
Sbjct  95    QGMTPREVGAMQDCVEELSDTVSELRKSLGEMKQLRGRDFDMKMSDIQTWVSAALTNEDT  154

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VAHMT N L L+    A
Sbjct  155   CTEGFAGKAMNGKVKTVVRGKIVEVAHMTSNALALINTLDA  195


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 102/190 (54%), Gaps = 6/190 (3%)
 Frame = -1

Query  824  LNGLTLMKKFAAAGFP--GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKN  651
            L    ++  F  A  P  G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  
Sbjct  13   LTVFLILLAFTTAARPDSGETNTEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQLLAHE  72

Query  650  AISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINEL  471
            ++S++  T + T   M ++A   G++P+E  ++  C +    ++  ++ SL  ++   +L
Sbjct  73   SLSVSIETAQSTSTMMIKVAHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMK---QL  129

Query  470  KGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALAL  291
            +G D    + DI+ W+ +  +N ++C E    + +  KV   V   + E+   +  ALAL
Sbjct  130  RGRDFDMKMSDIQTWVSAALTNEDTCTEGFAGKAMNGKVKTVVRGKIVEVAHMTSNALAL  189

Query  290  FSSFAAGMHG  261
             ++  A +HG
Sbjct  190  INTLDA-LHG  198



>ref|XP_009597893.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
 dbj|BAA95794.1| DC1.2 homologue [Nicotiana tabacum]
Length=205

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 92/161 (57%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S +  + ++A  
Sbjct  42    TEFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQSTSVTMVELAHG  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M  C+E+++D++ +L+ SL EMK L+   F+ K+S I+  ++ AL D D 
Sbjct  102   QGMTPREIGAMHDCVEELSDAVVELRKSLGEMKQLRGKDFDLKMSDIQTWVSAALTDEDT  161

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VAHMT N L L+   AA
Sbjct  162   CTEGFAGKVMNGKVKTVVRGRILDVAHMTSNALALINSLAA  202


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 100/178 (56%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA    G  NT+FI++SC  T +PN+C++SLSS A  I  +P+ LA  +++++  T + T
Sbjct  32   AARPVAGDTNTEFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQST  91

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M E+A   G++P+E  ++H C +    +++ ++ SL  ++   +L+G D    + DI
Sbjct  92   SVTMVELAHGQGMTPREIGAMHDCVEELSDAVVELRKSLGEMK---QLRGKDFDLKMSDI  148

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++ ++C E    + +  KV   V   + ++   +  ALAL +S AA  HG
Sbjct  149  QTWVSAALTDEDTCTEGFAGKVMNGKVKTVVRGRILDVAHMTSNALALINSLAA-FHG  205



>ref|XP_002264101.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
 ref|XP_002264204.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
 emb|CAN82970.1| hypothetical protein VITISV_006071 [Vitis vinifera]
 emb|CBI24574.3| unnamed protein product [Vitis vinifera]
 emb|CBI24575.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 91/163 (56%), Gaps = 3/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+TEFI+TSC  T YP LC  SL  H   I    +LLA  A+   L  +RS + +++K+ 
Sbjct  37    ASTEFIRTSCGTTTYPRLCYTSLSAHASVIQTSPKLLADTALAVTLSTARSTSSLMSKMV  96

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q+  L P     M  C+E+++DS+ +L+ ++ EM  +K   F   +  I+  ++TAL D 
Sbjct  97    QSHGLKPREVAAMHDCVEELSDSVDQLRRAMGEMTQIKGSNFGLMMDDIQTWVSTALTDE  156

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D C +G     +N   +  V+ +I  +AHMT N L L+  +A+
Sbjct  157   DTCTDGFAGNAMNGNLKTTVRARIVNMAHMTSNALGLINSYAS  199


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 95/188 (51%), Gaps = 15/188 (8%)
 Frame = -1

Query  815  LTLMKKFAAAGFPG--RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAIS  642
            LT     ++A  P   + +T+FI++SC  T +P +CY SLS+ A  I  +PK LA  A++
Sbjct  20   LTSYINLSSAARPAADKASTEFIRTSCGTTTYPRLCYTSLSAHASVIQTSPKLLADTALA  79

Query  641  LTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLET----IN  477
            +T  T   T   M ++    GL P+E  ++H C E+LS        DS+  L      + 
Sbjct  80   VTLSTARSTSSLMSKMVQSHGLKPREVAAMHDCVEELS--------DSVDQLRRAMGEMT  131

Query  476  ELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIAL  297
            ++KG +   ++DDI+ W+ +  ++ ++C +      +   +   V   +  M   +  AL
Sbjct  132  QIKGSNFGLMMDDIQTWVSTALTDEDTCTDGFAGNAMNGNLKTTVRARIVNMAHMTSNAL  191

Query  296  ALFSSFAA  273
             L +S+A+
Sbjct  192  GLINSYAS  199



>ref|XP_002322405.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06532.2| ripening-related family protein [Populus trichocarpa]
Length=197

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 90/159 (57%), Gaps = 3/159 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             +FI+TSC  T YP+LC  SL  H   I    ELLA+AA+N  L  ++S +  ++ ++Q+ 
Sbjct  35    DFIRTSCSTTIYPKLCYSSLSIHSSTIQTSPELLANAALNVTLSSAKSTSAKMSTLSQSH  94

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P   + M+ C+E++ D++++LK S+ EM H K   F   IS ++  ++ AL D   C
Sbjct  95    GLKPREVSAMEDCVEELTDAVYELKKSIDEMSHAKKSNFRMMISDVQTWVSAALTDESTC  154

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              +G     +N   + AV+ +I   A +T N L L+  +A
Sbjct  155   SDGFEGNAMNGNLKTAVRGKIVHTAQLTSNALALINNYA  193


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 88/173 (51%), Gaps = 3/173 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +AA    + + DFI++SC  T +P +CY+SLS  +  I  +P+ LA  A+++T  + + T
Sbjct  24   SAARVTPQSSIDFIRTSCSTTIYPKLCYSSLSIHSSTIQTSPELLANAALNVTLSSAKST  83

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
              +M  ++   GL P+E  ++  C +    ++  ++ S   ++ ++  K  +   +I D+
Sbjct  84   SAKMSTLSQSHGLKPREVSAMEDCVEELTDAVYELKKS---IDEMSHAKKSNFRMMISDV  140

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            + W+ +  ++  +C +  E   +   +   V   +      +  ALAL +++A
Sbjct  141  QTWVSAALTDESTCSDGFEGNAMNGNLKTAVRGKIVHTAQLTSNALALINNYA  193



>gb|AFK49039.1| unknown [Medicago truncatula]
 gb|KEH29367.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 92/164 (56%), Gaps = 3/164 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A T FI+ SC  T YP LC  SL KH   I  +  LL   A+N  L  ++S + M++ ++
Sbjct  32    ANTLFIKNSCSSTTYPRLCYTSLVKHADSIQTNHVLLTCTALNVTLASAKSTSAMISTLS  91

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             +++ L P  A  MK C+E+++DS+ +L+ S+ EM  L+   FE  +S ++  ++ AL D 
Sbjct  92    KSQGLKPREAAAMKDCVEELSDSVDELRRSIGEMSRLRTSNFELTMSDVQTWVSAALTDE  151

Query  908   DRCPNG---MNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
               C +G   +N  G  +  V+ +I  VA +T N L L+ K A +
Sbjct  152   STCTDGFQEVNAPGNVQTTVRGKIVQVAQLTSNALALINKLATS  195


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/166 (23%), Positives = 77/166 (46%), Gaps = 3/166 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + NT FIK+SC  T +P +CY SL   A  I  N   L   A+++T  + + T   +  +
Sbjct  31   QANTLFIKNSCSSTTYPRLCYTSLVKHADSIQTNHVLLTCTALNVTLASAKSTSAMISTL  90

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   GL P+E  ++  C +    S+  ++ S+  +   + L+  +    + D++ W+ + 
Sbjct  91   SKSQGLKPREAAAMKDCVEELSDSVDELRRSIGEM---SRLRTSNFELTMSDVQTWVSAA  147

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             ++  +C +  +       V   V   + ++   +  ALAL +  A
Sbjct  148  LTDESTCTDGFQEVNAPGNVQTTVRGKIVQVAQLTSNALALINKLA  193



>gb|KFK27963.1| hypothetical protein AALP_AA8G454300 [Arabis alpina]
Length=199

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++++C  T YP LC  SL  H   I    +L+AHAA+N  L  +++ + M+ +++ N 
Sbjct  37    EFVKSACTYTTYPRLCIASLSTHATLIQTSPKLMAHAALNITLASAKATSAMMVRLSSNV  96

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  IS I+  ++ AL D + C
Sbjct  97    QLKPREVSAMRDCVEELGDTVEELRKSIGEMGQLNSSNYEVYISDIQTWVSAALTDENTC  156

Query  899   PNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N  A   V+ +I  +AH+T N L L+  FA+
Sbjct  157   TDGFQGDEMNGKAKVFVRGRILFIAHLTSNALALINHFAS  196


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 86/167 (51%), Gaps = 4/167 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KS+C  T +P +C ASLS+ A  I  +PK +A  A+++T  + + T   M  ++  +
Sbjct  37   EFVKSACTYTTYPRLCIASLSTHATLIQTSPKLMAHAALNITLASAKATSAMMVRLSSNV  96

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
             L P+E  ++  C +    ++  ++ S+  +    +L   +    I DI+ W+ +  ++ 
Sbjct  97   QLKPREVSAMRDCVEELGDTVEELRKSIGEM---GQLNSSNYEVYISDIQTWVSAALTDE  153

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +C +  + +++  K    V   +  +   +  ALAL + FA+ +HG
Sbjct  154  NTCTDGFQGDEMNGKAKVFVRGRILFIAHLTSNALALINHFAS-IHG  199



>ref|XP_009779211.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=205

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 91/161 (57%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC+ T YP LC  SL      IG   +LLAH ++  +L+ ++S +  + K+A  
Sbjct  42    TEFIRTSCKSTTYPNLCFSSLSSRSTAIGVSPQLLAHESLTVSLETAQSTSATMLKLAHG  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + +       M  C+E+++D++ +L+ SL EMK L+   F+ K++ I+  ++ AL D D 
Sbjct  102   QGMTAREVGAMHDCVEELSDAVVELRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDT  161

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VAHMT N L L+   AA
Sbjct  162   CTEGFAGKVMNGKVKTVVRGRILEVAHMTSNALALINSLAA  202


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 96/169 (57%), Gaps = 3/169 (2%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
             G  NT+FI++SC  T +PN+C++SLSS +  I  +P+ LA  +++++  T + T   M 
Sbjct  37   AGDTNTEFIRTSCKSTTYPNLCFSSLSSRSTAIGVSPQLLAHESLTVSLETAQSTSATML  96

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
            ++A   G++ +E  ++H C +    +++ ++ SL  ++   +L+G D    ++DI+ W+ 
Sbjct  97   KLAHGQGMTAREVGAMHDCVEELSDAVVELRKSLGEMK---QLRGKDFDLKMNDIQTWVS  153

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +  ++ ++C E    + +  KV   V   + E+   +  ALAL +S AA
Sbjct  154  AALTDEDTCTEGFAGKVMNGKVKTVVRGRILEVAHMTSNALALINSLAA  202



>ref|XP_002264028.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CBI24573.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 92/163 (56%), Gaps = 3/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+TEFI+TSC  T YP+LC  SL  H   I    +LLA  A+   L  +RS + +++K+ 
Sbjct  36    ASTEFIRTSCGTTTYPKLCYTSLSAHASVIQTSPKLLADTALAVTLSTARSTSSLMSKMV  95

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q+  L P     M  C+E+++DS+ +L+ ++ EM  +K   F   ++ I+  ++ AL D 
Sbjct  96    QSHGLKPREVAAMHDCVEELSDSVDQLRKAMGEMTQIKGSNFGLMMNDIQTWVSAALTDE  155

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D C +G     +N   +  V+ ++  +AHMT N L L+  +A+
Sbjct  156   DTCTDGFAGNAMNGNLKTTVRARVVNMAHMTSNALGLINSYAS  198


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 93/182 (51%), Gaps = 15/182 (8%)
 Frame = -1

Query  797  FAAAGFPGRE--NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTT  624
             ++A  P  E  +T+FI++SC  T +P +CY SLS+ A  I  +PK LA  A+++T  T 
Sbjct  25   LSSAARPAAEKASTEFIRTSCGTTTYPKLCYTSLSAHASVIQTSPKLLADTALAVTLSTA  84

Query  623  EFTVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLET----INELKGID  459
              T   M ++    GL P+E  ++H C E+LS        DS+  L      + ++KG +
Sbjct  85   RSTSSLMSKMVQSHGLKPREVAAMHDCVEELS--------DSVDQLRKAMGEMTQIKGSN  136

Query  458  LHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
               +++DI+ W+ +  ++ ++C +      +   +   V   +  M   +  AL L +S+
Sbjct  137  FGLMMNDIQTWVSAALTDEDTCTDGFAGNAMNGNLKTTVRARVVNMAHMTSNALGLINSY  196

Query  278  AA  273
            A+
Sbjct  197  AS  198



>ref|XP_009112019.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
 emb|CDY16779.1| BnaA09g06030D [Brassica napus]
Length=199

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 96/165 (58%), Gaps = 4/165 (2%)
 Frame = -1

Query  1271  TAT-TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             TAT TEF+++SC  T YP LC  SL  H   I    +L+AHAA+N  L  +++ + M+ +
Sbjct  32    TATNTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKATSVMMVR  91

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             ++ +  L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  +S I+  ++ AL 
Sbjct  92    LSSSSQLKPREVSAMRVCVEELGDTLDELRKSIGEMGQLSGSSYEVYMSDIQTWVSAALT  151

Query  914   DYDRCPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAA  789
             D + C +G     +N      V+++I ++AH+T N L L+  FA+
Sbjct  152   DENTCTDGFGGDDMNGKVKIFVRERILVIAHLTSNALALINHFAS  196


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 87/169 (51%), Gaps = 4/169 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC  T +P +C ASLS+ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  35   NTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKATSVMMVRLSS  94

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
               L P+E  ++ VC +    ++  ++ S+  +    +L G      + DI+ W+ +  +
Sbjct  95   SSQLKPREVSAMRVCVEELGDTLDELRKSIGEM---GQLSGSSYEVYMSDIQTWVSAALT  151

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +  +C +    + +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  152  DENTCTDGFGGDDMNGKVKIFVRERILVIAHLTSNALALINHFAS-IHG  199



>ref|NP_001236761.1| uncharacterized protein LOC100305537 precursor [Glycine max]
 gb|ACU13268.1| unknown [Glycine max]
 gb|KHN11658.1| 21 kDa protein [Glycine soja]
Length=207

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 90/164 (55%), Gaps = 5/164 (3%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+T FI+TSC  T YP LC  SL KH   I  +  +L   A+N  L  ++S + M++ +A
Sbjct  40    ASTVFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGTALNVTLASAKSTSAMMSTLA  99

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             + + L P     MK C+E++ DS+ +L+ S+ EM  L    FE  +S +E  ++ AL D 
Sbjct  100   KRQGLKPREVAAMKDCVEELADSVDELRRSISEMAQLTPSNFEMTMSDVETWVSAALTDE  159

Query  908   DRCPNGMNDT----GLN-EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G  +T    G N +  V+ QI  VA +T N L L+ + A
Sbjct  160   STCTDGFQETAAAGGSNVKNTVRGQILQVAQLTSNALALINQLA  203


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 73/143 (51%), Gaps = 4/143 (3%)
 Frame = -1

Query  803  KKFAAAGFPGRE-NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRT  627
            KK + +  P +E +T FI++SC  T +P +CY+SL   A  I  N   L   A+++T  +
Sbjct  28   KKGSDSERPYQEASTVFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGTALNVTLAS  87

Query  626  TEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTI  447
             + T   M  +A + GL P+E  ++  C +    S+  ++ S+S +    +L   +    
Sbjct  88   AKSTSAMMSTLAKRQGLKPREVAAMKDCVEELADSVDELRRSISEMA---QLTPSNFEMT  144

Query  446  IDDIKEWLKSVKSNYESCIEELE  378
            + D++ W+ +  ++  +C +  +
Sbjct  145  MSDVETWVSAALTDESTCTDGFQ  167



>gb|KDP22409.1| hypothetical protein JCGZ_26240 [Jatropha curcas]
Length=203

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP+LC  SL  H   I    +LLA+AA+N  L  ++S + M++K++Q+
Sbjct  40    TEFIRTSCSTTTYPKLCYTSLSVHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKLSQS  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               + P     M+ C+E+++D++  L+ S+ EMK  K   F+  I+ ++  ++ AL D + 
Sbjct  100   HGMKPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKESDFKLMINDVQTWVSAALTDENT  159

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G     +N   +  V++ I  +AH+T N L L+  +A+
Sbjct  160   CSDGFAGKTMNGNTKTLVREMILNIAHLTSNALALINNYAS  200


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 90/171 (53%), Gaps = 4/171 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + NT+FI++SC  T +P +CY SLS  A  I  +PK LA  A+++T  + + T   M ++
Sbjct  37   KTNTEFIRTSCSTTTYPKLCYTSLSVHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKL  96

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   G+ P E  ++  C +    ++  ++ S+  ++T  E    D   +I+D++ W+ + 
Sbjct  97   SQSHGMKPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKE---SDFKLMINDVQTWVSAA  153

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +    + +       V  ++  +   +  ALAL +++A+ +HG
Sbjct  154  LTDENTCSDGFAGKTMNGNTKTLVREMILNIAHLTSNALALINNYAS-LHG  203



>ref|XP_007039937.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24438.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=202

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 96/166 (58%), Gaps = 3/166 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T+FI+TSC  T YP++C  +L  +  EI    +LLA  A++  L+ +RS +  + K
Sbjct  33    KEANTQFIKTSCSSTVYPDVCFTTLSSYASEIQASPKLLASTALSVTLNATRSASTTMIK  92

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
              ++++ + P  A  +  C+E++ DS+++L+ S+ EM       F  +++ IE  ++ AL 
Sbjct  93    RSKSQGMKPREAEALSDCMEELRDSVYELQRSVGEMDQPGGKNFGLQMNDIETWVSAALT  152

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
             D   C +G +   +N   + +V+ QI  VAHMT N L L+  +AAA
Sbjct  153   DEHTCMDGFSGKAMNGNVKNSVRSQIVKVAHMTSNALALVNSYAAA  198


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 89/168 (53%), Gaps = 3/168 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT FIK+SC  T +P++C+ +LSS A +I A+PK LA  A+S+T   T      M + + 
Sbjct  36   NTQFIKTSCSSTVYPDVCFTTLSSYASEIQASPKLLASTALSVTLNATRSASTTMIKRSK  95

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              G+ P+E  ++  C +    S+  +Q S+  ++   +  G +    ++DI+ W+ +  +
Sbjct  96   SQGMKPREAEALSDCMEELRDSVYELQRSVGEMD---QPGGKNFGLQMNDIETWVSAALT  152

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
            +  +C++    + +   V   V   + ++   +  ALAL +S+AA + 
Sbjct  153  DEHTCMDGFSGKAMNGNVKNSVRSQIVKVAHMTSNALALVNSYAAAVQ  200



>ref|XP_011010937.1| PREDICTED: 21 kDa protein-like isoform X2 [Populus euphratica]
Length=190

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 97/171 (57%), Gaps = 5/171 (3%)
 Frame = -1

Query  1289  GIAGKKT--ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRS  1116
              +A + T  ++ EFI+TSC  T YP+LC  SL  H   I    +LLA+AA+N  L  ++S
Sbjct  8     SLAARATPQSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKS  67

Query  1115  LTGMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIEN  936
              +  ++ ++Q   L P   + M+ C+E+++D++++LK S+ EM H K   F   I+ ++ 
Sbjct  68    TSAKMSTLSQRHGLKPREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQT  127

Query  935   LITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              ++ AL D   C +G     +N   + AV+ +I  +A +T N L L+  ++
Sbjct  128   WVSAALTDESTCSDGFERNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYS  178


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/174 (24%), Positives = 91/174 (52%), Gaps = 4/174 (2%)
 Frame = -1

Query  797  FAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
             AA   P + + +FI++SC  T +P +CYASLS  +  I  +PK LA  A+++T  + + 
Sbjct  9    LAARATP-QSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKS  67

Query  617  TVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
            T  +M  ++ + GL P+E  ++  C +    ++  +++S   ++ ++  K  +   +I+D
Sbjct  68   TSAKMSTLSQRHGLKPREVSAMEDCVEELSDAVYELKNS---IDEMSHAKKSNFRLMIND  124

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            ++ W+ +  ++  +C +  E   +   +   V   +  +   +  ALAL  +++
Sbjct  125  VQTWVSAALTDESTCSDGFERNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYS  178



>ref|XP_010550579.1| PREDICTED: 21 kDa protein [Tarenaya hassleriana]
Length=197

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 98/161 (61%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI++SC  T YP LC  SL  H   I    +L+AHAA+N +L  ++S + M+ +++++
Sbjct  34    TEFIRSSCSVTTYPRLCFTSLSSHATFIQTSPKLMAHAALNVSLSSAKSTSAMMTRLSRS  93

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               + P  A+ ++ C+E++++++ +L+ S+ EM  L+   +E  +S IE  ++ AL D + 
Sbjct  94    HGIKPLEASAVRDCVEELSNTVDELRSSVGEMDRLRGSNYEVYMSDIETWVSAALTDENT  153

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G   + ++   +  V+++I  +A +T N L L+  FA+
Sbjct  154   CTDGFEGSAMDGKVKVLVRERILAIARLTSNALALINHFAS  194


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 95/180 (53%), Gaps = 7/180 (4%)
 Frame = -1

Query  797  FAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            F    +P + NT+FI+SSC  T +P +C+ SLSS A  I  +PK +A  A++++  + + 
Sbjct  24   FVRTTYP-QTNTEFIRSSCSVTTYPRLCFTSLSSHATFIQTSPKLMAHAALNVSLSSAKS  82

Query  617  TVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
            T   M  ++   G+ P E  ++  C E+LS+     + +  S++  ++ L+G +    + 
Sbjct  83   TSAMMTRLSRSHGIKPLEASAVRDCVEELSNT----VDELRSSVGEMDRLRGSNYEVYMS  138

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            DI+ W+ +  ++  +C +  E   +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  139  DIETWVSAALTDENTCTDGFEGSAMDGKVKVLVRERILAIARLTSNALALINHFAS-LHG  197



>gb|AFK47771.1| unknown [Lotus japonicus]
Length=205

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 93/167 (56%), Gaps = 6/167 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+T FI+TSC  T YP LC  SL KH   I  D   L   A+N  L  ++S + M++ +A
Sbjct  37    ASTVFIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMA  96

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             + + + P     M+ C+E ++DS+ +L+ S+ E+ +LK   FE  +S ++  ++ AL D 
Sbjct  97    KKQGMKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALTDE  156

Query  908   DRCPNGM---NDTGLNE---PAVKDQIAMVAHMTLNGLTLMKKFAAA  786
               C +G    ++  +NE    AV+ ++   A +T N L L+ + A++
Sbjct  157   STCTDGFQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASS  203


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/172 (24%), Positives = 86/172 (50%), Gaps = 8/172 (5%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T FIK+SC  T +P +C+ASL   A  I  +  +L   A+++T    + T   +  +
Sbjct  36   QASTVFIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTM  95

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            A K G+ P+E  ++  C ++   S+  ++ S++ L     LK  +    + D++ W+ + 
Sbjct  96   AKKQGMKPREVAAMQDCVEVLSDSVDELRRSIAEL---GNLKTSNFEMTMSDVQTWVSAA  152

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMR----EMEPFSEIALALFSSFAAG  270
             ++  +C +  + +Q ++ V E+    +R    +    +  ALAL +  A+ 
Sbjct  153  LTDESTCTDGFQ-QQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASS  203



>ref|XP_011010936.1| PREDICTED: 21 kDa protein-like isoform X1 [Populus euphratica]
Length=197

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 97/171 (57%), Gaps = 5/171 (3%)
 Frame = -1

Query  1289  GIAGKKT--ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRS  1116
              +A + T  ++ EFI+TSC  T YP+LC  SL  H   I    +LLA+AA+N  L  ++S
Sbjct  23    SLAARATPQSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKS  82

Query  1115  LTGMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIEN  936
              +  ++ ++Q   L P   + M+ C+E+++D++++LK S+ EM H K   F   I+ ++ 
Sbjct  83    TSAKMSTLSQRHGLKPREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQT  142

Query  935   LITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              ++ AL D   C +G     +N   + AV+ +I  +A +T N L L+  ++
Sbjct  143   WVSAALTDESTCSDGFERNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYS  193


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 96/180 (53%), Gaps = 7/180 (4%)
 Frame = -1

Query  797  FAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
             AA   P + + +FI++SC  T +P +CYASLS  +  I  +PK LA  A+++T  + + 
Sbjct  24   LAARATP-QSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKS  82

Query  617  TVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
            T  +M  ++ + GL P+E  ++  C E+LS  ++  +++S   ++ ++  K  +   +I+
Sbjct  83   TSAKMSTLSQRHGLKPREVSAMEDCVEELS-DAVYELKNS---IDEMSHAKKSNFRLMIN  138

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            D++ W+ +  ++  +C +  E   +   +   V   +  +   +  ALAL  ++ +  HG
Sbjct  139  DVQTWVSAALTDESTCSDGFERNAMNGNLKTAVRGRIVHLAQLTSNALALIDNY-SQRHG  197



>ref|XP_007039951.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24452.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=204

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 88/160 (55%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             E+I++SC  T YP LC  SL  +  +I     LL H A+N  L  S+S + ++ K+++  
Sbjct  39    EYIKSSCSTTTYPRLCYRSLSIYASKINTSPRLLVHTALNVTLKASKSTSRLMIKISRIH  98

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P  A  M  C+E + DS+ +L+ S+ E+ H++   F   +S I+  ++ AL D D C
Sbjct  99    GLRPRVAAAMADCIEVMGDSVDELQQSIGELGHIRSSNFSLTMSDIQTWVSAALTDEDTC  158

Query  899   PNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N  A   V+ +I  +AH+T N L L+  +A+
Sbjct  159   MDGFAGKAMNGYAKTMVRKRIVKIAHLTSNALALINNYAS  198


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 89/170 (52%), Gaps = 3/170 (2%)
 Frame = -1

Query  782  FPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            F  + N ++IKSSC  T +P +CY SLS  A  I  +P+ L   A+++T + ++ T R M
Sbjct  32   FHSQRNIEYIKSSCSTTTYPRLCYRSLSIYASKINTSPRLLVHTALNVTLKASKSTSRLM  91

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
             +I+   GL P+   ++  C ++   S+  +Q S+  L     ++  +    + DI+ W+
Sbjct  92   IKISRIHGLRPRVAAAMADCIEVMGDSVDELQQSIGEL---GHIRSSNFSLTMSDIQTWV  148

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  ++ ++C++    + +       V + + ++   +  ALAL +++A+
Sbjct  149  SAALTDEDTCMDGFAGKAMNGYAKTMVRKRIVKIAHLTSNALALINNYAS  198



>gb|AFK37116.1| unknown [Lotus japonicus]
Length=206

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 93/168 (55%), Gaps = 7/168 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+T FI+TSC  T YP LC  SL KH   I  D   L   A+N  L  ++S + M++ +A
Sbjct  37    ASTVFIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMA  96

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             + + + P     M+ C+E ++DS+ +L+ S+ E+ +LK   FE  +S ++  ++ AL D 
Sbjct  97    KKQGMKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALTDE  156

Query  908   DRCPNGM----NDTGLNE---PAVKDQIAMVAHMTLNGLTLMKKFAAA  786
               C +G     ++  +NE    AV+ ++   A +T N L L+ + A++
Sbjct  157   STCTDGFRQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASS  204


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/172 (24%), Positives = 85/172 (49%), Gaps = 7/172 (4%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T FIK+SC  T +P +C+ASL   A  I  +  +L   A+++T    + T   +  +
Sbjct  36   QASTVFIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTM  95

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            A K G+ P+E  ++  C ++   S+  ++ S++ L     LK  +    + D++ W+ + 
Sbjct  96   AKKQGMKPREVAAMQDCVEVLSDSVDELRRSIAEL---GNLKTSNFEMTMSDVQTWVSAA  152

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMR----EMEPFSEIALALFSSFAAG  270
             ++  +C +    +Q ++ V E+    +R    +    +  ALAL +  A+ 
Sbjct  153  LTDESTCTDGFRQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASS  204



>ref|XP_010259038.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=208

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 93/159 (58%), Gaps = 3/159 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEFI+TSC+ T YP+LC  SL  +   I  D +LLA AA+N +L  +RS + M+ ++
Sbjct  42    TTNTEFIKTSCDTTMYPKLCISSLSGYASAIQTDPKLLADAALNVSLTNARSTSTMMTEL  101

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             +++  + P  A  M+ C+E V DS+ +L+ S+ EM HL  P    +IS I+  ++ AL +
Sbjct  102   SRSHGMKPREAAAMQDCVETVGDSVDELQRSMAEMGHLGGPNLAFQISNIQTWVSAALTN  161

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLM  804
              D C +G     ++   +  V+ +I  +A +T N L+ +
Sbjct  162   EDTCMDGFAGKAVDGSIKTTVRARILNLAQLTSNALSFI  200


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 84/167 (50%), Gaps = 3/167 (2%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
            PG  NT+FIK+SCD T +P +C +SLS  A  I  +PK LA  A++++      T   M 
Sbjct  40   PGTTNTEFIKTSCDTTMYPKLCISSLSGYASAIQTDPKLLADAALNVSLTNARSTSTMMT  99

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
            E++   G+ P+E  ++  C +    S+  +Q S++ +     L G +L   I +I+ W+ 
Sbjct  100  ELSRSHGMKPREAAAMQDCVETVGDSVDELQRSMAEM---GHLGGPNLAFQISNIQTWVS  156

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
            +  +N ++C++    + +   +   V   +  +   +  AL+  +  
Sbjct  157  AALTNEDTCMDGFAGKAVDGSIKTTVRARILNLAQLTSNALSFINGL  203



>ref|XP_004234935.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=201

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+FI+TSC+ T YP LC  SL      IG   +LLAH +++ +L+ ++S + M+ K++ +
Sbjct  38    TDFIRTSCKSTTYPTLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMMLKLSHS  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + + P     M+ C+E+++D++  +K SL EMK LK   F+ K++ I+  ++ AL D D 
Sbjct  98    QGMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELKGKDFDLKMNDIQTWVSAALTDEDT  157

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G     +N   +  V+ +I  VA +T N L L+ + AA
Sbjct  158   CTEGFAGKVMNGKVKTVVRGKILEVAQLTSNALALINRLAA  198


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 96/172 (56%), Gaps = 4/172 (2%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
            G  NTDFI++SC  T +P +C++SLSS +  I  +P+ LA  ++S++  T + T   M +
Sbjct  34   GETNTDFIRTSCKSTTYPTLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMMLK  93

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            ++   G++P+E  ++  C +    ++  ++ SL  ++   ELKG D    ++DI+ W+ +
Sbjct  94   LSHSQGMTPREVGAMRDCVEELSDAVSGIKKSLGEMK---ELKGKDFDLKMNDIQTWVSA  150

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++ ++C E    + +  KV   V   + E+   +  ALAL +  AA +HG
Sbjct  151  ALTDEDTCTEGFAGKVMNGKVKTVVRGKILEVAQLTSNALALINRLAA-IHG  201



>emb|CDX87244.1| BnaC09g05590D [Brassica napus]
Length=199

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 97/165 (59%), Gaps = 4/165 (2%)
 Frame = -1

Query  1271  TAT-TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             TAT TEF+++SC  T YP LC  SL  H   I    +L+AHAA+N  L  +++ + M+ +
Sbjct  32    TATNTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKATSVMMVR  91

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             ++ +  L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  +S I+  ++ AL 
Sbjct  92    LSSSSQLKPREVSAMRDCVEELGDTLDELRKSIGEMGQLIGSSYEVYMSDIQTWVSAALT  151

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D + C +G     +N   +  V+++I ++AH+T N L L+  FA+
Sbjct  152   DENTCTDGFEGDDMNGKVKVFVRERILVIAHLTSNALALINHFAS  196


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 87/169 (51%), Gaps = 4/169 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC  T +P +C ASLS+ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  35   NTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKATSVMMVRLSS  94

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
               L P+E  ++  C +    ++  ++ S+  +    +L G      + DI+ W+ +  +
Sbjct  95   SSQLKPREVSAMRDCVEELGDTLDELRKSIGEM---GQLIGSSYEVYMSDIQTWVSAALT  151

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +  +C +  E + +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  152  DENTCTDGFEGDDMNGKVKVFVRERILVIAHLTSNALALINHFAS-IHG  199



>ref|XP_008234384.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=203

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP+LC  SL  H   I    +L+A AA+N  L  ++S +  + K++Q+
Sbjct  40    TEFIKTSCRATTYPKLCRTSLSSHASTIQTSPKLMAGAALNVTLSSAKSTSATMLKLSQS  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P+    M+ CLE+++DS+ +L+ S+ EM + K   F+  IS ++  ++ AL D + 
Sbjct  100   HGLKPKEVGAMRDCLEELSDSVDELQSSIAEMGNFKSYDFQLMISDVQTWVSAALTDENT  159

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G    G+N   + AV+ +I  +A +T N L L+ ++A+
Sbjct  160   CSEGFGGNGMNGNLKTAVRGRIVNIAQLTSNALALINRYAS  200


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 92/179 (51%), Gaps = 6/179 (3%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + NT+FIK+SC  T +P +C  SLSS A  I  +PK +A  A+++T  + + T
Sbjct  30   AARDLAPKTNTEFIKTSCRATTYPKLCRTSLSSHASTIQTSPKLMAGAALNVTLSSAKST  89

Query  614  VRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
               M +++   GL PKE  ++  C E+LS  S+  +Q S++ +      K  D   +I D
Sbjct  90   SATMLKLSQSHGLKPKEVGAMRDCLEELS-DSVDELQSSIAEM---GNFKSYDFQLMISD  145

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            ++ W+ +  ++  +C E      +   +   V   +  +   +  ALAL + +A+ +HG
Sbjct  146  VQTWVSAALTDENTCSEGFGGNGMNGNLKTAVRGRIVNIAQLTSNALALINRYAS-VHG  203



>ref|XP_008357027.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=199

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 92/160 (58%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL  H   I    +L+A AA+N  L  ++S + M++K++ + 
Sbjct  37    EFMKTSCSATTYPKLCLASLSSHAGAIQTSPKLMACAALNVTLASAKSTSTMMSKLSHSH  96

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P+    M+ C+E+++DS+++LK S+ EM   K   F+  IS ++   + AL D   C
Sbjct  97    GMEPKEVGAMRDCVEELSDSVYELKRSIAEMGRFKSSDFQLMISDVQTWASAALTDETTC  156

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G  + G+N   +  V  +I  +A +T N L L+  +A+
Sbjct  157   SDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALINIYAS  196


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 86/167 (51%), Gaps = 3/167 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + N +F+K+SC  T +P +C ASLSS A  I  +PK +A  A+++T  + + T   M ++
Sbjct  33   KTNNEFMKTSCSATTYPKLCLASLSSHAGAIQTSPKLMACAALNVTLASAKSTSTMMSKL  92

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   G+ PKE  ++  C +    S+  ++ S++ +      K  D   +I D++ W  + 
Sbjct  93   SHSHGMEPKEVGAMRDCVEELSDSVYELKRSIAEM---GRFKSSDFQLMISDVQTWASAA  149

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++  +C +  E   +  K+   V   + ++   +  ALAL + +A+
Sbjct  150  LTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALINIYAS  196



>ref|XP_009372895.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=199

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 93/160 (58%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL  H   I    +L+A AA+N  L  ++S + M++K++ + 
Sbjct  37    EFMKTSCSATTYPKLCLTSLSSHAGAIQTSPKLMACAALNVTLASAKSTSTMMSKLSHSH  96

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P+    M+ C+E+++DS+++LK S+  M   K   F+  IS ++  ++ AL D   C
Sbjct  97    GMEPKEVEAMRDCVEELSDSVYELKRSIAGMGSFKNSDFQLMISDVQTWVSAALTDETTC  156

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G  + G+N   +  V  +I  +A +T N L L+ ++A+
Sbjct  157   SDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALIDRYAS  196


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + N +F+K+SC  T +P +C  SLSS A  I  +PK +A  A+++T  + + T   M ++
Sbjct  33   KTNNEFMKTSCSATTYPKLCLTSLSSHAGAIQTSPKLMACAALNVTLASAKSTSTMMSKL  92

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   G+ PKE  ++  C +    S+  ++ S++ +      K  D   +I D++ W+ + 
Sbjct  93   SHSHGMEPKEVEAMRDCVEELSDSVYELKRSIAGM---GSFKNSDFQLMISDVQTWVSAA  149

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +  E   +  K+   V   + ++   +  ALAL   +A+ +HG
Sbjct  150  LTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALIDRYAS-VHG  199



>ref|XP_007218426.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
 gb|EMJ19625.1| hypothetical protein PRUPE_ppa011607mg [Prunus persica]
Length=203

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 96/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP+LC  SL  H   I    +L+A AA+N  L  ++S + ++ K++Q+
Sbjct  40    TEFIKTSCSATTYPKLCLTSLSSHASTIQTSPKLMAGAALNVTLSSAKSTSAVMLKLSQS  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P+    M+ CLE+++DS+ +L+ S+ EM + K   F+  IS ++  ++ AL D + 
Sbjct  100   HGLKPKEVGAMRDCLEELSDSVDELQSSIAEMGNFKSYDFQLMISDVQTWVSAALTDENT  159

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C  G    G+N   + AV+ +I  +A +T N L L+ ++A+
Sbjct  160   CSEGFGGNGMNGNLKTAVRGRIVNIAQLTSNALALINRYAS  200


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 92/179 (51%), Gaps = 6/179 (3%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + NT+FIK+SC  T +P +C  SLSS A  I  +PK +A  A+++T  + + T
Sbjct  30   AARDLAPKTNTEFIKTSCSATTYPKLCLTSLSSHASTIQTSPKLMAGAALNVTLSSAKST  89

Query  614  VRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
               M +++   GL PKE  ++  C E+LS  S+  +Q S++ +      K  D   +I D
Sbjct  90   SAVMLKLSQSHGLKPKEVGAMRDCLEELS-DSVDELQSSIAEM---GNFKSYDFQLMISD  145

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            ++ W+ +  ++  +C E      +   +   V   +  +   +  ALAL + +A+ +HG
Sbjct  146  VQTWVSAALTDENTCSEGFGGNGMNGNLKTAVRGRIVNIAQLTSNALALINRYAS-VHG  203



>ref|XP_007131336.1| hypothetical protein PHAVU_011G005300g [Phaseolus vulgaris]
 gb|ESW03330.1| hypothetical protein PHAVU_011G005300g [Phaseolus vulgaris]
Length=203

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 86/163 (53%), Gaps = 4/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+  FI+TSC  T YP LC  SL KH   I  +  +L   A+N  L  ++S   M+  + 
Sbjct  37    ASIVFIRTSCSSTTYPTLCYSSLVKHADLIQTNRMVLTGTALNVTLASAKSTAAMMLALG  96

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             + + L P     MK C+E++ DS+ +L+ S+ EM HL+   FE  +S ++  ++ AL D 
Sbjct  97    KRQGLKPREVAAMKDCVEELRDSVDELRRSIDEMSHLRTSNFEMTMSDVQTWVSAALTDE  156

Query  908   DRCPNGMNDTGLN----EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G  +T       +  V+ ++  +A +T N L L+ + A
Sbjct  157   STCSDGFQETATGATNIKSTVRGEVVQIAQLTSNALALINQLA  199


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 81/171 (47%), Gaps = 13/171 (8%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FI++SC  T +P +CY+SL   A  I  N   L   A+++T  + + T   M  +  + G
Sbjct  41   FIRTSCSSTTYPTLCYSSLVKHADLIQTNRMVLTGTALNVTLASAKSTAAMMLALGKRQG  100

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            L P+E  ++  C +    S+  ++ S   ++ ++ L+  +    + D++ W+ +  ++  
Sbjct  101  LKPREVAAMKDCVEELRDSVDELRRS---IDEMSHLRTSNFEMTMSDVQTWVSAALTDES  157

Query  398  SCIEELE-----TEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +C +  +        IK  V  EV ++ +     +  ALAL +   A  HG
Sbjct  158  TCSDGFQETATGATNIKSTVRGEVVQIAQ----LTSNALALINQL-ANSHG  203



>ref|XP_007039938.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24439.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=200

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 94/160 (59%), Gaps = 3/160 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP+LC  +   +  EI    ++LA  +++  L+ + S +  + +++++
Sbjct  37    TEFIKTSCGATSYPDLCFTTFSSYASEIQASPKILASKSLSLTLNTTLSASKFLTELSKS  96

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P+ A  ++ C+E+++DS+ +LK S+ E+  ++   F  ++S IE  ++ AL D D 
Sbjct  97    QDLEPQEAAALQDCVEEISDSVDELKRSIGEIDEIEGKSFAFRMSDIETWVSAALTDEDT  156

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             C +G ++   +   +  V+ QI  VAHMT   L  + ++A
Sbjct  157   CTDGFSENATDGDVKATVRSQIEKVAHMTSIALAFVNRYA  196


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 86/164 (52%), Gaps = 3/164 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P++C+ + SS A +I A+PK LA  ++SLT  TT    + + E++ 
Sbjct  36   DTEFIKTSCGATSYPDLCFTTFSSYASEIQASPKILASKSLSLTLNTTLSASKFLTELSK  95

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
               L P+E  ++  C +    S+  ++ S+     I+E++G      + DI+ W+ +  +
Sbjct  96   SQDLEPQEAAALQDCVEEISDSVDELKRSIGE---IDEIEGKSFAFRMSDIETWVSAALT  152

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            + ++C +          V   V   + ++   + IALA  + +A
Sbjct  153  DEDTCTDGFSENATDGDVKATVRSQIEKVAHMTSIALAFVNRYA  196



>gb|AFK35257.1| unknown [Medicago truncatula]
 gb|KEH29362.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 87/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI+ SC  T YP LC  SL KH   I  +  LL   A+N  L  ++S + +++ +++ 
Sbjct  34    TLFIRNSCSSTTYPRLCYTSLVKHADFIQTNQMLLTGTALNVTLASAKSTSALMSTLSKG  93

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P  A  MK C+E ++DS+ +L+ S+ EM  L+   FE  +S ++  ++ AL D + 
Sbjct  94    QQLNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFEITMSDVQTWVSAALTDQNT  153

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAAA  786
             C +G  +    E     V+  I  VA +T N L L+ K A +
Sbjct  154   CTDGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLATS  195


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 82/171 (48%), Gaps = 4/171 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + NT FI++SC  T +P +CY SL   A  I  N   L   A+++T  + + T   M  +
Sbjct  31   QSNTLFIRNSCSSTTYPRLCYTSLVKHADFIQTNQMLLTGTALNVTLASAKSTSALMSTL  90

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +    L+P+E  ++  C ++   S+  ++ S   ++ ++ L+  +    + D++ W+ + 
Sbjct  91   SKGQQLNPREAAAMKDCVEVLSDSVDELRRS---IDEMSRLRTSNFEITMSDVQTWVSAA  147

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +  +     E V   V   + ++   +  ALAL +  A   HG
Sbjct  148  LTDQNTCTDGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLATS-HG  197



>ref|XP_009618650.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=191

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 96/172 (56%), Gaps = 6/172 (3%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             ++G     T FI+ SC+ T YP+LC  SL  + + I    E L   A++ +LD ++S  G
Sbjct  18    LSGAADTATSFIKNSCKPTTYPDLCVASLSGYAQTIKNSQEQLIKTALSVSLDRAQSTKG  77

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMK---HLKCPGFEGKISYIEN  936
              V+K+ + K L P     +K C+E+ +DS+ +L  S+ E+K   H +   F   IS +E 
Sbjct  78    FVSKLLKFKGLKPREYEAIKDCVEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVET  137

Query  935   LITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              ++ A+ D + C +G     LN   + +++++IA +A +T N L L+ ++AA
Sbjct  138   WVSAAITDENTCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYAA  189


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 84/164 (51%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIK+SC  T +P++C ASLS  A  I  + ++L K A+S++    + T   + ++   
Sbjct  26   TSFIKNSCKPTTYPDLCVASLSGYAQTIKNSQEQLIKTALSVSLDRAQSTKGFVSKLLKF  85

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  +I  C + +  S+  +  S+S L+ ++  +G D    I +++ W+ +  ++
Sbjct  86   KGLKPREYEAIKDCVEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVETWVSAAITD  145

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C +      +  ++   +   +  +   +  ALAL + +AA
Sbjct  146  ENTCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYAA  189



>ref|XP_009374503.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 90/160 (56%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL  H   I    +L+A  A+   L  ++S + +++K++Q  
Sbjct  40    EFVKTSCSATTYPKLCLTSLSSHASAIQTSPKLMASTALTVTLASAKSTSTVMSKLSQRH  99

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E+++DS+  ++ S+ EM + +   F+  IS ++  ++ AL D   C
Sbjct  100   GMKPREVGAMRDCIEELSDSVDVIQRSIAEMGNFRSSDFQLMISDVQTWVSAALTDETTC  159

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G    G+N   +  V+ ++  +A +T N L L+ ++A+
Sbjct  160   SDGFGGNGMNSNLKTVVRGRVVNIAQLTSNALALINRYAS  199


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 90/172 (52%), Gaps = 6/172 (3%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + N +F+K+SC  T +P +C  SLSS A  I  +PK +A  A+++T  + + T   M ++
Sbjct  36   KTNNEFVKTSCSATTYPKLCLTSLSSHASAIQTSPKLMASTALTVTLASAKSTSTVMSKL  95

Query  593  AGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            + + G+ P+E  ++  C E+LS  S+  +Q S++ +      +  D   +I D++ W+ +
Sbjct  96   SQRHGMKPREVGAMRDCIEELS-DSVDVIQRSIAEM---GNFRSSDFQLMISDVQTWVSA  151

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++  +C +      +   +   V   +  +   +  ALAL + +A+ +HG
Sbjct  152  ALTDETTCSDGFGGNGMNSNLKTVVRGRVVNIAQLTSNALALINRYAS-VHG  202



>ref|XP_002510935.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51537.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=201

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 95/165 (58%), Gaps = 3/165 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             +T +TEFI+TSC  T YP LC  SL  H  +I     LLA+AA+N  L  +RS + M+ K
Sbjct  34    QTTSTEFIRTSCSTTTYPRLCYSSLKIHASKIQTSPMLLANAALNVTLASTRSTSTMMQK  93

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             ++++  + P   + M+ C++++ DS+ +L+ S+ E+   +   F   ++ ++  ++ AL 
Sbjct  94    LSKSHGMKPREVSAMQDCMDELTDSVDELRKSIDELGKAQGSKFGLMMNDVQTWVSAALT  153

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D   C +G   + +N   +  V+ Q   +AH+T N L+L+  +A+
Sbjct  154   DESTCSDGFAGSTMNGELKTLVRQQTVKIAHLTSNALSLVNSYAS  198


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 92/173 (53%), Gaps = 12/173 (7%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FI++SC  T +P +CY+SL   A  I  +P  LA  A+++T  +T  T   M +++ 
Sbjct  37   STEFIRTSCSTTTYPRLCYSSLKIHASKIQTSPMLLANAALNVTLASTRSTSTMMQKLSK  96

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNL-ETINEL---KGIDLHTIIDDIKEWLK  420
              G+ P+E  ++  C D        + DS+  L ++I+EL   +G     +++D++ W+ 
Sbjct  97   SHGMKPREVSAMQDCMD-------ELTDSVDELRKSIDELGKAQGSKFGLMMNDVQTWVS  149

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +  ++  +C +      +  ++   V +   ++   +  AL+L +S+A+ +HG
Sbjct  150  AALTDESTCSDGFAGSTMNGELKTLVRQQTVKIAHLTSNALSLVNSYAS-VHG  201



>ref|XP_009370481.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=199

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 93/160 (58%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL      I    +L+A AA+N  L  ++S + M++K++ + 
Sbjct  37    EFMKTSCSATTYPKLCLASLSSDAGAIQTSPKLMACAALNVTLASAKSTSTMMSKLSHSH  96

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P+    M+ C+E+++DS+++LK S+ EM   +   F+  IS ++  ++ AL D   C
Sbjct  97    GMEPKEVEAMRDCVEELSDSVYELKRSIAEMGSFENSDFQLMISDVQTWVSAALTDETTC  156

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G  + G+N   +  V  +I  +A +T N L L+ ++A+
Sbjct  157   SDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALINRYAS  196


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 90/171 (53%), Gaps = 4/171 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + N +F+K+SC  T +P +C ASLSS A  I  +PK +A  A+++T  + + T   M ++
Sbjct  33   KTNNEFMKTSCSATTYPKLCLASLSSDAGAIQTSPKLMACAALNVTLASAKSTSTMMSKL  92

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   G+ PKE  ++  C +    S+  ++ S++ +      +  D   +I D++ W+ + 
Sbjct  93   SHSHGMEPKEVEAMRDCVEELSDSVYELKRSIAEM---GSFENSDFQLMISDVQTWVSAA  149

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +  E   +  K+   V   + ++   +  ALAL + +A+ +HG
Sbjct  150  LTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALALINRYAS-VHG  199



>ref|XP_004234936.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=209

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 97/167 (58%), Gaps = 4/167 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K  T++FI+TSC  T YP+LC  +L  +   I      LA++A+  +L  ++S T  +AK
Sbjct  43    KLNTSDFIKTSCGTTLYPKLCIETLSPYSNSIQTSPMELANSALTVSLKGAKSTTNKIAK  102

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +++ +SL P  A  +  C+E + DS+ +L+ SL+EMK+L  P FE K+  +   ++ AL 
Sbjct  103   MSKEESLGPAEAHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALT  162

Query  914   DYDRCPNGMND-TGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
             D D C +G  D + +N   +  +++ I  VA +T N L L K  +++
Sbjct  163   DEDTCMDGFQDNSAMNSKVKATIRNYIVNVAQLTSNALALTKNLSSS  209


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/159 (23%), Positives = 81/159 (51%), Gaps = 4/159 (3%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            +DFIK+SC  T +P +C  +LS  +  I  +P  LA +A++++ +  + T  ++ +++ +
Sbjct  47   SDFIKTSCGTTLYPKLCIETLSPYSNSIQTSPMELANSALTVSLKGAKSTTNKIAKMSKE  106

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L P E  ++  C +    S+  +Q SL  ++ +N   G D    + ++  W+ +  ++
Sbjct  107  ESLGPAEAHALTDCVENMEDSVDELQKSLLEMKNLN---GPDFEEKMGNVMTWVSAALTD  163

Query  404  YESCIEELE-TEQIKEKVTEEVTRLMREMEPFSEIALAL  291
             ++C++  +    +  KV   +   +  +   +  ALAL
Sbjct  164  EDTCMDGFQDNSAMNSKVKATIRNYIVNVAQLTSNALAL  202



>gb|KHN32444.1| 21 kDa protein [Glycine soja]
Length=202

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 88/164 (54%), Gaps = 3/164 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T FI+TSC  T YP LC  SL KH   I  +  +L  AA+N  L   +S + M++ 
Sbjct  37    KEANTLFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMMST  96

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +A+ + L P     M+ C+EQ++D++ +L+ S+ EM  L+   FE  +S ++  ++ AL 
Sbjct  97    LAKKQGLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALT  156

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             D   C +G  +       +  V+  +  VA +T N L L+ K A
Sbjct  157   DETTCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  200


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 86/169 (51%), Gaps = 4/169 (2%)
 Frame = -1

Query  779  PGRE-NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            P +E NT FI++SC  T +P +CY+SL   A  I  N   L   A+++T  + + T   M
Sbjct  35   PYKEANTLFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMM  94

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
              +A K GL P+E  ++  C +    ++  ++ S++ +   ++L+  +   I+ D++ W+
Sbjct  95   STLAKKQGLKPREVAAMQDCVEQLSDTVDELRRSIAEM---SDLRASNFEMIMSDVQTWV  151

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             +  ++  +C +  +       +   V RL+ ++   +  ALAL +  A
Sbjct  152  SAALTDETTCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  200



>ref|XP_009796710.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=191

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 95/172 (55%), Gaps = 6/172 (3%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             ++G     T FI+ SC+ T YP+LC  SL  +   I    E L   A++ +LD ++S  G
Sbjct  18    LSGAADTATSFIKNSCKPTTYPDLCVASLSGYAPTIKNSQEQLIKTALSVSLDRAQSTKG  77

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMK---HLKCPGFEGKISYIEN  936
              V+K+ + K L P     +K C+E+ +DS+ +L  S+ E+K   H +   F   IS +E 
Sbjct  78    FVSKLLKFKGLKPREYAAIKDCIEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVET  137

Query  935   LITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              ++ A+ D + C +G     LN   + +++++IA +A +T N L L+ ++AA
Sbjct  138   WVSAAITDENTCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYAA  189


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 84/164 (51%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIK+SC  T +P++C ASLS  A  I  + ++L K A+S++    + T   + ++   
Sbjct  26   TSFIKNSCKPTTYPDLCVASLSGYAPTIKNSQEQLIKTALSVSLDRAQSTKGFVSKLLKF  85

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  +I  C + +  S+  +  S+S L+ ++  +G D    I +++ W+ +  ++
Sbjct  86   KGLKPREYAAIKDCIEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVETWVSAAITD  145

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C +      +  ++   +   +  +   +  ALAL + +AA
Sbjct  146  ENTCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYAA  189



>gb|KEH29361.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 87/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI+ SC  T YP LC  SL KH   I  +  LL   A+N  L  ++S + +++ +++ 
Sbjct  34    TLFIRNSCSSTTYPRLCYTSLVKHADFIQTNRMLLTGTALNVTLASAKSTSALMSTLSKG  93

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P  A  MK C+E ++DS+ +L+ S+ EM  L+   FE  +S ++  ++ AL D + 
Sbjct  94    QGLNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFELTMSDVQTWVSAALTDQNT  153

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAAA  786
             C +G  +    E     V+  I  VA +T N L L+ K + +
Sbjct  154   CTDGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLSTS  195


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 83/171 (49%), Gaps = 4/171 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + NT FI++SC  T +P +CY SL   A  I  N   L   A+++T  + + T   M  +
Sbjct  31   QSNTLFIRNSCSSTTYPRLCYTSLVKHADFIQTNRMLLTGTALNVTLASAKSTSALMSTL  90

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   GL+P+E  ++  C ++   S+  ++ S   ++ ++ L+  +    + D++ W+ + 
Sbjct  91   SKGQGLNPREAAAMKDCVEVLSDSVDELRRS---IDEMSRLRTSNFELTMSDVQTWVSAA  147

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +  +     E V   V   + ++   +  ALAL +  +   HG
Sbjct  148  LTDQNTCTDGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLSTS-HG  197



>ref|XP_011041731.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=197

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 96/171 (56%), Gaps = 5/171 (3%)
 Frame = -1

Query  1289  GIAGKKT--ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRS  1116
              +A + T  ++ EFI+TSC  T YP+LC  SL  H   I    +LLA+AA+N  L  ++S
Sbjct  23    SLAARATPQSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKS  82

Query  1115  LTGMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIEN  936
              +  ++ ++Q   L     + M+ C+E+++D++++LK S+ EM H K   F   I+ ++ 
Sbjct  83    TSAKMSTLSQRHGLKRREVSAMEDCVEELSDAVYELKNSIDEMSHAKKSNFRLMINDVQT  142

Query  935   LITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              ++ AL D   C +G     +N   + AV+ +I  +A +T N L L+  ++
Sbjct  143   WVSAALTDESTCSDGFEGNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYS  193


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 95/180 (53%), Gaps = 7/180 (4%)
 Frame = -1

Query  797  FAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
             AA   P + + +FI++SC  T +P +CYASLS  +  I  +PK LA  A+++T  + + 
Sbjct  24   LAARATP-QSSIEFIRTSCSTTIYPKLCYASLSIHSSTIQTSPKLLANAALNVTLSSAKS  82

Query  617  TVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
            T  +M  ++ + GL  +E  ++  C E+LS  ++  +++S   ++ ++  K  +   +I+
Sbjct  83   TSAKMSTLSQRHGLKRREVSAMEDCVEELS-DAVYELKNS---IDEMSHAKKSNFRLMIN  138

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            D++ W+ +  ++  +C +  E   +   +   V   +  +   +  ALAL  +++   HG
Sbjct  139  DVQTWVSAALTDESTCSDGFEGNAMNGNLKTAVRGRIVHLAQLTSNALALIDNYSQ-RHG  197



>ref|XP_004307823.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=199

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 88/161 (55%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEF++TSC  T YP+LC  SL      I    +L+A AA++  L  ++S + ++  ++  
Sbjct  36    TEFMKTSCSATTYPKLCLTSLASQATAIQTSPKLMASAALSVTLSSAKSTSNLMLSLSHG  95

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               + P     M+ C+E + DS+ +L+ S+ EM + K   +E  IS ++  ++ AL D   
Sbjct  96    HGMKPREVAAMRDCVEVLGDSVDELQRSISEMGNFKSSDYEMMISDVQTWVSAALTDEST  155

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G    GLN   +  V+ +I  +A +T N L L+ ++A+
Sbjct  156   CADGFAGNGLNGNLKTVVRGKIVTIAQLTSNALALINRYAS  196


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 89/178 (50%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + NT+F+K+SC  T +P +C  SL+S A  I  +PK +A  A+S+T  + + T
Sbjct  26   AARDLAPKTNTEFMKTSCSATTYPKLCLTSLASQATAIQTSPKLMASAALSVTLSSAKST  85

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M  ++   G+ P+E  ++  C ++   S+  +Q S+S +      K  D   +I D+
Sbjct  86   SNLMLSLSHGHGMKPREVAAMRDCVEVLGDSVDELQRSISEM---GNFKSSDYEMMISDV  142

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++  +C +      +   +   V   +  +   +  ALAL + +A+ +HG
Sbjct  143  QTWVSAALTDESTCADGFAGNGLNGNLKTVVRGKIVTIAQLTSNALALINRYAS-VHG  199



>ref|XP_010264195.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=210

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 98/163 (60%), Gaps = 5/163 (3%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+T+FI+TSC  T YP+LC  +L  +   I  D +LLA  A++ +L  +RS + M+++++
Sbjct  43    ASTDFIKTSCGTTMYPKLCFSTLSGYASAIQTDPKLLADTALSVSLTNARSSSAMISELS  102

Query  1088  QNK--SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +++  ++ P  A  M+ C+E V DS+ +L+ S+ EM HL  P    +IS I+  ++ AL 
Sbjct  103   KSQLATMKPREAAAMRDCVEMVGDSVDELQKSMAEMSHLGGPDLGFQISNIQTWVSAALT  162

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKF  795
             + D C +G     ++   + +++ +I  +A +T N L+L+ K 
Sbjct  163   NEDTCMDGFAGKAMDSNIKTSIRGRILNLAQLTSNALSLINKL  205


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 95/193 (49%), Gaps = 14/193 (7%)
 Frame = -1

Query  833  HMTLNGLTLMKKFAAAG---FPGR------ENTDFIKSSCDKTPFPNICYASLSSSACDI  681
            H  + GL ++  F+ +G     GR       +TDFIK+SC  T +P +C+++LS  A  I
Sbjct  13   HCVVAGLLILLVFSPSGKLCSAGRVLDAVKASTDFIKTSCGTTMYPKLCFSTLSGYASAI  72

Query  680  AANPKRLAKNAISLTQRTTEFTVRRMGEIAGK--IGLSPKENMSIHVCEDLSHKSILYMQ  507
              +PK LA  A+S++      +   + E++      + P+E  ++  C ++   S+  +Q
Sbjct  73   QTDPKLLADTALSVSLTNARSSSAMISELSKSQLATMKPREAAAMRDCVEMVGDSVDELQ  132

Query  506  DSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMR  327
             S++ +   + L G DL   I +I+ W+ +  +N ++C++    + +   +   +   + 
Sbjct  133  KSMAEM---SHLGGPDLGFQISNIQTWVSAALTNEDTCMDGFAGKAMDSNIKTSIRGRIL  189

Query  326  EMEPFSEIALALF  288
             +   +  AL+L 
Sbjct  190  NLAQLTSNALSLI  202



>ref|XP_010062118.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW90824.1| hypothetical protein EUGRSUZ_A02883 [Eucalyptus grandis]
Length=201

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 93/162 (57%), Gaps = 3/162 (2%)
 Frame = -1

Query  1265  TTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ  1086
             +T+FI+TSC  T YP+LC  SL  H   I    +LLA  A++  L  +RS++ ++  +++
Sbjct  37    STDFIRTSCSKTTYPKLCFSSLSSHAAAIQMSPKLLACTALDVTLKNARSVSVLMVNLSR  96

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYD  906
             ++ L P  A  M+ C+E + D++ +L+ S+ EMK LK   F+  IS ++   + AL D D
Sbjct  97    SQGLKPREAAAMQDCMELLGDAVDELRRSIAEMKDLKERDFKLMISDVQTWASAALTDED  156

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G     ++   +  V+  I  ++H+T N L L+  +A+
Sbjct  157   TCSDGFAGKEMDGKVKTVVRAWIVTLSHLTSNALALINAYAS  198


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 95/178 (53%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            A    P   +TDFI++SC KT +P +C++SLSS A  I  +PK LA  A+ +T +     
Sbjct  28   ALGDLPNENSTDFIRTSCSKTTYPKLCFSSLSSHAAAIQMSPKLLACTALDVTLKNARSV  87

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M  ++   GL P+E  ++  C +L   ++  ++ S++ ++   +LK  D   +I D+
Sbjct  88   SVLMVNLSRSQGLKPREAAAMQDCMELLGDAVDELRRSIAEMK---DLKERDFKLMISDV  144

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W  +  ++ ++C +    +++  KV   V   +  +   +  ALAL +++A+ +HG
Sbjct  145  QTWASAALTDEDTCSDGFAGKEMDGKVKTVVRAWIVTLSHLTSNALALINAYAS-LHG  201



>emb|CDX86901.1| BnaC03g51710D [Brassica napus]
Length=200

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++SC  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ +++ + 
Sbjct  38    EFVKSSCTFTTYPRLCVTSLSTQSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSSS  97

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  +S I+  ++ AL + + C
Sbjct  98    RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMSDIQTWVSAALTNENTC  157

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N   +  V+ +I ++AH+T N L L+  FA+
Sbjct  158   SDGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFAS  197


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 84/167 (50%), Gaps = 4/167 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KSSC  T +P +C  SLS+ +  I  + K +A  A+++T  + + T   M  ++   
Sbjct  38   EFVKSSCTFTTYPRLCVTSLSTQSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSSS  97

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
             L P+E  ++  C +    ++  ++ S+  +    +L G +    + DI+ W+ +  +N 
Sbjct  98   RLKPREVSAMRDCVEELGDTLEELRKSIGEM---GQLSGSNYEVYMSDIQTWVSAALTNE  154

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +C +  E + +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  155  NTCSDGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFAS-IHG  200



>ref|XP_010264393.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=204

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 93/157 (59%), Gaps = 3/157 (2%)
 Frame = -1

Query  1265  TTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ  1086
             TT+FI+TSC  T YP+LC  SL      I  +   LA  A+N ++  ++S + +V+K++Q
Sbjct  44    TTDFIRTSCGVTTYPQLCYTSLSSFASSIQANPRKLAQTALNISITSAQSTSVLVSKLSQ  103

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYD  906
              + L    A  +K C++Q+ DSI +LK SL +++ L+ PG + K+S I+  ++ AL + +
Sbjct  104   RRDLKTWEAATVKDCVDQIEDSIDELKQSLEQLQKLEGPGIDFKMSNIKTWLSAALSNDE  163

Query  905   RCPNGMNDTGLNE---PAVKDQIAMVAHMTLNGLTLM  804
              C +G++   +NE     +K  I  VA +T N L ++
Sbjct  164   TCMDGIDGKDINEEVNSTIKKSILNVAKLTSNALAII  200


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 90/159 (57%), Gaps = 3/159 (2%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            TDFI++SC  T +P +CY SLSS A  I ANP++LA+ A++++  + + T   + +++ +
Sbjct  45   TDFIRTSCGVTTYPQLCYTSLSSFASSIQANPRKLAQTALNISITSAQSTSVLVSKLSQR  104

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L   E  ++  C D    SI  ++ SL  L+ + E  GID    + +IK WL +  SN
Sbjct  105  RDLKTWEAATVKDCVDQIEDSIDELKQSLEQLQKL-EGPGIDFK--MSNIKTWLSAALSN  161

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALF  288
             E+C++ ++ + I E+V   + + +  +   +  ALA+ 
Sbjct  162  DETCMDGIDGKDINEEVNSTIKKSILNVAKLTSNALAII  200



>ref|XP_010483948.1| PREDICTED: 21 kDa protein-like isoform X1 [Camelina sativa]
 ref|XP_010483950.1| PREDICTED: 21 kDa protein-like isoform X2 [Camelina sativa]
Length=195

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 95/164 (58%), Gaps = 4/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEF+++SC  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ ++
Sbjct  30    TTNTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRL  89

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             + ++  P EAA  M+ C+E++ D++ +L+ S+ EM  L    +E  +S ++  ++ AL D
Sbjct  90    SSSRLKPREAAA-MRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTD  148

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              + C  G +   +N   +  V+ +I +VAH+T N L L+  FA+
Sbjct  149   ENTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS  192


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 90/174 (52%), Gaps = 15/174 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC  T +P +C+ SLS+ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  32   NTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSS  91

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWL  423
               L P+E  ++  C E+L+        D+L  L ++I E   L   +    + D++ W+
Sbjct  92   S-RLKPREAAAMRDCVEELA--------DTLDELRKSIGEMCRLSSSNYEVYMSDMQTWV  142

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +  ++  +C E  + +++  K    V   +  +   +  ALAL + FA+ +HG
Sbjct  143  SAALTDENTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS-IHG  195



>ref|XP_006362112.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=209

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = -1

Query  1265  TTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ  1086
             T++FI+TSC  T YP+LC  +L  +   I  +   LA++A+  +L  ++S T  +AK+++
Sbjct  46    TSDFIKTSCGTTLYPKLCIETLSPYSNSIQTNPMELANSALTVSLKGAKSTTNKIAKMSK  105

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYD  906
              +SL P  A  +  C+E + DS+ +L+ SL+EMK+L  P FE K+  +   ++ AL D D
Sbjct  106   EESLGPAEAHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDED  165

Query  905   RCPNGMN-DTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              C +G   ++ +N   +  +++ I  VA +T N L L K  +++
Sbjct  166   TCMDGFQENSAMNAKVKATIRNYIVNVAQLTSNALALTKNLSSS  209


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/159 (24%), Positives = 81/159 (51%), Gaps = 4/159 (3%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            +DFIK+SC  T +P +C  +LS  +  I  NP  LA +A++++ +  + T  ++ +++ +
Sbjct  47   SDFIKTSCGTTLYPKLCIETLSPYSNSIQTNPMELANSALTVSLKGAKSTTNKIAKMSKE  106

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L P E  ++  C +    S+  +Q SL  ++ +N   G D    + ++  W+ +  ++
Sbjct  107  ESLGPAEAHALTDCVENMEDSVDELQKSLLEMKNLN---GPDFEEKMGNVMTWVSAALTD  163

Query  404  YESCIEEL-ETEQIKEKVTEEVTRLMREMEPFSEIALAL  291
             ++C++   E   +  KV   +   +  +   +  ALAL
Sbjct  164  EDTCMDGFQENSAMNAKVKATIRNYIVNVAQLTSNALAL  202



>ref|XP_009603391.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=194

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 94/173 (54%), Gaps = 6/173 (3%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G A   T  T  I++SC+ T YPE+C  SL      I +  + LA  A++ +LD ++S  
Sbjct  20    GTANSATVATSSIKSSCKFTTYPEVCFTSLAGFAPAIKRSPQQLAQTALSVSLDRAQSTQ  79

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIE  939
               V K+ + K L P     +K C+EQ++D+I ++  S+ E+K++   +   FE  +S IE
Sbjct  80    AFVNKLCKFKGLKPREYAALKDCVEQMSDTISRISKSVKELKNMGSARGKDFEWHMSNIE  139

Query  938   NLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               I+ AL D + C +G      N   + +V+ ++  VA +T N L L+ +FAA
Sbjct  140   TWISAALTDENTCGDGFAGKTFNGRIKASVRARVTHVAQVTSNALALINQFAA  192


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/175 (25%), Positives = 84/175 (48%), Gaps = 5/175 (3%)
 Frame = -1

Query  782  FPGREN-----TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            F G  N     T  IKSSC  T +P +C+ SL+  A  I  +P++LA+ A+S++    + 
Sbjct  18   FSGTANSATVATSSIKSSCKFTTYPEVCFTSLAGFAPAIKRSPQQLAQTALSVSLDRAQS  77

Query  617  TVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
            T   + ++    GL P+E  ++  C +    +I  +  S+  L+ +   +G D    + +
Sbjct  78   TQAFVNKLCKFKGLKPREYAALKDCVEQMSDTISRISKSVKELKNMGSARGKDFEWHMSN  137

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            I+ W+ +  ++  +C +    +    ++   V   +  +   +  ALAL + FAA
Sbjct  138  IETWISAALTDENTCGDGFAGKTFNGRIKASVRARVTHVAQVTSNALALINQFAA  192



>ref|XP_010444081.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 95/164 (58%), Gaps = 4/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEF+++SC  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ ++
Sbjct  30    TTNTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRL  89

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             + ++  P EAA  M+ C+E++ D++ +L+ S+ EM  L    +E  +S ++  ++ AL D
Sbjct  90    SSSRLNPREAAA-MRDCVEELADTLDELRKSIGEMCRLSTSNYEVYMSDMQTWVSAALTD  148

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              + C  G +   +N   +  V+ +I +VAH+T N L L+  FA+
Sbjct  149   ENTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS  192


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 91/174 (52%), Gaps = 15/174 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC  T +P +C+ SLS+ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  32   NTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSS  91

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWL  423
               L+P+E  ++  C E+L+        D+L  L ++I E   L   +    + D++ W+
Sbjct  92   S-RLNPREAAAMRDCVEELA--------DTLDELRKSIGEMCRLSTSNYEVYMSDMQTWV  142

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +  ++  +C E  + +++  K    V   +  +   +  ALAL + FA+ +HG
Sbjct  143  SAALTDENTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS-IHG  195



>ref|XP_010458855.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 95/164 (58%), Gaps = 4/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEF+++SC  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ ++
Sbjct  30    TTNTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRL  89

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             + ++  P EAA  M+ C+E++ D++ +L+ S+ EM  L    +E  +S ++  ++ AL D
Sbjct  90    SSSRLNPREAAA-MRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTD  148

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              + C  G +   +N   +  V+ +I +VAH+T N L L+  FA+
Sbjct  149   ENTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS  192


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 91/174 (52%), Gaps = 15/174 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC  T +P +C+ SLS+ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  32   NTEFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSS  91

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWL  423
               L+P+E  ++  C E+L+        D+L  L ++I E   L   +    + D++ W+
Sbjct  92   S-RLNPREAAAMRDCVEELA--------DTLDELRKSIGEMCRLSSSNYEVYMSDMQTWV  142

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +  ++  +C E  + +++  K    V   +  +   +  ALAL + FA+ +HG
Sbjct  143  SAALTDENTCTEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS-IHG  195



>ref|XP_003541070.2| PREDICTED: 21 kDa protein-like [Glycine max]
Length=251

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 88/164 (54%), Gaps = 3/164 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T FI+TSC  T YP LC  SL KH   I  +  +L  AA+N  L   +S + M++ 
Sbjct  86    KEANTLFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMMST  145

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +A+ + L P     M+ C+EQ++D++ +L+ S+ EM  L+   FE  +S ++  ++ AL 
Sbjct  146   LAKKQGLKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALT  205

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             D   C +G  +       +  V+  +  VA +T N L L+ K A
Sbjct  206   DETTCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  249


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 86/169 (51%), Gaps = 4/169 (2%)
 Frame = -1

Query  779  PGRE-NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            P +E NT FI++SC  T +P +CY+SL   A  I  N   L   A+++T  + + T   M
Sbjct  84   PYKEANTLFIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMM  143

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
              +A K GL P+E  ++  C +    ++  ++ S++ +   ++L+  +   I+ D++ W+
Sbjct  144  STLAKKQGLKPREVAAMQDCVEQLSDTVDELRRSIAEM---SDLRASNFEMIMSDVQTWV  200

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             +  ++  +C +  +       +   V RL+ ++   +  ALAL +  A
Sbjct  201  SAALTDETTCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  249



>ref|XP_010259198.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=209

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 92/163 (56%), Gaps = 3/163 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  T FI++SC  T YP+LC  SL  +   I      LA+ A+N ++  +RS + M++ +
Sbjct  40    TTITNFIRSSCGVTLYPQLCYTSLSSYASSIQTSHMKLAYTALNVSMKSARSTSAMISNM  99

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             +Q + L P  A  +K C+E++ DSI +LK SL +M+ L     + ++S I+  ++ AL +
Sbjct  100   SQRQDLMPREAAAVKDCVEEIGDSIDELKQSLRQMQELGGSNVDFQMSNIKTWVSAALSN  159

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              D C +G++   +N   +  +K +I  VA +T N L L+   +
Sbjct  160   DDTCVDGIDSNDINAEVKNTIKKRILRVAKLTSNALALINNLS  202


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 89/163 (55%), Gaps = 3/163 (2%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FI+SSC  T +P +CY SLSS A  I  +  +LA  A++++ ++   T   +  ++ +
Sbjct  43   TNFIRSSCGVTLYPQLCYTSLSSYASSIQTSHMKLAYTALNVSMKSARSTSAMISNMSQR  102

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L P+E  ++  C +    SI  ++ SL  ++   EL G ++   + +IK W+ +  SN
Sbjct  103  QDLMPREAAAVKDCVEEIGDSIDELKQSLRQMQ---ELGGSNVDFQMSNIKTWVSAALSN  159

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             ++C++ +++  I  +V   + + +  +   +  ALAL ++ +
Sbjct  160  DDTCVDGIDSNDINAEVKNTIKKRILRVAKLTSNALALINNLS  202



>ref|NP_201042.2| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 dbj|BAA97200.1| ripening-related protein-like; contains similarity to pectinesterase 
[Arabidopsis thaliana]
 gb|AAO41999.1| putative DC1.2 homolog [Arabidopsis thaliana]
 gb|AED97600.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=203

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 92/160 (58%), Gaps = 4/160 (3%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++SC  T YP LC  SL  H   I    +L+AHAA+N  L  ++  + M+ +++ N 
Sbjct  42    EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKLMAHAALNITLASAKVTSAMMVRLS-NS  100

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P+  + M+ C+E++ D++ +L+ S+ EM  L    +E  IS I+  ++ AL D + C
Sbjct  101   RLKPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALTDVNTC  160

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     ++   +  V+ +I ++AH+T N L L+  FA+
Sbjct  161   TDGFEGEDMDGKVKVLVRGRILVIAHLTSNALALINHFAS  200


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 89/172 (52%), Gaps = 15/172 (9%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KSSC  T +P +C++SLS+ A  I  +PK +A  A+++T  + + T   M  ++   
Sbjct  42   EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKLMAHAALNITLASAKVTSAMMVRLSNS-  100

Query  581  GLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWLKS  417
             L PKE  ++  C E+L         D+L  L ++I E   L G +    I DI+ W+ +
Sbjct  101  RLKPKEVSAMRDCVEELG--------DTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSA  152

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++  +C +  E E +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  153  ALTDVNTCTDGFEGEDMDGKVKVLVRGRILVIAHLTSNALALINHFAS-IHG  203



>gb|AAN60276.1| unknown [Arabidopsis thaliana]
Length=204

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 92/160 (58%), Gaps = 4/160 (3%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++SC  T YP LC  SL  H   I    +L+AHAA+N  L  ++  + M+ +++ N 
Sbjct  43    EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKLMAHAALNITLASAKVTSAMMVRLS-NS  101

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P+  + M+ C+E++ D++ +L+ S+ EM  L    +E  IS I+  ++ AL D + C
Sbjct  102   RLKPKEVSAMRDCVEELGDTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSAALTDVNTC  161

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     ++   +  V+ +I ++AH+T N L L+  FA+
Sbjct  162   TDGFEGEDMDGKVKVLVRGRILVIAHLTSNALALINHFAS  201


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 89/172 (52%), Gaps = 15/172 (9%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KSSC  T +P +C++SLS+ A  I  +PK +A  A+++T  + + T   M  ++   
Sbjct  43   EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKLMAHAALNITLASAKVTSAMMVRLSNS-  101

Query  581  GLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWLKS  417
             L PKE  ++  C E+L         D+L  L ++I E   L G +    I DI+ W+ +
Sbjct  102  RLKPKEVSAMRDCVEELG--------DTLEELRKSIGEMCQLSGSNYEVYISDIQTWVSA  153

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++  +C +  E E +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  154  ALTDVNTCTDGFEGEDMDGKVKVLVRGRILVIAHLTSNALALINHFAS-IHG  204



>ref|XP_009370482.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=199

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL      I    +L+A AA+N  L  ++S + M++K++ + 
Sbjct  37    EFMKTSCSATTYPKLCLASLSSDAGAIQTSPKLMACAALNVTLASAKSTSTMMSKLSHSH  96

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P+    M+ C+E+++DS++ LK S+  M   K   F+  IS ++  ++ AL D   C
Sbjct  97    GMEPKEVEAMRDCVEELSDSVYDLKRSIAGMGSFKNSDFQLMISDVQTWVSAALTDETTC  156

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G  + G+N   +  V  +I  +A +T N L L+ ++A+
Sbjct  157   SDGFEENGMNGKLKTIVGGRIVKIAQLTSNALPLIDRYAS  196


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + N +F+K+SC  T +P +C ASLSS A  I  +PK +A  A+++T  + + T   M ++
Sbjct  33   KTNNEFMKTSCSATTYPKLCLASLSSDAGAIQTSPKLMACAALNVTLASAKSTSTMMSKL  92

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   G+ PKE  ++  C +    S+  ++ S++ +      K  D   +I D++ W+ + 
Sbjct  93   SHSHGMEPKEVEAMRDCVEELSDSVYDLKRSIAGM---GSFKNSDFQLMISDVQTWVSAA  149

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C +  E   +  K+   V   + ++   +  AL L   +A+ +HG
Sbjct  150  LTDETTCSDGFEENGMNGKLKTIVGGRIVKIAQLTSNALPLIDRYAS-VHG  199



>ref|XP_006490092.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=209

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 94/162 (58%), Gaps = 3/162 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             +++TEFI+TSC  T YP+LC  +L  +   I  +   LA+AA++ +L+ ++S + +V K+
Sbjct  46    SSSTEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKL  105

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             ++   L P  A+ +K C+E   DS+ +L+ SL  MK LK P FE KI+ ++  ++ AL +
Sbjct  106   SKGLELRPREASAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWVSAALTN  165

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKF  795
              D C +     G+N   +  ++ +I   + +  N L L+ + 
Sbjct  166   EDTCMDNFEGNGMNGKVKDTIRGRIVRASQLISNALALINQL  207


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P++CY +LSS A  I  NP  LA  A+S++    + T   + +++ 
Sbjct  48   STEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLSK  107

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
             + L P+E  ++  C + +  S+  +Q S   L+ + +LKG +    I+D++ W+ +  +
Sbjct  108  GLELRPREASAVKDCVENTRDSVDELQQS---LQAMKDLKGPEFEFKINDLQTWVSAALT  164

Query  407  NYESCIEELETEQIKEKVTEEVT-RLMREMEPFSEIALAL  291
            N ++C++  E   +  KV + +  R++R  +  S  ALAL
Sbjct  165  NEDTCMDNFEGNGMNGKVKDTIRGRIVRASQLISN-ALAL  203



>gb|KDO65436.1| hypothetical protein CISIN_1g028434mg [Citrus sinensis]
Length=209

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 94/162 (58%), Gaps = 3/162 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             +++TEFI+TSC  T YP+LC  +L  +   I  +   LA+AA++ +L+ ++S + +V K+
Sbjct  46    SSSTEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKL  105

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             ++   L P  A+ +K C+E   DS+ +L+ SL  MK LK P FE KI+ ++  ++ AL +
Sbjct  106   SKGLELRPREASAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWVSAALTN  165

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKF  795
              D C +     G+N   +  ++ +I   + +  N L L+ + 
Sbjct  166   EDTCMDNFEGNGVNGKVKDTIRGRIVRASQLISNALALINQL  207


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P++CY +LSS A  I  NP  LA  A+S++    + T   + +++ 
Sbjct  48   STEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLSK  107

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
             + L P+E  ++  C + +  S+  +Q S   L+ + +LKG +    I+D++ W+ +  +
Sbjct  108  GLELRPREASAVKDCVENTRDSVDELQQS---LQAMKDLKGPEFEFKINDLQTWVSAALT  164

Query  407  NYESCIEELETEQIKEKVTEEVT-RLMREMEPFSEIALAL  291
            N ++C++  E   +  KV + +  R++R  +  S  ALAL
Sbjct  165  NEDTCMDNFEGNGVNGKVKDTIRGRIVRASQLISN-ALAL  203



>gb|KDP22408.1| hypothetical protein JCGZ_26239 [Jatropha curcas]
Length=186

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 95/169 (56%), Gaps = 4/169 (2%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSLT  1110
             I+  +  T +FI++SC  T YP+LC  +L  +   I  ++   LA+AA+N  L  + + +
Sbjct  16    ISRAENGTDDFIKSSCLVTRYPDLCYQTLSAYATSIQDNNPTQLANAALNVTLKSAEATS  75

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLI  930
              MV+K+ +  +L P+ A  +K C+E + DS+ ++K SL+ M  L+ P FE K+S I+  +
Sbjct  76    NMVSKMLKAHNLMPKEAAAIKDCVETMRDSVDEIKQSLLVMSDLEGPDFEMKMSNIQTWV  135

Query  929   TTALIDYDRCPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFA  792
             + AL D D C +G     +N      ++  +  V+ +T N L L+ K A
Sbjct  136   SAALTDEDTCMDGFQGNAMNGKVKLKIRQYVERVSQLTSNALALINKVA  184


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIA-ANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            DFIKSSC  T +P++CY +LS+ A  I   NP +LA  A+++T ++ E T   + ++   
Sbjct  25   DFIKSSCLVTRYPDLCYQTLSAYATSIQDNNPTQLANAALNVTLKSAEATSNMVSKMLKA  84

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L PKE  +I  C +    S+  ++ SL     +++L+G D    + +I+ W+ +  ++
Sbjct  85   HNLMPKEAAAIKDCVETMRDSVDEIKQSLL---VMSDLEGPDFEMKMSNIQTWVSAALTD  141

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             ++C++  +   +  KV  ++ + +  +   +  ALAL +  A
Sbjct  142  EDTCMDGFQGNAMNGKVKLKIRQYVERVSQLTSNALALINKVA  184



>gb|AIT42250.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 100/175 (57%), Gaps = 9/175 (5%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSL  1113
             G AG   A T FI++SC+   YP++C  SL  + + I K+S+L L   A++ +LD ++S 
Sbjct  21    GAAGNAAAPTSFIKSSCKSPTYPDVCVASLSGYAQAI-KNSQLQLVKTALSVSLDKAQST  79

Query  1112  TGMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG---FEGKISY  945
              G V+K+ + K L P     +K C+E+ NDS+++L  S+ E+K L + PG   F+  +S 
Sbjct  80    KGFVSKLLKFKGLKPREYAAIKDCVEETNDSVNRLSRSVNELKGLDRSPGKAHFQWHMSN  139

Query  944   IENLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             ++  ++ A+ D   C +G     LN   + ++K  IA +A +T N   L+  +AA
Sbjct  140   VKTWVSAAITDEKTCTDGFAGRALNGKIKASIKSHIANLAQVTSNAPALINPYAA  194


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 82/171 (48%), Gaps = 13/171 (8%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC    +P++C ASLS  A  I  +  +L K A+S++    + T   + ++   
Sbjct  30   TSFIKSSCKSPTYPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAQSTKGFVSKLLKF  89

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGID-------LHTIIDDIKEW  426
             GL P+E  +I  C + ++ S+  +  S      +NELKG+D           + ++K W
Sbjct  90   KGLKPREYAAIKDCVEETNDSVNRLSRS------VNELKGLDRSPGKAHFQWHMSNVKTW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++ ++C +      +  K+   +   +  +   +  A AL + +AA
Sbjct  144  VSAAITDEKTCTDGFAGRALNGKIKASIKSHIANLAQVTSNAPALINPYAA  194



>ref|XP_010264194.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=211

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 88/166 (53%), Gaps = 3/166 (2%)
 Frame = -1

Query  1265  TTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ  1086
             +TEFI+ SC  T YP++C  SL  +   I +  +LLA  A++ +L  +RS   +V  +++
Sbjct  43    STEFIKNSCRRTLYPQVCVESLSAYASTIQESPKLLAQVALSVSLKSARSTEKLVLNLSK  102

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYD  906
                + P  A  +  C+E + D + +L+ SL EMKHL  P F  K+S I+  ++ AL + D
Sbjct  103   VNDIRPREAAALMDCVETMGDCVEELRQSLQEMKHLGGPDFALKLSNIKTWVSAALTNED  162

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
              C +G  D  +N   +  +   I  VA +T N L L+     +  P
Sbjct  163   TCRDGFQDKSMNGNIKNTITKSIDYVAKLTSNALALINNIQPSNTP  208


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/186 (24%), Positives = 94/186 (51%), Gaps = 10/186 (5%)
 Frame = -1

Query  815  LTLMKKFAAAGFPG-------RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLA  657
            +TL   F+  G  G       + +T+FIK+SC +T +P +C  SLS+ A  I  +PK LA
Sbjct  20   VTLFILFSCTGCSGAKLNPCSKTSTEFIKNSCRRTLYPQVCVESLSAYASTIQESPKLLA  79

Query  656  KNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETIN  477
            + A+S++ ++   T + +  ++    + P+E  ++  C +     +  ++ SL  ++   
Sbjct  80   QVALSVSLKSARSTEKLVLNLSKVNDIRPREAAALMDCVETMGDCVEELRQSLQEMK---  136

Query  476  ELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIAL  297
             L G D    + +IK W+ +  +N ++C +  + + +   +   +T+ +  +   +  AL
Sbjct  137  HLGGPDFALKLSNIKTWVSAALTNEDTCRDGFQDKSMNGNIKNTITKSIDYVAKLTSNAL  196

Query  296  ALFSSF  279
            AL ++ 
Sbjct  197  ALINNI  202



>ref|XP_006281048.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
 gb|EOA13946.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
Length=228

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEF+++SC  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ ++
Sbjct  63    TTNTEFVKSSCTFTTYPRLCFTSLATQASLIQTSPKLMAHAALNITLASAKATSAMMVRL  122

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             + N  L P     M+ C+E++ D++ +L+ S+ EM  L    +E  +S I+  ++ AL D
Sbjct  123   S-NTRLKPREVAAMRDCVEELGDTLDELRKSIGEMCRLSNSNYEVYMSDIQTWVSAALTD  181

Query  911   YDRCPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAA  789
              + C  G     +N  A   V+ +I ++AH+T N L L+  FA+
Sbjct  182   ENTCTEGFEGDDMNGKAKVLVRGRILVIAHLTSNALALINHFAS  225


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 88/174 (51%), Gaps = 15/174 (9%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC  T +P +C+ SL++ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  65   NTEFVKSSCTFTTYPRLCFTSLATQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSN  124

Query  587  KIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWL  423
               L P+E  ++  C E+L         D+L  L ++I E   L   +    + DI+ W+
Sbjct  125  T-RLKPREVAAMRDCVEELG--------DTLDELRKSIGEMCRLSNSNYEVYMSDIQTWV  175

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +  ++  +C E  E + +  K    V   +  +   +  ALAL + FA+ +HG
Sbjct  176  SAALTDENTCTEGFEGDDMNGKAKVLVRGRILVIAHLTSNALALINHFAS-IHG  228



>gb|AIT42255.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSLTGMVAKVAQ  1086
             T FI++SC+ T YP++C  SL  + + I K+S+L L   A++ +LD + S  G V+K+ +
Sbjct  30    TSFIKSSCKSTTYPDVCVASLSGYAQAI-KNSQLQLVKTALSVSLDKAESTKGFVSKLLK  88

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG---FEGKISYIENLITTAL  918
              K L P     +K C+E+ NDS+ +L  S+ E+K L +  G   F+  +S +E  ++ A+
Sbjct  89    FKGLKPREYAAIKDCVEETNDSVDRLSRSVNELKRLDRSHGKADFQWHMSNVETWVSAAI  148

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D + C +G     LN   + +++  IA +A +T N L L+ ++AA
Sbjct  149   TDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 83/165 (50%), Gaps = 1/165 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC  T +P++C ASLS  A  I  +  +L K A+S++    E T   + ++   
Sbjct  30   TSFIKSSCKSTTYPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKG-IDLHTIIDDIKEWLKSVKS  408
             GL P+E  +I  C + ++ S+  +  S++ L+ ++   G  D    + +++ W+ +  +
Sbjct  90   KGLKPREYAAIKDCVEETNDSVDRLSRSVNELKRLDRSHGKADFQWHMSNVETWVSAAIT  149

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +  +C +      +  K+   +   +  +   +  ALAL + +AA
Sbjct  150  DENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194



>ref|XP_002864788.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41047.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=196

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 91/160 (57%), Gaps = 4/160 (3%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++SC  T YP LC  SL  H   I    +++AHAA+N  L  +++ + M+ +++ N 
Sbjct  35    EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKIMAHAALNITLASAKATSAMMVRLS-NS  93

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  +S I+  ++ AL D + C
Sbjct  94    RLKPREISAMRDCVEELGDTLEELRKSIGEMCRLSGSNYEVYMSDIQTWVSAALTDVNTC  153

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               G     +N   +  V+ +I ++AH+T N L L+  FA+
Sbjct  154   TEGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFAS  193


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 88/171 (51%), Gaps = 13/171 (8%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KSSC  T +P +C++SLS+ A  I  +PK +A  A+++T  + + T   M  ++   
Sbjct  35   EFVKSSCTFTTYPRLCFSSLSTHASLIQTSPKIMAHAALNITLASAKATSAMMVRLSNS-  93

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNL-ETINE---LKGIDLHTIIDDIKEWLKSV  414
             L P+E  ++  C +        + D+L  L ++I E   L G +    + DI+ W+ + 
Sbjct  94   RLKPREISAMRDCVE-------ELGDTLEELRKSIGEMCRLSGSNYEVYMSDIQTWVSAA  146

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             ++  +C E  E + +  KV   V   +  +   +  ALAL + FA+ +HG
Sbjct  147  LTDVNTCTEGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFAS-IHG  196



>ref|XP_002263991.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 88/161 (55%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP LC  SL  H   I     LLA  A++  L  +RS + +++ +  +
Sbjct  37    TEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTSSVMSNLLLS  96

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P     MK C+E+++DS+ +L+ ++ EM  +K   F   ++ I+  ++ AL   D 
Sbjct  97    HGLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWVSAALTYEDT  156

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G     ++   + AV+ +I  +AHMT N L L+  +A+
Sbjct  157   CTDGFAGNTMDGKLKKAVRTRIVKIAHMTSNALALINSYAS  197


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 97/180 (54%), Gaps = 14/180 (8%)
 Frame = -1

Query  794  AAAGFPGR-ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            +AAG   R +NT+FI++SC  T +P +C+ SLS+ A  I  +P+ LA  A+S+T  T   
Sbjct  26   SAAGPAARKDNTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARS  85

Query  617  TVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLET----INELKGIDLH  453
            T   M  +    GL P+E +++  C E+LS        DS+  L      +N++KG +  
Sbjct  86   TSSVMSNLLLSHGLKPREVVAMKDCVEELS--------DSVDQLRKAMGEMNQIKGSNFG  137

Query  452  TIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             I++DI+ W+ +  +  ++C +      +  K+ + V   + ++   +  ALAL +S+A+
Sbjct  138  LIMNDIQTWVSAALTYEDTCTDGFAGNTMDGKLKKAVRTRIVKIAHMTSNALALINSYAS  197



>ref|XP_007131335.1| hypothetical protein PHAVU_011G005200g [Phaseolus vulgaris]
 gb|ESW03329.1| hypothetical protein PHAVU_011G005200g [Phaseolus vulgaris]
Length=204

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 90/167 (54%), Gaps = 6/167 (4%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T FI+TSC  T YP LC  SL KH   I  +  +L  AA+N  L  ++S + +++ 
Sbjct  35    KEANTVFIRTSCSSTTYPRLCYSSLVKHAELIQTNRVVLTGAALNVTLASAKSTSAVMSA  94

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +A+ + L P     MK C+E +N+S+ +L+ S+  M  L+   FE  +S ++  ++ AL 
Sbjct  95    MAKRRGLKPREVAAMKDCVEVLNESVEELRRSINGMSDLRRSNFEMTMSDVQTWVSAALT  154

Query  914   DYDRCPNGMNDT-----GLNEPA-VKDQIAMVAHMTLNGLTLMKKFA  792
             D   C +G  ++     G N  + V+  +  VA +T N L L+ + A
Sbjct  155   DESTCMDGFEESEMSIDGTNTKSRVRGLVVQVAQLTSNALALINQLA  201


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 91/172 (53%), Gaps = 7/172 (4%)
 Frame = -1

Query  779  PGRE-NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            P +E NT FI++SC  T +P +CY+SL   A  I  N   L   A+++T  + + T   M
Sbjct  33   PYKEANTVFIRTSCSSTTYPRLCYSSLVKHAELIQTNRVVLTGAALNVTLASAKSTSAVM  92

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
              +A + GL P+E  ++  C ++ ++S+  ++ S++ +   ++L+  +    + D++ W+
Sbjct  93   SAMAKRRGLKPREVAAMKDCVEVLNESVEELRRSINGM---SDLRRSNFEMTMSDVQTWV  149

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTR---LMREMEPFSEIALALFSSFA  276
             +  ++  +C++  E  ++    T   +R   L+ ++   +  ALAL +  A
Sbjct  150  SAALTDESTCMDGFEESEMSIDGTNTKSRVRGLVVQVAQLTSNALALINQLA  201



>emb|CAN70288.1| hypothetical protein VITISV_015784 [Vitis vinifera]
Length=200

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 92/170 (54%), Gaps = 4/170 (2%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G A +K   TEFI+TSC  T YP LC  SL  H   I     LLA  A++  L  +RS +
Sbjct  29    GPAARKD-NTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTS  87

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLI  930
              +++ +  +  L P     MK C+E+++DS+ +L+ ++ EM  +K   F   ++ I+  +
Sbjct  88    SVMSNLLLSHGLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWV  147

Query  929   TTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + AL   D C +G     ++   + AV+ +I  +AHMT N L L+  +A+
Sbjct  148   SAALTYEDTCTDGFAGNTMDGKLKKAVRARIVKIAHMTSNALALINSYAS  197


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 97/180 (54%), Gaps = 14/180 (8%)
 Frame = -1

Query  794  AAAGFPGR-ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            +AAG   R +NT+FI++SC  T +P +C+ SLS+ A  I  +P+ LA  A+S+T  T   
Sbjct  26   SAAGPAARKDNTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARS  85

Query  617  TVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLET----INELKGIDLH  453
            T   M  +    GL P+E +++  C E+LS        DS+  L      +N++KG +  
Sbjct  86   TSSVMSNLLLSHGLKPREVVAMKDCVEELS--------DSVDQLRKAMGEMNQIKGSNFG  137

Query  452  TIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             I++DI+ W+ +  +  ++C +      +  K+ + V   + ++   +  ALAL +S+A+
Sbjct  138  LIMNDIQTWVSAALTYEDTCTDGFAGNTMDGKLKKAVRARIVKIAHMTSNALALINSYAS  197



>emb|CDY00279.1| BnaA06g21800D [Brassica napus]
Length=198

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 89/160 (56%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++ C  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ +V+ + 
Sbjct  36    EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSSS  95

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  ++ I+  ++ AL D   C
Sbjct  96    RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTC  155

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N   +  V+ +I ++AH+T N L L+  FA+
Sbjct  156   SDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFAS  195


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 82/163 (50%), Gaps = 3/163 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KS C  T +P +C  SLS+ +  I  + K +A  A+++T  + + T   M  ++   
Sbjct  36   EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSSS  95

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
             L P+E  ++  C +    ++  ++ S+  +    +L G +    ++DI+ W+ +  ++ 
Sbjct  96   RLKPREVSAMRDCVEELGDTLEELRKSIGEM---GQLSGSNYEVYMNDIQTWVSAALTDE  152

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +C +  E +++  KV   V   +  +   +  ALAL + FA+
Sbjct  153  YTCSDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFAS  195



>ref|XP_002510934.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51536.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=185

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 90/162 (56%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A+ +FI+TSC  T YP+LC  +L  +   I ++   LA+AA+N  L+ + S +  V  + 
Sbjct  24    ASDDFIKTSCGATRYPDLCYQTLSAYASSIQENPLQLANAALNVTLESAESTSNSVLNML  83

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             +  +L P+ A  +  C+E + DS+ +L+ SL+ M  L+ P F  K+S I+  ++ AL D 
Sbjct  84    KAHNLSPKEAGAISDCVENMKDSVDELRESLMTMTDLEGPDFNMKMSNIQTWVSAALTDE  143

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             D C +G     +N   +  ++  I  VA +T N L L+ K A
Sbjct  144   DTCMDGFEGNAMNGKVKNTIRSYIEKVAQLTSNALALINKVA  185


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 97/189 (51%), Gaps = 4/189 (2%)
 Frame = -1

Query  842  MVAHMTLNGLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKR  663
            M  H +L  +  +  F  A      + DFIK+SC  T +P++CY +LS+ A  I  NP +
Sbjct  1    MFCH-SLVKIVFLVFFCFANTCSGASDDFIKTSCGATRYPDLCYQTLSAYASSIQENPLQ  59

Query  662  LAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLET  483
            LA  A+++T  + E T   +  +     LSPKE  +I  C +    S+  +++SL    T
Sbjct  60   LANAALNVTLESAESTSNSVLNMLKAHNLSPKEAGAISDCVENMKDSVDELRESLM---T  116

Query  482  INELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEI  303
            + +L+G D +  + +I+ W+ +  ++ ++C++  E   +  KV   +   + ++   +  
Sbjct  117  MTDLEGPDFNMKMSNIQTWVSAALTDEDTCMDGFEGNAMNGKVKNTIRSYIEKVAQLTSN  176

Query  302  ALALFSSFA  276
            ALAL +  A
Sbjct  177  ALALINKVA  185



>gb|AIT42253.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSLTGMVAKVAQ  1086
             T FI++SC+ T YP++C  SL  + + I K+S+L L   A++ +LD + S  G V+K+ +
Sbjct  30    TSFIKSSCKSTTYPDVCVASLSGYAQAI-KNSQLQLVKTALSVSLDKAESTKGFVSKLLK  88

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG---FEGKISYIENLITTAL  918
              K L P     +K C+E+ NDS+ +L  S+ E+K L +  G   F+  +S +E  ++ A+
Sbjct  89    FKGLKPREYAAIKDCVEETNDSVDRLSRSVNELKGLDRSHGKADFQWHMSNVETWVSAAI  148

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D + C +G     LN   + +++  IA +A +T N L L+ ++AA
Sbjct  149   TDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 85/171 (50%), Gaps = 13/171 (8%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC  T +P++C ASLS  A  I  +  +L K A+S++    E T   + ++   
Sbjct  30   TSFIKSSCKSTTYPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGI-------DLHTIIDDIKEW  426
             GL P+E  +I  C + ++ S+    D LS   ++NELKG+       D    + +++ W
Sbjct  90   KGLKPREYAAIKDCVEETNDSV----DRLS--RSVNELKGLDRSHGKADFQWHMSNVETW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++  +C +      +  K+   +   +  +   +  ALAL + +AA
Sbjct  144  VSAAITDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194



>ref|XP_006421708.1| hypothetical protein CICLE_v10007178mg [Citrus clementina]
 gb|ESR34948.1| hypothetical protein CICLE_v10007178mg [Citrus clementina]
Length=209

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 92/161 (57%), Gaps = 3/161 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI+TSC  T YP+LC  +L  +   I  +   LA+AA++ +L+ ++S + +V K++
Sbjct  47    SSTEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLS  106

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             +   L P  A  +K C+E   DS+ +L+ SL  MK LK P FE KI+ ++  ++ AL + 
Sbjct  107   KGLELRPREAGAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWVSAALTNE  166

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKF  795
             D C +     G+N   +  ++ +I   + +  N L L+ + 
Sbjct  167   DTCMDNFEGNGMNGKVKDTIRGRIVRASQLISNALALINQL  207


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 92/164 (56%), Gaps = 5/164 (3%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T+FIK+SC  T +P++CY +LSS A  I  NP  LA  A+S++    + T   + +++ 
Sbjct  48   STEFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLSK  107

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
             + L P+E  ++  C + +  S+  +Q S   L+ + +LKG +    I+D++ W+ +  +
Sbjct  108  GLELRPREAGAVKDCVENTRDSVDELQQS---LQAMKDLKGPEFEFKINDLQTWVSAALT  164

Query  407  NYESCIEELETEQIKEKVTEEVT-RLMREMEPFSEIALALFSSF  279
            N ++C++  E   +  KV + +  R++R  +  S  ALAL +  
Sbjct  165  NEDTCMDNFEGNGMNGKVKDTIRGRIVRASQLISN-ALALINQL  207



>ref|XP_009151355.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=198

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 89/159 (56%), Gaps = 3/159 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++ C  T YP LC  SL      I    +L+AHAA+N  L  +++ + M+ +V+++ 
Sbjct  36    EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRSS  95

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P   + M+ C+E++ D++ +L+ S+ EM  L    +E  ++ I+  ++ AL D   C
Sbjct  96    RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTC  155

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              +G     +N   +  V+ +I ++AH+T N L L+  FA
Sbjct  156   LDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFA  194


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 82/162 (51%), Gaps = 3/162 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +F+KS C  T +P +C  SLS+ +  I  + K +A  A+++T  + + T   M  ++   
Sbjct  36   EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRSS  95

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
             L P+E  ++  C +    ++  ++ S+  +    +L G +    ++DI+ W+ +  ++ 
Sbjct  96   RLKPREVSAMRDCVEELGDTLEELRKSIGEM---GQLSGSNYEVYMNDIQTWVSAALTDE  152

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             +C++  E +++  KV   V   +  +   +  ALAL + FA
Sbjct  153  YTCLDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFA  194



>gb|ACU13418.1| unknown [Glycine max]
Length=202

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 87/164 (53%), Gaps = 3/164 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T FI+TSC  T YP LC  SL +H   I  +  +L  AA+N  L   +S + M++ 
Sbjct  37    KEANTLFIRTSCSSTTYPRLCYSSLVRHADLIQTNRVVLTGAALNVTLASVKSTSAMMST  96

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +A+ + L       M+ C+EQ++D++ +L+ S+ EM  L+   FE  +S ++  ++ AL 
Sbjct  97    LAKKQGLKLREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALT  156

Query  914   DYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             D   C +G  +       +  V+  +  VA +T N L L+ K A
Sbjct  157   DETTCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  200


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 85/169 (50%), Gaps = 4/169 (2%)
 Frame = -1

Query  779  PGRE-NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            P +E NT FI++SC  T +P +CY+SL   A  I  N   L   A+++T  + + T   M
Sbjct  35   PYKEANTLFIRTSCSSTTYPRLCYSSLVRHADLIQTNRVVLTGAALNVTLASVKSTSAMM  94

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
              +A K GL  +E  ++  C +    ++  ++ S++ +   ++L+  +   I+ D++ W+
Sbjct  95   STLAKKQGLKLREVAAMQDCVEQLSDTVDELRRSIAEM---SDLRASNFEMIMSDVQTWV  151

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             +  ++  +C +  +       +   V RL+ ++   +  ALAL +  A
Sbjct  152  SAALTDETTCNDGFQEITAATDIKSTVRRLVIQVAQLTSNALALINKLA  200



>ref|XP_006838616.1| hypothetical protein AMTR_s00002p00229990 [Amborella trichopoda]
 gb|ERN01185.1| hypothetical protein AMTR_s00002p00229990 [Amborella trichopoda]
Length=205

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 86/161 (53%), Gaps = 1/161 (1%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A T FI+ SC  T YP LC  SL  +   I      LAHAA++ +L  ++S +  VAK+ 
Sbjct  42    AATSFIRASCRTTRYPALCVSSLSAYAPAIRTSPRQLAHAALSVSLTRAKSTSSFVAKLG  101

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
               + L    A  ++ C+E + DS+ ++K SL EM  +    F+ ++S ++  ++ AL + 
Sbjct  102   TTRGLRAREAGAIRDCVENMGDSVDEIKRSLGEMGRVGGGTFQWRMSNVQTWVSAALTNE  161

Query  908   DRCPNGMNDT-GLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + C +G     G  + AVK +I  VA +T N L L+   AA
Sbjct  162   NTCVDGFQGVDGSTKSAVKARIQNVAQVTSNALALVNCLAA  202


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 79/164 (48%), Gaps = 5/164 (3%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FI++SC  T +P +C +SLS+ A  I  +P++LA  A+S++    + T   + ++   
Sbjct  44   TSFIRASCRTTRYPALCVSSLSAYAPAIRTSPRQLAHAALSVSLTRAKSTSSFVAKLGTT  103

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL  +E  +I  C +    S+  ++ SL  +     + G      + +++ W+ +  +N
Sbjct  104  RGLRAREAGAIRDCVENMGDSVDEIKRSLGEM---GRVGGGTFQWRMSNVQTWVSAALTN  160

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++  +   +       V   ++ +   +  ALAL +  AA
Sbjct  161  ENTCVDGFQG--VDGSTKSAVKARIQNVAQVTSNALALVNCLAA  202



>ref|XP_010035021.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW46288.1| hypothetical protein EUGRSUZ_K00155 [Eucalyptus grandis]
Length=200

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 92/167 (55%), Gaps = 4/167 (2%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              + +  T+FI+TSC  T YP LC  SL  H   I    +LL   A+N  L+ +RS + M+
Sbjct  30    AQTSTNTQFIRTSCSKTTYPRLCYTSLSSHANLIQTSPKLLTSTALNVTLNKARSTSAMM  89

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLK-CPGFEGKISYIENLITT  924
              ++++   + P     M+ C+E+++ ++ +L+ S+ EM  +K    F   ++ ++  ++ 
Sbjct  90    VRLSRAHGMKPREVGAMQDCVEELSSTVDELRRSIHEMGQIKRSSNFGLIMNDVQTWVSA  149

Query  923   ALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             AL D + C +G   + +N   +  V++ I  +AH+T N L L+ ++A
Sbjct  150   ALTDENTCSDGFTGSTMNGNTKTVVRNAILTIAHLTSNALALINRYA  196


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 78/164 (48%), Gaps = 2/164 (1%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT FI++SC KT +P +CY SLSS A  I  +PK L   A+++T      T   M  ++ 
Sbjct  35   NTQFIRTSCSKTTYPRLCYTSLSSHANLIQTSPKLLTSTALNVTLNKARSTSAMMVRLSR  94

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              G+ P+E  ++  C +    ++  ++ S+  +  I       L  I++D++ W+ +  +
Sbjct  95   AHGMKPREVGAMQDCVEELSSTVDELRRSIHEMGQIKRSSNFGL--IMNDVQTWVSAALT  152

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +  +C +      +       V   +  +   +  ALAL + +A
Sbjct  153  DENTCSDGFTGSTMNGNTKTVVRNAILTIAHLTSNALALINRYA  196



>ref|XP_009370516.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 89/160 (56%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL  H   I    +L+A+ A+   L  S+S + M+ K++Q+ 
Sbjct  40    EFLKTSCSATTYPKLCLTSLSSHANAIQTSPKLMANEALTVTLASSKSTSIMMLKLSQSH  99

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+++++DS+  ++ S+ EM + +   F+  IS ++   + AL D   C
Sbjct  100   GMKPREVGAMRDCIQELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWDSAALTDETTC  159

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N   +  V+ +I  +A +T N L L+ ++A+
Sbjct  160   SDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYAS  199


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/174 (23%), Positives = 84/174 (48%), Gaps = 3/174 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + N +F+K+SC  T +P +C  SLSS A  I  +PK +A  A+++T  +++ T
Sbjct  29   AARDLAQKTNNEFLKTSCSATTYPKLCLTSLSSHANAIQTSPKLMANEALTVTLASSKST  88

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   G+ P+E  ++  C      S+  +Q S++ +      +  D   +I D+
Sbjct  89   SIMMLKLSQSHGMKPREVGAMRDCIQELSDSVDAIQRSIAEM---GNFRSSDFQLMISDV  145

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + W  +  ++  +C +      +   +   V   +  +   +  +LAL + +A+
Sbjct  146  QTWDSAALTDETTCSDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYAS  199



>ref|XP_003635233.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
Length=204

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 88/161 (55%), Gaps = 3/161 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFIQ SC  TPYP LC  SL  +  +I    +LLA  A++ +L+ + S +  + K+++ 
Sbjct  38    TEFIQKSCHVTPYPRLCISSLSSYASKIESSPKLLAVTALSMSLETALSTSTAITKLSKI  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P  A  +  C+EQ+ DS+ +L+ SL EMKH     F   ++ ++  ++ AL D   
Sbjct  98    HGLQPAEAAAISDCVEQIRDSVDELQRSLQEMKHPGGSNFVFPMNDVQTWVSAALTDDHT  157

Query  902   CPNGMNDT---GLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G  +    G     V+ +I  VA MT N L+L+  +A+
Sbjct  158   CMDGFAEIASKGKVHTMVRSRILHVAQMTSNALSLINNYAS  198


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 94/181 (52%), Gaps = 4/181 (2%)
 Frame = -1

Query  812  TLMKKFAAAGF-PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT  636
            T M   +AAG  PG  NT+FI+ SC  TP+P +C +SLSS A  I ++PK LA  A+S++
Sbjct  21   TYMNSCSAAGATPGETNTEFIQKSCHVTPYPRLCISSLSSYASKIESSPKLLAVTALSMS  80

Query  635  QRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDL  456
              T   T   + +++   GL P E  +I  C +    S+  +Q SL  ++      G + 
Sbjct  81   LETALSTSTAITKLSKIHGLQPAEAAAISDCVEQIRDSVDELQRSLQEMK---HPGGSNF  137

Query  455  HTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
               ++D++ W+ +  ++  +C++       K KV   V   +  +   +  AL+L +++A
Sbjct  138  VFPMNDVQTWVSAALTDDHTCMDGFAEIASKGKVHTMVRSRILHVAQMTSNALSLINNYA  197

Query  275  A  273
            +
Sbjct  198  S  198



>ref|XP_006362116.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
 gb|AIT42249.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 97/166 (58%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSLTGMVAKVAQ  1086
             T FI++SC+ T +P++C  SL  + + I K+S+L L   A++ +LD + S  G V+K+ +
Sbjct  30    TSFIKSSCKSTTFPDVCVASLSGYAQAI-KNSQLQLVKTALSVSLDKAESTKGFVSKLLK  88

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG---FEGKISYIENLITTAL  918
              K L P     +K C+E+ NDS+ +L  S+ E+K L +  G   F+  +S +E  ++ A+
Sbjct  89    FKGLKPREYAAIKDCVEETNDSVDRLSRSVNELKGLDRSHGKADFQWHMSNVETWVSAAI  148

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D + C +G     LN   + +++  IA +A +T N L L+ ++AA
Sbjct  149   TDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 85/171 (50%), Gaps = 13/171 (8%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC  T FP++C ASLS  A  I  +  +L K A+S++    E T   + ++   
Sbjct  30   TSFIKSSCKSTTFPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGI-------DLHTIIDDIKEW  426
             GL P+E  +I  C + ++ S+    D LS   ++NELKG+       D    + +++ W
Sbjct  90   KGLKPREYAAIKDCVEETNDSV----DRLS--RSVNELKGLDRSHGKADFQWHMSNVETW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++  +C +      +  K+   +   +  +   +  ALAL + +AA
Sbjct  144  VSAAITDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194



>ref|XP_008791710.1| PREDICTED: 21 kDa protein [Phoenix dactylifera]
Length=208

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 89/169 (53%), Gaps = 3/169 (2%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +  +K   TEFI+TSC  T YP LC  SL  +   I      LA AA+  +L  +RS + 
Sbjct  35    VGPQKPTNTEFIRTSCSATEYPILCFDSLSSYASTIQNSPMKLADAALTVSLSTARSTST  94

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT  927
             M+++++    + P  A  +  C+E + DS+ +L+ SL EM H++      +I+ I+  ++
Sbjct  95    MMSRMSAAGGMKPREAAAVSDCMENLGDSVDELQESLAEMAHMRSKNMGLQINDIQTWVS  154

Query  926   TALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              AL D D C +G+    +N   + AV+  +  VA +T N L  +   ++
Sbjct  155   AALTDDDTCMDGLAANAMNGEVKNAVRGHVVNVAQLTSNALAFINALSS  203


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/165 (25%), Positives = 88/165 (53%), Gaps = 3/165 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+FI++SC  T +P +C+ SLSS A  I  +P +LA  A++++  T   T   M  ++ 
Sbjct  42   NTEFIRTSCSATEYPILCFDSLSSYASTIQNSPMKLADAALTVSLSTARSTSTMMSRMSA  101

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              G+ P+E  ++  C +    S+  +Q+SL+ +     ++  ++   I+DI+ W+ +  +
Sbjct  102  AGGMKPREAAAVSDCMENLGDSVDELQESLAEMA---HMRSKNMGLQINDIQTWVSAALT  158

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + ++C++ L    +  +V   V   +  +   +  ALA  ++ ++
Sbjct  159  DDDTCMDGLAANAMNGEVKNAVRGHVVNVAQLTSNALAFINALSS  203



>ref|XP_010919458.1| PREDICTED: 21 kDa protein [Elaeis guineensis]
Length=208

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 3/164 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI+TSC  T YP LC  SL  +   I      LAHAA++ +L  +RS + M++++   
Sbjct  43    TRFIRTSCSATKYPILCFNSLSSYASTIQNSPMKLAHAALSVSLSTARSTSTMMSRMCTA  102

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               + P     +  C+E + DS+ +L+ SL EM H++       I+ I+  ++ AL D D 
Sbjct  103   GRMKPREVAAVSDCMENLGDSVDELQESLAEMAHMRGKNMGLTINDIQTWVSAALTDDDT  162

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGF  780
             C +G     +N   + AV+  +  VA +T N L L+   ++  F
Sbjct  163   CMDGFAGNAMNGEVKNAVRGHVVKVARLTSNALALINALSSTQF  206


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 87/165 (53%), Gaps = 3/165 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT FI++SC  T +P +C+ SLSS A  I  +P +LA  A+S++  T   T   M  +  
Sbjct  42   NTRFIRTSCSATKYPILCFNSLSSYASTIQNSPMKLAHAALSVSLSTARSTSTMMSRMCT  101

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
               + P+E  ++  C +    S+  +Q+SL+ +     ++G ++   I+DI+ W+ +  +
Sbjct  102  AGRMKPREVAAVSDCMENLGDSVDELQESLAEMA---HMRGKNMGLTINDIQTWVSAALT  158

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + ++C++      +  +V   V   + ++   +  ALAL ++ ++
Sbjct  159  DDDTCMDGFAGNAMNGEVKNAVRGHVVKVARLTSNALALINALSS  203



>ref|NP_001238450.1| uncharacterized protein LOC100305900 precursor [Glycine max]
 gb|ACU13809.1| unknown [Glycine max]
 gb|KHN43825.1| 21 kDa protein [Glycine soja]
Length=193

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 91/171 (53%), Gaps = 5/171 (3%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             IA   +  T FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ + +   
Sbjct  21    IASTLSTPTNFIKSSCSTTQYPALCIQSLSVYASTIQQDPHELVQTALSLSLNHTEATKT  80

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENL  933
              VAK  + + L P     +K C E+++DS+ +L  SL E+K  K  G  F   IS +E  
Sbjct  81    FVAKCNKFRGLKPREYAALKDCAEEISDSVDRLSRSLKELKLCKVKGEDFTWHISNVETW  140

Query  932   ITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             +++AL D   C +G     LN   + A++ ++  VA +T N L+L+ ++AA
Sbjct  141   VSSALTDESTCGDGFAGKALNGKIKEAIRARMVNVAQVTSNALSLINQYAA  191


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 83/164 (51%), Gaps = 1/164 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS  A  I  +P  L + A+SL+   TE T   + +    
Sbjct  29   TNFIKSSCSTTQYPALCIQSLSVYASTIQQDPHELVQTALSLSLNHTEATKTFVAKCNKF  88

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  ++  C +    S+  +  SL  L+ + ++KG D    I +++ W+ S  ++
Sbjct  89   RGLKPREYAALKDCAEEISDSVDRLSRSLKELK-LCKVKGEDFTWHISNVETWVSSALTD  147

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C +    + +  K+ E +   M  +   +  AL+L + +AA
Sbjct  148  ESTCGDGFAGKALNGKIKEAIRARMVNVAQVTSNALSLINQYAA  191



>ref|XP_006440385.1| hypothetical protein CICLE_v10023344mg [Citrus clementina]
 gb|ESR53625.1| hypothetical protein CICLE_v10023344mg [Citrus clementina]
 gb|KDO37980.1| hypothetical protein CISIN_1g042707mg [Citrus sinensis]
Length=203

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 95/165 (58%), Gaps = 3/165 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+FI+TSC  T YP+LC  +L  +  +I    +LLA  A++ AL  +   +  + K++++
Sbjct  38    TQFIKTSCRVTTYPDLCITTLSGYATKIQASPKLLASTALSVALKTALVTSTTMNKLSKS  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             + L P  A  +  C++Q+ D++ +L+ S+ EM   +   F  +++ ++  ++ AL + D 
Sbjct  98    QGLNPREAAALYDCVDQLRDAVDELQNSISEMGRNERSNFALQMNNVQTWVSAALTNEDT  157

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
             C +G +   +N   +  V+ QI+ VAH+T NGL L+  +A+   P
Sbjct  158   CMDGFSRKSMNGNVKATVRRQISNVAHLTSNGLALVNSYASITSP  202


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 96/182 (53%), Gaps = 5/182 (3%)
 Frame = -1

Query  812  TLMKKFAAAGFP--GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISL  639
            T M  + +A  P     NT FIK+SC  T +P++C  +LS  A  I A+PK LA  A+S+
Sbjct  20   TYMNTYCSAARPVQSETNTQFIKTSCRVTTYPDLCITTLSGYATKIQASPKLLASTALSV  79

Query  638  TQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGID  459
              +T   T   M +++   GL+P+E  +++ C D    ++  +Q+S+S +   NE     
Sbjct  80   ALKTALVTSTTMNKLSKSQGLNPREAAALYDCVDQLRDAVDELQNSISEMGR-NERSNFA  138

Query  458  LHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
            L   +++++ W+ +  +N ++C++    + +   V   V R +  +   +   LAL +S+
Sbjct  139  LQ--MNNVQTWVSAALTNEDTCMDGFSRKSMNGNVKATVRRQISNVAHLTSNGLALVNSY  196

Query  278  AA  273
            A+
Sbjct  197  AS  198



>ref|XP_008376226.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=202

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 92/160 (58%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T YP+LC  SL +H  EI    +L+A  A+   L  ++S + M++K++Q+ 
Sbjct  40    EFMKTSCSATTYPKLCLTSLSRHSSEIQTSPKLMASTALTVTLASAKSTSTMMSKLSQSH  99

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E+++DS+  ++ S+ EM +     F+  IS ++  ++ AL D   C
Sbjct  100   GMKPREVGAMRDCIEELSDSVDVIQRSIAEMGNFTSSDFQLMISDVQTWVSAALTDETTC  159

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G    G+N   +  V+ ++  +A +T N L L+ ++A+
Sbjct  160   SDGFGGNGMNGNLKTVVRGRVVNIAQLTSNALALINRYAS  199


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 90/179 (50%), Gaps = 6/179 (3%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + N +F+K+SC  T +P +C  SLS  + +I  +PK +A  A+++T  + + T
Sbjct  29   AARDLAQKTNNEFMKTSCSATTYPKLCLTSLSRHSSEIQTSPKLMASTALTVTLASAKST  88

Query  614  VRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
               M +++   G+ P+E  ++  C E+LS  S+  +Q S++ +         D   +I D
Sbjct  89   STMMSKLSQSHGMKPREVGAMRDCIEELS-DSVDVIQRSIAEM---GNFTSSDFQLMISD  144

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            ++ W+ +  ++  +C +      +   +   V   +  +   +  ALAL + +A+ +HG
Sbjct  145  VQTWVSAALTDETTCSDGFGGNGMNGNLKTVVRGRVVNIAQLTSNALALINRYAS-VHG  202



>ref|XP_003598239.1| 21 kDa protein [Medicago truncatula]
 gb|AES68490.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
 gb|AFK36590.1| unknown [Medicago truncatula]
Length=187

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 86/162 (53%), Gaps = 5/162 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ ++S  G V K    
Sbjct  23    TNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKGFVTKCKSF  82

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             K L P     +  C+E++ DS+ +L  SL E+K  K  G  F   IS +E  +++AL D 
Sbjct  83    KGLKPREYAALHDCVEEITDSVDRLSRSLKELKLCKIQGEDFSWHISNVETWVSSALTDE  142

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G     L+   + +++ ++  VA +T N L+L+ ++A
Sbjct  143   STCSDGFGGKALDGRMKASIRSRMVNVAQVTSNALSLINQYA  184


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 83/163 (51%), Gaps = 1/163 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS  A  I  +P +L + A+SL+   T+ T   + +    
Sbjct  23   TNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKGFVTKCKSF  82

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  ++H C +    S+  +  SL  L+ + +++G D    I +++ W+ S  ++
Sbjct  83   KGLKPREYAALHDCVEEITDSVDRLSRSLKELK-LCKIQGEDFSWHISNVETWVSSALTD  141

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              +C +    + +  ++   +   M  +   +  AL+L + +A
Sbjct  142  ESTCSDGFGGKALDGRMKASIRSRMVNVAQVTSNALSLINQYA  184



>ref|XP_010091300.1| 21 kDa protein [Morus notabilis]
 gb|EXC36884.1| 21 kDa protein [Morus notabilis]
Length=205

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 90/162 (56%), Gaps = 5/162 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP+LC  SL  H   I    +LLA  +++  L  +++ +  + +++ +
Sbjct  40    TEFIRTSCVSTTYPKLCFSSLSTHASTIQSSPQLLAITSLSVTLSSAKTTSAEMTRLSLS  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL--KCPGFEGKISYIENLITTALIDY  909
               L P     MK C+E++ DS+ +L+ S+ EM  L     GF+  I+ I+  ++ AL D 
Sbjct  100   HGLKPREVDAMKDCIEELRDSVDELRKSMGEMSQLVKGKSGFKLMINDIQTWVSAALTDE  159

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             + C +G  +  +N   + AV+ Q+  VA +T N L L+ ++ 
Sbjct  160   NTCTDGFEEKPMNGNLKTAVRGQVVNVAQLTSNALALINRYG  201


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 92/172 (53%), Gaps = 4/172 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + NT+FI++SC  T +P +C++SLS+ A  I ++P+ LA  ++S+T  + + T   M  +
Sbjct  37   KTNTEFIRTSCVSTTYPKLCFSSLSTHASTIQSSPQLLAITSLSVTLSSAKTTSAEMTRL  96

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELK-GIDLHTIIDDIKEWLKS  417
            +   GL P+E  ++  C +    S+  ++ S+  +  + + K G  L  +I+DI+ W+ +
Sbjct  97   SLSHGLKPREVDAMKDCIEELRDSVDELRKSMGEMSQLVKGKSGFKL--MINDIQTWVSA  154

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
              ++  +C +  E + +   +   V   +  +   +  ALAL + +   +HG
Sbjct  155  ALTDENTCTDGFEEKPMNGNLKTAVRGQVVNVAQLTSNALALINRYGL-IHG  205



>gb|AIT42252.1| pectinmethylesterase inhibitor [Solanum tuberosum]
 gb|AIT42254.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 95/166 (57%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSLTGMVAKVAQ  1086
             T FI++SC+ T +P++C  SL  + + I K+S+L L   A++ +LD + S  G V+K+ +
Sbjct  30    TSFIKSSCKSTTFPDVCVASLSGYAQAI-KNSQLQLVKTALSVSLDKAESTKGFVSKLLK  88

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKC----PGFEGKISYIENLITTAL  918
              K L P     +K C+E+ NDS+ +L  S+ E+K L        F+  +S +E  ++ A+
Sbjct  89    FKGLKPREYAAIKDCVEETNDSVDRLSRSVNELKGLDRNHGKADFQWHMSNVETWVSAAI  148

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D + C +G     LN   + +++  IA +A +T N L L+ ++AA
Sbjct  149   TDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 85/171 (50%), Gaps = 13/171 (8%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC  T FP++C ASLS  A  I  +  +L K A+S++    E T   + ++   
Sbjct  30   TSFIKSSCKSTTFPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGI-------DLHTIIDDIKEW  426
             GL P+E  +I  C + ++ S+    D LS   ++NELKG+       D    + +++ W
Sbjct  90   KGLKPREYAAIKDCVEETNDSV----DRLS--RSVNELKGLDRNHGKADFQWHMSNVETW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++  +C +      +  K+   +   +  +   +  ALAL + +AA
Sbjct  144  VSAAITDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194



>ref|XP_006394407.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
 gb|ESQ31693.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
Length=198

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 90/164 (55%), Gaps = 3/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  TEF+++SC  T Y  LC  SL      I    +L+AHAA+N  L  +++ + M+ ++
Sbjct  32    TTNTEFVKSSCNFTQYQRLCVASLSTQASLIQTSPKLMAHAALNITLASAKATSVMMVRL  91

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             ++   L P  A+ M+ C+E++ D++ +L+ S+ EM  L    +E  +S ++  ++ AL D
Sbjct  92    SRTSPLKPREASAMRDCVEELGDTLEELRKSIGEMGQLSGSNYELYMSDVQTWVSAALTD  151

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
                C +G     +N   +  V+ +I ++  +T N L L+  FA+
Sbjct  152   VTTCTDGFEGDDMNGKVKVLVRRRILVITQLTSNALALINHFAS  195


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 89/169 (53%), Gaps = 4/169 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+F+KSSC+ T +  +C ASLS+ A  I  +PK +A  A+++T  + + T   M  ++ 
Sbjct  34   NTEFVKSSCNFTQYQRLCVASLSTQASLIQTSPKLMAHAALNITLASAKATSVMMVRLSR  93

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
               L P+E  ++  C +    ++  ++ S+  +    +L G +    + D++ W+ +  +
Sbjct  94   TSPLKPREASAMRDCVEELGDTLEELRKSIGEM---GQLSGSNYELYMSDVQTWVSAALT  150

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +  +C +  E + +  KV   V R +  +   +  ALAL + FA+ +HG
Sbjct  151  DVTTCTDGFEGDDMNGKVKVLVRRRILVITQLTSNALALINHFAS-IHG  198



>ref|XP_004511656.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=202

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 88/164 (54%), Gaps = 6/164 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI++SCE T YP LC   L  +   IG+  + LA  A++ ++  ++     V  ++++
Sbjct  31    TEFIRSSCEATSYPALCVQCLTGYASAIGQSDQQLAITAISVSISRTQLSASFVNTMSKS  90

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEM---KHLKCPGFEGKISYIENLITTALID  912
             + +       M+ C+E + DS+ +L  S+ E+    H     F   +S ++  ++ AL D
Sbjct  91    RGIKQREYRAMQDCIENMADSLDRLSKSVTELGNIGHAVGEDFRWHMSNVQTWVSAALTD  150

Query  911   YDRCPNGMNDTGLNE---PAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D C +G  D  +NE    A+KD++  VA +T N L L+ +FA+
Sbjct  151   DDSCLDGFTDLFMNENVKAAIKDKVVNVAQVTSNALALVNRFAS  194


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 81/164 (49%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FI+SSC+ T +P +C   L+  A  I  + ++LA  AIS++   T+ +   +  ++  
Sbjct  31   TEFIRSSCEATSYPALCVQCLTGYASAIGQSDQQLAITAISVSISRTQLSASFVNTMSKS  90

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+  +E  ++  C +    S+  +  S++ L  I    G D    + +++ W+ +  ++
Sbjct  91   RGIKQREYRAMQDCIENMADSLDRLSKSVTELGNIGHAVGEDFRWHMSNVQTWVSAALTD  150

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +SC++      + E V   +   +  +   +  ALAL + FA+
Sbjct  151  DDSCLDGFTDLFMNENVKAAIKDKVVNVAQVTSNALALVNRFAS  194



>ref|XP_002263715.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CAN82390.1| hypothetical protein VITISV_030086 [Vitis vinifera]
Length=212

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 90/162 (56%), Gaps = 3/162 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T TT+FI+TSC  T YP+LC  +L  +   I      LA+AA+  +L  ++S +  V K+
Sbjct  43    TNTTQFIRTSCGVTMYPKLCFKTLSAYASTIQTSHMELANAALCVSLKGAQSSSNKVLKL  102

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             ++ + L    A  +  C+E + DS+ +L+ SLV MK L+ P F+ K+S I   ++ AL D
Sbjct  103   SKGQGLSRREAAAITDCIENMQDSVDELQQSLVAMKDLQGPDFQMKMSDIVTWVSAALTD  162

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKF  795
              D C +G  +  +    +  ++  I  VA +T N L ++ KF
Sbjct  163   EDTCMDGFAEHAMKGDLKSTIRSNIVSVAQLTSNALAIINKF  204


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 83/171 (49%), Gaps = 11/171 (6%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
            P    T FI++SC  T +P +C+ +LS+ A  I  +   LA  A+ ++ +  + +  ++ 
Sbjct  41   PPTNTTQFIRTSCGVTMYPKLCFKTLSAYASTIQTSHMELANAALCVSLKGAQSSSNKVL  100

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLE----TINELKGIDLHTIIDDIK  432
            +++   GLS +E  +I  C       I  MQDS+  L+     + +L+G D    + DI 
Sbjct  101  KLSKGQGLSRREAAAITDC-------IENMQDSVDELQQSLVAMKDLQGPDFQMKMSDIV  153

Query  431  EWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
             W+ +  ++ ++C++      +K  +   +   +  +   +  ALA+ + F
Sbjct  154  TWVSAALTDEDTCMDGFAEHAMKGDLKSTIRSNIVSVAQLTSNALAIINKF  204



>ref|XP_008369524.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=205

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 91/170 (54%), Gaps = 6/170 (4%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              + +++T+FI+ SC  T YP LC  SL  +   I +    LA  A+  +L   RS T  V
Sbjct  32    ARHSSSTDFIKASCRTTQYPALCVQSLAAYASAIRQSERQLAQTALTVSLARVRSATSFV  91

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKISYIENLI  930
              K+ + + + P     +K C+E + DS+ +L  S+ E+ H+ +  G  F   +S +E  +
Sbjct  92    TKLTRVRGIKPREYRAVKDCIENMGDSVDRLGQSVRELGHMGRAFGQDFMWHMSNVETWV  151

Query  929   TTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + AL D   C +G +   ++   + A++ ++  VAH+T N L L+ +FAA
Sbjct  152   SAALTDEGTCLDGFSGRFMDGNIKNAIRRRVNNVAHVTSNALALVTRFAA  201


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/166 (22%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
             +TDFIK+SC  T +P +C  SL++ A  I  + ++LA+ A++++          + ++ 
Sbjct  36   SSTDFIKASCRTTQYPALCVQSLAAYASAIRQSERQLAQTALTVSLARVRSATSFVTKLT  95

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
               G+ P+E  ++  C +    S+  +  S+  L  +    G D    + +++ W+ +  
Sbjct  96   RVRGIKPREYRAVKDCIENMGDSVDRLGQSVRELGHMGRAFGQDFMWHMSNVETWVSAAL  155

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++  +C++      +   +   + R +  +   +  ALAL + FAA
Sbjct  156  TDEGTCLDGFSGRFMDGNIKNAIRRRVNNVAHVTSNALALVTRFAA  201



>ref|XP_008796852.1| PREDICTED: 21 kDa protein-like [Phoenix dactylifera]
Length=209

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 87/164 (53%), Gaps = 3/164 (2%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T + EF++TSC  T YP LC  SL  +   I      LA AA++ +L  +R  + M+ ++
Sbjct  41    TISLEFVRTSCNKTKYPSLCFNSLAAYATTIQTSPVQLAEAALSVSLSYARGASTMMTRL  100

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALID  912
             ++ K +    A  M  C+E + DS+ +L+ SL  M HL     + +++ I+  +++AL D
Sbjct  101   SKGKGMSSREAEAMSDCIESLGDSVEELRQSLKAMGHLSGKNLKLRVNDIQTWVSSALTD  160

Query  911   YDRCPNGMNDTGL---NEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
                C +G  + G+      A++  I  VA +T N L+++   AA
Sbjct  161   ESTCMDGFANDGMKAGGRSALRSHIVKVAQLTSNALSIISGLAA  204


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/203 (23%), Positives = 98/203 (48%), Gaps = 6/203 (3%)
 Frame = -1

Query  872  NEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFPGRENT---DFIKSSCDKTPFPNICYASL  702
            N  ++     + A +TL    L      A  P    T   +F+++SC+KT +P++C+ SL
Sbjct  5    NSTSISSCFLLTAFLTLIAFALDASTCHAARPNTHGTISLEFVRTSCNKTKYPSLCFNSL  64

Query  701  SSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKS  522
            ++ A  I  +P +LA+ A+S++          M  ++   G+S +E  ++  C +    S
Sbjct  65   AAYATTIQTSPVQLAEAALSVSLSYARGASTMMTRLSKGKGMSSREAEAMSDCIESLGDS  124

Query  521  ILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEV  342
            +  ++ S   L+ +  L G +L   ++DI+ W+ S  ++  +C++    + +K      +
Sbjct  125  VEELRQS---LKAMGHLSGKNLKLRVNDIQTWVSSALTDESTCMDGFANDGMKAGGRSAL  181

Query  341  TRLMREMEPFSEIALALFSSFAA  273
               + ++   +  AL++ S  AA
Sbjct  182  RSHIVKVAQLTSNALSIISGLAA  204



>ref|XP_010672019.1| PREDICTED: 21 kDa protein-like [Beta vulgaris subsp. vulgaris]
Length=207

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 98/164 (60%), Gaps = 5/164 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+F++TSC+ T YPELC  SL  +   I    E LA+AA++  L  +R+ T M+++++  
Sbjct  41    TDFLKTSCKATLYPELCYNSLSTYTNVIQTSPEKLANAALSVTLTTTRTTTDMISRMSNG  100

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEG-KISYIENLITTALIDYD  906
               + P  A  ++ CLE++ND+I++L+ S++EM H+K     G KI+ I+  ++ AL D D
Sbjct  101   PGIRPSEAGALRDCLEELNDAIYELQESIMEMFHIKGSKKLGLKINNIQTWVSAALTDED  160

Query  905   RCPNGMND----TGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              C +G +      G  +  V+ +I  + H+T N L L+  +A++
Sbjct  161   TCMDGSSGGEAMDGKLKSVVRGRIVNICHLTSNSLALINDYASS  204


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 89/167 (53%), Gaps = 3/167 (2%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            TDF+K+SC  T +P +CY SLS+    I  +P++LA  A+S+T  TT  T   +  ++  
Sbjct  41   TDFLKTSCKATLYPELCYNSLSTYTNVIQTSPEKLANAALSVTLTTTRTTTDMISRMSNG  100

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P E  ++  C +  + +I  +Q+S+  +  I   K + L   I++I+ W+ +  ++
Sbjct  101  PGIRPSEAGALRDCLEELNDAIYELQESIMEMFHIKGSKKLGLK--INNIQTWVSAALTD  158

Query  404  YESCIE-ELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGM  267
             ++C++     E +  K+   V   +  +   +  +LAL + +A+ M
Sbjct  159  EDTCMDGSSGGEAMDGKLKSVVRGRIVNICHLTSNSLALINDYASSM  205



>ref|XP_009595798.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=215

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 93/164 (57%), Gaps = 4/164 (2%)
 Frame = -1

Query  1265  TTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ  1086
             T+EFI  SC  T Y +LC  +L  +   I  + + LA+AA+  +L  ++S T  ++K+++
Sbjct  52    TSEFITNSCGTTLYTKLCIETLSPYSNSIQTNPKELANAALTVSLKGAKSTTNKISKMSK  111

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYD  906
              + L P     +  C+E + DS+ +L+ SL+EMK+L  P FE K+  +   ++ AL D D
Sbjct  112   EQDLGPAETHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDED  171

Query  905   RCPNGMN-DTGLNE---PAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              C +G + +  +NE     +++ I  VA +T N L L K  +++
Sbjct  172   TCMDGFDGNDNMNEKVKATIRNYIVNVAQLTSNALALTKNLSSS  215


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/159 (23%), Positives = 81/159 (51%), Gaps = 4/159 (3%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FI +SC  T +  +C  +LS  +  I  NPK LA  A++++ +  + T  ++ +++ +
Sbjct  53   SEFITNSCGTTLYTKLCIETLSPYSNSIQTNPKELANAALTVSLKGAKSTTNKISKMSKE  112

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L P E  ++  C +    S+  +Q SL  ++ +N   G D    + ++  W+ +  ++
Sbjct  113  QDLGPAETHALTDCVENMEDSVDELQKSLLEMKNLN---GPDFEEKMGNVMTWVSAALTD  169

Query  404  YESCIEELE-TEQIKEKVTEEVTRLMREMEPFSEIALAL  291
             ++C++  +  + + EKV   +   +  +   +  ALAL
Sbjct  170  EDTCMDGFDGNDNMNEKVKATIRNYIVNVAQLTSNALAL  208



>ref|XP_010035020.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW46287.1| hypothetical protein EUGRSUZ_K00154 [Eucalyptus grandis]
Length=222

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 88/161 (55%), Gaps = 5/161 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEFI+TSC  T YP++C  +L  +   I    + +A+AA+   LD + S + MV++++  
Sbjct  61    TEFIKTSCGFTIYPDVCYQTLSPYASTIQTSPKEMANAALLVTLDGALSASNMVSRLSNA  120

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L    A  +  C+E ++DS+ +++ SLV MK L  P FE  +S +   ++ AL D D 
Sbjct  121   GGLSKREARAVIDCVETMSDSVDEIRQSLVAMKTLDGPEFETNMSDMRTWVSAALTDEDT  180

Query  902   CPNGMNDTGLN-----EPAVKDQIAMVAHMTLNGLTLMKKF  795
             C +G  + G++     E  ++  I  VA +T N L L+ + 
Sbjct  181   CMDGFQERGISNNKKVEGPIRSSIVRVAQLTSNALALINRL  221


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 76/144 (53%), Gaps = 4/144 (3%)
 Frame = -1

Query  794  AAAGF-PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            A++GF P    T+FIK+SC  T +P++CY +LS  A  I  +PK +A  A+ +T      
Sbjct  50   ASSGFDPSPSYTEFIKTSCGFTIYPDVCYQTLSPYASTIQTSPKEMANAALLVTLDGALS  109

Query  617  TVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
                +  ++   GLS +E  ++  C +    S+  ++ SL  ++T   L G +  T + D
Sbjct  110  ASNMVSRLSNAGGLSKREARAVIDCVETMSDSVDEIRQSLVAMKT---LDGPEFETNMSD  166

Query  437  IKEWLKSVKSNYESCIEELETEQI  366
            ++ W+ +  ++ ++C++  +   I
Sbjct  167  MRTWVSAALTDEDTCMDGFQERGI  190



>ref|XP_011010938.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 93/163 (57%), Gaps = 3/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI+TSC    YP LC  SL  H   I    +LLA+AA+N  L  ++S +  ++ ++
Sbjct  35    SSTEFIRTSCSTATYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTTISTLS  94

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q   + P   + MK C+E+++D++++L  S+ EM H +   F+  I  ++  ++ AL D 
Sbjct  95    QTHGMKPREVSAMKDCVEELSDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDE  154

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + C +G     +N   + +V+ +I  +A +T N L L+  +A+
Sbjct  155   NTCSDGFAGNAMNGNLKTSVRGRIVNIARLTSNALALINNYAS  197


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 92/181 (51%), Gaps = 5/181 (3%)
 Frame = -1

Query  812  TLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQ  633
            + +   +AA    + +T+FI++SC    +P +CY SLS  +  I  +PK LA  A+++T 
Sbjct  21   SYLNSSSAARVTTKSSTEFIRTSCSTATYPRLCYTSLSIHSSTIQTSPKLLANAALNVTL  80

Query  632  RTTEFTVRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDL  456
             + + T   +  ++   G+ P+E  ++  C E+LS      + +   +++ ++  +  + 
Sbjct  81   SSAKSTSTTISTLSQTHGMKPREVSAMKDCVEELSDA----VNELGKSMDEMSHARQSNF  136

Query  455  HTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             ++IDD++ W+ +  ++  +C +      +   +   V   +  +   +  ALAL +++A
Sbjct  137  QSMIDDVQTWVSAALTDENTCSDGFAGNAMNGNLKTSVRGRIVNIARLTSNALALINNYA  196

Query  275  A  273
            +
Sbjct  197  S  197



>gb|EYU24974.1| hypothetical protein MIMGU_mgv1a014119mg [Erythranthe guttata]
Length=200

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 90/170 (53%), Gaps = 6/170 (4%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             A     TT FI+TSC  T YP +C  SL  H   I K  + L   A++ +++ ++S    
Sbjct  28    AAAAVTTTSFIRTSCRATTYPSVCVQSLYTHAAAIKKSPKQLVTTALSVSVEKAQSTKTF  87

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENL  933
             V+ + + + L P     +K CLE+V+DS+ +L  S+ E+K L   + P F   +S ++  
Sbjct  88    VSMLTRFRGLKPREYAAIKDCLEEVSDSVDRLSKSVKELKKLGPARGPEFVWHMSNLQTW  147

Query  932   ITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             ++ AL D   C +G +   +N   + +++ ++  VA +T N L L  +FA
Sbjct  148   VSAALTDDSTCMDGFSGRAMNGRIKSSIRARMTHVAQVTSNALALCNRFA  197


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/164 (23%), Positives = 79/164 (48%), Gaps = 0/164 (0%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
             T FI++SC  T +P++C  SL + A  I  +PK+L   A+S++    + T   +  +  
Sbjct  34   TTSFIRTSCRATTYPSVCVQSLYTHAAAIKKSPKQLVTTALSVSVEKAQSTKTFVSMLTR  93

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              GL P+E  +I  C +    S+  +  S+  L+ +   +G +    + +++ W+ +  +
Sbjct  94   FRGLKPREYAAIKDCLEEVSDSVDRLSKSVKELKKLGPARGPEFVWHMSNLQTWVSAALT  153

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +  +C++      +  ++   +   M  +   +  ALAL + FA
Sbjct  154  DDSTCMDGFSGRAMNGRIKSSIRARMTHVAQVTSNALALCNRFA  197



>ref|XP_009372896.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 88/160 (55%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T Y +LC  SL  H   I    +L+A  A+   L  ++S + M+ K++Q+ 
Sbjct  40    EFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKSTSIMMLKLSQSH  99

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E+++DS+  ++ S+ EM + +   F+  IS ++  ++ AL D   C
Sbjct  100   GMKPREVGAMRDCVEELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWVSAALTDETTC  159

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N   +  V+ +I  +A +T N L L+ ++A+
Sbjct  160   SDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYAS  199


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 87/178 (49%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + N +F+K+SC  T +  +C  SLSS A  I  +PK +A  A+++T  + + T
Sbjct  29   AARDLAQKTNNEFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKST  88

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   G+ P+E  ++  C +    S+  +Q S++ +      +  D   +I D+
Sbjct  89   SIMMLKLSQSHGMKPREVGAMRDCVEELSDSVDAIQRSIAEM---GNFRSSDFQLMISDV  145

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++  +C +      +   +   V   +  +   +  +LAL + +A+ +HG
Sbjct  146  QTWVSAALTDETTCSDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYAS-VHG  202



>ref|XP_011041732.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 93/163 (57%), Gaps = 3/163 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI+TSC    YP LC  SL  H   I    +LLA+AA+N  L  ++S +  ++ ++
Sbjct  35    SSTEFIRTSCSTATYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTTISTLS  94

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             Q   + P   + MK C+E+++D++++L  S+ EM H +   F+  I  ++  ++ AL D 
Sbjct  95    QTHGMKPREVSAMKDCVEELSDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDE  154

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + C +G     +N   + +V+ +I  +A +T N L L+  +A+
Sbjct  155   NTCSDGFAGNAMNGNLKTSVRGRIVNIARLTSNALALINYYAS  197


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 89/175 (51%), Gaps = 5/175 (3%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +AA    + +T+FI++SC    +P +CY SLS  +  I  +PK LA  A+++T  + + T
Sbjct  27   SAARVTTKSSTEFIRTSCSTATYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKST  86

Query  614  VRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
               +  ++   G+ P+E  ++  C E+LS      + +   +++ ++  +  +  ++IDD
Sbjct  87   STTISTLSQTHGMKPREVSAMKDCVEELSDA----VNELGKSMDEMSHARQSNFQSMIDD  142

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++ W+ +  ++  +C +      +   +   V   +  +   +  ALAL + +A+
Sbjct  143  VQTWVSAALTDENTCSDGFAGNAMNGNLKTSVRGRIVNIARLTSNALALINYYAS  197



>ref|XP_008376261.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=194

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+TSC  T YP++C  SL  +   I +    LA AA++ +L  ++S    V K+A+ K 
Sbjct  31    FIETSCRATTYPQVCIQSLSSYANSIQQSPRQLAQAALSVSLTKAKSAKTFVTKLAKFKG  90

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L       +K CLE++ DS+ ++  S+ E+K++   K   F   +S +E  ++ AL D +
Sbjct  91    LKSREYGAIKDCLEEMGDSVDRMSKSVTELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  150

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G +   LN   + +V+ Q+  VA  T N L L  +FA 
Sbjct  151   TCLDGFSGKALNGKIKSSVRAQVLNVAQCTSNALALCNRFAG  192


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 86/166 (52%), Gaps = 1/166 (1%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FI++SC  T +P +C  SLSS A  I  +P++LA+ A+S++    +     + ++A   
Sbjct  30   NFIETSCRATTYPQVCIQSLSSYANSIQQSPRQLAQAALSVSLTKAKSAKTFVTKLAKFK  89

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            GL  +E  +I  C +    S+  M  S++ L+ + + KG D    + +++ W+ +  ++ 
Sbjct  90   GLKSREYGAIKDCLEEMGDSVDRMSKSVTELKNMGKSKGQDFLWHMSNVETWVSAALTDD  149

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
             +C++    + +  K+   V   +  +   +  ALAL + F AG H
Sbjct  150  NTCLDGFSGKALNGKIKSSVRAQVLNVAQCTSNALALCNRF-AGNH  194



>ref|XP_002264799.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
Length=201

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 88/166 (53%), Gaps = 3/166 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T++I+TSC  T YP LC  SL  +  +I    + LA  A++ A   +RS    + ++++ 
Sbjct  34    TDYIKTSCLATTYPHLCYDSLSIYANKIQTSPKRLATTALSVASSSARSTLVSMKQLSKT  93

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P  A+ M  C+E+V DS+ +L  S+ EM H   P FE ++  I+  ++ AL D + 
Sbjct  94    HGLKPREASAMIDCVEEVADSVDELHKSIGEMGHAGGPDFEFRMGNIQTWVSAALTDEET  153

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFPG  774
             C +G     +N   +  V+  I  VA +T N L L+ K+A+   P 
Sbjct  154   CTDGFAGRAMNGNLKKTVQRHINKVARLTSNALALVNKYASTHTPA  199


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 85/165 (52%), Gaps = 3/165 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NTD+IK+SC  T +P++CY SLS  A  I  +PKRLA  A+S+   +   T+  M +++ 
Sbjct  33   NTDYIKTSCLATTYPHLCYDSLSIYANKIQTSPKRLATTALSVASSSARSTLVSMKQLSK  92

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              GL P+E  ++  C +    S+  +  S+  +       G D    + +I+ W+ +  +
Sbjct  93   THGLKPREASAMIDCVEEVADSVDELHKSIGEM---GHAGGPDFEFRMGNIQTWVSAALT  149

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + E+C +      +   + + V R + ++   +  ALAL + +A+
Sbjct  150  DEETCTDGFAGRAMNGNLKKTVQRHINKVARLTSNALALVNKYAS  194



>gb|AIT42251.1| pectinmethylesterase inhibitor [Solanum tuberosum]
Length=196

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 97/166 (58%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSEL-LAHAAVNAALDISRSLTGMVAKVAQ  1086
             T FI++SC+ T +P++C  SL  + + I K+S+L L   A++ +LD + S  G V+K+ +
Sbjct  30    TSFIKSSCKSTTFPDVCVASLSGYAQAI-KNSQLQLVKTALSVSLDKAESTKGFVSKLLK  88

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKC----PGFEGKISYIENLITTAL  918
              K L P     +K C+E+ NDS+++L  S+ E+K L+       F+  ++ ++  ++ A+
Sbjct  89    FKGLKPREYAAIKDCVEETNDSVNRLNRSVNELKGLERNHGKADFQWHMNNVKTWVSAAI  148

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D + C +G     LN   + +++  IA +A +T N L L+ ++AA
Sbjct  149   TDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 84/171 (49%), Gaps = 13/171 (8%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC  T FP++C ASLS  A  I  +  +L K A+S++    E T   + ++   
Sbjct  30   TSFIKSSCKSTTFPDVCVASLSGYAQAIKNSQLQLVKTALSVSLDKAESTKGFVSKLLKF  89

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGI-------DLHTIIDDIKEW  426
             GL P+E  +I  C + ++ S+  +  S      +NELKG+       D    ++++K W
Sbjct  90   KGLKPREYAAIKDCVEETNDSVNRLNRS------VNELKGLERNHGKADFQWHMNNVKTW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++  +C +      +  K+   +   +  +   +  ALAL + +AA
Sbjct  144  VSAAITDENTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194



>ref|XP_004298672.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=197

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 93/170 (55%), Gaps = 5/170 (3%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             A      TE+I+TSC  T YP+LC  SL  +  +I    ++LAH A+N  L  +++ + +
Sbjct  27    ASSSKVNTEYIKTSCSVTLYPKLCYTSLSIYAGKIKTSPKVLAHTALNVTLRATKATSAV  86

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL--KCPGFEGKISYIENLI  930
             + + ++   L P        C+E+++D++ +L+ S+ E+ H       F  +IS I+  +
Sbjct  87    INRCSKVHGLKPIEVAATLDCVEEISDALDELRKSIGELGHAVKGSRSFLFQISDIQTWV  146

Query  929   TTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + AL D D C +G ++  LN   E  V+ +I  +AH+T N L L+  +A+
Sbjct  147   SAALTDEDTCLDGFDEPKLNGRVETIVRREITKIAHLTSNALALINNYAS  196


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 92/175 (53%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AAA    + NT++IK+SC  T +P +CY SLS  A  I  +PK LA  A+++T R T+ T
Sbjct  24   AAAASSSKVNTEYIKTSCSVTLYPKLCYTSLSIYAGKIKTSPKVLAHTALNVTLRATKAT  83

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTI-IDD  438
               +   +   GL P E  +   C +    ++  ++ S+  L   + +KG       I D
Sbjct  84   SAVINRCSKVHGLKPIEVAATLDCVEEISDALDELRKSIGELG--HAVKGSRSFLFQISD  141

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            I+ W+ +  ++ ++C++  +  ++  +V   V R + ++   +  ALAL +++A+
Sbjct  142  IQTWVSAALTDEDTCLDGFDEPKLNGRVETIVRREITKIAHLTSNALALINNYAS  196



>ref|XP_009374505.1| PREDICTED: 21 kDa protein [Pyrus x bretschneideri]
Length=195

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 86/162 (53%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+TSC  T YP++C  SL  +   I +    LA A+++ +L  ++S    V K+A+ K 
Sbjct  32    FIETSCRATTYPQVCIQSLSSYATSIQQSPRQLAQASLSVSLTRAKSAKTFVTKLAKFKG  91

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L       +K CLE++ DS+ +L  S+ E+K +   K   F   +S +E  ++ AL D +
Sbjct  92    LKSREYGAIKDCLEEMGDSVDRLSKSVTELKDMGKSKGQDFLWHMSNVETWVSAALTDDN  151

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G +   LN   + +V+ Q+  VA  T N L L  +FA 
Sbjct  152   TCLDGFSGKALNGKIKSSVRAQVLNVAQCTSNALALCNRFAG  193


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 86/166 (52%), Gaps = 1/166 (1%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FI++SC  T +P +C  SLSS A  I  +P++LA+ ++S++    +     + ++A   
Sbjct  31   NFIETSCRATTYPQVCIQSLSSYATSIQQSPRQLAQASLSVSLTRAKSAKTFVTKLAKFK  90

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            GL  +E  +I  C +    S+  +  S++ L+ + + KG D    + +++ W+ +  ++ 
Sbjct  91   GLKSREYGAIKDCLEEMGDSVDRLSKSVTELKDMGKSKGQDFLWHMSNVETWVSAALTDD  150

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
             +C++    + +  K+   V   +  +   +  ALAL + F AG H
Sbjct  151  NTCLDGFSGKALNGKIKSSVRAQVLNVAQCTSNALALCNRF-AGKH  195



>ref|XP_009362113.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=205

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 90/170 (53%), Gaps = 6/170 (4%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              + +++T+FI+ SC  T YP LC  SL  +   I +    LA  A+  +L   RS    V
Sbjct  32    ARHSSSTDFIKASCRTTQYPALCVQSLAAYASAIRQSERQLAETALTVSLARVRSAASFV  91

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKISYIENLI  930
              K+ + + + P     +K C+E + DS+ +L  S+ E+ H+ +  G  F   +S +E  +
Sbjct  92    TKLTRVRGIKPRECRAVKDCIENMGDSVDRLGQSVRELGHMGRAFGQDFMWHMSNVETWV  151

Query  929   TTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + AL D   C +G +   ++   + A++ ++  VAH+T N L L+ +FAA
Sbjct  152   SAALTDEGTCLDGFSGRFMDGNIKNAIRRRVNNVAHVTSNALALVNRFAA  201


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/166 (22%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
             +TDFIK+SC  T +P +C  SL++ A  I  + ++LA+ A++++          + ++ 
Sbjct  36   SSTDFIKASCRTTQYPALCVQSLAAYASAIRQSERQLAETALTVSLARVRSAASFVTKLT  95

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
               G+ P+E  ++  C +    S+  +  S+  L  +    G D    + +++ W+ +  
Sbjct  96   RVRGIKPRECRAVKDCIENMGDSVDRLGQSVRELGHMGRAFGQDFMWHMSNVETWVSAAL  155

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++  +C++      +   +   + R +  +   +  ALAL + FAA
Sbjct  156  TDEGTCLDGFSGRFMDGNIKNAIRRRVNNVAHVTSNALALVNRFAA  201



>ref|XP_009779184.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=215

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 93/167 (56%), Gaps = 4/167 (2%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             +T T+EFI  SC  T Y +LC  +L  +   I  + + LA+AA+  +L  ++S T  ++K
Sbjct  49    ETNTSEFITNSCGTTLYSKLCIETLSPYSNSIQTNPKELANAALTVSLKGAKSTTNKISK  108

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALI  915
             +++ + L       +  C+E + DS+ +L+ SL+EMK+L  P FE K+  +   ++ AL 
Sbjct  109   MSKEQDLGLAETHALTDCVENMEDSVVELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALT  168

Query  914   DYDRCPNGMNDTG-LNE---PAVKDQIAMVAHMTLNGLTLMKKFAAA  786
             D D C +G    G +NE     +++ I  VA +T N L L K  +++
Sbjct  169   DEDTCMDGFEGNGNMNEKVRATIRNYIVNVAQLTSNALALTKNLSSS  215


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/159 (23%), Positives = 80/159 (50%), Gaps = 4/159 (3%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FI +SC  T +  +C  +LS  +  I  NPK LA  A++++ +  + T  ++ +++ +
Sbjct  53   SEFITNSCGTTLYSKLCIETLSPYSNSIQTNPKELANAALTVSLKGAKSTTNKISKMSKE  112

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L   E  ++  C +    S++ +Q SL  ++ +N   G D    + ++  W+ +  ++
Sbjct  113  QDLGLAETHALTDCVENMEDSVVELQKSLLEMKNLN---GPDFEEKMGNVMTWVSAALTD  169

Query  404  YESCIEELETE-QIKEKVTEEVTRLMREMEPFSEIALAL  291
             ++C++  E    + EKV   +   +  +   +  ALAL
Sbjct  170  EDTCMDGFEGNGNMNEKVRATIRNYIVNVAQLTSNALAL  208



>ref|XP_002510932.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51534.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=196

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP LC  SL  +   I ++   L   A++ +L+ ++S    V K+ + K 
Sbjct  33    FIKASCRTTTYPALCIQSLSAYATSIQQNPLQLTQTALSVSLENAQSTRTFVYKLTKFKG  92

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMK---HLKCPGFEGKISYIENLITTALIDYD  906
             + P     +K CLE+++D+  +L  S  E+K   H K   F+  +S +E  ++ AL D +
Sbjct  93    VKPREMAALKDCLEEIDDTADRLSKSYNELKNLGHYKGKDFQWHMSNVETWVSAALTDEN  152

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G     LN   + ++K +I  VA +T N L+L+ K+A+
Sbjct  153   TCTDGFAGKALNGKMKSSIKARIVKVAQVTSNALSLINKYAS  194


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 81/163 (50%), Gaps = 0/163 (0%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FIK+SC  T +P +C  SLS+ A  I  NP +L + A+S++    + T   + ++    
Sbjct  32   NFIKASCRTTTYPALCIQSLSAYATSIQQNPLQLTQTALSVSLENAQSTRTFVYKLTKFK  91

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            G+ P+E  ++  C +    +   +  S + L+ +   KG D    + +++ W+ +  ++ 
Sbjct  92   GVKPREMAALKDCLEEIDDTADRLSKSYNELKNLGHYKGKDFQWHMSNVETWVSAALTDE  151

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +C +    + +  K+   +   + ++   +  AL+L + +A+
Sbjct  152  NTCTDGFAGKALNGKMKSSIKARIVKVAQVTSNALSLINKYAS  194



>ref|XP_010093663.1| 21 kDa protein [Morus notabilis]
 gb|EXB54443.1| 21 kDa protein [Morus notabilis]
Length=222

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 97/180 (54%), Gaps = 17/180 (9%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
             G+    T+F++TSC  T YP+LC  +L  H  +I +  +LLA AA++  L   RS +  +
Sbjct  39    GEHDTNTQFVKTSCGATSYPDLCFTTLSCHASQIKRSPKLLATAALSETLKTVRSASTAM  98

Query  1100  AKVAQNKS---LPPEAATNMKHCLEQVNDSIHKLKMSLVEM-------KHLKCPGFEGKI  951
             +K+++ K+   L P  A  +  C+E++ DS+ +L+ S+ EM       ++     F  ++
Sbjct  99    SKLSKAKTRHGLTPRDAEALSDCVEELRDSVEELQRSIEEMGVGFRKKENNGTSEFGLRM  158

Query  950   SYIENLITTALIDYDRCPNGMNDTGLNEPA-------VKDQIAMVAHMTLNGLTLMKKFA  792
             S IE  ++ AL D D C +G ++  +N  +       V+  I  VAHMT N L L+  +A
Sbjct  159   SDIETWVSAALTDEDTCVDGFSEKFMNGSSGSAIKSNVRGHIMNVAHMTRNALALVNHYA  218


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 71/141 (50%), Gaps = 21/141 (15%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA-  591
            NT F+K+SC  T +P++C+ +LS  A  I  +PK LA  A+S T +T       M +++ 
Sbjct  44   NTQFVKTSCGATSYPDLCFTTLSCHASQIKRSPKLLATAALSETLKTVRSASTAMSKLSK  103

Query  590  --GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGI-----------DLHT  450
               + GL+P++  ++  C       +  ++DS+  L+   E  G+           +   
Sbjct  104  AKTRHGLTPRDAEALSDC-------VEELRDSVEELQRSIEEMGVGFRKKENNGTSEFGL  156

Query  449  IIDDIKEWLKSVKSNYESCIE  387
             + DI+ W+ +  ++ ++C++
Sbjct  157  RMSDIETWVSAALTDEDTCVD  177



>ref|XP_007038423.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
 gb|EOY22924.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
Length=230

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP LC  SL      I +    LA  A+N +L  ++S    V+K+ + K 
Sbjct  67    FIKASCSATKYPALCVQSLAAFAPSIQQSPRQLAQTALNVSLARAQSTEAFVSKMKKFKG  126

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L       +K C+E+++DS+ +L  S+ E+KH+   K   F   +S +E  ++ AL D  
Sbjct  127   LEKREYEAIKDCIEEMSDSVDRLSKSVQELKHMGQAKGQDFLWHVSNVETWVSAALTDES  186

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G    GL+   + +++ ++  VA +T N L+L+ +FA+
Sbjct  187   TCVDGFASQGLDGKVKASIRARVMNVAQVTSNALSLVNQFAS  228


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 88/166 (53%), Gaps = 6/166 (4%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGEIA  591
            +FIK+SC  T +P +C  SL++ A  I  +P++LA+ A++++    ++TE  V +M +  
Sbjct  66   NFIKASCSATKYPALCVQSLAAFAPSIQQSPRQLAQTALNVSLARAQSTEAFVSKMKKFK  125

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
               GL  +E  +I  C +    S+  +  S+  L+ + + KG D    + +++ W+ +  
Sbjct  126  ---GLEKREYEAIKDCIEEMSDSVDRLSKSVQELKHMGQAKGQDFLWHVSNVETWVSAAL  182

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++  +C++   ++ +  KV   +   +  +   +  AL+L + FA+
Sbjct  183  TDESTCVDGFASQGLDGKVKASIRARVMNVAQVTSNALSLVNQFAS  228



>ref|XP_009799203.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=393

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 94/173 (54%), Gaps = 6/173 (3%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G A      T FI++SC+ T YP +C  SL  +   I +  + LA  A++ +L  ++S  
Sbjct  219   GTANSAPVATSFIKSSCKFTTYPVVCVTSLAGYAPAIKRSPQQLAQTALSVSLTRAQSTQ  278

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIE  939
               V K+ + K L P     +K C+EQ++D+I ++  S+ E+K++   +   F+  +S IE
Sbjct  279   AFVNKLRKFKGLKPREYAALKDCVEQMSDTIDRISKSVKELKNMGSARGKDFQWHMSNIE  338

Query  938   NLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               I+ AL D + C +G +   LN   + +++ ++  V  +T N L L+ +FAA
Sbjct  339   TWISAALTDENTCGDGFSGKALNGRIKASIRARVTHVTQVTSNALALINQFAA  391


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/175 (25%), Positives = 85/175 (49%), Gaps = 5/175 (3%)
 Frame = -1

Query  782  FPGREN-----TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            F G  N     T FIKSSC  T +P +C  SL+  A  I  +P++LA+ A+S++    + 
Sbjct  217  FSGTANSAPVATSFIKSSCKFTTYPVVCVTSLAGYAPAIKRSPQQLAQTALSVSLTRAQS  276

Query  617  TVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
            T   + ++    GL P+E  ++  C +    +I  +  S+  L+ +   +G D    + +
Sbjct  277  TQAFVNKLRKFKGLKPREYAALKDCVEQMSDTIDRISKSVKELKNMGSARGKDFQWHMSN  336

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            I+ W+ +  ++  +C +    + +  ++   +   +  +   +  ALAL + FAA
Sbjct  337  IETWISAALTDENTCGDGFSGKALNGRIKASIRARVTHVTQVTSNALALINQFAA  391



>ref|XP_009370483.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 88/160 (55%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T Y +LC  SL  H   I    +L+A  A+   L  ++S + ++ K++Q+ 
Sbjct  40    EFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKSTSIIMLKLSQSH  99

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E+++DS+  ++ S+ EM + +   F+  IS ++  ++ AL D   C
Sbjct  100   GMKPREVGAMRDCVEELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWVSAALTDETTC  159

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G     +N   +  V+ +I  +A +T N L L+ ++A+
Sbjct  160   SDGFGGNLMNGNLKTIVRGRIVNIAQLTSNSLALVNRYAS  199


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 87/178 (49%), Gaps = 4/178 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + N +F+K+SC  T +  +C  SLSS A  I  +PK +A  A+++T  + + T
Sbjct  29   AARDLAQKTNNEFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKST  88

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M +++   G+ P+E  ++  C +    S+  +Q S++ +      +  D   +I D+
Sbjct  89   SIIMLKLSQSHGMKPREVGAMRDCVEELSDSVDAIQRSIAEM---GNFRSSDFQLMISDV  145

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            + W+ +  ++  +C +      +   +   V   +  +   +  +LAL + +A+ +HG
Sbjct  146  QTWVSAALTDETTCSDGFGGNLMNGNLKTIVRGRIVNIAQLTSNSLALVNRYAS-VHG  202



>ref|XP_009370484.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=194

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI  SC  T YPE+C  SL  +   I ++   LA AA++ +L  ++S    V K+A+ K 
Sbjct  31    FISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLKKAQSAKTFVTKLAKFKG  90

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L       +K C+E++ D++ +L  S+ E+K++   K   F   +S +E  ++ AL D +
Sbjct  91    LKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  150

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G +   LN   + AV+ Q+  VA  T N L+L  +FA 
Sbjct  151   TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFAG  192


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 85/166 (51%), Gaps = 1/166 (1%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FI  SC  T +P +C  SLSS A  I  NP+RLA+ A+S++ +  +     + ++A   
Sbjct  30   NFISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLKKAQSAKTFVTKLAKFK  89

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            GL  +E  +I  C +    ++  + +S+  L+ + + KG D    + +++ W+ +  ++ 
Sbjct  90   GLKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDD  149

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
             +C++    + +  K+   V   +  +   +  AL+L + F AG H
Sbjct  150  NTCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRF-AGKH  194



>ref|XP_002264891.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CAN71118.1| hypothetical protein VITISV_041020 [Vitis vinifera]
Length=204

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 90/162 (56%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A  EFI+TSC  T YP+LC+ SL  +  +I    ++LA  A++ AL  + S +  + K++
Sbjct  36    AYAEFIKTSCRTTTYPQLCTSSLLSYASKIQTSPKILADTALSIALATAHSTSTAITKLS  95

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             + +SL P  A  ++ C+E + DS  +L+MS+ EM+H +   F  ++S I+  ++ AL + 
Sbjct  96    KTQSLKPGEAAAIRDCVEVLGDSEDELQMSIQEMEHPEGKSFGLQMSDIQTWVSAALTND  155

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             D C +      +N   +  V+  I  VA MT   L L+  +A
Sbjct  156   DTCMDSFAGNAMNGNVKTIVRGYILHVAQMTSVALALINNYA  197


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 83/175 (47%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA   P     +FIK+SC  T +P +C +SL S A  I  +PK LA  A+S+   T   T
Sbjct  28   AARPSPNEAYAEFIKTSCRTTTYPQLCTSSLLSYASKIQTSPKILADTALSIALATAHST  87

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               + +++    L P E  +I  C ++   S   +Q S+  +E     +G      + DI
Sbjct  88   STAITKLSKTQSLKPGEAAAIRDCVEVLGDSEDELQMSIQEME---HPEGKSFGLQMSDI  144

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAG  270
            + W+ +  +N ++C++      +   V   V   +  +   + +ALAL +++A G
Sbjct  145  QTWVSAALTNDDTCMDSFAGNAMNGNVKTIVRGYILHVAQMTSVALALINNYALG  199



>gb|KGN57276.1| hypothetical protein Csa_3G176245 [Cucumis sativus]
Length=194

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI++SC  T YP LC  SL  H   I     LLA AA++ +L   +S    + K++
Sbjct  30    SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
              +  LP    + +  CLE+++DS+  L  S+ EM  L+   F+  +S ++  ++ AL D 
Sbjct  90    HSHGLPSRDVSALDDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C  G     +N   + AV+ +I  +A +T N L+L+ + A
Sbjct  150   TTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIA  191


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 89/167 (53%), Gaps = 5/167 (3%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T+FIKSSC  T +P +C++SLS  A  I  +P+ LA  A+S++  + + T  ++ ++
Sbjct  29   QSSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKL  88

Query  593  AGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +   GL  ++  ++  C E+LS  S+  +  S+S +    +L+G +    + +++ W+ +
Sbjct  89   SHSHGLPSRDVSALDDCLEELS-DSVDSLAASISEMP---KLRGTNFDLAMSNVQTWVSA  144

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              ++  +C E  + + +   V   V   +  +   +  AL+L +  A
Sbjct  145  ALTDETTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIA  191



>ref|NP_001235143.1| uncharacterized protein LOC100527116 precursor [Glycine max]
 gb|ACU16163.1| unknown [Glycine max]
 gb|KHN20594.1| 21 kDa protein [Glycine soja]
Length=198

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 87/161 (54%), Gaps = 5/161 (3%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ +++    VA   + + 
Sbjct  36    FIKSSCSSTQYPALCVSSLSVYASSIQQDPHQLVQTALSLSLNRTQATKTFVANCNKFRG  95

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDYDR  903
             L P     +K C E+++DS+ +L  SL E+K  K  G  F   IS +E  +++AL D   
Sbjct  96    LKPREHAALKDCAEEISDSVDRLSRSLKELKLCKVKGEDFTWHISNVETWVSSALTDEST  155

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G +   LN   + +++ ++  VA +T N L+L+  +AA
Sbjct  156   CGDGFSGKALNGKIKDSIRARMLNVAQVTSNALSLINHYAA  196


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 83/162 (51%), Gaps = 1/162 (1%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIKSSC  T +P +C +SLS  A  I  +P +L + A+SL+   T+ T   +       G
Sbjct  36   FIKSSCSSTQYPALCVSSLSVYASSIQQDPHQLVQTALSLSLNRTQATKTFVANCNKFRG  95

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            L P+E+ ++  C +    S+  +  SL  L+ + ++KG D    I +++ W+ S  ++  
Sbjct  96   LKPREHAALKDCAEEISDSVDRLSRSLKELK-LCKVKGEDFTWHISNVETWVSSALTDES  154

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +C +    + +  K+ + +   M  +   +  AL+L + +AA
Sbjct  155  TCGDGFSGKALNGKIKDSIRARMLNVAQVTSNALSLINHYAA  196



>gb|EYU43527.1| hypothetical protein MIMGU_mgv1a024700mg, partial [Erythranthe 
guttata]
Length=181

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI++SC  T YP +C  SL  H   I K    L   A+  ++D +RS    VA +A+ + 
Sbjct  18    FIRSSCRATTYPAVCVQSLSPHATTIQKSPGQLVTTALTVSVDRARSAKVFVANLAKFRG  77

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L P     +K CLE+V DS+ +L  S+ E+K++   + P +   +S ++  ++ AL D  
Sbjct  78    LKPRERAALKDCLEEVTDSVDRLSKSIQELKNMGRARGPDYVWHMSNLQTWVSAALTDDS  137

Query  905   RCPNGMNDT---GLNEPAVKDQIAMVAHMTLNGLTLMKKFA  792
              C +G       G  + +++ ++  VA +T N L L  KFA
Sbjct  138   TCMDGFAGRVMEGRVKTSIRARMTNVAQVTSNALALCNKFA  178


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/161 (23%), Positives = 76/161 (47%), Gaps = 0/161 (0%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FI+SSC  T +P +C  SLS  A  I  +P +L   A++++          +  +A   G
Sbjct  18   FIRSSCRATTYPAVCVQSLSPHATTIQKSPGQLVTTALTVSVDRARSAKVFVANLAKFRG  77

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            L P+E  ++  C +    S+  +  S+  L+ +   +G D    + +++ W+ +  ++  
Sbjct  78   LKPRERAALKDCLEEVTDSVDRLSKSIQELKNMGRARGPDYVWHMSNLQTWVSAALTDDS  137

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +C++      ++ +V   +   M  +   +  ALAL + FA
Sbjct  138  TCMDGFAGRVMEGRVKTSIRARMTNVAQVTSNALALCNKFA  178



>ref|XP_009372897.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=194

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI  SC  T YPE+C  SL  +   I ++   LA AA++ +L  ++S    V ++A+ K 
Sbjct  31    FISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLTKAQSAKTFVTRLAKFKG  90

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L       +K C+E++ D++ +L  S+ E+K++   K   F   +S +E  ++ AL D +
Sbjct  91    LKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  150

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G +   LN   + AV+ Q+  VA  T N L+L  +FA 
Sbjct  151   TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFAG  192


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 83/166 (50%), Gaps = 1/166 (1%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FI  SC  T +P +C  SLSS A  I  NP+RLA+ A+S++    +     +  +A   
Sbjct  30   NFISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLTKAQSAKTFVTRLAKFK  89

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            GL  +E  +I  C +    ++  + +S+  L+ + + KG D    + +++ W+ +  ++ 
Sbjct  90   GLKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDD  149

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
             +C++    + +  K+   V   +  +   +  AL+L + F AG H
Sbjct  150  NTCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRF-AGKH  194



>ref|XP_004148163.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=171

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI++SC  T YP LC  SL  H   I     LLA AA++ +L   +S    + K++
Sbjct  7     SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  66

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
              +  LP    + +  CLE+++DS+  L  S+ EM  L+   F+  +S ++  ++ AL D 
Sbjct  67    HSHGLPSRDVSALNDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  126

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C  G     +N   + AV+ +I  +A +T N L+L+ +  
Sbjct  127   TTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIG  168


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 88/163 (54%), Gaps = 5/163 (3%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T+FIKSSC  T +P +C++SLS  A  I  +P+ LA  A+S++  + + T  ++ ++
Sbjct  6    QSSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKL  65

Query  593  AGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +   GL  ++  +++ C E+LS  S+  +  S+S +    +L+G +    + +++ W+ +
Sbjct  66   SHSHGLPSRDVSALNDCLEELS-DSVDSLAASISEMP---KLRGTNFDLAMSNVQTWVSA  121

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALF  288
              ++  +C E  + + +   V   V   +  +   +  AL+L 
Sbjct  122  ALTDETTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLI  164



>gb|KDP25617.1| hypothetical protein JCGZ_20773 [Jatropha curcas]
Length=204

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 88/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T++I+TSC  T YP LC  SL  +  +I  + +LL + A+N  L  ++S + ++ ++++ 
Sbjct  38    TQYIKTSCTNTTYPRLCYHSLSIYASKIKTNPKLLTNIALNVTLKATKSTSRLMKRLSRI  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L    A  +  C+E V DS+++L+ S+ EM   +   F   I  I+  ++ AL D D 
Sbjct  98    HGLKRREAAALVDCVEVVGDSVYELQRSIGEMGQAEGSKFAQVIDDIQTWVSAALTDDDT  157

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAAA  786
             C +G ++  +N       +  +  +AH+T N L L+  FA++
Sbjct  158   CMDGFSEVSMNRKVKIIARKHLLKIAHLTSNALALINNFASS  199


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 99/193 (51%), Gaps = 4/193 (2%)
 Frame = -1

Query  845  AMVAHMTLNGLTLMKKFAAAG-FPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANP  669
            A+VA +TL   T +     +   P   NT +IK+SC  T +P +CY SLS  A  I  NP
Sbjct  10   ALVAILTLQFSTHINSIEPSKPLPNNTNTQYIKTSCTNTTYPRLCYHSLSIYASKIKTNP  69

Query  668  KRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNL  489
            K L   A+++T + T+ T R M  ++   GL  +E  ++  C ++   S+  +Q S+  +
Sbjct  70   KLLTNIALNVTLKATKSTSRLMKRLSRIHGLKRREAAALVDCVEVVGDSVYELQRSIGEM  129

Query  488  ETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFS  309
                + +G     +IDDI+ W+ +  ++ ++C++      +  KV     + + ++   +
Sbjct  130  ---GQAEGSKFAQVIDDIQTWVSAALTDDDTCMDGFSEVSMNRKVKIIARKHLLKIAHLT  186

Query  308  EIALALFSSFAAG  270
              ALAL ++FA+ 
Sbjct  187  SNALALINNFASS  199



>emb|CAA72315.1| putative 21kD protein precursor [Medicago sativa subsp. x varia]
Length=187

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 85/162 (52%), Gaps = 5/162 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ ++S    V K    
Sbjct  23    TNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKSFVTKCKSF  82

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             + L P     +  C+E++ DS+ +L+ SL  +K  K  G  F   IS +E  +++AL D 
Sbjct  83    RGLKPREYAALHDCVEEITDSVDRLRRSLKGLKLCKIQGEDFSWHISNVETWVSSALTDE  142

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G     L+   + +++ ++  VA +T N L+L+ ++A
Sbjct  143   STCSDGFGGKALDGRMKASIRSRMVNVAQVTSNALSLINQYA  184


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 84/163 (52%), Gaps = 1/163 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS  A  I  +P +L + A+SL+   T+ T   + +    
Sbjct  23   TNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKSFVTKCKSF  82

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  ++H C +    S+  ++ SL  L+ + +++G D    I +++ W+ S  ++
Sbjct  83   RGLKPREYAALHDCVEEITDSVDRLRRSLKGLK-LCKIQGEDFSWHISNVETWVSSALTD  141

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              +C +    + +  ++   +   M  +   +  AL+L + +A
Sbjct  142  ESTCSDGFGGKALDGRMKASIRSRMVNVAQVTSNALSLINQYA  184



>ref|XP_008234382.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=194

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 90/167 (54%), Gaps = 6/167 (4%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T+ T FI++SC  T YP++C  SL  +   I +    LA AA++ +L  ++     V K+
Sbjct  26    TSDTNFIKSSCSATTYPQVCIQSLSSYATSIQQSPRQLAQAALSVSLTRAQKAKTFVTKL  85

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTA  921
             A+ K L       +K CLE++ D++ +L  S+ E+K++   K   F   +S +E  ++ A
Sbjct  86    AKFKGLKAREYGALKDCLEEMGDTVDRLSKSVQELKNMGKSKGQDFVWHMSNVETWVSAA  145

Query  920   LIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             L D + C +G +   L+   + +++ Q+  VA  T N L L  +FA+
Sbjct  146   LTDDNTCLDGFSGKALDGKIKASIRAQVLNVAQCTSNALALCNRFAS  192


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 86/166 (52%), Gaps = 0/166 (0%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
             +T+FIKSSC  T +P +C  SLSS A  I  +P++LA+ A+S++    +     + ++A
Sbjct  27   SDTNFIKSSCSATTYPQVCIQSLSSYATSIQQSPRQLAQAALSVSLTRAQKAKTFVTKLA  86

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
               GL  +E  ++  C +    ++  +  S+  L+ + + KG D    + +++ W+ +  
Sbjct  87   KFKGLKAREYGALKDCLEEMGDTVDRLSKSVQELKNMGKSKGQDFVWHMSNVETWVSAAL  146

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++  +C++    + +  K+   +   +  +   +  ALAL + FA+
Sbjct  147  TDDNTCLDGFSGKALDGKIKASIRAQVLNVAQCTSNALALCNRFAS  192



>ref|XP_007039950.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24451.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=205

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 90/161 (56%), Gaps = 3/161 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             E+I+ SC GT YP+LC  SL +H  +I  D +LLAHAA+N     +++ + ++A  ++  
Sbjct  42    EYIKNSCRGTTYPKLCLKSLARHASKIKADPKLLAHAALNTTFFAAKATSKLLAHTSKVH  101

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P  A  M  C+  V+DS+ KL+ S+ EM   +    + +++ I+  + TAL + + C
Sbjct  102   GLRPNEAAAMVDCIADVSDSVQKLQKSIKEMDRAEGSDLQVQMNDIQMWVNTALDEEETC  161

Query  899   PNGMNDTGLNE---PAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              N + +  +       V+ ++  VA +T N L L+K FA A
Sbjct  162   MNALANKAIRSKVKRGVRRRVVKVALLTSNALNLVKSFALA  202


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 82/164 (50%), Gaps = 3/164 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            N ++IK+SC  T +P +C  SL+  A  I A+PK LA  A++ T    + T + +   + 
Sbjct  40   NQEYIKNSCRGTTYPKLCLKSLARHASKIKADPKLLAHAALNTTFFAAKATSKLLAHTSK  99

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
              GL P E  ++  C      S+  +Q S+  ++     +G DL   ++DI+ W+ +   
Sbjct  100  VHGLRPNEAAAMVDCIADVSDSVQKLQKSIKEMD---RAEGSDLQVQMNDIQMWVNTALD  156

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              E+C+  L  + I+ KV   V R + ++   +  AL L  SFA
Sbjct  157  EEETCMNALANKAIRSKVKRGVRRRVVKVALLTSNALNLVKSFA  200



>ref|XP_008238630.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=200

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 90/163 (55%), Gaps = 4/163 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T++I+ SC  T YP LC  SL  +  +I  D ++LAH A+N  L  ++  + ++ ++++ 
Sbjct  33    TQYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIMRRLSEI  92

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKH-LKCPGFEGKISYIENLITTALIDYD  906
               L P     +  C+E++ D+I +L+ SL E+ H L+   F  ++S I+  ++ AL D D
Sbjct  93    HGLKPIETAAVHDCMEEIGDAIDELQQSLDELGHVLRGSNFWFQMSDIQTWVSAALTDED  152

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              C +G  +  L    E  V+     VAH+T N L L+  +A++
Sbjct  153   TCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYASS  195


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 91/171 (53%), Gaps = 8/171 (5%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTE---FTVRR  606
            G+ NT +IK SC  T +P +CY SLS  A  I  +PK LA  A+++T   T+     +RR
Sbjct  29   GKTNTQYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIMRR  88

Query  605  MGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEW  426
            + EI    GL P E  ++H C +    +I  +Q SL  L  +  L+G +    + DI+ W
Sbjct  89   LSEIH---GLKPIETAAVHDCMEEIGDAIDELQQSLDELGHV--LRGSNFWFQMSDIQTW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++ ++C++  E   ++ +V   V R    +   +  ALAL +S+A+
Sbjct  144  VSAALTDEDTCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYAS  194



>ref|XP_008387667.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=200

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 93/170 (55%), Gaps = 4/170 (2%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             A    + T++I+TSC  T YP LC  SL  +  +I  + + LAH A+N  +  ++  + +
Sbjct  24    ASPSRSNTQYIRTSCSVTNYPRLCYNSLSIYAGKIKTNPKALAHTALNVTIAATQETSVI  83

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPGFEGKISYIENLIT  927
             + ++++   L P        C+E++ D++ +L+ S+ E+ H+ +   F  ++S I+  ++
Sbjct  84    MRRLSKIHGLKPIEXAAALDCMEEIGDAVDELQNSIDELSHVXRGSNFWLQMSDIQTWVS  143

Query  926   TALIDYDRCPNGM---NDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              AL D D C +G    N +G  E  V+  I  VAH+T N L L+  +A+A
Sbjct  144   XALTDEDTCMDGFDEHNXSGRVENLVRRYIVNVAHLTCNALALINSYASA  193


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
            P R NT +I++SC  T +P +CY SLS  A  I  NPK LA  A+++T   T+ T   M 
Sbjct  26   PSRSNTQYIRTSCSVTNYPRLCYNSLSIYAGKIKTNPKALAHTALNVTIAATQETSVIMR  85

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
             ++   GL P E  +   C +    ++  +Q+S+  L  +   +G +    + DI+ W+ 
Sbjct  86   RLSKIHGLKPIEXAAALDCMEEIGDAVDELQNSIDELSHV--XRGSNFWLQMSDIQTWVS  143

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAG  270
               ++ ++C++  +      +V   V R +  +   +  ALAL +S+A+ 
Sbjct  144  XALTDEDTCMDGFDEHNXSGRVENLVRRYIVNVAHLTCNALALINSYASA  193



>ref|XP_006440386.1| hypothetical protein CICLE_v10022313mg [Citrus clementina]
 gb|ESR53626.1| hypothetical protein CICLE_v10022313mg [Citrus clementina]
 gb|KDO48402.1| hypothetical protein CISIN_1g028904mg [Citrus sinensis]
Length=202

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 90/165 (55%), Gaps = 4/165 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             E+I+TSC GT Y  LC  SL  +  +I  + + LA+ A+N  L  ++S + M+ K+++  
Sbjct  35    EYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIP  94

Query  1079  SL-PPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
              + P E A  +  C+E + DSI +L+ S+ E+ H++   F   +  ++  ++ AL   D 
Sbjct  95    GMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLTMGDVQTWVSAALTYEDT  154

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
             C +G+    LN   +  ++  I  VAH+T N L L+  +AA   P
Sbjct  155   CVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINSYAAGSNP  199


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 91/168 (54%), Gaps = 4/168 (2%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
             N ++I++SC  T +  +CY SLS  A  I +NPK LA  A+++T + T+ T R M +++
Sbjct  32   SNIEYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMS  91

Query  590  GKIGLSPKENM-SIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
               G+ P+E   ++  C ++   SI  +QDS+  L     ++  +    + D++ W+ + 
Sbjct  92   RIPGMIPRETAGAVADCIEVIGDSIDELQDSMDEL---GHIRNSNFWLTMGDVQTWVSAA  148

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAG  270
             +  ++C++ L+   +       + R + ++   +  ALAL +S+AAG
Sbjct  149  LTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINSYAAG  196



>ref|XP_004148138.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=194

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI++SC  T YP LC  SL  H   I     LLA AA++ +L   +S    + K++
Sbjct  30    SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
              +  LP    + +  CLE+++DS+  L  S+ EM  L+   F+  +S ++  ++ AL D 
Sbjct  90    HSHGLPSRDVSALNDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C  G     +N   +  V+ +I  +A +T N L+L+ + A
Sbjct  150   TTCSEGFQGKTVNGGVKAEVRTKIVNIAQLTSNALSLINRIA  191


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 91/167 (54%), Gaps = 5/167 (3%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T+FIKSSC  T +P +C++SLS  A  I  +P+ LA  A+S++  + + T  ++ ++
Sbjct  29   QSSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKL  88

Query  593  AGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +   GL  ++  +++ C E+LS  S+  +  S+S +    +L+G +    + +++ W+ +
Sbjct  89   SHSHGLPSRDVSALNDCLEELS-DSVDSLAASISEMP---KLRGTNFDLAMSNVQTWVSA  144

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              ++  +C E  + + +   V  EV   +  +   +  AL+L +  A
Sbjct  145  ALTDETTCSEGFQGKTVNGGVKAEVRTKIVNIAQLTSNALSLINRIA  191



>ref|XP_011101127.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=205

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 86/163 (53%), Gaps = 6/163 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             + FI+TSC+ T YP +C  SL  +   I K    L   A++ ++  + S    VAK+ + 
Sbjct  40    SSFIRTSCKATTYPAVCVESLSAYASTIHKSPRQLVMTALSVSVKRAESTKAFVAKLTKF  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
               L P   + +K CLE+V+DS+ +L  S+ E+K +   + P F   +S ++  ++ AL D
Sbjct  100   HGLKPRERSALKDCLEEVSDSVDRLSKSVRELKKMGRARGPEFAWHMSNLQTWVSAALTD  159

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
                C +G     +N   + +++ ++  VA +T N L L  KFA
Sbjct  160   ESTCMDGFAGRAVNGRIKTSIRARMTNVAQVTSNALALCNKFA  202


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 81/163 (50%), Gaps = 0/163 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            + FI++SC  T +P +C  SLS+ A  I  +P++L   A+S++ +  E T   + ++   
Sbjct  40   SSFIRTSCKATTYPAVCVESLSAYASTIHKSPRQLVMTALSVSVKRAESTKAFVAKLTKF  99

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  ++  C +    S+  +  S+  L+ +   +G +    + +++ W+ +  ++
Sbjct  100  HGLKPRERSALKDCLEEVSDSVDRLSKSVRELKKMGRARGPEFAWHMSNLQTWVSAALTD  159

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              +C++      +  ++   +   M  +   +  ALAL + FA
Sbjct  160  ESTCMDGFAGRAVNGRIKTSIRARMTNVAQVTSNALALCNKFA  202



>ref|XP_006421710.1| hypothetical protein CICLE_v10005968mg [Citrus clementina]
 gb|ESR34950.1| hypothetical protein CICLE_v10005968mg [Citrus clementina]
Length=193

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A T FI++SC+ T YP LC  SL  +   I +    LA  A++ +L  ++S    V K+ 
Sbjct  26    ADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKLR  85

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTAL  918
             + ++L       +  CL+++ D++ +L  S+ E+ H+   K   F   +S +E  ++ AL
Sbjct  86    KFRNLKHREYEAIADCLDEMGDTVDRLSKSVQELNHMGQAKGQDFLWHMSNVETWVSAAL  145

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              D + C +G     L    + +V+ Q+  VAH+T N L+L+ KFA
Sbjct  146   TDENTCTDGFGGKALEGKVKSSVRAQVVNVAHVTSNALSLINKFA  190


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 83/172 (48%), Gaps = 1/172 (1%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
             G  +T FI+SSC  T +P +C  SLS+ A  I  +P++LA  A+S++    +     + 
Sbjct  23   AGIADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVT  82

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
            ++     L  +E  +I  C D    ++  +  S+  L  + + KG D    + +++ W+ 
Sbjct  83   KLRKFRNLKHREYEAIADCLDEMGDTVDRLSKSVQELNHMGQAKGQDFLWHMSNVETWVS  142

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
            +  ++  +C +    + ++ KV   V   +  +   +  AL+L + F AG H
Sbjct  143  AALTDENTCTDGFGGKALEGKVKSSVRAQVVNVAHVTSNALSLINKF-AGKH  193



>ref|XP_007220475.1| hypothetical protein PRUPE_ppa011831mg [Prunus persica]
 gb|EMJ21674.1| hypothetical protein PRUPE_ppa011831mg [Prunus persica]
Length=194

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 90/167 (54%), Gaps = 6/167 (4%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T+ T FI++SC  T YP++C  SL  +   I +    LA AA++ +L  ++     V K+
Sbjct  26    TSDTNFIKSSCSATTYPQVCIQSLSSYATSIQQSPRQLAQAALSVSLTRAQKAKTFVTKL  85

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTA  921
             A+ K L       +K CLE++ D++ +L  S+ E+K++   K   F   +S +E  ++ A
Sbjct  86    AKFKGLKAREYGAVKDCLEEMGDTVDRLSKSVQELKNMGKSKGQDFVWHMSNVETWVSAA  145

Query  920   LIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             L D + C +G +   L+   + +++ Q+  VA  T N L L  +FA+
Sbjct  146   LTDDNTCLDGFSGKALDGKIKASIRAQVLNVAQCTSNALALCNRFAS  192


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 86/166 (52%), Gaps = 0/166 (0%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
             +T+FIKSSC  T +P +C  SLSS A  I  +P++LA+ A+S++    +     + ++A
Sbjct  27   SDTNFIKSSCSATTYPQVCIQSLSSYATSIQQSPRQLAQAALSVSLTRAQKAKTFVTKLA  86

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
               GL  +E  ++  C +    ++  +  S+  L+ + + KG D    + +++ W+ +  
Sbjct  87   KFKGLKAREYGAVKDCLEEMGDTVDRLSKSVQELKNMGKSKGQDFVWHMSNVETWVSAAL  146

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++  +C++    + +  K+   +   +  +   +  ALAL + FA+
Sbjct  147  TDDNTCLDGFSGKALDGKIKASIRAQVLNVAQCTSNALALCNRFAS  192



>gb|KDP22406.1| hypothetical protein JCGZ_26237 [Jatropha curcas]
Length=195

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 86/159 (54%), Gaps = 3/159 (2%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP LC  SL  +   I ++   L  AA++ ++  +++    V K+ + K 
Sbjct  35    FIKASCRTTTYPVLCVESLSAYAPSIQQNPRQLTEAALSVSVARAQATRTFVYKLTKFKG  94

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRCP  897
             + P     +  CLE+++D++ +L  S  E+K  K   F+  +S +E  ++ AL D + C 
Sbjct  95    VKPREREAINDCLEEIDDTVDRLSKSFKELKSAKGKDFQWHMSNVETWVSAALTDENTCV  154

Query  896   NGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             +G     L+   + ++K +I  VA +T N L+L+ KFA+
Sbjct  155   DGFAGKALDGKLKASIKARIVNVAQVTSNALSLINKFAS  193


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/163 (23%), Positives = 83/163 (51%), Gaps = 3/163 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FIK+SC  T +P +C  SLS+ A  I  NP++L + A+S++    + T   + ++    
Sbjct  34   NFIKASCRTTTYPVLCVESLSAYAPSIQQNPRQLTEAALSVSVARAQATRTFVYKLTKFK  93

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            G+ P+E  +I+ C +    ++  +  S   L++    KG D    + +++ W+ +  ++ 
Sbjct  94   GVKPREREAINDCLEEIDDTVDRLSKSFKELKSA---KGKDFQWHMSNVETWVSAALTDE  150

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +C++    + +  K+   +   +  +   +  AL+L + FA+
Sbjct  151  NTCVDGFAGKALDGKLKASIKARIVNVAQVTSNALSLINKFAS  193



>ref|XP_008364822.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=214

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YPE+C  SL  +   I +    LA AA++ +L  ++S    V K+A+ K 
Sbjct  51    FIRDSCSATTYPEVCIKSLSSYASSIKQSPRQLAQAALSVSLTKAQSAKTFVTKLAKFKG  110

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             L       +K C+E++ D++ +L  S+ E+K++   K   F   +S +E  ++ AL D +
Sbjct  111   LKSREYGAIKDCMEEIGDTVDRLSKSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  170

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G +   LN   + AV+ Q+  VA  T N L+L  +FA 
Sbjct  171   TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFAG  212


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 84/166 (51%), Gaps = 1/166 (1%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FI+ SC  T +P +C  SLSS A  I  +P++LA+ A+S++    +     + ++A   
Sbjct  50   NFIRDSCSATTYPEVCIKSLSSYASSIKQSPRQLAQAALSVSLTKAQSAKTFVTKLAKFK  109

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            GL  +E  +I  C +    ++  +  S+  L+ + + KG D    + +++ W+ +  ++ 
Sbjct  110  GLKSREYGAIKDCMEEIGDTVDRLSKSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDD  169

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
             +C++    + +  K+   V   +  +   +  AL+L + F AG H
Sbjct  170  NTCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRF-AGKH  214



>ref|XP_011076330.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=202

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 86/162 (53%), Gaps = 6/162 (4%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
              FI+TSC  T YP +C  SL  +   I K  + L   A++ ++D ++S    V+K+ + +
Sbjct  38    SFIRTSCRATTYPAVCVQSLSTYATVIQKSPKQLVMTALSVSVDRAQSTKTFVSKLTKFR  97

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENL---ITTALIDY  909
              L P     +K CLE+V+DS+ +L  S  E+K L   G    I ++ NL   ++ AL D 
Sbjct  98    GLKPREYAAIKDCLEEVSDSVDRLSKSAQELKRLGRAGGPEYIWHLSNLQTWVSAALTDD  157

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G +   LN   + +++ ++  VA +T N L L  K+A
Sbjct  158   STCLDGFSGRALNGRIKTSIRARMTNVAQVTSNALALCNKYA  199


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 77/161 (48%), Gaps = 0/161 (0%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FI++SC  T +P +C  SLS+ A  I  +PK+L   A+S++    + T   + ++    G
Sbjct  39   FIRTSCRATTYPAVCVQSLSTYATVIQKSPKQLVMTALSVSVDRAQSTKTFVSKLTKFRG  98

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            L P+E  +I  C +    S+  +  S   L+ +    G +    + +++ W+ +  ++  
Sbjct  99   LKPREYAAIKDCLEEVSDSVDRLSKSAQELKRLGRAGGPEYIWHLSNLQTWVSAALTDDS  158

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +C++      +  ++   +   M  +   +  ALAL + +A
Sbjct  159  TCLDGFSGRALNGRIKTSIRARMTNVAQVTSNALALCNKYA  199



>gb|ACJ83861.1| unknown [Medicago truncatula]
 gb|AFK36719.1| unknown [Medicago truncatula]
Length=186

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 5/162 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ ++S  G V K  + 
Sbjct  22    TNFIKSSCSTTSYPTLCVESLSAYATTIQQDPHQLVQTALSLSLNKTQSTKGFVTKCKKF  81

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             K L P     +  C+E++ DS+ +L  SL E+K  K  G  F   IS ++  +++++ D 
Sbjct  82    KGLKPREYAALHDCVEEITDSVDRLSRSLKELKLCKINGQDFNWHISNVQTWVSSSMTDA  141

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G     L+   + +++ ++  +A +T N L+L+ ++ 
Sbjct  142   STCSDGFGGKALDGRMKTSIRSRMVNLAQVTSNALSLINQYG  183


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 83/163 (51%), Gaps = 1/163 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS+ A  I  +P +L + A+SL+   T+ T   + +    
Sbjct  22   TNFIKSSCSTTSYPTLCVESLSAYATTIQQDPHQLVQTALSLSLNKTQSTKGFVTKCKKF  81

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  ++H C +    S+  +  SL  L+ + ++ G D +  I +++ W+ S  ++
Sbjct  82   KGLKPREYAALHDCVEEITDSVDRLSRSLKELK-LCKINGQDFNWHISNVQTWVSSSMTD  140

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              +C +    + +  ++   +   M  +   +  AL+L + + 
Sbjct  141  ASTCSDGFGGKALDGRMKTSIRSRMVNLAQVTSNALSLINQYG  183



>ref|XP_004234937.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=196

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 90/163 (55%), Gaps = 7/163 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI++SC+ T +P++C  SL  + + I  +   L   A++ +L+ + S  G V+K+ + K 
Sbjct  32    FIKSSCKSTTFPDVCVASLSGYAQAIKNNQLQLVKTALSVSLNKAGSTKGFVSKMLKFKG  91

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKC----PGFEGKISYIENLITTALIDY  909
             L P     +K C+E+ +DSI +L  S+ E+K L        F+  +S +E  ++ A+ D 
Sbjct  92    LKPREYAAIKDCVEETSDSIDRLSRSVNELKSLDHSHGKADFQWHMSNVETWVSAAITDE  151

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + C +G     LN   + +++  IA +A +T N L L+ ++AA
Sbjct  152   NTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 81/163 (50%), Gaps = 1/163 (1%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIKSSC  T FP++C ASLS  A  I  N  +L K A+S++      T   + ++    G
Sbjct  32   FIKSSCKSTTFPDVCVASLSGYAQAIKNNQLQLVKTALSVSLNKAGSTKGFVSKMLKFKG  91

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKG-IDLHTIIDDIKEWLKSVKSNY  402
            L P+E  +I  C + +  SI  +  S++ L++++   G  D    + +++ W+ +  ++ 
Sbjct  92   LKPREYAAIKDCVEETSDSIDRLSRSVNELKSLDHSHGKADFQWHMSNVETWVSAAITDE  151

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +C +      +  K+   +   +  +   +  ALAL + +AA
Sbjct  152  NTCTDGFAGRALNGKIKASIRSHIANLAQVTSNALALINQYAA  194



>ref|XP_009401795.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=209

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 3/168 (2%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +A + + +TEFI+ SC  T YP+LC  SL  +   I      LA  A++ +L  +RS + 
Sbjct  36    VAPQDSKSTEFIRASCAATMYPDLCFSSLSSYASTIRTSPVQLADVALSVSLAGARSASA  95

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT  927
              +++    + + P  A  +K CLE + DS+ +L+ SL  M H+       +I+ I+  ++
Sbjct  96    AMSRSIAGRGMAPRVAAAVKDCLETMGDSVDELRESLAAMGHVAGRNAAYQINSIQTWVS  155

Query  926   TALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              AL D D C +G     ++   +  V+  +  VA ++ N L L+   A
Sbjct  156   AALTDEDTCVDGFASGAMDGEVKNMVRSHVVYVAQLSSNALALVNGLA  203


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 91/168 (54%), Gaps = 9/168 (5%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMG  600
            ++T+FI++SC  T +P++C++SLSS A  I  +P +LA  A+S++    R+    + R  
Sbjct  42   KSTEFIRASCAATMYPDLCFSSLSSYASTIRTSPVQLADVALSVSLAGARSASAAMSR--  99

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
             IAG+ G++P+   ++  C +    S+  +++SL+    +  + G +    I+ I+ W+ 
Sbjct  100  SIAGR-GMAPRVAAAVKDCLETMGDSVDELRESLA---AMGHVAGRNAAYQINSIQTWVS  155

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +  ++ ++C++   +  +  +V   V   +  +   S  ALAL +  A
Sbjct  156  AALTDEDTCVDGFASGAMDGEVKNMVRSHVVYVAQLSSNALALVNGLA  203



>ref|XP_010093661.1| 21 kDa protein [Morus notabilis]
 gb|EXB54441.1| 21 kDa protein [Morus notabilis]
Length=215

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 90/170 (53%), Gaps = 3/170 (2%)
 Frame = -1

Query  1277  KKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVA  1098
             K +  T FI+ SC+ T YP LC   L    ++I +    LA  A+  +L  +RS + +V+
Sbjct  36    KSSTPTNFIRASCKTTSYPALCVQCLSAFAKQIRRSERQLAQTALTVSLSRARSASHLVS  95

Query  1097  KVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTAL  918
             K+ + + + P     +K C+E + D+++ L  S+ E+  +    F   +S ++  ++ AL
Sbjct  96    KMTRVRGIKPREYQAVKDCIENMGDTVNTLSHSVRELGQVGQQDFVWHMSNVQTWVSAAL  155

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
              D + C +G +   ++   + A++ ++  VA +T N L L+ +FA+   P
Sbjct  156   TDENTCLDGFSGRFMDGNVKAAIRRRVVNVAQVTSNALALVNRFASKHRP  205


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/171 (23%), Positives = 84/171 (49%), Gaps = 17/171 (10%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGEI  594
            T+FI++SC  T +P +C   LS+ A  I  + ++LA+ A++++    R+    V +M  +
Sbjct  41   TNFIRASCKTTSYPALCVQCLSAFAKQIRRSERQLAQTALTVSLSRARSASHLVSKMTRV  100

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNL-ETINELKGI---DLHTIIDDIKEW  426
                G+ P+E  ++  C       I  M D+++ L  ++ EL  +   D    + +++ W
Sbjct  101  R---GIKPREYQAVKDC-------IENMGDTVNTLSHSVRELGQVGQQDFVWHMSNVQTW  150

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++  +C++      +   V   + R +  +   +  ALAL + FA+
Sbjct  151  VSAALTDENTCLDGFSGRFMDGNVKAAIRRRVVNVAQVTSNALALVNRFAS  201



>ref|XP_010933727.1| PREDICTED: 21 kDa protein [Elaeis guineensis]
Length=211

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 85/159 (53%), Gaps = 3/159 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EFI+TSC  T YP LC  SL  +   I      LA A+++ +L  +R  + M+ +++++K
Sbjct  46    EFIRTSCNKTKYPSLCFNSLAAYAPTIQTSPTQLAEASLSVSLSYARGTSTMMTRLSKDK  105

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              +    A  +  C+E + DS+ +LK SL  M HL     + +++ I+  +++AL D + C
Sbjct  106   GMSSREAEAISDCMESLGDSVDELKQSLKVMGHLSGENLKLRVNDIQTWVSSALTDENTC  165

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              +G    G+       V+ +I  VA +T N L+++   A
Sbjct  166   LDGFASNGMKTGERSNVRGRIVRVAQLTSNALSIISGLA  204


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 95/189 (50%), Gaps = 12/189 (6%)
 Frame = -1

Query  815  LTLMKKFA---AAGFPGRENT------DFIKSSCDKTPFPNICYASLSSSACDIAANPKR  663
            LTL+  FA   +     R NT      +FI++SC+KT +P++C+ SL++ A  I  +P +
Sbjct  19   LTLILAFALDASTCHAARPNTHGTIGLEFIRTSCNKTKYPSLCFNSLAAYAPTIQTSPTQ  78

Query  662  LAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLET  483
            LA+ ++S++      T   M  ++   G+S +E  +I  C +    S+  ++ S   L+ 
Sbjct  79   LAEASLSVSLSYARGTSTMMTRLSKDKGMSSREAEAISDCMESLGDSVDELKQS---LKV  135

Query  482  INELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEI  303
            +  L G +L   ++DI+ W+ S  ++  +C++   +  +K      V   +  +   +  
Sbjct  136  MGHLSGENLKLRVNDIQTWVSSALTDENTCLDGFASNGMKTGERSNVRGRIVRVAQLTSN  195

Query  302  ALALFSSFA  276
            AL++ S  A
Sbjct  196  ALSIISGLA  204



>ref|XP_004147611.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=215

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 95/171 (56%), Gaps = 5/171 (3%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             AG +T  TE+++TSC  T YP LC  SL  +  +I  + + LA AA++  L  +RS    
Sbjct  38    AGIRT-NTEYVRTSCSTTSYPRLCYNSLSVYAGKIKTNPKTLALAALHVNLAAARSSAAS  96

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITT  924
             + ++A+ + L    A+ +  C+E+V DS+ +L+ ++ E+   +   F G IS IE  +++
Sbjct  97    MRRLAKTRGLRRRDASAISDCVEEVGDSVFELQRAIRELGRPRGYDFMGLISDIETWVSS  156

Query  923   ALIDYDRCPNGMNDTGLNEPAVKDQ----IAMVAHMTLNGLTLMKKFAAAG  783
             AL D + C  G     +N  +VK +    I  VAH+T N L L+  +A++ 
Sbjct  157   ALTDEETCMEGFGGRRVNGVSVKAKVRRHIVRVAHLTSNSLALINSYASSA  207


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 96/196 (49%), Gaps = 12/196 (6%)
 Frame = -1

Query  857  KDQIAMVAHMTLNGLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIA  678
            + QI  VA  TL       + ++AG   R NT+++++SC  T +P +CY SLS  A  I 
Sbjct  21   QTQILSVAASTL------PRKSSAGI--RTNTEYVRTSCSTTSYPRLCYNSLSVYAGKIK  72

Query  677  ANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSL  498
             NPK LA  A+ +       +   M  +A   GL  ++  +I  C +    S+  +Q ++
Sbjct  73   TNPKTLALAALHVNLAAARSSAASMRRLAKTRGLRRRDASAISDCVEEVGDSVFELQRAI  132

Query  497  SNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKE-KVTEEVTRLMREM  321
              L      +G D   +I DI+ W+ S  ++ E+C+E     ++    V  +V R +  +
Sbjct  133  REL---GRPRGYDFMGLISDIETWVSSALTDEETCMEGFGGRRVNGVSVKAKVRRHIVRV  189

Query  320  EPFSEIALALFSSFAA  273
               +  +LAL +S+A+
Sbjct  190  AHLTSNSLALINSYAS  205



>ref|XP_003598238.1| 21 kDa protein [Medicago truncatula]
 gb|AES68489.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=186

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 5/162 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ ++S  G V K  + 
Sbjct  22    TNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKGFVTKCKKF  81

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             K L P     +  C+E++ DS+ +L  SL E+K  K  G  F   IS ++  +++++ D 
Sbjct  82    KGLKPREYAALHDCVEEITDSVDRLSRSLKELKLCKINGQDFNWHISNVQTWVSSSMTDA  141

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C +G     L+   + +++ ++  +A +T N L+L+ ++ 
Sbjct  142   STCSDGFGGKALDGRMKTSIRSRMVNLAQVTSNALSLINQYG  183


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 82/163 (50%), Gaps = 1/163 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS  A  I  +P +L + A+SL+   T+ T   + +    
Sbjct  22   TNFIKSSCSTTSYPTLCVESLSVYATTIQQDPHQLVQTALSLSLNKTQSTKGFVTKCKKF  81

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL P+E  ++H C +    S+  +  SL  L+ + ++ G D +  I +++ W+ S  ++
Sbjct  82   KGLKPREYAALHDCVEEITDSVDRLSRSLKELK-LCKINGQDFNWHISNVQTWVSSSMTD  140

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              +C +    + +  ++   +   M  +   +  AL+L + + 
Sbjct  141  ASTCSDGFGGKALDGRMKTSIRSRMVNLAQVTSNALSLINQYG  183



>gb|AFK45022.1| unknown [Lotus japonicus]
Length=189

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 86/163 (53%), Gaps = 5/163 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++  L+ ++S    V++    
Sbjct  25    TNFIKSSCSTTQYPTLCVESLSAYATTIQQDPHQLVQTALSLTLNRTQSTKAFVSRCKNF  84

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             + L P+    +  C E+++DS+ +L  SL E+K     G  F   IS +E  +++AL D 
Sbjct  85    RGLKPKEYAALHDCSEEISDSVDRLSRSLKELKMCTIKGEDFTWHISNVETWVSSALTDE  144

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               C +G     +N   + +++ ++  +A +T N L+L+ ++AA
Sbjct  145   STCSDGFAGNAMNGKIKTSIRARMVNIAQVTSNALSLVNQYAA  187


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 82/165 (50%), Gaps = 1/165 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS+ A  I  +P +L + A+SLT   T+ T   +      
Sbjct  25   TNFIKSSCSTTQYPTLCVESLSAYATTIQQDPHQLVQTALSLTLNRTQSTKAFVSRCKNF  84

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL PKE  ++H C +    S+  +  SL  L+ +  +KG D    I +++ W+ S  ++
Sbjct  85   RGLKPKEYAALHDCSEEISDSVDRLSRSLKELK-MCTIKGEDFTWHISNVETWVSSALTD  143

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAG  270
              +C +      +  K+   +   M  +   +  AL+L + +AA 
Sbjct  144  ESTCSDGFAGNAMNGKIKTSIRARMVNIAQVTSNALSLVNQYAAN  188



>ref|NP_001268141.1| ripening-related protein-like precursor [Vitis vinifera]
 emb|CAB85625.1| putative ripening-related protein [Vitis vinifera]
 emb|CAN79279.1| hypothetical protein VITISV_005237 [Vitis vinifera]
 emb|CBI24569.3| unnamed protein product [Vitis vinifera]
 gb|AGB13718.1| putative pectin methylesterase inhibitor [Vitis vinifera]
Length=198

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 88/171 (51%), Gaps = 6/171 (4%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             A   + +T FI+  C  T YP LC  SL  +   I K  + LAH A+  +L  ++S    
Sbjct  26    AAANSGSTSFIKAKCSATRYPALCVQSLSVYASTIQKSPKQLAHTALTVSLAKAQSAKAF  85

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENL  933
             V+K+ + K +       ++ CLE++NDSI +L  S+ E++     K   F   +S ++  
Sbjct  86    VSKLGKIKGMKARELEAVQDCLEEMNDSIDRLSRSVQELEEAGKSKGQDFLWHMSNVDTW  145

Query  932   ITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             ++ AL D + C +G     L+   + +++  +  VA +T N L L+ +FAA
Sbjct  146   VSAALTDDNTCVDGFAGRALDGRVKASIRGWLVTVAQVTSNALALVNQFAA  196


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 84/168 (50%), Gaps = 6/168 (4%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGE  597
            +T FIK+ C  T +P +C  SLS  A  I  +PK+LA  A++++    ++ +  V ++G+
Sbjct  32   STSFIKAKCSATRYPALCVQSLSVYASTIQKSPKQLAHTALTVSLAKAQSAKAFVSKLGK  91

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            I    G+  +E  ++  C +  + SI  +  S+  LE   + KG D    + ++  W+ +
Sbjct  92   IK---GMKARELEAVQDCLEEMNDSIDRLSRSVQELEEAGKSKGQDFLWHMSNVDTWVSA  148

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              ++  +C++      +  +V   +   +  +   +  ALAL + FAA
Sbjct  149  ALTDDNTCVDGFAGRALDGRVKASIRGWLVTVAQVTSNALALVNQFAA  196



>ref|XP_002280585.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=208

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              +K+    FI+ SC  T YP LC   L  +  +  +    LA  A++ +L  +R     V
Sbjct  30    ARKSRARTFIEASCRSTRYPSLCVKCLSGYANKTQQSPFQLAQVALSVSLAKTRHTRAYV  89

Query  1100  AKVAQN-KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG----FEGKISYIEN  936
              +VA N K +      ++  CL+Q+ND + +L  S++E++ +   G    F  ++S IE 
Sbjct  90    MEVASNFKDVEGRTHQDISDCLDQINDGVDRLAQSIIELRRMNQEGGDSDFTWRMSNIET  149

Query  935   LITTALIDYDRCPNGMN--DTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              ++ AL D   C +G +  D G  +  +K ++  VA +T N L L+ +FAA
Sbjct  150   WVSAALTDATTCVDGFSGRDMGKLKATIKGKVLNVAQVTSNALALVNRFAA  200



>ref|XP_008376217.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=202

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 88/160 (55%), Gaps = 3/160 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF++TSC  T Y +LC  SL  H   I    +L+A  A+   L  ++S + M++K+ Q+ 
Sbjct  40    EFVKTSCSATTYXKLCLTSLSSHASAIQTSPKLMASTALTVTLASTKSTSTMMSKLXQSH  99

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     M+ C+E+++DS+  ++ S+ EM + +   F+   S ++  ++ AL D   C
Sbjct  100   GMKPREVGAMRDCIEELSDSVDAIQRSIAEMGNFRSSDFQXMXSDVQTWVSAALTDETTC  159

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G    G+N   +  V+ ++  +A +T N L L+ ++A+
Sbjct  160   FDGFGGNGMNGNLKTVVRGRVVNIAQLTSNALALINRYAS  199


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/175 (25%), Positives = 86/175 (49%), Gaps = 5/175 (3%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            AA     + N +F+K+SC  T +  +C  SLSS A  I  +PK +A  A+++T  +T+ T
Sbjct  29   AARDLAQKTNNEFVKTSCSATTYXKLCLTSLSSHASAIQTSPKLMASTALTVTLASTKST  88

Query  614  VRRMGEIAGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
               M ++    G+ P+E  ++  C E+LS  S+  +Q S++ +      +  D   +  D
Sbjct  89   STMMSKLXQSHGMKPREVGAMRDCIEELS-DSVDAIQRSIAEM---GNFRSSDFQXMXSD  144

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++ W+ +  ++  +C +      +   +   V   +  +   +  ALAL + +A+
Sbjct  145  VQTWVSAALTDETTCFDGFGGNGMNGNLKTVVRGRVVNIAQLTSNALALINRYAS  199



>ref|XP_007209621.1| hypothetical protein PRUPE_ppa011699mg [Prunus persica]
 gb|EMJ10820.1| hypothetical protein PRUPE_ppa011699mg [Prunus persica]
Length=200

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 90/163 (55%), Gaps = 4/163 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T++I+ SC  T YP LC  SL  +  +I  D ++LAH A+N  L  ++  + ++ ++++ 
Sbjct  33    TQYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIMRRLSEI  92

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKH-LKCPGFEGKISYIENLITTALIDYD  906
               L P     +  C+E++ D+I +L+ SL E+ H ++   F  ++S I+  ++ AL D D
Sbjct  93    HGLKPIETAAVLDCMEEIGDAILELQQSLDELGHVVRGSNFWFQMSDIQTWVSAALTDED  152

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              C +G  +  L    E  V+     VAH+T N L L+  +A++
Sbjct  153   TCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYASS  195


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 91/171 (53%), Gaps = 8/171 (5%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTE---FTVRR  606
            G+ NT +IK SC  T +P +CY SLS  A  I  +PK LA  A+++T   T+     +RR
Sbjct  29   GKTNTQYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIMRR  88

Query  605  MGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEW  426
            + EI    GL P E  ++  C +    +IL +Q SL  L  +  ++G +    + DI+ W
Sbjct  89   LSEIH---GLKPIETAAVLDCMEEIGDAILELQQSLDELGHV--VRGSNFWFQMSDIQTW  143

Query  425  LKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + +  ++ ++C++  E   ++ +V   V R    +   +  ALAL +S+A+
Sbjct  144  VSAALTDEDTCMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYAS  194



>ref|XP_007039940.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24441.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=201

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 83/162 (51%), Gaps = 3/162 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI+TSC  T YP LC  +  ++   I     LLA  A++ A + +RS T     ++++
Sbjct  38    TRFIRTSCRATLYPNLCFTTFSRYTTRIRGSPRLLASTALSMAFNTTRSTTKAFINLSKH  97

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMK-HLKCPGFEGKISYIENLITTALIDYD  906
             + L    A  ++ C+EQ+ DS+ +LK S+  M    +   F  ++S ++  ++ AL + D
Sbjct  98    RGLERSEAAALRDCVEQLGDSVDELKDSISAMSPPRRGDDFRSRMSDLQTWVSAALTNDD  157

Query  905   RCPNGMNDTGLNE--PAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              C  G     +      V+ Q+  VAH+T   L  + ++AAA
Sbjct  158   TCMGGFPRKAMKRDFKTVRRQVVKVAHLTSIALAFVNRYAAA  199


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 98/196 (50%), Gaps = 7/196 (4%)
 Frame = -1

Query  848  IAMVAHMTLN-GLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAAN  672
            +A++  +T+N  L L    AA   P   NT FI++SC  T +PN+C+ + S     I  +
Sbjct  12   LAILIQLTINLNLCLA---AAPIHPSGRNTRFIRTSCRATLYPNLCFTTFSRYTTRIRGS  68

Query  671  PKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSN  492
            P+ LA  A+S+   TT  T +    ++   GL   E  ++  C +    S+  ++DS+S 
Sbjct  69   PRLLASTALSMAFNTTRSTTKAFINLSKHRGLERSEAAALRDCVEQLGDSVDELKDSISA  128

Query  491  LETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPF  312
            +      +G D  + + D++ W+ +  +N ++C+     + +K    + V R + ++   
Sbjct  129  MSP--PRRGDDFRSRMSDLQTWVSAALTNDDTCMGGFPRKAMKRDF-KTVRRQVVKVAHL  185

Query  311  SEIALALFSSFAAGMH  264
            + IALA  + +AA  H
Sbjct  186  TSIALAFVNRYAAATH  201



>ref|XP_004162668.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=229

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 95/171 (56%), Gaps = 5/171 (3%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             AG +T  TE+++TSC  T YP LC  SL  +  +I  + + LA AA++  L  +RS    
Sbjct  52    AGIRT-NTEYVRTSCSTTSYPRLCYNSLSVYAGKIKTNPKTLALAALHVNLAAARSSAAS  110

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITT  924
             + ++A+ + L    A+ +  C+E+V DS+ +L+ ++ E+   +   F G IS IE  +++
Sbjct  111   MRRLAKTRGLRRRDASAISDCVEEVGDSVFELQRAIRELGRPRGYDFMGLISDIETWVSS  170

Query  923   ALIDYDRCPNGMNDTGLNEPAVKDQ----IAMVAHMTLNGLTLMKKFAAAG  783
             AL D + C  G     +N  +VK +    I  VAH+T N L L+  +A++ 
Sbjct  171   ALTDEETCMEGFGGRRVNGVSVKAKVRRHIVRVAHLTSNSLALINSYASSA  221


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 96/196 (49%), Gaps = 12/196 (6%)
 Frame = -1

Query  857  KDQIAMVAHMTLNGLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIA  678
            + QI  VA  TL       + ++AG   R NT+++++SC  T +P +CY SLS  A  I 
Sbjct  35   QTQILSVAASTL------PRKSSAGI--RTNTEYVRTSCSTTSYPRLCYNSLSVYAGKIK  86

Query  677  ANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSL  498
             NPK LA  A+ +       +   M  +A   GL  ++  +I  C +    S+  +Q ++
Sbjct  87   TNPKTLALAALHVNLAAARSSAASMRRLAKTRGLRRRDASAISDCVEEVGDSVFELQRAI  146

Query  497  SNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKE-KVTEEVTRLMREM  321
              L      +G D   +I DI+ W+ S  ++ E+C+E     ++    V  +V R +  +
Sbjct  147  REL---GRPRGYDFMGLISDIETWVSSALTDEETCMEGFGGRRVNGVSVKAKVRRHIVRV  203

Query  320  EPFSEIALALFSSFAA  273
               +  +LAL +S+A+
Sbjct  204  AHLTSNSLALINSYAS  219



>ref|XP_006490090.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65434.1| hypothetical protein CISIN_1g029436mg [Citrus sinensis]
Length=193

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 87/166 (52%), Gaps = 6/166 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A T FI++SC+ T YP LC  SL  +   I +    LA  A++ +L  ++S    V K+ 
Sbjct  26    ADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKLR  85

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTAL  918
             + ++L       +  CL+++ D++ +L  S+ E+ H+   K   F   +S +E  ++ AL
Sbjct  86    KFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVSAAL  145

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D + C +G     L    + +V+ Q+  VA +T N L+L+ KFA 
Sbjct  146   TDENTCTDGFGGKALEGKVKSSVRAQVVNVAQVTSNALSLINKFAG  191


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 82/172 (48%), Gaps = 1/172 (1%)
 Frame = -1

Query  779  PGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMG  600
             G  +T FI+SSC  T +P +C  SLS+ A  I  +P++LA  A+S++    +     + 
Sbjct  23   AGIADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVT  82

Query  599  EIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
            ++     L  +E  +I  C D    ++  +  S+  L  +   KG D    + +++ W+ 
Sbjct  83   KLRKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVS  142

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
            +  ++  +C +    + ++ KV   V   +  +   +  AL+L + F AG H
Sbjct  143  AALTDENTCTDGFGGKALEGKVKSSVRAQVVNVAQVTSNALSLINKF-AGKH  193



>gb|KGN57274.1| hypothetical protein Csa_3G175740 [Cucumis sativus]
Length=236

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI++SC  T YP LC  SL  H   I     LLA AA++ +L   +S    + K++
Sbjct  72    SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  131

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
              +  LP    + +  CLE+++DS+  L  S+ EM  L+   F+  +S ++  ++ AL D 
Sbjct  132   HSHGLPSRDVSALDDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  191

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C  G     +N   + AV+ +I  +A +T N L+L+ +  
Sbjct  192   TTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLINRIG  233


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 87/163 (53%), Gaps = 5/163 (3%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T+FIKSSC  T +P +C++SLS  A  I  +P+ LA  A+S++  + + T  ++ ++
Sbjct  71   QSSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKL  130

Query  593  AGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +   GL  ++  ++  C E+LS  S+  +  S+S +    +L+G +    + +++ W+ +
Sbjct  131  SHSHGLPSRDVSALDDCLEELS-DSVDSLAASISEMP---KLRGTNFDLAMSNVQTWVSA  186

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALF  288
              ++  +C E  + + +   V   V   +  +   +  AL+L 
Sbjct  187  ALTDETTCSEGFQGKTVNGGVKGAVRTKIVNIAQLTSNALSLI  229



>ref|XP_006357906.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=192

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 92/164 (56%), Gaps = 6/164 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC+ T YP++C  SL  +   I +  + LA  A++ +LD ++S    + K+ + 
Sbjct  27    TSFIKSSCKITTYPQVCVSSLAVYAPTIKRSPQQLAQTALSVSLDRAQSAHTFITKLNKF  86

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
             K L       +K CLE+++++I ++  S+ E+K +   +   F+ ++S IE  I+ A+ +
Sbjct  87    KGLKQREYAALKDCLEEMSETIDRINKSVKELKSMGSARGKDFQWRMSNIETWISAAITN  146

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              + C +G     LN   + +++ ++  V  +T N L L+ +FAA
Sbjct  147   ENTCADGFAGRALNGRIKTSIRARVTHVTQVTSNALALINQFAA  190


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 82/164 (50%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIKSSC  T +P +C +SL+  A  I  +P++LA+ A+S++    +     + ++   
Sbjct  27   TSFIKSSCKITTYPQVCVSSLAVYAPTIKRSPQQLAQTALSVSLDRAQSAHTFITKLNKF  86

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL  +E  ++  C +   ++I  +  S+  L+++   +G D    + +I+ W+ +  +N
Sbjct  87   KGLKQREYAALKDCLEEMSETIDRINKSVKELKSMGSARGKDFQWRMSNIETWISAAITN  146

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C +      +  ++   +   +  +   +  ALAL + FAA
Sbjct  147  ENTCADGFAGRALNGRIKTSIRARVTHVTQVTSNALALINQFAA  190



>ref|XP_004160872.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=194

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 85/162 (52%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI++SC  T YP LC  SL  H   I     LLA AA++ +L   +S    + +++
Sbjct  30    SSTEFIRSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILQLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
              +  LP    + +  CLE+++DS+  L  S+ EM  L+   F+  +S ++  ++ AL D 
Sbjct  90    HSHGLPSRDVSALNDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C  G     +N   +  V+ +I   A +T N L+L+ + A
Sbjct  150   TTCSEGFQGKTVNGGVKAEVRTKIVNSAQLTSNALSLINRIA  191


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 90/167 (54%), Gaps = 5/167 (3%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T+FI+SSC  T +P +C++SLS  A  I  +P+ LA  A+S++  + + T  ++ ++
Sbjct  29   QSSTEFIRSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILQL  88

Query  593  AGKIGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            +   GL  ++  +++ C E+LS  S+  +  S+S +    +L+G +    + +++ W+ +
Sbjct  89   SHSHGLPSRDVSALNDCLEELS-DSVDSLAASISEMP---KLRGTNFDLAMSNVQTWVSA  144

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              ++  +C E  + + +   V  EV   +      +  AL+L +  A
Sbjct  145  ALTDETTCSEGFQGKTVNGGVKAEVRTKIVNSAQLTSNALSLINRIA  191



>ref|XP_007148704.1| hypothetical protein PHAVU_005G007600g [Phaseolus vulgaris]
 gb|ESW20698.1| hypothetical protein PHAVU_005G007600g [Phaseolus vulgaris]
Length=189

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 89/163 (55%), Gaps = 5/163 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++ AL+ + S    VAK  + 
Sbjct  25    TNFIKSSCSATQYPALCVESLSVYAAAIQQDPHQLVQTALSLALNKTESTKTFVAKCNKF  84

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             K L P     +K C+E+++D + +L  SL E+K  K  G  F+  +S +E  +++AL D 
Sbjct  85    KGLKPREYAALKDCVEEISDGVDRLSRSLKELKLCKLKGQDFDWHMSNVETWVSSALTDE  144

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               C +G     L+   + A++ ++  VA +T N L+L+ ++AA
Sbjct  145   STCGDGFAGKALSGKIKDAIRGRMVNVAQVTSNALSLINQYAA  187


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 78/165 (47%), Gaps = 3/165 (2%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T+FIKSSC  T +P +C  SLS  A  I  +P +L + A+SL    TE T   + +    
Sbjct  25   TNFIKSSCSATQYPALCVESLSVYAAAIQQDPHQLVQTALSLALNKTESTKTFVAKCNKF  84

Query  584  IGLSPKENMSIHVC-EDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
             GL P+E  ++  C E++S       +          + +  D H  + +++ W+ S  +
Sbjct  85   KGLKPREYAALKDCVEEISDGVDRLSRSLKELKLCKLKGQDFDWH--MSNVETWVSSALT  142

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +  +C +    + +  K+ + +   M  +   +  AL+L + +AA
Sbjct  143  DESTCGDGFAGKALSGKIKDAIRGRMVNVAQVTSNALSLINQYAA  187



>gb|KDP38091.1| hypothetical protein JCGZ_04734 [Jatropha curcas]
Length=206

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 90/175 (51%), Gaps = 9/175 (5%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             ++ + ++I+TSC  T YPE+C  SL ++   + +    LA  A+  +L  +R ++  V+ 
Sbjct  32    RSNSADYIRTSCGATLYPEVCYSSLSRYSSAVQQSPGRLARVAIGVSLSRARHMSSFVSN  91

Query  1094  VAQNKSLPPE--AATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG-----FEGKISYIEN  936
             +++      +  AA  +  CL    D++ +++ SL +M+ L   G     F  ++S ++ 
Sbjct  92    LSRQADYGSDHRAAAALHDCLSNFGDAVEEIRGSLKQMRQLGAAGSSDEAFRFQMSNVQT  151

Query  935   LITTALIDYDRCPNGMNDT--GLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
              ++ AL D + C +G +D   G  +  V D+ A V   T N L L+  +AA G P
Sbjct  152   WMSAALTDEETCTDGFDDVADGPLKSEVCDRAADVKKFTSNALALVNSYAAKGLP  206


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 84/189 (44%), Gaps = 30/189 (16%)
 Frame = -1

Query  788  AGFPGRENT-DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTV  612
            A    R N+ D+I++SC  T +P +CY+SLS  +  +  +P RLA+ AI ++        
Sbjct  27   ASLDDRSNSADYIRTSCGATLYPEVCYSSLSRYSSAVQQSPGRLARVAIGVSLS----RA  82

Query  611  RRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNL-ETINELKGI---------  462
            R M             N+S        H++   + D LSN  + + E++G          
Sbjct  83   RHMSSFV--------SNLSRQADYGSDHRAAAALHDCLSNFGDAVEEIRGSLKQMRQLGA  134

Query  461  ------DLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIA  300
                       + +++ W+ +  ++ E+C +  + +     +  EV     +++ F+  A
Sbjct  135  AGSSDEAFRFQMSNVQTWMSAALTDEETCTDGFD-DVADGPLKSEVCDRAADVKKFTSNA  193

Query  299  LALFSSFAA  273
            LAL +S+AA
Sbjct  194  LALVNSYAA  202



>ref|XP_011029962.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=198

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 83/162 (51%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP LC  SL  +   I +    L   A+  ++D ++S    V K+ + K 
Sbjct  35    FIKASCTATKYPALCVESLSLYATSINQSPRQLIQTALAVSVDKAQSTKTFVYKLTKFKG  94

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             + P     +K C E+++D++ +L  S+ E+K++   K   F+  IS ++  I+  L D +
Sbjct  95    VKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDEN  154

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G     LN   + ++K +   V  +T N L L+ KFA+
Sbjct  155   TCVDGFAGKALNGRIKNSIKTRFVHVERVTSNALALINKFAS  196


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/163 (23%), Positives = 82/163 (50%), Gaps = 0/163 (0%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FIK+SC  T +P +C  SLS  A  I  +P++L + A++++    + T   + ++    
Sbjct  34   NFIKASCTATKYPALCVESLSLYATSINQSPRQLIQTALAVSVDKAQSTKTFVYKLTKFK  93

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            G+ P+E  +I  C +    ++  +  S+  L+ +   KG D    I +++ W+ +  ++ 
Sbjct  94   GVKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDE  153

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +C++    + +  ++   +      +E  +  ALAL + FA+
Sbjct  154  NTCVDGFAGKALNGRIKNSIKTRFVHVERVTSNALALINKFAS  196



>ref|XP_002318283.1| 21K protein precursor [Populus trichocarpa]
 gb|ABK94466.1| unknown [Populus trichocarpa]
 gb|EEE96503.1| 21K protein precursor [Populus trichocarpa]
Length=198

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 82/162 (51%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP LC  SL  +   I +    L   A+  +LD ++S    V K+ + K 
Sbjct  35    FIKASCTATTYPALCVQSLSLYATSINQSPRQLIQTALAVSLDKAQSTKTFVYKLTKFKG  94

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             + P     +K C E+++D++ +L  S+ E+K++   K   F+  IS ++  I+  L D +
Sbjct  95    VKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDEN  154

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G     LN   + ++K +   V  +T N L L+ KF +
Sbjct  155   TCVDGFAGKALNGRIKNSIKARFVHVERVTSNALALINKFGS  196


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 81/163 (50%), Gaps = 0/163 (0%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FIK+SC  T +P +C  SLS  A  I  +P++L + A++++    + T   + ++    
Sbjct  34   NFIKASCTATTYPALCVQSLSLYATSINQSPRQLIQTALAVSLDKAQSTKTFVYKLTKFK  93

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            G+ P+E  +I  C +    ++  +  S+  L+ +   KG D    I +++ W+ +  ++ 
Sbjct  94   GVKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDE  153

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +C++    + +  ++   +      +E  +  ALAL + F +
Sbjct  154  NTCVDGFAGKALNGRIKNSIKARFVHVERVTSNALALINKFGS  196



>ref|XP_011018248.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=206

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 87/161 (54%), Gaps = 4/161 (2%)
 Frame = -1

Query  1259  EFIQTSC-EGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             E+I+TSC   T YP+LC  +L  +   I    +LLA  A+N +L  + S + ++ +V++ 
Sbjct  40    EYIKTSCYNSTFYPKLCYHTLVIYASTIKTSPKLLAKTALNVSLINTNSASRLMIRVSKI  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P        CLE+V DS+++L+ S+ E+ H     F   +S +E  ++ AL D D 
Sbjct  100   PGLEPRVVAATLDCLEEVGDSVYELQRSMEEIGHAGGSDFSKAMSDVETWVSAALTDDDT  159

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G  +  +N+     VK  I  +A +T N L L+ ++A+
Sbjct  160   CLDGFAEEVVNKKVTAIVKRHIQRIARLTSNALALVNRYAS  200


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 88/176 (50%), Gaps = 5/176 (3%)
 Frame = -1

Query  794  AAAGFPGREN-TDFIKSSC-DKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTE  621
            A    P R    ++IK+SC + T +P +CY +L   A  I  +PK LAK A++++   T 
Sbjct  28   ATTSLPSRNTYIEYIKTSCYNSTFYPKLCYHTLVIYASTIKTSPKLLAKTALNVSLINTN  87

Query  620  FTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
               R M  ++   GL P+   +   C +    S+  +Q S+   E I    G D    + 
Sbjct  88   SASRLMIRVSKIPGLEPRVVAATLDCLEEVGDSVYELQRSM---EEIGHAGGSDFSKAMS  144

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            D++ W+ +  ++ ++C++    E + +KVT  V R ++ +   +  ALAL + +A+
Sbjct  145  DVETWVSAALTDDDTCLDGFAEEVVNKKVTAIVKRHIQRIARLTSNALALVNRYAS  200



>ref|XP_006355502.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=206

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 89/166 (54%), Gaps = 7/166 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A  +FI+ SC+ T YP LC   L      + +  + LAHAA++ +L  ++S    V+K+ 
Sbjct  34    AAIKFIKVSCKATLYPVLCVQCLSAFANTVKQSEQQLAHAALSVSLSKAKSTMIFVSKLN  93

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL----KCPGFEGKISYIENLITTA  921
             + + L P     +K CL+ ++DSI ++  S+ E+ H         F   +S ++  ++ A
Sbjct  94    RMRGLKPREKQAVKDCLDTMSDSIDQINKSIPELGHTGQFSTGQDFMWHVSNVQTWVSAA  153

Query  920   LIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             L D + C +G +  G+N   + A++ +I  VA +T N L L+ +FA
Sbjct  154   LTDENTCLDGFSGRGMNGNVKAALRLRILHVAQVTSNALALVNRFA  199


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/162 (23%), Positives = 75/162 (46%), Gaps = 1/162 (1%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIK SC  T +P +C   LS+ A  +  + ++LA  A+S++    + T+  + ++    G
Sbjct  38   FIKVSCKATLYPVLCVQCLSAFANTVKQSEQQLAHAALSVSLSKAKSTMIFVSKLNRMRG  97

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELK-GIDLHTIIDDIKEWLKSVKSNY  402
            L P+E  ++  C D    SI  +  S+  L    +   G D    + +++ W+ +  ++ 
Sbjct  98   LKPREKQAVKDCLDTMSDSIDQINKSIPELGHTGQFSTGQDFMWHVSNVQTWVSAALTDE  157

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             +C++      +   V   +   +  +   +  ALAL + FA
Sbjct  158  NTCLDGFSGRGMNGNVKAALRLRILHVAQVTSNALALVNRFA  199



>ref|XP_006368687.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
 gb|ERP65256.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
Length=206

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 88/161 (55%), Gaps = 4/161 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTP-YPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             E+I+TSC  T  YP+LC  +L  +   I  + +LLA  A+N +L  + S + ++ +V++ 
Sbjct  40    EYIKTSCYNTTFYPKLCYHTLVIYASTIKTNPKLLAKTALNVSLINTNSTSRLMIRVSKI  99

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P        C+E+V DS+++L+ S+ E+ H     F   +S +E  ++ AL D D 
Sbjct  100   PGLEPRVVAATLDCVEEVGDSVYELQRSMEEIGHAGGSDFSKAMSDVETWVSAALTDDDA  159

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G  +  +N+     VK  I  +A +T N L L+ ++A+
Sbjct  160   CLDGFAEEVMNKKVTAIVKRHIRRIARLTSNALALVNRYAS  200


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 88/176 (50%), Gaps = 5/176 (3%)
 Frame = -1

Query  794  AAAGFPGREN-TDFIKSSCDKTPF-PNICYASLSSSACDIAANPKRLAKNAISLTQRTTE  621
            A    P R    ++IK+SC  T F P +CY +L   A  I  NPK LAK A++++   T 
Sbjct  28   ATTSLPSRNTYIEYIKTSCYNTTFYPKLCYHTLVIYASTIKTNPKLLAKTALNVSLINTN  87

Query  620  FTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
             T R M  ++   GL P+   +   C +    S+  +Q S   +E I    G D    + 
Sbjct  88   STSRLMIRVSKIPGLEPRVVAATLDCVEEVGDSVYELQRS---MEEIGHAGGSDFSKAMS  144

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            D++ W+ +  ++ ++C++    E + +KVT  V R +R +   +  ALAL + +A+
Sbjct  145  DVETWVSAALTDDDACLDGFAEEVMNKKVTAIVKRHIRRIARLTSNALALVNRYAS  200



>ref|XP_004148136.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
 ref|XP_004160871.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
 gb|KGN57279.1| hypothetical protein Csa_3G176260 [Cucumis sativus]
Length=192

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 82/162 (51%), Gaps = 5/162 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             + FI++ C    YP+LC  SL      I ++   L   A+  +L  ++S    V K+ + 
Sbjct  27    SSFIKSKCSAATYPDLCVQSLSSFSSTIQRNPRQLVQTALAVSLSHAQSTRSFVWKLTKF  86

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCP--GFEGKISYIENLITTALIDY  909
               L P     +K C+E+V D++ +L  S+ E+K +      F+  IS +E  ++ A+ D 
Sbjct  87    SGLKPRERAALKDCMEEVGDTVDRLNKSVEELKRVSGSKKDFQWHISNVETWVSAAMTDE  146

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             + C +G   + LN   + +V+ +I  V  +  N L+L+ K+A
Sbjct  147   NTCSDGFAGSALNGRIKSSVRGRIVDVTRVISNALSLINKYA  188


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/172 (22%), Positives = 84/172 (49%), Gaps = 2/172 (1%)
 Frame = -1

Query  791  AAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTV  612
            A+ F G  ++ FIKS C    +P++C  SLSS +  I  NP++L + A++++    + T 
Sbjct  19   ASAFNGGASS-FIKSKCSAATYPDLCVQSLSSFSSTIQRNPRQLVQTALAVSLSHAQSTR  77

Query  611  RRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIK  432
              + ++    GL P+E  ++  C +    ++  +  S+  L+ ++  K  D    I +++
Sbjct  78   SFVWKLTKFSGLKPRERAALKDCMEEVGDTVDRLNKSVEELKRVSGSKK-DFQWHISNVE  136

Query  431  EWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             W+ +  ++  +C +      +  ++   V   + ++      AL+L + +A
Sbjct  137  TWVSAAMTDENTCSDGFAGSALNGRIKSSVRGRIVDVTRVISNALSLINKYA  188



>ref|XP_010546336.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=213

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 86/163 (53%), Gaps = 6/163 (4%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             ++I+TSC  T Y  LC   L  +   I  D E LA  A+N  L  ++S   +V  +++ +
Sbjct  46    DYIKTSCNATLYQTLCYSCLYPYASLIDSDPEKLAITALNLTLSETKSTQRLVKFISRRR  105

Query  1079  --SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYD  906
               SL P  A  +K CLE+++DS+++LK S+ EMK +    FE  +S ++  ++ AL D  
Sbjct  106   HASLGPGEAAAVKDCLEEMSDSVYELKDSIAEMKAINYSSFEMVVSDVQTWVSAALTDQV  165

Query  905   RCPNGMNDTGLNEPAVKD----QIAMVAHMTLNGLTLMKKFAA  789
              C +G  + G  +  VK+     I  V  MT N L  +  +A+
Sbjct  166   TCMDGFEEAGGGKTEVKELVRKHIDRVTRMTSNALAFINLYAS  208


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 91/175 (52%), Gaps = 14/175 (8%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
             + N D+IK+SC+ T +  +CY+ L   A  I ++P++LA  A++LT   T+ T R +  
Sbjct  41   NQTNLDYIKTSCNATLYQTLCYSCLYPYASLIDSDPEKLAITALNLTLSETKSTQRLVKF  100

Query  596  IAGK--IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
            I+ +    L P E  ++  C +    S+  ++DS++ ++ IN         ++ D++ W+
Sbjct  101  ISRRRHASLGPGEAAAVKDCLEEMSDSVYELKDSIAEMKAINYSS---FEMVVSDVQTWV  157

Query  422  KSVKSNYESCIEELE-----TEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  ++  +C++  E       ++KE V + + R+ R     +  ALA  + +A+
Sbjct  158  SAALTDQVTCMDGFEEAGGGKTEVKELVRKHIDRVTR----MTSNALAFINLYAS  208



>ref|XP_004499663.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=192

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 83/163 (51%), Gaps = 5/163 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC  T YP LC  SL  +   I +D   L   A++ +L+ ++S    V +    
Sbjct  28    TNFIKSSCSTTQYPTLCVESLSTYASTIQQDPHQLVQTAISISLNKTQSTKDFVTRCKNI  87

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDY  909
             K L       +  C E+++DS+ +L  SL E+K  K  G  F   IS +E  +++AL D 
Sbjct  88    KGLKAREYAALHDCSEEISDSVDRLIRSLKELKICKIKGEDFNWHISNVETWVSSALTDE  147

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               C +G     LN   + +++ ++  VA +T N L L+  +A+
Sbjct  148   TTCGDGFGGKALNGRIKASIRSRMINVAQVTSNALALVNHYAS  190


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 87/168 (52%), Gaps = 9/168 (5%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISL----TQRTTEFTVRRMGE  597
            T+FIKSSC  T +P +C  SLS+ A  I  +P +L + AIS+    TQ T +F V R   
Sbjct  28   TNFIKSSCSTTQYPTLCVESLSTYASTIQQDPHQLVQTAISISLNKTQSTKDF-VTRCKN  86

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            I    GL  +E  ++H C +    S+  +  SL  L+ I ++KG D +  I +++ W+ S
Sbjct  87   IK---GLKAREYAALHDCSEEISDSVDRLIRSLKELK-ICKIKGEDFNWHISNVETWVSS  142

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              ++  +C +    + +  ++   +   M  +   +  ALAL + +A+
Sbjct  143  ALTDETTCGDGFGGKALNGRIKASIRSRMINVAQVTSNALALVNHYAS  190



>gb|ABK94287.1| unknown [Populus trichocarpa]
Length=198

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 81/162 (50%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP LC  SL  +   I +    L   A+  +LD ++S    V K+ + K 
Sbjct  35    FIKASCTATTYPALCVQSLSLYATSINQSPRQLIQTALAVSLDKAQSTKTFVYKLTKFKG  94

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALIDYD  906
             + P     +K C E+++D++ +L  S+ E+K++   K   F+  IS ++  I+  L D  
Sbjct  95    VKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDEK  154

Query  905   RCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              C +G     LN   + ++K +   V  +T N L L+ KF +
Sbjct  155   TCVDGFAGKALNGRIKNSIKARFVHVERVTSNALALINKFGS  196


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 82/163 (50%), Gaps = 0/163 (0%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            +FIK+SC  T +P +C  SLS  A  I  +P++L + A++++    + T   + ++    
Sbjct  34   NFIKASCTATTYPALCVQSLSLYATSINQSPRQLIQTALAVSLDKAQSTKTFVYKLTKFK  93

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            G+ P+E  +I  C +    ++  +  S+  L+ +   KG D    I +++ W+ +  ++ 
Sbjct  94   GVKPREKAAIKDCFEEIDDTVDRLVKSVKELKNMGSSKGSDFQWHISNVQTWISAGLTDE  153

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++C++    + +  ++   +      +E  +  ALAL + F +
Sbjct  154  KTCVDGFAGKALNGRIKNSIKARFVHVERVTSNALALINKFGS  196



>ref|XP_007210220.1| hypothetical protein PRUPE_ppa015829mg [Prunus persica]
 gb|EMJ11419.1| hypothetical protein PRUPE_ppa015829mg [Prunus persica]
Length=208

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 85/168 (51%), Gaps = 6/168 (4%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              + ++ T FI+ SC  T YP LC  SL  +   IG+    LA  A+  +L   RS    V
Sbjct  28    ARHSSPTAFIKASCRATDYPALCVQSLAGYASAIGQSERQLAQTALTVSLARVRSAQSYV  87

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKISYIENLI  930
             AK+ + + + P     +K C+E + DS+ +L+ S+ E+    +  G  F   +S +E  +
Sbjct  88    AKLTRVRGIKPREYRAVKDCIENMGDSVDRLRQSVRELGQTGRAVGQDFMWHMSNVETWV  147

Query  929   TTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKF  795
             + AL D   C +G +   ++   + A+  ++  VA +T N L L+ +F
Sbjct  148   SAALTDESTCLDGFSGRFMDGNIKTAITRRVNNVAQVTSNALALVNRF  195


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/162 (21%), Positives = 76/162 (47%), Gaps = 0/162 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIK+SC  T +P +C  SL+  A  I  + ++LA+ A++++          + ++   
Sbjct  34   TAFIKASCRATDYPALCVQSLAGYASAIGQSERQLAQTALTVSLARVRSAQSYVAKLTRV  93

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  ++  C +    S+  ++ S+  L       G D    + +++ W+ +  ++
Sbjct  94   RGIKPREYRAVKDCIENMGDSVDRLRQSVRELGQTGRAVGQDFMWHMSNVETWVSAALTD  153

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
              +C++      +   +   +TR +  +   +  ALAL + F
Sbjct  154  ESTCLDGFSGRFMDGNIKTAITRRVNNVAQVTSNALALVNRF  195



>ref|XP_010056361.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW73051.1| hypothetical protein EUGRSUZ_E01499 [Eucalyptus grandis]
Length=198

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI++SC    YP LC  SL  +   I +  + LA AA+  +L  ++S    VA+ A+ 
Sbjct  33    TNFIKSSCSTVQYPALCVQSLVVYASTIKQSPQQLAQAALAVSLARAQSTKDFVARAAKF  92

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
             + L       +K CLE+++DS+ +L  S  E+K     K   F+  +S ++  ++ A  D
Sbjct  93    RGLKAREYAAIKDCLEEMDDSVDRLANSGKELKRAGASKGQDFQWHVSNVQTWVSAASTD  152

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
                C +G   T LN   + +++ ++  VA +T N L L+ ++A+
Sbjct  153   TTTCLDGYASTALNGRLKTSIRSRVLNVAQVTSNALALVNRYAS  196


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 82/169 (49%), Gaps = 10/169 (6%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT----QRTTEFTVRRMGE  597
            T+FIKSSC    +P +C  SL   A  I  +P++LA+ A++++    Q T +F  R    
Sbjct  33   TNFIKSSCSTVQYPALCVQSLVVYASTIKQSPQQLAQAALAVSLARAQSTKDFVAR----  88

Query  596  IAGKI-GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
             A K  GL  +E  +I  C +    S+  + +S   L+     KG D    + +++ W+ 
Sbjct  89   -AAKFRGLKAREYAAIKDCLEEMDDSVDRLANSGKELKRAGASKGQDFQWHVSNVQTWVS  147

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +  ++  +C++   +  +  ++   +   +  +   +  ALAL + +A+
Sbjct  148  AASTDTTTCLDGYASTALNGRLKTSIRSRVLNVAQVTSNALALVNRYAS  196



>ref|XP_002318880.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
 gb|EEE97100.1| invertase/pectin methylesterase inhibitor family protein [Populus 
trichocarpa]
Length=202

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 80/160 (50%), Gaps = 3/160 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T ++QT+C  T YP+LC  SL  +   I  +   L   A+   L  + + + +V  +++ 
Sbjct  42    TNYLQTACNSTTYPQLCFKSLSSYTSTIKTNYLKLCRTALTVTLKAASNTSSLVKALSKQ  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             K L    A  +K C+E++ DSI +L  SL  +  LK    E +I+ I+  I+ A+ D D 
Sbjct  102   KGLSKTEAGIVKDCIEEIGDSIDELNQSLKALGSLKGSDIEFQIANIKTWISAAITDEDT  161

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFA  792
             C  G  +  + +     ++  I  VA +T N L L+ K +
Sbjct  162   CTEGFEERNITDEVMIKIRKSIVNVARLTSNALALINKLS  201


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 88/175 (50%), Gaps = 3/175 (2%)
 Frame = -1

Query  800  KFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTE  621
            + + A    +  T++++++C+ T +P +C+ SLSS    I  N  +L + A+++T +   
Sbjct  30   QLSLADTTSKTYTNYLQTACNSTTYPQLCFKSLSSYTSTIKTNYLKLCRTALTVTLKAAS  89

Query  620  FTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
             T   +  ++ + GLS  E   +  C +    SI  +  S   L+ +  LKG D+   I 
Sbjct  90   NTSSLVKALSKQKGLSKTEAGIVKDCIEEIGDSIDELNQS---LKALGSLKGSDIEFQIA  146

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +IK W+ +  ++ ++C E  E   I ++V  ++ + +  +   +  ALAL +  +
Sbjct  147  NIKTWISAAITDEDTCTEGFEERNITDEVMIKIRKSIVNVARLTSNALALINKLS  201



>sp|P17407.1|21KD_DAUCA RecName: Full=21 kDa protein; AltName: Full=1.2 protein; Flags: 
Precursor [Daucus carota]
 emb|CAA36642.1| precursor polypeptide (AA -22 to 171) [Daucus carota]
Length=193

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 84/163 (52%), Gaps = 6/163 (4%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             +FI+TSC  T YP +C  SL  + + I  + + LA  A+  +L  ++     + ++ + K
Sbjct  27    QFIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFK  86

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMK---HLKCPGFEGKISYIENLITTALIDY  909
              L       +  CLE+V DS+ ++  S  EMK   H K   F  ++S +E  ++ AL D 
Sbjct  87    GLKARQYAAIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDE  146

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               C +G    G++   + +V+ Q+  VA +T N L L+  FAA
Sbjct  147   TTCMDGFAGKGMDGKIKESVRAQVVAVARVTSNALALVNNFAA  189


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 81/162 (50%), Gaps = 0/162 (0%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIK+SC  T +P +C  SLS+ A  I  NP+ LA  A+ ++   T+     M  +    G
Sbjct  28   FIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFKG  87

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            L  ++  +IH C +    S+  +  S   ++ ++  KG D    + +++ W+ +  ++  
Sbjct  88   LKARQYAAIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDET  147

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +C++    + +  K+ E V   +  +   +  ALAL ++FAA
Sbjct  148  TCMDGFAGKGMDGKIKESVRAQVVAVARVTSNALALVNNFAA  189



>ref|XP_011041730.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 83/155 (54%), Gaps = 3/155 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             +FI+TSC  T YP+LC   L  +   I  +   LA+ +++  L  + S   MV K+ + +
Sbjct  45    DFIKTSCGVTRYPDLCYKKLSAYADTIQDNPTQLANVSLSETLKNAESTLIMVQKLLKKR  104

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P  A  +K C+E + DS+ +L+ S++ M HL+ P FE ++S I+  ++ AL D D C
Sbjct  105   KLRPREAGAIKECVETMKDSVEELQKSMLAMSHLEGPDFEMEMSNIQTWVSAALTDEDTC  164

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLM  804
              +   +  ++   +   +  I  VA +T   L L+
Sbjct  165   MDDFEENSMDGKVKDTTRSYIVTVAQLTSISLALI  199


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 86/161 (53%), Gaps = 3/161 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            DFIK+SC  T +P++CY  LS+ A  I  NP +LA  ++S T +  E T+  + ++  K 
Sbjct  45   DFIKTSCGVTRYPDLCYKKLSAYADTIQDNPTQLANVSLSETLKNAESTLIMVQKLLKKR  104

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
             L P+E  +I  C +    S+  +Q S+     ++ L+G D    + +I+ W+ +  ++ 
Sbjct  105  KLRPREAGAIKECVETMKDSVEELQKSML---AMSHLEGPDFEMEMSNIQTWVSAALTDE  161

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
            ++C+++ E   +  KV +     +  +   + I+LAL +S 
Sbjct  162  DTCMDDFEENSMDGKVKDTTRSYIVTVAQLTSISLALINSI  202



>gb|EPS67841.1| hypothetical protein M569_06935, partial [Genlisea aurea]
Length=172

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 1/141 (1%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A  +FI  SC  T YP +C  SL  +   I K+ + L  AA+  +L  SRS    V+ +A
Sbjct  14    AAGDFIAASCRTTTYPAVCIRSLQAYASTIQKNRQQLVSAALAVSLQRSRSAKAFVSNLA  73

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
                 L P      + C++QV DS+ ++  S+ EM+ L+   +   +S ++  ++ A+ DY
Sbjct  74    IGSGLSPRERAAARDCVQQVADSVDRVSSSIREMRVLRTGDYAWHVSNLQTWMSAAITDY  133

Query  908   DRCPNGMNDTGLNEPAVKDQI  846
             + C +G +   L  P V D +
Sbjct  134   NGCMDGFSGRVLRGP-VSDSV  153


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/173 (24%), Positives = 78/173 (45%), Gaps = 10/173 (6%)
 Frame = -1

Query  809  LMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQR  630
            L+   AAAG       DFI +SC  T +P +C  SL + A  I  N ++L   A++++ +
Sbjct  8    LLAVSAAAG-------DFIAASCRTTTYPAVCIRSLQAYASTIQKNRQQLVSAALAVSLQ  60

Query  629  TTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHT  450
             +      +  +A   GLSP+E  +   C      S+  +  S+  +     L+  D   
Sbjct  61   RSRSAKAFVSNLAIGSGLSPRERAAARDCVQQVADSVDRVSSSIREMRV---LRTGDYAW  117

Query  449  IIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALAL  291
             + +++ W+ +  ++Y  C++      ++  V++ V   M      +  ALAL
Sbjct  118  HVSNLQTWMSAAITDYNGCMDGFSGRVLRGPVSDSVRVWMVNSIQVASNALAL  170



>ref|XP_008439100.1| PREDICTED: 21 kDa protein-like [Cucumis melo]
Length=193

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 82/163 (50%), Gaps = 6/163 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             + FI++ C    YP+LC  SL      I ++   L   A+  +L  ++S    V K+ + 
Sbjct  27    SNFIKSKCSAATYPDLCVQSLSSFASTIQRNPRQLVQTALAVSLSRAQSTRSFVWKLTKF  86

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
               L P     +K C+E+V D++ +L  S+ E+K +   K   F   IS +E  ++ A+ D
Sbjct  87    SGLKPRERAALKDCMEEVGDTVDRLNKSVEELKRVSGSKKKDFLWHISNVETWVSAAMTD  146

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              + C +G   + LN   + +V+ +I  V  +  N L+L+ K+A
Sbjct  147   ENTCSDGFAGSALNGRIKSSVRGRIVDVTRVISNALSLINKYA  189


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 84/172 (49%), Gaps = 1/172 (1%)
 Frame = -1

Query  791  AAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTV  612
            A+ F G   ++FIKS C    +P++C  SLSS A  I  NP++L + A++++    + T 
Sbjct  19   ASAFNGGA-SNFIKSKCSAATYPDLCVQSLSSFASTIQRNPRQLVQTALAVSLSRAQSTR  77

Query  611  RRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIK  432
              + ++    GL P+E  ++  C +    ++  +  S+  L+ ++  K  D    I +++
Sbjct  78   SFVWKLTKFSGLKPRERAALKDCMEEVGDTVDRLNKSVEELKRVSGSKKKDFLWHISNVE  137

Query  431  EWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             W+ +  ++  +C +      +  ++   V   + ++      AL+L + +A
Sbjct  138  TWVSAAMTDENTCSDGFAGSALNGRIKSSVRGRIVDVTRVISNALSLINKYA  189



>ref|XP_010555621.1| PREDICTED: 21 kDa protein [Tarenaya hassleriana]
Length=202

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (49%), Gaps = 8/169 (5%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T   EF++TSCE   YP+LC  SL  +  EI K    L   A+  +LD +RS    ++++
Sbjct  32    TEDIEFVRTSCEAASYPDLCFQSLSSYASEIKKRPRQLTETALAVSLDRARSAKVYISEL  91

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG-----FEGKISYIENLIT  927
                K +       +  C E++ D++ +L  SL E+KHL   G     F   +S ++   +
Sbjct  92    TDYKGITKRQHGAVSDCAEEMGDTVDRLNKSLKELKHLGEEGQSDQDFWFCLSNVQTWTS  151

Query  926   TALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              AL D + C +G     +    + +VK  I  VA  T N L L+ +F +
Sbjct  152   AALTDENTCLDGFGGKAMEGELKSSVKTHIVRVAQETSNALALINEFGS  200


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/172 (20%), Positives = 85/172 (49%), Gaps = 10/172 (6%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
            E+ +F+++SC+   +P++C+ SLSS A +I   P++L + A++++          + E+ 
Sbjct  33   EDIEFVRTSCEAASYPDLCFQSLSSYASEIKKRPRQLTETALAVSLDRARSAKVYISELT  92

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINE--LKGIDLHTIIDDIKEWLKS  417
               G++ +++ ++  C +    ++  +  SL  L+ + E      D    + +++ W  +
Sbjct  93   DYKGITKRQHGAVSDCAEEMGDTVDRLNKSLKELKHLGEEGQSDQDFWFCLSNVQTWTSA  152

Query  416  VKSNYESCIEELETE----QIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              ++  +C++    +    ++K  V   + R+ +E       ALAL + F +
Sbjct  153  ALTDENTCLDGFGGKAMEGELKSSVKTHIVRVAQETSN----ALALINEFGS  200



>ref|XP_007155620.1| hypothetical protein PHAVU_003G217200g [Phaseolus vulgaris]
 gb|ESW27614.1| hypothetical protein PHAVU_003G217200g [Phaseolus vulgaris]
Length=208

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 89/166 (54%), Gaps = 6/166 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ATT+FI++SC+ T YP  C  SL  +  +IG+  E L   A+  ++  +RS    + K+ 
Sbjct  35    ATTDFIKSSCKETRYPVACVQSLSGYGSKIGQSEEELVTTALAVSVSKTRSCASFLKKME  94

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCP---GFEGKISYIENLITTAL  918
             + K +  +    ++ C+E ++DS+ +L  S+ E+  L  P    F   +S I+  ++ A+
Sbjct  95    KVKGMKVKEYNAVRDCIENMDDSVERLNQSVKELGLLGKPKGKDFRWHMSNIQTWVSAAI  154

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D D C +G +   L    + A+K ++   + +T N L L+ +FA+
Sbjct  155   TDQDTCLDGFDGLHLGANFKAAIKPRVLDASQLTSNALALVNRFAS  200


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 0/167 (0%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            +  TDFIKSSC +T +P  C  SLS     I  + + L   A++++   T      + ++
Sbjct  34   KATTDFIKSSCKETRYPVACVQSLSGYGSKIGQSEEELVTTALAVSVSKTRSCASFLKKM  93

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
                G+  KE  ++  C +    S+  +  S+  L  + + KG D    + +I+ W+ + 
Sbjct  94   EKVKGMKVKEYNAVRDCIENMDDSVERLNQSVKELGLLGKPKGKDFRWHMSNIQTWVSAA  153

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++ ++C++  +   +       +   + +    +  ALAL + FA+
Sbjct  154  ITDQDTCLDGFDGLHLGANFKAAIKPRVLDASQLTSNALALVNRFAS  200



>gb|ABK21023.1| unknown [Picea sitchensis]
Length=210

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 84/163 (52%), Gaps = 4/163 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV-AQN  1083
             EFI+TSC  T YP++C  SL  +   +      L  AAV  +L  +R+++   A + A+ 
Sbjct  45    EFIKTSCNVTLYPQVCVSSLSSYPGSLKAKQSDLVKAAVTVSLLNARNVSVWAAGLKARK  104

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
              ++    +T +K C+    D+ +++  SL E+KHLK   F+ ++  ++  ++ AL D D 
Sbjct  105   ATMSKSESTALKDCIGNFKDATYEISGSLAELKHLKPNTFQFQMGNVQTWMSAALTDQDS  164

Query  902   CPNGMND---TGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAG  783
             C NG  D   +G     V  ++  V  +  N L L+  FAA G
Sbjct  165   CLNGFQDLDTSGKVTGTVTGRVQNVCKLISNALALINTFAATG  207


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 80/168 (48%), Gaps = 4/168 (2%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT-QRTTEFTVRRMGEIAGK  585
            +FIK+SC+ T +P +C +SLSS    + A    L K A++++       +V   G  A K
Sbjct  45   EFIKTSCNVTLYPQVCVSSLSSYPGSLKAKQSDLVKAAVTVSLLNARNVSVWAAGLKARK  104

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              +S  E+ ++  C      +   +  SL+ L+    LK       + +++ W+ +  ++
Sbjct  105  ATMSKSESTALKDCIGNFKDATYEISGSLAELK---HLKPNTFQFQMGNVQTWMSAALTD  161

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
             +SC+   +      KVT  VT  ++ +      ALAL ++FAA   G
Sbjct  162  QDSCLNGFQDLDTSGKVTGTVTGRVQNVCKLISNALALINTFAATGAG  209



>emb|CDP05316.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 83/167 (50%), Gaps = 6/167 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T FI+  C  T YP LC  SL      I +    LA  A++ +LD ++S    VAK+++ 
Sbjct  29    TSFIRAKCRTTTYPSLCVESLSTFAATIQRSPNQLAQTALSVSLDRAQSTRAFVAKLSKF  88

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
             + L       ++ CLEQ+ DS+ +L  S+ E+K+L   + P     IS  +  ++ AL D
Sbjct  89    RGLKGREYAALRDCLEQMADSVDRLGNSVQEIKNLGRSRGPELFWHISNAQTWVSAALTD  148

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGF  780
                C +G     LN   + ++  ++  VA +T N L L+ + A   +
Sbjct  149   DSTCADGFAGRTLNGRVKSSITTRMTNVAQVTSNALALINQMAGGNY  195


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/167 (23%), Positives = 83/167 (50%), Gaps = 0/167 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FI++ C  T +P++C  SLS+ A  I  +P +LA+ A+S++    + T   + +++  
Sbjct  29   TSFIRAKCRTTTYPSLCVESLSTFAATIQRSPNQLAQTALSVSLDRAQSTRAFVAKLSKF  88

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             GL  +E  ++  C +    S+  + +S+  ++ +   +G +L   I + + W+ +  ++
Sbjct  89   RGLKGREYAALRDCLEQMADSVDRLGNSVQEIKNLGRSRGPELFWHISNAQTWVSAALTD  148

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMH  264
              +C +      +  +V   +T  M  +   +  ALAL +  A G +
Sbjct  149  DSTCADGFAGRTLNGRVKSSITTRMTNVAQVTSNALALINQMAGGNY  195



>gb|AFK45126.1| unknown [Medicago truncatula]
Length=196

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             +EFI++SC  T YP LC   L  +   IG+    L   A++ ++  +RS    V K+++ 
Sbjct  25    SEFIRSSCRATRYPVLCVQCLMGYASVIGQSERQLTITALSVSISRTRSSASFVKKISKA  84

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEM---KHLKCPGFEGKISYIENLITTALID  912
             + + P     ++ C+E + DS+  L  S+ E+    H     F   ++ ++  ++ AL D
Sbjct  85    RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGSIGHAVGEDFVWHMTNVQTWVSAALTD  144

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              + C +G     +N   + A+KD++  VA +T N L L+ +FA++
Sbjct  145   DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFASS  189


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/164 (21%), Positives = 76/164 (46%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FI+SSC  T +P +C   L   A  I  + ++L   A+S++   T  +   + +I+  
Sbjct  25   SEFIRSSCRATRYPVLCVQCLMGYASVIGQSERQLTITALSVSISRTRSSASFVKKISKA  84

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  ++  C +    S+  +  S+  L +I    G D    + +++ W+ +  ++
Sbjct  85   RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGSIGHAVGEDFVWHMTNVQTWVSAALTD  144

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++      +   V   +   +  +   +   LAL + FA+
Sbjct  145  DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFAS  188



>ref|XP_006385731.1| hypothetical protein POPTR_0003s11320g [Populus trichocarpa]
 gb|ERP63528.1| hypothetical protein POPTR_0003s11320g [Populus trichocarpa]
Length=198

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 93/173 (54%), Gaps = 6/173 (3%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G AG  ++ T+FI++SC+ T YPELC   L  +   I ++   LA  A++ +L  +RS  
Sbjct  19    GTAGSASSPTDFIKSSCKATRYPELCVGCLSGYASVIQRNERRLALTALSVSLARARSAA  78

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKISYIE  939
               V K+ + + + P      K C+E + DS+ +L  S+ E++H  +  G  F   +S ++
Sbjct  79    AFVTKMTKVRGIKPREYQAAKDCIENMGDSVDRLSQSVRELRHTGRAVGRDFLWHMSNVQ  138

Query  938   NLITTALIDYDRCPNGMND---TGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               ++ AL D + C +G       G  + A+K +I  VA +T N L L+ +FA+
Sbjct  139   TWVSAALTDENTCLDGFAGHLMDGNVKVAIKRRINNVAQVTSNALALVDRFAS  191


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 74/169 (44%), Gaps = 0/169 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            TDFIKSSC  T +P +C   LS  A  I  N +RLA  A+S++          + ++   
Sbjct  28   TDFIKSSCKATRYPELCVGCLSGYASVIQRNERRLALTALSVSLARARSAAAFVTKMTKV  87

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  +   C +    S+  +  S+  L       G D    + +++ W+ +  ++
Sbjct  88   RGIKPREYQAAKDCIENMGDSVDRLSQSVRELRHTGRAVGRDFLWHMSNVQTWVSAALTD  147

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHGR  258
              +C++      +   V   + R +  +   +  ALAL   FA+    R
Sbjct  148  ENTCLDGFAGHLMDGNVKVAIKRRINNVAQVTSNALALVDRFASRHRAR  196



>gb|ACJ83345.1| unknown [Medicago truncatula]
 gb|AFK47307.1| unknown [Medicago truncatula]
Length=196

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             +EFI++SC  T YP LC   L  +   IG+    L   A++ ++  +RS    V K+++ 
Sbjct  25    SEFIRSSCRATRYPVLCVQCLMGYASVIGQSERQLTITALSVSISRTRSSASFVKKISKA  84

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEM---KHLKCPGFEGKISYIENLITTALID  912
             + + P     ++ C+E + DS+  L  S+ E+    H     F   ++ ++  ++ AL D
Sbjct  85    RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGNIGHAVGEDFVWHMTNVQTWVSAALTD  144

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              + C +G     +N   + A+KD++  VA +T N L L+ +FA++
Sbjct  145   DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFASS  189


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/164 (21%), Positives = 75/164 (46%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FI+SSC  T +P +C   L   A  I  + ++L   A+S++   T  +   + +I+  
Sbjct  25   SEFIRSSCRATRYPVLCVQCLMGYASVIGQSERQLTITALSVSISRTRSSASFVKKISKA  84

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  ++  C +    S+  +  S+  L  I    G D    + +++ W+ +  ++
Sbjct  85   RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGNIGHAVGEDFVWHMTNVQTWVSAALTD  144

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++      +   V   +   +  +   +   LAL + FA+
Sbjct  145  DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFAS  188



>gb|KCW77718.1| hypothetical protein EUGRSUZ_D02018 [Eucalyptus grandis]
Length=212

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 89/173 (51%), Gaps = 7/173 (4%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T FI +SC  T YP LC   L  + R I +    LA AA+  +L  +RS    ++K
Sbjct  35    KPAPTSFIVSSCRATRYPALCVHCLAAYGRAIQRSDHHLAQAALIVSLARARSAASFMSK  94

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTA  921
             +++ + +       M+ C+E + D++ +L  S+ E+   +  G  F   +S +E  ++ A
Sbjct  95    LSRARRIKLRELRAMRDCVENMGDTVDRLADSVRELGRSRYVGRDFAWHMSNVETWVSAA  154

Query  920   LIDYDRCPNGMN----DTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFPG  774
             L D + C +G      D G+ + AV+ ++  VA +T N L L+ ++A+   P 
Sbjct  155   LTDENTCTDGFGGRVMDGGV-KVAVRGRVVDVARVTSNALALVNRYASRHSPA  206



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score = 88.2 bits (217),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 3/162 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             ++TEFI++SC  T YP LC  SL  H   I     LLA AA++ +L   +S    + K++
Sbjct  30    SSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
              +  LP    + +  CLE+++DS+  L  S+ EM  L+   F+  +S ++  ++ AL D 
Sbjct  90    HSHGLPSRDVSALDDCLEELSDSVDSLAASISEMPKLRGTNFDLAMSNVQTWVSAALTDE  149

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
               C  G     +N   +  V+ +I  +A +T N L+L+ + A
Sbjct  150   TTCSEGFQGKTVNGGVKGVVRTKIVNIAQLTSNALSLINQIA  191


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/166 (23%), Positives = 86/166 (52%), Gaps = 3/166 (2%)
 Frame = -1

Query  773  RENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEI  594
            + +T+FIKSSC  T +P +C++SLS  A  I  +P+ LA  A+S++  + + T  ++ ++
Sbjct  29   QSSTEFIKSSCSSTTYPRLCFSSLSVHANAIQTSPRLLATAALSVSLSSVKSTATQILKL  88

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
            +   GL  ++  ++  C +    S+  +  S+S +    +L+G +    + +++ W+ + 
Sbjct  89   SHSHGLPSRDVSALDDCLEELSDSVDSLAASISEMP---KLRGTNFDLAMSNVQTWVSAA  145

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             ++  +C E  + + +   V   V   +  +   +  AL+L +  A
Sbjct  146  LTDETTCSEGFQGKTVNGGVKGVVRTKIVNIAQLTSNALSLINQIA  191



>ref|XP_006826916.1| hypothetical protein AMTR_s00010p00166600 [Amborella trichopoda]
 gb|ERM94153.1| hypothetical protein AMTR_s00010p00166600 [Amborella trichopoda]
Length=197

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 87/165 (53%), Gaps = 1/165 (1%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+T+CE T YP+LC  SL      +    + LA AA+  +L  +++  G VA++ +   
Sbjct  33    FIKTACETTLYPDLCLSSLSGQVEYVTYSHKKLARAALMVSLSATKATAGFVAELIKTAK  92

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRCP  897
             +  E    +  C+E + D   K+  S+ E++ +K   F+ ++S ++  I+ AL D + C 
Sbjct  93    VSEEEQMALNDCVEALEDGEDKMNDSMKELQRIKTESFKWQMSNVQTWISAALTDENACS  152

Query  896   NGMND-TGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFPGREN  765
             +G  +  G  +  +  +I  +A +T N L+L+  F+ A   G ++
Sbjct  153   DGFEELDGEVKDVIAGKIGDLAQLTSNALSLVNHFSTATVGGEQH  197


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/166 (22%), Positives = 83/166 (50%), Gaps = 5/166 (3%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            FIK++C+ T +P++C +SLS     +  + K+LA+ A+ ++   T+ T   + E+     
Sbjct  33   FIKTACETTLYPDLCLSSLSGQVEYVTYSHKKLARAALMVSLSATKATAGFVAELIKTAK  92

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            +S +E M+++ C +        M DS+  L+ I   K       + +++ W+ +  ++  
Sbjct  93   VSEEEQMALNDCVEALEDGEDKMNDSMKELQRI---KTESFKWQMSNVQTWISAALTDEN  149

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHG  261
            +C +    E++  +V + +   + ++   +  AL+L + F+    G
Sbjct  150  ACSDGF--EELDGEVKDVIAGKIGDLAQLTSNALSLVNHFSTATVG  193



>ref|XP_008377851.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=208

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 92/160 (58%), Gaps = 1/160 (1%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            ++K++C+ T +P +CY SLSS A  + +NP++L   A+S+T + ++     + +++ + G
Sbjct  48   YVKTACNSTTYPLVCYQSLSSYASKVKSNPRKLCIYALSVTLQASKNASSXVSKLSKRAG  107

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            L+P E   I+ C +   +SI  ++DSLS+++ +  +KG D+   +DDIK W+ +V ++  
Sbjct  108  LTPTEKGIINDCLESIKESIDELKDSLSSMKNLG-VKGADMQAQLDDIKTWVSAVITDDV  166

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSF  279
            +C +  +  ++   V   +   +  +   +  AL+L  S 
Sbjct  167  TCTDGFDGLKVSTAVKTPINNSIVYVARLASNALSLIDSL  206


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 79/157 (50%), Gaps = 7/157 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             +++T+C  T YP +C  SL  +  ++  +   L   A++  L  S++ +  V+K+++   
Sbjct  48    YVKTACNSTTYPLVCYQSLSSYASKVKSNPRKLCIYALSVTLQASKNASSXVSKLSKRAG  107

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDYDR  903
             L P     +  CLE + +SI +LK SL  MK+L   G   + ++  I+  ++  + D   
Sbjct  108   LTPTEKGIINDCLESIKESIDELKDSLSSMKNLGVKGADMQAQLDDIKTWVSAVITDDVT  167

Query  902   CPNGMN----DTGLNEPAVKDQIAMVAHMTLNGLTLM  804
             C +G +     T +  P + + I  VA +  N L+L+
Sbjct  168   CTDGFDGLKVSTAVKTP-INNSIVYVARLASNALSLI  203



>ref|XP_002322406.1| 21K protein precursor [Populus trichocarpa]
 gb|ABK93773.1| unknown [Populus trichocarpa]
 gb|EEF06533.1| 21K protein precursor [Populus trichocarpa]
Length=199

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 84/164 (51%), Gaps = 6/164 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             + FI+ SC  T YP LC  SL  +   I +    L   A++ +LD ++S    V K+ + 
Sbjct  34    SNFIKASCSATTYPALCVQSLSLYASSIKQSPRQLIQTALSVSLDKAQSTKTFVYKLTKF  93

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
             K + P     +K C E+++D++ KL  S+ E+K++   K   ++  IS ++  I+ AL D
Sbjct  94    KGIKPREKAAIKDCFEEIDDTLDKLVKSVKELKNMGSSKGQDYQWHISNVQTWISAALTD  153

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              + C +G     L+   + ++  +   V  +T N L L+ KF +
Sbjct  154   ENTCVDGFAGKALDGRVKNSITARFVHVERVTSNALALINKFGS  197


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 83/164 (51%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FIK+SC  T +P +C  SLS  A  I  +P++L + A+S++    + T   + ++   
Sbjct  34   SNFIKASCSATTYPALCVQSLSLYASSIKQSPRQLIQTALSVSLDKAQSTKTFVYKLTKF  93

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  +I  C +    ++  +  S+  L+ +   KG D    I +++ W+ +  ++
Sbjct  94   KGIKPREKAAIKDCFEEIDDTLDKLVKSVKELKNMGSSKGQDYQWHISNVQTWISAALTD  153

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++    + +  +V   +T     +E  +  ALAL + F +
Sbjct  154  ENTCVDGFAGKALDGRVKNSITARFVHVERVTSNALALINKFGS  197



>gb|EYU26823.1| hypothetical protein MIMGU_mgv1a020375mg [Erythranthe guttata]
Length=180

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 93/167 (56%), Gaps = 7/167 (4%)
 Frame = -1

Query  1277  KKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVA  1098
             KK   +E+IQ SC+ T YP+LC+ SL K+  +I  + + LA AA+  A + ++S   ++ 
Sbjct  17    KKYHASEYIQKSCKKTLYPDLCNKSLAKYSTKIKTNPKTLATAALLVAFNTTQSTYKILR  76

Query  1097  KVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEM----KHLKCPGFEGKISYIENLI  930
              +++N++L P     +  C+E+V+DS+++L+ S  E+    K LK   FE +++ I+  +
Sbjct  77    NLSRNRALNPGEKEGLLECVEEVSDSVYELQKSFKELFFSRKGLK---FELQMNDIQTWV  133

Query  929   TTALIDYDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + AL D D C +    +G     V+  +  +A ++   L+ +  +  
Sbjct  134   SAALTDDDTCMDDFRASGRMNILVRGLVLRIARLSSIALSFINMYGV  180


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 80/164 (49%), Gaps = 5/164 (3%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            +++I+ SC KT +P++C  SL+  +  I  NPK LA  A+ +   TT+ T + +  ++  
Sbjct  22   SEYIQKSCKKTLYPDLCNKSLAKYSTKIKTNPKTLATAALLVAFNTTQSTYKILRNLSRN  81

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
              L+P E   +  C +    S+  +Q S    E     KG+     ++DI+ W+ +  ++
Sbjct  82   RALNPGEKEGLLECVEEVSDSVYELQKSFK--ELFFSRKGLKFELQMNDIQTWVSAALTD  139

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++C+++        ++   V  L+  +   S IAL+  + +  
Sbjct  140  DDTCMDDFRASG---RMNILVRGLVLRIARLSSIALSFINMYGV  180



>ref|XP_003611258.1| Pectinesterase [Medicago truncatula]
 gb|AES94216.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=217

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             +EFI++SC  T YP LC   L  +   IG+    L   A++ ++  +RS    V K+++ 
Sbjct  46    SEFIRSSCRATRYPVLCVQCLMGYASVIGQSERQLTITALSVSISRTRSSASFVKKISKA  105

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEM---KHLKCPGFEGKISYIENLITTALID  912
             + + P     ++ C+E + DS+  L  S+ E+    H     F   ++ ++  ++ AL D
Sbjct  106   RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGSIGHAVGEDFVWHMTNVQTWVSAALTD  165

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              + C +G     +N   + A+KD++  VA +T N L L+ +FA++
Sbjct  166   DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFASS  210


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/164 (21%), Positives = 76/164 (46%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FI+SSC  T +P +C   L   A  I  + ++L   A+S++   T  +   + +I+  
Sbjct  46   SEFIRSSCRATRYPVLCVQCLMGYASVIGQSERQLTITALSVSISRTRSSASFVKKISKA  105

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  ++  C +    S+  +  S+  L +I    G D    + +++ W+ +  ++
Sbjct  106  RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGSIGHAVGEDFVWHMTNVQTWVSAALTD  165

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++      +   V   +   +  +   +   LAL + FA+
Sbjct  166  DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFAS  209



>ref|XP_006385730.1| hypothetical protein POPTR_0003s11310g, partial [Populus trichocarpa]
 gb|ERP63527.1| hypothetical protein POPTR_0003s11310g, partial [Populus trichocarpa]
Length=198

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 89/161 (55%), Gaps = 4/161 (2%)
 Frame = -1

Query  1259  EFIQTSC-EGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
              +I+TSC + T YP+LC  +L  +   I  + +LLA+ A++ +L  + S + ++ + ++ 
Sbjct  32    RYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSLKSTNSTSRLMKRASKT  91

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P     M  C+E+V D++++L+ S+ EM H     F   ++ +E  ++ AL D D 
Sbjct  92    PGLDPRVLAAMLDCVEEVGDAVYELQRSIEEMDHAGGSNFSMVMNDVETWVSAALTDDDT  151

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             C +G  +  +N   +  VK  +  +A +T N L L+ ++A+
Sbjct  152   CMDGFAEGAVNKKVKTTVKRHLGRIARLTSNALALVNRYAS  192


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 90/174 (52%), Gaps = 4/174 (2%)
 Frame = -1

Query  791  AAGFPGRENTDFIKSSC-DKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +A  P   N  +IK+SC D T +P +CY +L+  A  I  NPK LA  A+ ++ ++T  T
Sbjct  22   SATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSLKSTNST  81

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
             R M   +   GL P+   ++  C +    ++  +Q S   +E ++   G +   +++D+
Sbjct  82   SRLMKRASKTPGLDPRVLAAMLDCVEEVGDAVYELQRS---IEEMDHAGGSNFSMVMNDV  138

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            + W+ +  ++ ++C++      + +KV   V R +  +   +  ALAL + +A+
Sbjct  139  ETWVSAALTDDDTCMDGFAEGAVNKKVKTTVKRHLGRIARLTSNALALVNRYAS  192



>ref|XP_011010941.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=199

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 83/164 (51%), Gaps = 6/164 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             + FI+ SC  T YP LC   L  +   I +    L   A++ +LD ++S    V K+ + 
Sbjct  34    SNFIKASCSATTYPALCVQCLSLYASSIKQSPRQLIQTALSVSLDKAQSTKTFVYKLTKF  93

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
             K + P     +K C E+++D++ KL  S+ E+K++   K   ++  IS ++  I+ AL D
Sbjct  94    KGIKPREKAAIKDCFEEIDDTLDKLVKSVKELKNMGSSKGQDYQWHISNVQTWISAALTD  153

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              + C +G     LN   + ++  +   V  +T N L L+ KF +
Sbjct  154   ENTCVDGFAGKALNGRVKNSITARFVHVERVTSNALALINKFGS  197


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 82/164 (50%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FIK+SC  T +P +C   LS  A  I  +P++L + A+S++    + T   + ++   
Sbjct  34   SNFIKASCSATTYPALCVQCLSLYASSIKQSPRQLIQTALSVSLDKAQSTKTFVYKLTKF  93

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  +I  C +    ++  +  S+  L+ +   KG D    I +++ W+ +  ++
Sbjct  94   KGIKPREKAAIKDCFEEIDDTLDKLVKSVKELKNMGSSKGQDYQWHISNVQTWISAALTD  153

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++    + +  +V   +T     +E  +  ALAL + F +
Sbjct  154  ENTCVDGFAGKALNGRVKNSITARFVHVERVTSNALALINKFGS  197



>gb|KFK40568.1| hypothetical protein AALP_AA2G013000 [Arabis alpina]
Length=201

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 93/172 (54%), Gaps = 6/172 (3%)
 Frame = -1

Query  782  FPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            +  + N D+IK+SC+ T + NICY SLS  A  I + P++LA  A++LT  + +  ++ +
Sbjct  30   YSNKTNLDYIKTSCNLTLYKNICYNSLSPYASTIDSKPQKLAVTALNLTLSSAKSALKVI  89

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
              I+ K GL+  E  +++ C +    S+  +QDSL  L++IN         ++ D++ W 
Sbjct  90   KAISHKTGLTRLEVAAVNDCVEEIGDSVSELQDSLRELDSINNKDSSKFEMVVSDVQTWA  149

Query  422  KSVKSNYESCIEEL--ETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  +N ++C++        +K+ V + V  + R     +  ALAL + +A+
Sbjct  150  SAALTNDDTCMDGFGRAGTVMKDLVRQHVVNVAR----LTSNALALINMYAS  197


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 78/161 (48%), Gaps = 4/161 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             ++I+TSC  T Y  +C  SL  +   I    + LA  A+N  L  ++S   ++  ++   
Sbjct  37    DYIKTSCNLTLYKNICYNSLSPYASTIDSKPQKLAVTALNLTLSSAKSALKVIKAISHKT  96

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLK---CPGFEGKISYIENLITTALIDY  909
              L       +  C+E++ DS+ +L+ SL E+  +       FE  +S ++   + AL + 
Sbjct  97    GLTRLEVAAVNDCVEEIGDSVSELQDSLRELDSINNKDSSKFEMVVSDVQTWASAALTND  156

Query  908   DRCPNGMNDTG-LNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D C +G    G + +  V+  +  VA +T N L L+  +A+
Sbjct  157   DTCMDGFGRAGTVMKDLVRQHVVNVARLTSNALALINMYAS  197



>ref|XP_002509585.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF50972.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=198

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 93/173 (54%), Gaps = 6/173 (3%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G AG  ++  +FI+ SC+ T YP+LC   L  +   I ++ + LA  A++ +L  ++S  
Sbjct  15    GKAGSASSPIDFIKASCKATRYPDLCVQCLSGYASAIQQNEQHLAQTALSVSLTRAKSAG  74

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKISYIE  939
               V K+ + + +       +K C++ + D++ +L  S+ E+ H+ +  G  F   +S ++
Sbjct  75    DYVKKLTKVRGIKAREYRAVKDCIDNMGDTVDRLSQSIRELDHMGRAVGKDFVWHMSNVQ  134

Query  938   NLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               ++ AL D + C +G     ++   + A+K ++  VA +T N L L+ +FA+
Sbjct  135   TWVSAALTDENTCLDGFAGRHMDGNVKAAIKSRVTNVARVTSNALALVNRFAS  187


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 83/181 (46%), Gaps = 4/181 (2%)
 Frame = -1

Query  815  LTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT  636
            L++  K  +A  P     DFIK+SC  T +P++C   LS  A  I  N + LA+ A+S++
Sbjct  11   LSIAGKAGSASSP----IDFIKASCKATRYPDLCVQCLSGYASAIQQNEQHLAQTALSVS  66

Query  635  QRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDL  456
                +     + ++    G+  +E  ++  C D    ++  +  S+  L+ +    G D 
Sbjct  67   LTRAKSAGDYVKKLTKVRGIKAREYRAVKDCIDNMGDTVDRLSQSIRELDHMGRAVGKDF  126

Query  455  HTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
               + +++ W+ +  ++  +C++      +   V   +   +  +   +  ALAL + FA
Sbjct  127  VWHMSNVQTWVSAALTDENTCLDGFAGRHMDGNVKAAIKSRVTNVARVTSNALALVNRFA  186

Query  275  A  273
            +
Sbjct  187  S  187



>ref|XP_004307821.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=193

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 7/168 (4%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  + FI+TSC  T YP+LC  SL  +   I +    LA  A++ +L  ++     V K+
Sbjct  24    TTASNFIKTSCSATTYPDLCVQSLSSYSNAIQQSPRQLAQTALSVSLTRAQYAKSFVTKL  83

Query  1091  AQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL----KCPGFEGKISYIENLITT  924
              + K L  +    +  CLE++ DS+ +L  S+ E+K +    K   F   +S +E  ++ 
Sbjct  84    TKFKGLSHKEYEAIDDCLEEMGDSVDRLSKSVDELKKMGKSSKGQDFIWHMSNVETWVSA  143

Query  923   ALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             AL D + C +G +   ++   + +++ Q+  VA +T N L L   FA+
Sbjct  144   ALTDDNTCLDGFSGKAMDGKIKASIRAQVLNVAKVTSNALALCNHFAS  191


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 87/165 (53%), Gaps = 1/165 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FIK+SC  T +P++C  SLSS +  I  +P++LA+ A+S++    ++    + ++   
Sbjct  27   SNFIKTSCSATTYPDLCVQSLSSYSNAIQQSPRQLAQTALSVSLTRAQYAKSFVTKLTKF  86

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINE-LKGIDLHTIIDDIKEWLKSVKS  408
             GLS KE  +I  C +    S+  +  S+  L+ + +  KG D    + +++ W+ +  +
Sbjct  87   KGLSHKEYEAIDDCLEEMGDSVDRLSKSVDELKKMGKSSKGQDFIWHMSNVETWVSAALT  146

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +  +C++    + +  K+   +   +  +   +  ALAL + FA+
Sbjct  147  DDNTCLDGFSGKAMDGKIKASIRAQVLNVAKVTSNALALCNHFAS  191



>ref|XP_010053423.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
Length=225

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 89/173 (51%), Gaps = 7/173 (4%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             K A T FI +SC  T YP LC   L  + R I +    LA AA+  +L  +RS    ++K
Sbjct  48    KPAPTSFIVSSCRATRYPALCVHCLAAYGRAIQRSDHHLAQAALIVSLARARSAASFMSK  107

Query  1094  VAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTA  921
             +++ + +       M+ C+E + D++ +L  S+ E+   +  G  F   +S +E  ++ A
Sbjct  108   LSRARRIKLRELRAMRDCVENMGDTVDRLADSVRELGRSRYVGRDFAWHMSNVETWVSAA  167

Query  920   LIDYDRCPNGMN----DTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFPG  774
             L D + C +G      D G+ + AV+ ++  VA +T N L L+ ++A+   P 
Sbjct  168   LTDENTCTDGFGGRVMDGGV-KVAVRGRVVDVARVTSNALALVNRYASRHSPA  219



>ref|XP_006421712.1| hypothetical protein CICLE_v10007113mg [Citrus clementina]
 gb|ESR34952.1| hypothetical protein CICLE_v10007113mg [Citrus clementina]
Length=195

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 86/163 (53%), Gaps = 6/163 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T ++ TSC+ T YP LC  SL  + R I +    ++  A++ +L  ++S    + K+ + 
Sbjct  28    TSYVTTSCKSTTYPALCMRSLSGYARVIRRSPRQMSLVALSVSLSRTKSAYSFLTKLKRF  87

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALID  912
             K+L P  +  +  CLE ++DS+ +L  S  EMK+L   K   F   +S ++   + AL +
Sbjct  88    KNLKPRESRAIADCLELMDDSVDRLSKSFQEMKNLGRVKSRDFLFHMSNVQTWASAALTN  147

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
              + C +   D  +N   + +V  Q+A V  +T N L L+ +FA
Sbjct  148   GNTCLDEFADKSMNGKVKDSVTAQVANVVQVTSNALGLVNQFA  190


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 82/164 (50%), Gaps = 0/164 (0%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            +T ++ +SC  T +P +C  SLS  A  I  +P++++  A+S++   T+     + ++  
Sbjct  27   DTSYVTTSCKSTTYPALCMRSLSGYARVIRRSPRQMSLVALSVSLSRTKSAYSFLTKLKR  86

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKS  408
               L P+E+ +I  C +L   S+  +  S   ++ +  +K  D    + +++ W  +  +
Sbjct  87   FKNLKPRESRAIADCLELMDDSVDRLSKSFQEMKNLGRVKSRDFLFHMSNVQTWASAALT  146

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            N  +C++E   + +  KV + VT  +  +   +  AL L + FA
Sbjct  147  NGNTCLDEFADKSMNGKVKDSVTAQVANVVQVTSNALGLVNQFA  190



>ref|XP_009362111.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=201

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 91/165 (55%), Gaps = 4/165 (2%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             + T++I+ SC  T YP+LC  SL  +  +I  + ++LA  A+N  +  ++     + +++
Sbjct  30    SNTQYIKRSCSVTTYPKLCYNSLSIYAGKIKTNPKVLARTALNVTIAATQETYVTMKRLS  89

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPGFEGKISYIENLITTALID  912
             +   L P  A     C+E++ D++ +++ S+ E  H+ +   F  ++S I+  ++ AL D
Sbjct  90    KTHGLNPIEAAAALDCVEEIGDAVEEVQKSIDEFGHVARGSNFWVQMSDIQTWVSAALTD  149

Query  911   YDRCPNGMND---TGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              D C +G ++   +G  E  V+  I  VAH+T N L L+  +A+A
Sbjct  150   EDTCMDGFDEHHMSGRVESLVRRYIVNVAHLTSNALALINSYASA  194


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 89/175 (51%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  AAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFT  615
            +A   P + NT +IK SC  T +P +CY SLS  A  I  NPK LA+ A+++T   T+ T
Sbjct  22   SANELPSKSNTQYIKRSCSVTTYPKLCYNSLSIYAGKIKTNPKVLARTALNVTIAATQET  81

Query  614  VRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDI  435
               M  ++   GL+P E  +   C +    ++  +Q S+     +   +G +    + DI
Sbjct  82   YVTMKRLSKTHGLNPIEAAAALDCVEEIGDAVEEVQKSIDEFGHV--ARGSNFWVQMSDI  139

Query  434  KEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAG  270
            + W+ +  ++ ++C++  +   +  +V   V R +  +   +  ALAL +S+A+ 
Sbjct  140  QTWVSAALTDEDTCMDGFDEHHMSGRVESLVRRYIVNVAHLTSNALALINSYASA  194



>ref|XP_006448207.1| hypothetical protein CICLE_v10016684mg [Citrus clementina]
 gb|ESR61447.1| hypothetical protein CICLE_v10016684mg [Citrus clementina]
 gb|KDO64576.1| hypothetical protein CISIN_1g028183mg [Citrus sinensis]
Length=212

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 85/169 (50%), Gaps = 9/169 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+FI+TSC  T YPE+C  +L ++   I +D   LA  A+   L  ++ +   V+ +++ 
Sbjct  42    TDFIRTSCNSTLYPEICYSTLSRYASTIQQDPAQLASVAIGVTLSKAKRMANYVSNISRQ  101

Query  1082  KSLPPE--AATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG-----FEGKISYIENLITT  924
                  +  AA  +  C     D++ ++  SL +M+ ++  G     F  ++S ++  ++ 
Sbjct  102   ADYGSDQRAAAALHDCFSNFGDAVEEIYGSLKQMRQIRSAGTSRASFRFQMSNVQTWMSA  161

Query  923   ALIDYDRCPNGMNDT--GLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAG  783
             AL D + C +G  D   G  +  V D++  V  +T N L L+ ++A  G
Sbjct  162   ALTDEETCTDGFEDVADGQMKEEVCDRVEYVKKLTSNALALVNRYAENG  210


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (46%), Gaps = 19/174 (11%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            TDFI++SC+ T +P ICY++LS  A  I  +P +LA  AI +T        +RM      
Sbjct  42   TDFIRTSCNSTLYPEICYSTLSRYASTIQQDPAQLASVAIGVTLS----KAKRMANYVSN  97

Query  584  I------GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINE--LKGIDLHTIIDDIKE  429
            I      G   +   ++H C      ++  +  SL  +  I             + +++ 
Sbjct  98   ISRQADYGSDQRAAAALHDCFSNFGDAVEEIYGSLKQMRQIRSAGTSRASFRFQMSNVQT  157

Query  428  WLKSVKSNYESC---IEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            W+ +  ++ E+C    E++   Q+KE+V + V      ++  +  ALAL + +A
Sbjct  158  WMSAALTDEETCTDGFEDVADGQMKEEVCDRV----EYVKKLTSNALALVNRYA  207



>ref|XP_006469216.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=212

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 85/169 (50%), Gaps = 9/169 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+FI+TSC  T YPE+C  +L ++   I +D   LA  A+   L  ++ +   V+ +++ 
Sbjct  42    TDFIRTSCNSTLYPEICYSTLSRYASTIQQDPAQLASVAIGVTLSKAKRMANYVSNISRQ  101

Query  1082  KSLPPE--AATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG-----FEGKISYIENLITT  924
                  +  AA  +  C     D++ ++  SL +M+ ++  G     F  ++S ++  ++ 
Sbjct  102   ADYGSDQRAAAALHDCFSNFGDAVEEIYGSLKQMRQIRSAGTSRASFRFQMSNVQTWMSA  161

Query  923   ALIDYDRCPNGMNDT--GLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAG  783
             AL D + C +G  D   G  +  V D++  V  +T N L L+ ++A  G
Sbjct  162   ALTDEETCTDGFEDVADGQMKEEVCDRVEYVKKLTSNALALVNRYAENG  210


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 80/170 (47%), Gaps = 11/170 (6%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA--  591
            TDFI++SC+ T +P ICY++LS  A  I  +P +LA  AI +T    +     +  I+  
Sbjct  42   TDFIRTSCNSTLYPEICYSTLSRYASTIQQDPAQLASVAIGVTLSKAKRMANYVSNISRQ  101

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINE--LKGIDLHTIIDDIKEWLKS  417
               G   +   ++H C      ++  +  SL  +  I             + +++ W+ +
Sbjct  102  ADYGSDQRAAAALHDCFSNFGDAVEEIYGSLKQMRQIRSAGTSRASFRFQMSNVQTWMSA  161

Query  416  VKSNYESC---IEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
              ++ E+C    E++   Q+KE+V + V      ++  +  ALAL + +A
Sbjct  162  ALTDEETCTDGFEDVADGQMKEEVCDRV----EYVKKLTSNALALVNRYA  207



>ref|XP_009393953.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=196

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 85/162 (52%), Gaps = 7/162 (4%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ--  1086
             EF++ SC GT YP LC  SL  +   + +    LA AA+  + D +RS +  V++++   
Sbjct  31    EFVRDSCRGTRYPALCEQSLVAYAPAVHRSKRELARAALAVSADRARSASAFVSRMSSGG  90

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALI  915
              K +    A  ++ C+E ++DS+ +L+ S+ EM  +   + P F   +S ++  ++ AL 
Sbjct  91    QKKVRSREAGAVRDCIETMHDSVDQLRQSVEEMGRMGRARSPRFAWHLSNVQTWVSAALT  150

Query  914   DYDRCPNGMNDTG--LNEPAVKDQIAMVAHMTLNGLTLMKKF  795
             D   C +G++         A++ ++  VA +T N L L+ + 
Sbjct  151   DETTCLDGISQYAGPAVRAAIRKKVVEVARVTSNALALVNQL  192



>ref|XP_007045219.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
partial [Theobroma cacao]
 gb|EOY01051.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
partial [Theobroma cacao]
Length=266

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 84/170 (49%), Gaps = 7/170 (4%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T  T+FI+TSC  T YP+LC  SL  +   I +D   LA  A+  +L  +R +   V+ +
Sbjct  95    TNATDFIRTSCSATLYPDLCYTSLSGYANAIQQDPARLARTAIGVSLSKTRHMAVYVSNL  154

Query  1091  AQ--NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG---FEGKISYIENLIT  927
             ++  +    P A+  +  C   + D++ +++ SL +M+ L  PG   F  ++  ++  ++
Sbjct  155   SREADYGADPRASAALHDCFSNMGDAVDEIRGSLKQMRQLVAPGSESFRFQMGNVQTWMS  214

Query  926   TALIDYDRCPNGMNDT--GLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAG  783
              AL D D C +G  D   G  +  V  +   V   T N L L+  +A  G
Sbjct  215   AALTDEDTCTDGFEDVAEGPMKTDVCQRTGKVKKFTSNALALVNSYAEKG  264


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 83/165 (50%), Gaps = 3/165 (2%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA--  591
            TDFI++SC  T +P++CY SLS  A  I  +P RLA+ AI ++   T      +  ++  
Sbjct  98   TDFIRTSCSATLYPDLCYTSLSGYANAIQQDPARLARTAIGVSLSKTRHMAVYVSNLSRE  157

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
               G  P+ + ++H C      ++  ++ SL  +  +           + +++ W+ +  
Sbjct  158  ADYGADPRASAALHDCFSNMGDAVDEIRGSLKQMRQLVAPGSESFRFQMGNVQTWMSAAL  217

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            ++ ++C +  E +  +  +  +V +   +++ F+  ALAL +S+A
Sbjct  218  TDEDTCTDGFE-DVAEGPMKTDVCQRTGKVKKFTSNALALVNSYA  261



>ref|XP_011081197.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=201

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 88/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             +++I+ SC  T YP+LC  SL K+  EI    +LLA  A+    + + S++  + K++ N
Sbjct  40    SKYIRVSCRQTLYPKLCQKSLAKYATEIKTSPKLLATTALLVTFNTTHSVSKRLRKLSVN  99

Query  1082  KS--LPPEAATNMKHCLEQVNDSIHKLKMSLVEMK-HLKCPGFEGKISYIENLITTALID  912
             ++  L P     +  C+E+V+DS+++L+ S+ E+    K P FE ++S ++  ++ AL D
Sbjct  100   RALKLKPGEIQALLECVEEVSDSVYELRKSIKELNDSRKGPEFELRMSDVQTWVSAALTD  159

Query  911   YDRCPNGMNDTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              D C +     G  +  V+  +  +A +T   L  +  +AA 
Sbjct  160   DDTCMDDFTTRGKVKVLVRRFVVRIARLTSIALAFINNYAAV  201


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 87/166 (52%), Gaps = 7/166 (4%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA--  591
            + +I+ SC +T +P +C  SL+  A +I  +PK LA  A+ +T  TT    +R+ +++  
Sbjct  40   SKYIRVSCRQTLYPKLCQKSLAKYATEIKTSPKLLATTALLVTFNTTHSVSKRLRKLSVN  99

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
              + L P E  ++  C +    S+  ++ S+  L   +  KG +    + D++ W+ +  
Sbjct  100  RALKLKPGEIQALLECVEEVSDSVYELRKSIKELN--DSRKGPEFELRMSDVQTWVSAAL  157

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            ++ ++C+++  T   + KV   V R +  +   + IALA  +++AA
Sbjct  158  TDDDTCMDDFTT---RGKVKVLVRRFVVRIARLTSIALAFINNYAA  200



>ref|XP_010264193.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=202

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+FI+ SC  T YP +C  SL  +   I +    LA AA+  +L  +RS T  V+K+ + 
Sbjct  29    TDFIKASCGVTRYPAVCVESLSVYANAIQQSPRQLAQAALQVSLGRARSATAFVSKMTRL  88

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLK---CPGFEGKISYIENLITTALID  912
             + L       +K C++ + DS+ ++  S+ E+  +       F   +S ++  ++ AL D
Sbjct  89    RGLKGRQYQAVKDCVDNLGDSVDRISRSIHELGQINRGASQDFMWHMSNVQTWVSAALTD  148

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              + C +G    G++   + A++ +I  VA +T N L L+ +FA+ 
Sbjct  149   ENTCMDGFAGHGMDGHVKTAIRGKILNVAQVTSNALALLNRFASG  193


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (48%), Gaps = 6/168 (4%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGEI  594
            TDFIK+SC  T +P +C  SLS  A  I  +P++LA+ A+ ++    R+    V +M  +
Sbjct  29   TDFIKASCGVTRYPAVCVESLSVYANAIQQSPRQLAQAALQVSLGRARSATAFVSKMTRL  88

Query  593  AGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSV  414
                GL  ++  ++  C D    S+  +  S+  L  IN     D    + +++ W+ + 
Sbjct  89   R---GLKGRQYQAVKDCVDNLGDSVDRISRSIHELGQINRGASQDFMWHMSNVQTWVSAA  145

Query  413  KSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAG  270
             ++  +C++      +   V   +   +  +   +  ALAL + FA+G
Sbjct  146  LTDENTCMDGFAGHGMDGHVKTAIRGKILNVAQVTSNALALLNRFASG  193



>ref|XP_009589629.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=202

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 87/173 (50%), Gaps = 7/173 (4%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
              +  +  ATT FI+TSC+ T YP +C  SL  +   I    + LA AA++ +L  ++   
Sbjct  27    SVTSQNPATTYFIKTSCKNTLYPTVCIQSLSAYANTIQLSEQQLAQAALSISLKKAKLAA  86

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKH----LKCPGFEGKISYI  942
               ++K+ + + L P      K CL  +NDS+++L  S+ E+           F   +S +
Sbjct  87    DFISKITKIRGLKPREFQAAKDCLSTMNDSVYQLNRSIPELSQSGQLAAGQDFTWHVSNV  146

Query  941   ENLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             +  I+ AL D + C +  N+  ++   +  V+ ++   A +T N L L+ +FA
Sbjct  147   QTWISAALTDENACLDMFNNPSMDGKIKALVRARVFAAAQVTSNALALVYRFA  199


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 77/164 (47%), Gaps = 1/164 (1%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            T FIK+SC  T +P +C  SLS+ A  I  + ++LA+ A+S++ +  +     + +I   
Sbjct  36   TYFIKTSCKNTLYPTVCIQSLSAYANTIQLSEQQLAQAALSISLKKAKLAADFISKITKI  95

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINEL-KGIDLHTIIDDIKEWLKSVKS  408
             GL P+E  +   C    + S+  +  S+  L    +L  G D    + +++ W+ +  +
Sbjct  96   RGLKPREFQAAKDCLSTMNDSVYQLNRSIPELSQSGQLAAGQDFTWHVSNVQTWISAALT  155

Query  407  NYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            +  +C++      +  K+   V   +      +  ALAL   FA
Sbjct  156  DENACLDMFNNPSMDGKIKALVRARVFAAAQVTSNALALVYRFA  199



>emb|CBI24572.3| unnamed protein product [Vitis vinifera]
Length=187

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 1/134 (1%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G A +K   TEFI+TSC  T YP LC  SL  H   I     LLA  A++  L  +RS +
Sbjct  29    GPAARKD-NTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTS  87

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLI  930
              +++ +  +  L P     MK C+E+++DS+ +L+ ++ EM  +K   F   ++ I+  +
Sbjct  88    SVMSNLLLSHGLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWV  147

Query  929   TTALIDYDRCPNGM  888
             + AL   D C +G 
Sbjct  148   SAALTYEDTCTDGF  161


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 86/162 (53%), Gaps = 4/162 (2%)
 Frame = -1

Query  794  AAAGFPGR-ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEF  618
            +AAG   R +NT+FI++SC  T +P +C+ SLS+ A  I  +P+ LA  A+S+T  T   
Sbjct  26   SAAGPAARKDNTEFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARS  85

Query  617  TVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDD  438
            T   M  +    GL P+E +++  C +    S+  ++ ++  +   N++KG +   I++D
Sbjct  86   TSSVMSNLLLSHGLKPREVVAMKDCVEELSDSVDQLRKAMGEM---NQIKGSNFGLIMND  142

Query  437  IKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPF  312
            I+ W+ +  +  ++C +      +  K+ + V   +R    F
Sbjct  143  IQTWVSAALTYEDTCTDGFAGNTMDGKLKKAVRTRIRANLSF  184



>ref|XP_011029961.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=202

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 77/159 (48%), Gaps = 3/159 (2%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T ++QT+C  T YP+LC  SL  +   I  +   L   A+   L  + + + +V  +++ 
Sbjct  42    TNYLQTACNSTTYPQLCFKSLSSYTSTIKTNDLKLCRTALTVTLKAASNTSSLVKALSKQ  101

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
             K L    A  +K C+E + DSI +L  SL  +  LK    E +I+ I+  I+ A+ D D 
Sbjct  102   KGLSKTEAGIIKDCIEVIGDSIDELNQSLKALGSLKGSDIEFQIANIKTWISAAITDEDT  161

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKF  795
             C  G  +  + +     ++  I  V  +T N L L+ K 
Sbjct  162   CTEGFEERNITDEVMIKIRKSIVNVTRLTSNALALINKL  200


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 87/171 (51%), Gaps = 3/171 (2%)
 Frame = -1

Query  800  KFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTE  621
            + + A    +  T++++++C+ T +P +C+ SLSS    I  N  +L + A+++T +   
Sbjct  30   QLSLADTTSKTYTNYLQTACNSTTYPQLCFKSLSSYTSTIKTNDLKLCRTALTVTLKAAS  89

Query  620  FTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
             T   +  ++ + GLS  E   I  C ++   SI  +  S   L+ +  LKG D+   I 
Sbjct  90   NTSSLVKALSKQKGLSKTEAGIIKDCIEVIGDSIDELNQS---LKALGSLKGSDIEFQIA  146

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALF  288
            +IK W+ +  ++ ++C E  E   I ++V  ++ + +  +   +  ALAL 
Sbjct  147  NIKTWISAAITDEDTCTEGFEERNITDEVMIKIRKSIVNVTRLTSNALALI  197



>ref|XP_003550896.1| PREDICTED: 21 kDa protein-like [Glycine max]
Length=213

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 85/166 (51%), Gaps = 10/166 (6%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             +FI++SC+ T YP  C  +L  H   I +  + LA  A++ ++  +RS    V ++   K
Sbjct  41    DFIKSSCKATRYPAACVQTLSGHASAIRQSEQQLAVTALSVSVSKTRSCASFVKRMGSVK  100

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG-----FEGKISYIENLITTALI  915
              + P     ++ C+E +NDS+ +L  S+ E+  +   G     F   +S ++  ++ A+ 
Sbjct  101   GMKPREYNALRDCVENMNDSVDRLSQSVKELGLVMGKGKGKKDFTWHVSNVQTWVSAAIT  160

Query  914   DYDRCPNGMN----DTGLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D D C +G +    D  L   +V+ ++   + +T N L L+ +FA+
Sbjct  161   DQDTCLDGFDGPHVDANL-RASVRPRVVDASQVTSNALALVNRFAS  205


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 84/168 (50%), Gaps = 8/168 (5%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGEIA  591
            DFIKSSC  T +P  C  +LS  A  I  + ++LA  A+S++    R+    V+RMG + 
Sbjct  41   DFIKSSCKATRYPAACVQTLSGHASAIRQSEQQLAVTALSVSVSKTRSCASFVKRMGSVK  100

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETI-NELKG-IDLHTIIDDIKEWLKS  417
               G+ P+E  ++  C +  + S+  +  S+  L  +  + KG  D    + +++ W+ +
Sbjct  101  ---GMKPREYNALRDCVENMNDSVDRLSQSVKELGLVMGKGKGKKDFTWHVSNVQTWVSA  157

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              ++ ++C++  +   +   +   V   + +    +  ALAL + FA+
Sbjct  158  AITDQDTCLDGFDGPHVDANLRASVRPRVVDASQVTSNALALVNRFAS  205



>ref|XP_008448897.1| PREDICTED: 21 kDa protein-like [Cucumis melo]
Length=192

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 87/163 (53%), Gaps = 6/163 (4%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
              + T  T+FI+T+C+ TPYP+LC  SL      I     L+  AA+  AL  +RS +  V
Sbjct  28    SQPTNDTQFIKTTCQSTPYPDLCLSSLSDSAAAIHSSYRLMTIAALTVALTHTRSTSSAV  87

Query  1100  AKVAQNK-SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITT  924
               +A++  +L P     ++ C+E+  DS+ +LKM++ E+K      FE +   I   ++ 
Sbjct  88    ESLAKSSNALTPREGYVIRDCIEEFGDSVEELKMAIEELKDNNKTRFETE--DIRTWVSA  145

Query  923   ALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLM  804
             AL D D C +G+    +N   + ++K  +  VA +T   L+L+
Sbjct  146   ALTDDDTCMDGLVGDAMNGNIKESIKAMVVDVAQLTSIALSLV  188


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 87/166 (52%), Gaps = 14/166 (8%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPK--RLAKNAISLTQ-RTTEFTVRRMGE  597
            +T FIK++C  TP+P++C +SLS SA  I ++ +   +A   ++LT  R+T   V  + +
Sbjct  33   DTQFIKTTCQSTPYPDLCLSSLSDSAAAIHSSYRLMTIAALTVALTHTRSTSSAVESLAK  92

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLE-TINELKGIDLHTI-IDDIKEWL  423
             +    L+P+E   I  C       I    DS+  L+  I ELK  +      +DI+ W+
Sbjct  93   SSN--ALTPREGYVIRDC-------IEEFGDSVEELKMAIEELKDNNKTRFETEDIRTWV  143

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFS  285
             +  ++ ++C++ L  + +   + E +  ++ ++   + IAL+L S
Sbjct  144  SAALTDDDTCMDGLVGDAMNGNIKESIKAMVVDVAQLTSIALSLVS  189



>ref|XP_004245727.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=206

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 88/166 (53%), Gaps = 7/166 (4%)
 Frame = -1

Query  1268  ATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVA  1089
             A  +FI+ SC+ T YP LC   L      + +  + LAHAA++ +L  ++S    V+K+ 
Sbjct  34    AAIKFIKVSCKATLYPVLCVQCLSAFANTVKQSEKQLAHAALSVSLSKAKSTIIFVSKLN  93

Query  1088  QNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL----KCPGFEGKISYIENLITTA  921
             + + L P     +K C++ ++DS+ ++  S+ E+ H         F   +S ++  ++ A
Sbjct  94    RMRGLKPIEKQAVKDCMDTMSDSVDQINKSIPELGHTGQFSSGQDFMWHVSNVQTWVSAA  153

Query  920   LIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             L D   C +G +  G+N   + A++ +I  VA +T N L L+ +FA
Sbjct  154   LTDESTCLDGFSGPGVNVNVKAALRLRILHVAQVTSNALALVNRFA  199


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/178 (24%), Positives = 79/178 (44%), Gaps = 3/178 (2%)
 Frame = -1

Query  806  MKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRT  627
            M K A A  P      FIK SC  T +P +C   LS+ A  +  + K+LA  A+S++   
Sbjct  24   MAKSAMASNPAA--IKFIKVSCKATLYPVLCVQCLSAFANTVKQSEKQLAHAALSVSLSK  81

Query  626  TEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINEL-KGIDLHT  450
             + T+  + ++    GL P E  ++  C D    S+  +  S+  L    +   G D   
Sbjct  82   AKSTIIFVSKLNRMRGLKPIEKQAVKDCMDTMSDSVDQINKSIPELGHTGQFSSGQDFMW  141

Query  449  IIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
             + +++ W+ +  ++  +C++      +   V   +   +  +   +  ALAL + FA
Sbjct  142  HVSNVQTWVSAALTDESTCLDGFSGPGVNVNVKAALRLRILHVAQVTSNALALVNRFA  199



>gb|ACJ86212.1| unknown [Medicago truncatula]
Length=217

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             +EFI++SC  T YP LC   L  +   IG+    L   A++ ++  +RS    V K+++ 
Sbjct  46    SEFIRSSCRATRYPVLCVQCLMGYLCVIGQSERQLTITALSVSISRTRSSASFVKKISKA  105

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEM---KHLKCPGFEGKISYIENLITTALID  912
             + + P     ++ C+E + DS+  L  S+ E+    H     F   ++ ++  ++ AL D
Sbjct  106   RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGSIGHAVGEDFVWHMTNVQTWVSAALTD  165

Query  911   YDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
              + C +G     +N   + A+KD++  VA +T N L L+ +FA++
Sbjct  166   DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFASS  210


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/164 (21%), Positives = 76/164 (46%), Gaps = 0/164 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            ++FI+SSC  T +P +C   L    C I  + ++L   A+S++   T  +   + +I+  
Sbjct  46   SEFIRSSCRATRYPVLCVQCLMGYLCVIGQSERQLTITALSVSISRTRSSASFVKKISKA  105

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  ++  C +    S+  +  S+  L +I    G D    + +++ W+ +  ++
Sbjct  106  RGIKPREYRAVQDCIENMGDSLDSLSQSVRELGSIGHAVGEDFVWHMTNVQTWVSAALTD  165

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              +C++      +   V   +   +  +   +   LAL + FA+
Sbjct  166  DNTCLDGFAGPSMNGIVKAAIKDRVVNVAQVTSNTLALVNRFAS  209



>ref|XP_010931030.1| PREDICTED: 21 kDa protein-like [Elaeis guineensis]
Length=199

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 83/162 (51%), Gaps = 7/162 (4%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQ--  1086
             +FI++SC  T YP LC   L  +   + +    LA AA+  + D +RS +  VA+ +   
Sbjct  34    DFIRSSCGTTTYPALCVKRLAAYAPSVRRSPRELARAALTVSADRARSTSAFVARFSAGG  93

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT---TALI  915
             NK++    A  ++ CLE + DS+  L+ S  E+  L  PG  G + ++ N+ T    AL 
Sbjct  94    NKAIKAREAGAIRDCLENMADSVDWLRQSAQELGRLGRPGSAGFMWHLNNVQTWSSAALT  153

Query  914   DYDRCPNGMNDTGLN--EPAVKDQIAMVAHMTLNGLTLMKKF  795
             D + C + ++  G      A++ ++  VA +T N L L+ + 
Sbjct  154   DENTCLDSLSQNGSRTAREAIRKKVVEVAQLTSNALALVNRI  195


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/148 (23%), Positives = 70/148 (47%), Gaps = 11/148 (7%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGEIA  591
            DFI+SSC  T +P +C   L++ A  +  +P+ LA+ A++++    R+T   V R     
Sbjct  34   DFIRSSCGTTTYPALCVKRLAAYAPSVRRSPRELARAALTVSADRARSTSAFVARF-SAG  92

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVK  411
            G   +  +E  +I  C +    S+ +++ S   L  +           +++++ W  +  
Sbjct  93   GNKAIKAREAGAIRDCLENMADSVDWLRQSAQELGRLGRPGSAGFMWHLNNVQTWSSAAL  152

Query  410  SNYESCIEELET-------EQIKEKVTE  348
            ++  +C++ L         E I++KV E
Sbjct  153  TDENTCLDSLSQNGSRTAREAIRKKVVE  180



>ref|XP_010062095.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
Length=204

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 83/163 (51%), Gaps = 7/163 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             FI+ SC  T YP +C  SL  +   +    + LA AA+   L  +++    V +  + K 
Sbjct  40    FIKASCSETSYPAVCVQSLSAYANTVKLSRKELAQAALTVTLAKAQATRDFVTRSTKLKG  99

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL----KCPGFEGKISYIENLITTALIDY  909
             L       +K CLE++ D++ +L  S+ E+K +    K   F+  +S +E  ++ AL D 
Sbjct  100   LKAREYEAVKDCLEEMGDTVDRLSKSMKELKGMGSQSKAQDFQWHVSNVETWVSAALTDE  159

Query  908   DRCPNGMNDT---GLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             + C +G +     G  + +++ +I  VA +T N L L+ +FAA
Sbjct  160   NTCMDGFSGKATEGRLKKSIRTRIVEVAQVTSNALALVNRFAA  202


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 90/176 (51%), Gaps = 25/176 (14%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT----QRTTEFTVRRMGEI  594
            +FIK+SC +T +P +C  SLS+ A  +  + K LA+ A+++T    Q T +F  R     
Sbjct  39   NFIKASCSETSYPAVCVQSLSAYANTVKLSRKELAQAALTVTLAKAQATRDFVTR-----  93

Query  593  AGKI-GLSPKENMSIHVCEDLSHKSILYMQDSLSNL-ETINELKGI-------DLHTIID  441
            + K+ GL  +E  ++  C +        M D++  L +++ ELKG+       D    + 
Sbjct  94   STKLKGLKAREYEAVKDCLE-------EMGDTVDRLSKSMKELKGMGSQSKAQDFQWHVS  146

Query  440  DIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +++ W+ +  ++  +C++    +  + ++ + +   + E+   +  ALAL + FAA
Sbjct  147  NVETWVSAALTDENTCMDGFSGKATEGRLKKSIRTRIVEVAQVTSNALALVNRFAA  202



>ref|XP_002312451.2| hypothetical protein POPTR_0008s13190g [Populus trichocarpa]
 gb|EEE89818.2| hypothetical protein POPTR_0008s13190g [Populus trichocarpa]
Length=212

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 91/175 (52%), Gaps = 9/175 (5%)
 Frame = -1

Query  1274  KTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK  1095
             +++ T++I++SC  T YPE+C  SL ++   + +    LA  A+  +L  +R L   V+ 
Sbjct  38    RSSGTDYIRSSCGVTLYPEICYTSLSRYASAVKQSPSRLARVAIGVSLSRARRLAAYVSN  97

Query  1094  VAQNKSLPPE--AATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG-----FEGKISYIEN  936
             + +++    +  A   +  CL  + D++ ++  SL +M+ +   G     F+ ++S ++ 
Sbjct  98    LTRHEDFGGDHRATAAIHDCLSNMGDAVDEMSGSLKQMRKVGAAGLSAESFQFQMSNVQT  157

Query  935   LITTALIDYDRCPNGMNDT--GLNEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
              ++ AL D + C +G  D   G  +  V +++A     T N L L+  FAAAG P
Sbjct  158   WMSAALTDEETCTDGFEDVADGAVKTEVCNRVADAKKFTSNALALVNTFAAAGTP  212


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 89/189 (47%), Gaps = 33/189 (17%)
 Frame = -1

Query  785  GFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRR  606
            GF     TD+I+SSC  T +P ICY SLS  A  +  +P RLA+ AI +       ++ R
Sbjct  35   GFSRSSGTDYIRSSCGVTLYPEICYTSLSRYASAVKQSPSRLARVAIGV-------SLSR  87

Query  605  MGEIAGKIGLSPKENMSIHVCEDLS--HKSILYMQDSLSNL-ETINELKGI---------  462
               +A  +      N++ H  ED    H++   + D LSN+ + ++E+ G          
Sbjct  88   ARRLAAYV-----SNLTRH--EDFGGDHRATAAIHDCLSNMGDAVDEMSGSLKQMRKVGA  140

Query  461  ------DLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIA  300
                       + +++ W+ +  ++ E+C +  E +     V  EV   + + + F+  A
Sbjct  141  AGLSAESFQFQMSNVQTWMSAALTDEETCTDGFE-DVADGAVKTEVCNRVADAKKFTSNA  199

Query  299  LALFSSFAA  273
            LAL ++FAA
Sbjct  200  LALVNTFAA  208



>ref|XP_007039952.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
 gb|EOY24453.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
Length=206

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 89/172 (52%), Gaps = 10/172 (6%)
 Frame = -1

Query  1289  GIAG----KKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDIS  1122
             GIA     + ++   +I  SC+ T YP LC   L  +  EI +D + LA  A++ +L  +
Sbjct  19    GIAASASTRNSSPAAYIVASCKATRYPALCVQCLSGYASEIRQDEQHLARTALSVSLSKA  78

Query  1121  RSLTGMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKI  951
             +S    VAK+ Q + + P     +K C+E + D + +L  S+ E+ H+ +  G  F   +
Sbjct  79    QSAAAFVAKMTQVRGIKPRERQAVKDCIENMGDGVDRLSKSVKELSHVGRAVGQDFMWHM  138

Query  950   SYIENLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLM  804
             S ++  ++ AL D + C +G     ++   + A++ ++  VA +T N L L+
Sbjct  139   SNVQTWVSAALTDENTCLDGFAGRVMDGNIKTAIRRRVVNVAQVTSNALALV  190


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/156 (19%), Positives = 70/156 (45%), Gaps = 0/156 (0%)
 Frame = -1

Query  758  FIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKIG  579
            +I +SC  T +P +C   LS  A +I  + + LA+ A+S++    +     + ++    G
Sbjct  34   YIVASCKATRYPALCVQCLSGYASEIRQDEQHLARTALSVSLSKAQSAAAFVAKMTQVRG  93

Query  578  LSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYE  399
            + P+E  ++  C +     +  +  S+  L  +    G D    + +++ W+ +  ++  
Sbjct  94   IKPRERQAVKDCIENMGDGVDRLSKSVKELSHVGRAVGQDFMWHMSNVQTWVSAALTDEN  153

Query  398  SCIEELETEQIKEKVTEEVTRLMREMEPFSEIALAL  291
            +C++      +   +   + R +  +   +  ALAL
Sbjct  154  TCLDGFAGRVMDGNIKTAIRRRVVNVAQVTSNALAL  189



>ref|XP_008779098.1| PREDICTED: 21 kDa protein-like [Phoenix dactylifera]
Length=198

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 90/171 (53%), Gaps = 7/171 (4%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +    +++T+FI++SC  T YP LC   L  +   + +    LA AA+  + D +RS + 
Sbjct  24    VTSAASSSTDFIRSSCRTTTYPALCIKCLSAYAPSVRRSPRELARAALTVSADRARSASA  83

Query  1106  MVAKVAQ--NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENL  933
              VA+++   +K++    A  ++ CLE + DS+ +L+ S  E+  L   G  G + ++ N+
Sbjct  84    YVARLSAGGSKAIKAREAGAVRDCLENMADSVDRLRQSAQELGRLGRAGSAGFMWHLNNV  143

Query  932   IT---TALIDYDRCPNGMNDTGLNEP--AVKDQIAMVAHMTLNGLTLMKKF  795
              T    AL D + C + ++ +G      A++ ++  VA +T N L L+ + 
Sbjct  144   QTWCSAALTDENTCLDSLSQSGSGSTREAIRKKVVEVAQLTSNALALVNRI  194


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/150 (23%), Positives = 71/150 (47%), Gaps = 11/150 (7%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGE  597
            +TDFI+SSC  T +P +C   LS+ A  +  +P+ LA+ A++++    R+    V R+  
Sbjct  31   STDFIRSSCRTTTYPALCIKCLSAYAPSVRRSPRELARAALTVSADRARSASAYVARL-S  89

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
              G   +  +E  ++  C +    S+  ++ S   L  +           +++++ W  +
Sbjct  90   AGGSKAIKAREAGAVRDCLENMADSVDRLRQSAQELGRLGRAGSAGFMWHLNNVQTWCSA  149

Query  416  VKSNYESCIEELET-------EQIKEKVTE  348
              ++  +C++ L         E I++KV E
Sbjct  150  ALTDENTCLDSLSQSGSGSTREAIRKKVVE  179



>ref|XP_010934409.1| PREDICTED: 21 kDa protein-like [Elaeis guineensis]
Length=199

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 89/167 (53%), Gaps = 9/167 (5%)
 Frame = -1

Query  1271  TATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV  1092
             T++T+FI++SC  T YP LC   L  +   + +    LA AA+  + D +RS +  +A++
Sbjct  28    TSSTDFIRSSCGSTTYPALCVKCLSAYAPSVRRSPRELARAALTVSADRARSASAYIARL  87

Query  1091  AQ---NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLI  930
             +    +K++    A  ++ CL+ + DS+ +L+ S  EM  L      GF   +S ++   
Sbjct  88    SAGGGSKAINAREAGAVRDCLDNMADSVDQLRQSAQEMGRLGRAGSAGFMWHLSNVQTWC  147

Query  929   TTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKK  798
             + AL D + C + ++ +G     + A++ ++  VA +T N L L+ +
Sbjct  148   SAALTDENTCLDSLSQSGSGGAAKEAIRKKVVEVAQLTSNALVLVNR  194


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 74/163 (45%), Gaps = 3/163 (2%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGE  597
            +TDFI+SSC  T +P +C   LS+ A  +  +P+ LA+ A++++    R+    + R+  
Sbjct  30   STDFIRSSCGSTTYPALCVKCLSAYAPSVRRSPRELARAALTVSADRARSASAYIARLSA  89

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
              G   ++ +E  ++  C D    S+  ++ S   +  +           + +++ W  +
Sbjct  90   GGGSKAINAREAGAVRDCLDNMADSVDQLRQSAQEMGRLGRAGSAGFMWHLSNVQTWCSA  149

Query  416  VKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALF  288
              ++  +C++ L          E + + + E+   +  AL L 
Sbjct  150  ALTDENTCLDSLSQSGSGGAAKEAIRKKVVEVAQLTSNALVLV  192



>emb|CDX94463.1| BnaC01g17210D [Brassica napus]
Length=201

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 84/166 (51%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEF++ SCE T YPELC  SL  +  EI K    LA  A+  +L  ++S    V+ ++  
Sbjct  35    TEFVKASCETTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMSDY  94

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGK-----ISYIENLITTAL  918
             K +       +  C+E++ D++ +L+ SL E+KHL+  G  G+     +  +    + AL
Sbjct  95    KGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLE-EGESGEDFWLCLGNVRTWTSAAL  153

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D   C +G     ++   +  +++ I  VA  T N L L+  FA+
Sbjct  154   TDETTCLDGFGGKAMDGELKSLIREHILRVAQDTSNALALINVFAS  199


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/171 (22%), Positives = 94/171 (55%), Gaps = 9/171 (5%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
            ++T+F+K+SC+ T +P +C+ SLSS A +I   P++LA+ A++++    +     + +++
Sbjct  33   DDTEFVKASCETTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMS  92

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELK-GIDLHTIIDDIKEWLKSV  414
               G++ +++ ++  C +    ++  ++ SL  L+ + E + G D    + +++ W  + 
Sbjct  93   DYKGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLEEGESGEDFWLCLGNVRTWTSAA  152

Query  413  KSNYESCIEELETE----QIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++  +C++    +    ++K  + E + R+ ++       ALAL + FA+
Sbjct  153  LTDETTCLDGFGGKAMDGELKSLIREHILRVAQDTSN----ALALINVFAS  199



>ref|XP_002886456.1| hypothetical protein ARALYDRAFT_893206 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62715.1| hypothetical protein ARALYDRAFT_893206 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 91/163 (56%), Gaps = 2/163 (1%)
 Frame = -1

Query  761  DFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI  582
            D+IK+SC+ T +  +CY SL   A  + +NP +LA  A++LT  + +   + +  I+ + 
Sbjct  9    DYIKTSCNLTLYKTLCYNSLYPYASTVHSNPHKLAVTALNLTLSSAKSASKFVKNISHRG  68

Query  581  GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNY  402
            GL+  E +++  C +    S++ +QDS+  L++IN         ++ D++ W+ +  ++ 
Sbjct  69   GLTLLEAVAVADCVEEIGDSVISLQDSIRELDSINYKDSAKFEMVMSDVETWVSAALTDD  128

Query  401  ESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            E+C++     ++K  V + V R + E+   +  ALAL + FA+
Sbjct  129  ETCMDGF--SRVKTAVKDLVRRHVVEVARLTSNALALINMFAS  169


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 82/171 (48%), Gaps = 10/171 (6%)
 Frame = -1

Query  1280  GKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMV  1101
             G  T   ++I+TSC  T Y  LC  SL  +   +  +   LA  A+N  L  ++S +  V
Sbjct  2     GIHTLCLDYIKTSCNLTLYKTLCYNSLYPYASTVHSNPHKLAVTALNLTLSSAKSASKFV  61

Query  1100  AKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLK---CPGFEGKISYIENLI  930
               ++    L    A  +  C+E++ DS+  L+ S+ E+  +       FE  +S +E  +
Sbjct  62    KNISHRGGLTLLEAVAVADCVEEIGDSVISLQDSIRELDSINYKDSAKFEMVMSDVETWV  121

Query  929   TTALIDYDRCPNGMNDTGLNEPAVKD----QIAMVAHMTLNGLTLMKKFAA  789
             + AL D + C +G +     + AVKD     +  VA +T N L L+  FA+
Sbjct  122   SAALTDDETCMDGFSRV---KTAVKDLVRRHVVEVARLTSNALALINMFAS  169



>ref|XP_002304431.2| hypothetical protein POPTR_0003s20640g [Populus trichocarpa]
 gb|EEE79410.2| hypothetical protein POPTR_0003s20640g [Populus trichocarpa]
Length=203

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 89/162 (55%), Gaps = 4/162 (2%)
 Frame = -1

Query  1259  EFIQTSC-EGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
              +I+TSC + T YP+LC  +L  +   I  + +LLA+ A++ +L  + S + ++ + ++ 
Sbjct  37    RYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSLKSTNSTSRLMKRASKT  96

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               L P     M  C+E+V D++++L+ S+ EM H     F   ++ +   ++ +L D D 
Sbjct  97    PGLDPRVLAAMLDCVEEVGDAVYELQRSIEEMDHAGGSNFSMVMNDVVTWVSASLTDDDT  156

Query  902   CPNGMNDTGLNEPA---VKDQIAMVAHMTLNGLTLMKKFAAA  786
             C +G  +  +N+     VK  +  +A +T N L L+ ++A++
Sbjct  157   CMDGFAEGAVNKKVKTTVKRHLGRIARLTSNALALVNRYASS  198


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 97/193 (50%), Gaps = 4/193 (2%)
 Frame = -1

Query  848  IAMVAHMTLNGLTLMKKFAAAGFPGRENTDFIKSSC-DKTPFPNICYASLSSSACDIAAN  672
            +A+ A + +   T +    +A  P   N  +IK+SC D T +P +CY +L+  A  I  N
Sbjct  8    LALAAILVIQFSTPVNSSCSATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTN  67

Query  671  PKRLAKNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSN  492
            PK LA  A+ ++ ++T  T R M   +   GL P+   ++  C +    ++  +Q S   
Sbjct  68   PKLLANTALHVSLKSTNSTSRLMKRASKTPGLDPRVLAAMLDCVEEVGDAVYELQRS---  124

Query  491  LETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPF  312
            +E ++   G +   +++D+  W+ +  ++ ++C++      + +KV   V R +  +   
Sbjct  125  IEEMDHAGGSNFSMVMNDVVTWVSASLTDDDTCMDGFAEGAVNKKVKTTVKRHLGRIARL  184

Query  311  SEIALALFSSFAA  273
            +  ALAL + +A+
Sbjct  185  TSNALALVNRYAS  197



>ref|XP_010273892.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=202

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 85/156 (54%), Gaps = 2/156 (1%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             + +++SC    YP LC  +L  +     + +  LA AAV  +L  +R+++G +A++A+  
Sbjct  35    DLVRSSCIHASYPNLCLRTLSSYTGST-RTANDLARAAVTVSLSRARAVSGCIARLAKLH  93

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
                      ++ C+EQ++DS+ +L+ +L E++HL+   F  ++S  E  ++ AL + D C
Sbjct  94    GGSKRQQGALRDCVEQLSDSVDELRETLAELRHLRRGSFRWQMSNAETWVSAALTNEDTC  153

Query  899   PNGMNDT-GLNEPAVKDQIAMVAHMTLNGLTLMKKF  795
              +G     G  + AV+ +I  VA +T N L  + + 
Sbjct  154   LDGFEKVDGKVKLAVRRKINNVARVTSNALYFINRL  189



>gb|KDP25618.1| hypothetical protein JCGZ_20774 [Jatropha curcas]
Length=205

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 89/164 (54%), Gaps = 5/164 (3%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             T+++Q SC  T YPELC  SL  + R+I ++ + LA+ A+N  L  ++S +  +  +  N
Sbjct  34    TQYVQASCSNTTYPELCYSSLSCYARKIQRNPKTLAYVALNVTLTATKSASEFIKTLYNN  93

Query  1082  K--SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDY  909
             K   L P+ A  M  C+E  ++++ +L+ S+ +M   +    +  I+ I+  ++ AL D 
Sbjct  94    KLHGLKPKEAAAMADCVELADEAVDELERSIGKMGRARGSNSDPVINDIQTWVSAALTDD  153

Query  908   DRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAA  786
             + C +G +   L+   +  V   +  VA +T   L L+ +FA++
Sbjct  154   NTCMDGFSGDVLDGEVKSIVLKNMTQVAQLTSVALALVNRFASS  197


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 104/200 (52%), Gaps = 9/200 (5%)
 Frame = -1

Query  866  PAVKDQIAMVAHMTLNGLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSAC  687
            P ++  I ++  + +   ++   F++A      NT ++++SC  T +P +CY+SLS  A 
Sbjct  4    PTLRVAIIIILPVFILFFSIQINFSSAD----TNTQYVQASCSNTTYPELCYSSLSCYAR  59

Query  686  DIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGKI--GLSPKENMSIHVCEDLSHKSILY  513
             I  NPK LA  A+++T   T+     +  +      GL PKE  ++  C +L+ +++  
Sbjct  60   KIQRNPKTLAYVALNVTLTATKSASEFIKTLYNNKLHGLKPKEAAAMADCVELADEAVDE  119

Query  512  MQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRL  333
            ++ S+  +      +G +   +I+DI+ W+ +  ++  +C++    + +  +V   V + 
Sbjct  120  LERSIGKM---GRARGSNSDPVINDIQTWVSAALTDDNTCMDGFSGDVLDGEVKSIVLKN  176

Query  332  MREMEPFSEIALALFSSFAA  273
            M ++   + +ALAL + FA+
Sbjct  177  MTQVAQLTSVALALVNRFAS  196



>ref|XP_009370518.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=208

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 97/183 (53%), Gaps = 1/183 (1%)
 Frame = -1

Query  836  AHMTLNGLTLMKKFAAAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLA  657
            A + L  +T M+   A     +    ++K++C+ T +P ICY SLSS A  I +NP++L 
Sbjct  23   AVLLLITITNMQTTMATSSSSQTYKTYVKTACNSTTYPLICYKSLSSYASKIKSNPRKLC  82

Query  656  KNAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETIN  477
              A+S+T   ++     + + + K GL+P E   I+ C +   +SI  ++DSL++++ + 
Sbjct  83   IYALSVTLTASKNASSVVSKQSKKAGLTPTEKGVINDCLENIKESIDELKDSLTSMKNLG  142

Query  476  ELKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIAL  297
             + G D+   +DDIK W+ +V ++  +C +E +  ++   +   +   +      +  AL
Sbjct  143  -VTGGDVQAQLDDIKTWVSAVLTDDATCTDEFDDVKVSTAIKTAIKNSIVTTARLASNAL  201

Query  296  ALF  288
            +L 
Sbjct  202  SLI  204


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 82/160 (51%), Gaps = 5/160 (3%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNKS  1077
             +++T+C  T YP +C  SL  +  +I  +   L   A++  L  S++ + +V+K ++   
Sbjct  49    YVKTACNSTTYPLICYKSLSSYASKIKSNPRKLCIYALSVTLTASKNASSVVSKQSKKAG  108

Query  1076  LPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPG--FEGKISYIENLITTALIDYDR  903
             L P     +  CLE + +SI +LK SL  MK+L   G   + ++  I+  ++  L D   
Sbjct  109   LTPTEKGVINDCLENIKESIDELKDSLTSMKNLGVTGGDVQAQLDDIKTWVSAVLTDDAT  168

Query  902   CPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             C +  +D  ++   + A+K+ I   A +  N L+L+ K +
Sbjct  169   CTDEFDDVKVSTAIKTAIKNSIVTTARLASNALSLIDKLS  208



>ref|NP_176463.2| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
 gb|AAF19547.1|AC007190_15 F23N19.12 [Arabidopsis thaliana]
 gb|AEE34001.1| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=312

 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 93/170 (55%), Gaps = 2/170 (1%)
 Frame = -1

Query  782  FPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRM  603
            +  + N D+IK+SC+ T +  ICY SLS  A  I +NP++LA  A++LT  + +   + +
Sbjct  139  YSNQTNLDYIKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFV  198

Query  602  GEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWL  423
              I+   GL+  E +++  C +    S+  +QDS+  L++IN         ++ D++ W+
Sbjct  199  KNISHGGGLTRLEVVAVADCVEEIGDSVTSLQDSIRELDSINYKDSAKFEMVMSDVETWV  258

Query  422  KSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             +  +N ++C++      +K  V + V R + E+   +  ALAL + +A+
Sbjct  259  SAALTNDDTCMDGFSL--VKTAVKDLVRRHVVEVARLTSNALALINMYAS  306


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 80/164 (49%), Gaps = 10/164 (6%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             ++I+TSC  T Y  +C  SL  +   I  + + LA  A+N  L  ++S +  V  ++   
Sbjct  146   DYIKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVKNISHGG  205

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLK---CPGFEGKISYIENLITTALIDY  909
              L       +  C+E++ DS+  L+ S+ E+  +       FE  +S +E  ++ AL + 
Sbjct  206   GLTRLEVVAVADCVEEIGDSVTSLQDSIRELDSINYKDSAKFEMVMSDVETWVSAALTND  265

Query  908   DRCPNGMNDTGLNEPAVKD----QIAMVAHMTLNGLTLMKKFAA  789
             D C +G     L + AVKD     +  VA +T N L L+  +A+
Sbjct  266   DTCMDGF---SLVKTAVKDLVRRHVVEVARLTSNALALINMYAS  306



>ref|XP_011033915.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=198

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 93/173 (54%), Gaps = 6/173 (3%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
             G AG  ++ T+FI++SC+ T YPELC   L  +   I ++   LA  A++ +L  +RS  
Sbjct  19    GTAGCASSPTDFIKSSCKATRYPELCVGCLSGYASVIQRNERRLALTALSVSLARARSAA  78

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL-KCPG--FEGKISYIE  939
               V K+ + + + P      K C+E + DS+ +L  S+ E+ H  +  G  F   +S + 
Sbjct  79    AFVTKMTKVRGIKPREYQAAKDCIENMGDSVDRLSQSVRELGHSGRAVGRDFLWHMSNVL  138

Query  938   NLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
               ++ AL D + C +G     ++   + A+K +I+ VA +T N L L+ +FA+
Sbjct  139   TWVSAALTDENTCLDGFAGHRMDGNVKVAIKRRISNVAQVTSNALALVDRFAS  191


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 74/169 (44%), Gaps = 0/169 (0%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAGK  585
            TDFIKSSC  T +P +C   LS  A  I  N +RLA  A+S++          + ++   
Sbjct  28   TDFIKSSCKATRYPELCVGCLSGYASVIQRNERRLALTALSVSLARARSAAAFVTKMTKV  87

Query  584  IGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSN  405
             G+ P+E  +   C +    S+  +  S+  L       G D    + ++  W+ +  ++
Sbjct  88   RGIKPREYQAAKDCIENMGDSVDRLSQSVRELGHSGRAVGRDFLWHMSNVLTWVSAALTD  147

Query  404  YESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAAGMHGR  258
              +C++     ++   V   + R +  +   +  ALAL   FA+    R
Sbjct  148  ENTCLDGFAGHRMDGNVKVAIKRRISNVAQVTSNALALVDRFASRHRSR  196



>ref|XP_002321835.2| hypothetical protein POPTR_0015s14670g [Populus trichocarpa]
 gb|EEF05962.2| hypothetical protein POPTR_0015s14670g [Populus trichocarpa]
Length=203

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 83/155 (54%), Gaps = 3/155 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             +FI+TSC  T YP+LC   L  +   I  +   LA+ +++  L  + S   MV K+ + +
Sbjct  45    DFIKTSCGVTRYPDLCYEKLSAYADTIQDNPTQLANVSLSETLKNAESTLIMVQKLLKKR  104

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              L P  A  +K C+E + DS+ +L+ S++ M  L+ P F+ ++S I+  ++ AL D D C
Sbjct  105   KLRPREADAIKECVETMKDSVDELQKSMLAMSDLEGPDFDMEMSNIQTWVSAALTDEDTC  164

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLM  804
              +   +  ++   +  ++  I  VA +T   L L+
Sbjct  165   MDDSEENSIDGKVKDTIRSYIVTVAQLTSIALALI  199


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 97/185 (52%), Gaps = 5/185 (3%)
 Frame = -1

Query  827  TLNGLTLMKKFAAAGF-PGREN-TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAK  654
            TL    + K   A  F P  E+  DFIK+SC  T +P++CY  LS+ A  I  NP +LA 
Sbjct  21   TLAFFCVAKTCLAENFKPQVESGDDFIKTSCGVTRYPDLCYEKLSAYADTIQDNPTQLAN  80

Query  653  NAISLTQRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINE  474
             ++S T +  E T+  + ++  K  L P+E  +I  C +    S+  +Q S+     +++
Sbjct  81   VSLSETLKNAESTLIMVQKLLKKRKLRPREADAIKECVETMKDSVDELQKSML---AMSD  137

Query  473  LKGIDLHTIIDDIKEWLKSVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALA  294
            L+G D    + +I+ W+ +  ++ ++C+++ E   I  KV + +   +  +   + IALA
Sbjct  138  LEGPDFDMEMSNIQTWVSAALTDEDTCMDDSEENSIDGKVKDTIRSYIVTVAQLTSIALA  197

Query  293  LFSSF  279
            L +S 
Sbjct  198  LINSI  202



>ref|XP_009398112.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=217

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 97/172 (56%), Gaps = 10/172 (6%)
 Frame = -1

Query  872  NEPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP---GRENTDFIKSSCDKTPFPNICYASL  702
            NE       ++VA + L  L +     +A  P   G +N +FI+SSC  T +P++C++SL
Sbjct  14   NEAMAFRSGSLVALIFLVALAVSAGTCSAARPEPYGGKNLNFIRSSCGATQYPSLCFSSL  73

Query  701  SSSACDIAANPKRLAKNAISLT---QRTTEFTVRRMGEIAGKIGLSPKENMSIHVCEDLS  531
            S+ A  I  +P +LA+ A+S++    RTT  T+ ++ + +G  G+  +E  +++ C +  
Sbjct  74   SAYATTIQRSPVQLAQAALSVSLTGARTTAATITKLLKGSGA-GVGAREAEAMNDCLENM  132

Query  530  HKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKSVKSNYESCIEELET  375
              S+  ++DS   L+ +  LKG DL   ++D++ W+ S  ++  +C+E L T
Sbjct  133  GNSVEELRDS---LKEMGHLKGKDLRLRVNDMQTWVSSALTDENTCMEGLPT  181


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 6/162 (4%)
 Frame = -1

Query  1256  FIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKV--AQN  1083
             FI++SC  T YP LC  SL  +   I +    LA AA++ +L  +R+    + K+     
Sbjct  55    FIRSSCGATQYPSLCFSSLSAYATTIQRSPVQLAQAALSVSLTGARTTAATITKLLKGSG  114

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDR  903
               +    A  M  CLE + +S+ +L+ SL EM HLK      +++ ++  +++AL D + 
Sbjct  115   AGVGAREAEAMNDCLENMGNSVEELRDSLKEMGHLKGKDLRLRVNDMQTWVSSALTDENT  174

Query  902   CPNGMNDTGLNEPAV----KDQIAMVAHMTLNGLTLMKKFAA  789
             C  G+  T   +  V    + +I     +T N L+L+   + 
Sbjct  175   CMEGLPTTASMKVGVRGTIRGEIVKAVQLTSNALSLINGLSG  216



>ref|XP_003517432.1| PREDICTED: 21 kDa protein [Glycine max]
Length=203

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 85/160 (53%), Gaps = 4/160 (3%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++SC  T YP LC  SL  +   I +    LA  A++ ++  SRS   +V K+ + +
Sbjct  36    EFVKSSCRATRYPVLCVKSLLAYASVIRRSDRQLATTALSVSISRSRSSAWLVKKMLKAR  95

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     ++ C+E + DS+ +L+ S+ E+       F   +S ++  ++ AL D   C
Sbjct  96    GMKPREYRAVQDCVENIGDSVDRLRQSVTELGRTG-EDFVWHMSNVQTWVSAALTDDSTC  154

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              +G   + +N   +  +KD+I  VA +T N L L+ +FA+
Sbjct  155   LDGFAGSAMNGNVKALIKDRIVHVAQVTSNALALVNRFAS  194



>ref|XP_004235096.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=195

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 83/165 (50%), Gaps = 4/165 (2%)
 Frame = -1

Query  1286  IAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTG  1107
             +   K + T F++T C+ T YP LC  +L  +   +  +S  L   A+N A   +R  T 
Sbjct  26    VTAAKDSNTNFVKTKCKITTYPSLCVKTLIPYASSVKTNSTKLCKEALNVATKGARDATA  85

Query  1106  MVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLIT  927
             +V  + + K +    A  +K C+E V D++++LK+++  + HL       +++  +   +
Sbjct  86    IVLNLKKQKGITRYEAAAIKDCIEDVKDAVYELKLAVEAIGHLGDKDKAFQLANAKTYAS  145

Query  926   TALIDYDRCPNGMNDTGLNEPAVKDQI----AMVAHMTLNGLTLM  804
              A+ D D C  G+ D G   P V D I    A+V  ++ N L+L+
Sbjct  146   AAITDADSCTGGLTDQGKVNPKVMDAISRSMAVVIKLSSNALSLI  190



>ref|XP_009392885.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=194

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 84/161 (52%), Gaps = 6/161 (4%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAK-VAQ  1086
             T+F+++SC  T YP+LC   L  +   +      LA AA+  + D +RS +  V++ +A 
Sbjct  30    TDFVRSSCSATRYPDLCFRCLASYAPAVRHSPRQLARAAMAVSADRARSASTYVSRIIAG  89

Query  1085  NKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHL---KCPGFEGKISYIENLITTALI  915
              KS+ P  A  ++ CLE + DS+ +L+ S  E+  L     P F   +S +    + AL 
Sbjct  90    AKSVRPRDAGAVRDCLENMADSVDRLRRSAEELDLLGGAGSPEFAWHMSNVRTWCSAALT  149

Query  914   DYDRCPNGMND--TGLNEPAVKDQIAMVAHMTLNGLTLMKK  798
             D + C + + +  +G    A++ ++  VA MT N L L+ +
Sbjct  150   DENTCLDSLEEHCSGGIRSAIRPKVVEVAQMTSNALALVNR  190


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 80/158 (51%), Gaps = 16/158 (10%)
 Frame = -1

Query  791  AAGFPGRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT---QRTTE  621
            +AG P    TDF++SSC  T +P++C+  L+S A  +  +P++LA+ A++++    R+  
Sbjct  25   SAGSP----TDFVRSSCSATRYPDLCFRCLASYAPAVRHSPRQLARAAMAVSADRARSAS  80

Query  620  FTVRRMGEIAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIID  441
              V R+  IAG   + P++  ++  C +    S+  ++ S   L+ +      +    + 
Sbjct  81   TYVSRI--IAGAKSVRPRDAGAVRDCLENMADSVDRLRRSAEELDLLGGAGSPEFAWHMS  138

Query  440  DIKEWLKSVKSNYESCIEELE-------TEQIKEKVTE  348
            +++ W  +  ++  +C++ LE          I+ KV E
Sbjct  139  NVRTWCSAALTDENTCLDSLEEHCSGGIRSAIRPKVVE  176



>ref|XP_010646817.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=199

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 85/171 (50%), Gaps = 6/171 (4%)
 Frame = -1

Query  1283  AGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGM  1104
             A + +A T FI+ SC  T YP LC   L  +   I +    LA  A++ +L  +RS T  
Sbjct  25    AARNSAATSFIKASCRVTRYPVLCFQCLSGYASTIRQSDRQLALTALSVSLSRARSATVF  84

Query  1103  VAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLK---CPGFEGKISYIENL  933
              +K+ + + L P     +K C+E + D++ +L  S+ E+          F   +S ++  
Sbjct  85    ASKLTKVRGLKPREHEAVKDCIENMADTVDRLSHSVQELGRTGKAVSQDFMWHMSNVQTW  144

Query  932   ITTALIDYDRCPNGMNDT---GLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             ++ AL D + C +G       G  + AV+ ++  VA +T N L L+ +FAA
Sbjct  145   VSAALTDENTCLDGFAGRVMEGNVKTAVRRKVIDVAQVTSNALALINRFAA  195


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 81/169 (48%), Gaps = 10/169 (6%)
 Frame = -1

Query  764  TDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLT-QRTTEFTVRRMGEIAG  588
            T FIK+SC  T +P +C+  LS  A  I  + ++LA  A+S++  R    TV      A 
Sbjct  32   TSFIKASCRVTRYPVLCFQCLSGYASTIRQSDRQLALTALSVSLSRARSATV-----FAS  86

Query  587  KI----GLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLK  420
            K+    GL P+E+ ++  C +    ++  +  S+  L    +    D    + +++ W+ 
Sbjct  87   KLTKVRGLKPREHEAVKDCIENMADTVDRLSHSVQELGRTGKAVSQDFMWHMSNVQTWVS  146

Query  419  SVKSNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
            +  ++  +C++      ++  V   V R + ++   +  ALAL + FAA
Sbjct  147  AALTDENTCLDGFAGRVMEGNVKTAVRRKVIDVAQVTSNALALINRFAA  195



>gb|ACU15105.1| unknown [Glycine max]
Length=198

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 86/164 (52%), Gaps = 4/164 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             EF+++SC  T YP LC  SL  +   I +    LA  A++ ++  SRS   +V K+ + +
Sbjct  36    EFVKSSCRATRYPVLCVKSLLAYASVIRRSDRQLATTALSVSISRSRSSAWLVKKMLKAR  95

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGKISYIENLITTALIDYDRC  900
              + P     ++ C+E + DS+ +L+ S+ E+       F   +S ++  ++ AL D   C
Sbjct  96    GMKPREYRAVQDCVENIGDSVDRLRQSVTELGRTG-EDFVWHMSNVQTWVSAALTDDSTC  154

Query  899   PNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAAAGFP  777
              +G   + +N   +  +KD+I  VA +T N L L+ +FA+   P
Sbjct  155   LDGFAGSAMNGNVKALIKDRIVHVAQVTSNALALVNRFASRHPP  198



>ref|XP_009780736.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=200

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 85/173 (49%), Gaps = 7/173 (4%)
 Frame = -1

Query  1289  GIAGKKTATTEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLT  1110
              +  +  A T FI+TSC+ T YP +C  SL  +   I    + LA AA++ +L  ++  T
Sbjct  25    SVTSQNPANTNFIKTSCKNTLYPSVCIQSLSAYANTIQLSEQQLAQAALSISLKKAKLAT  84

Query  1109  GMVAKVAQNKSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKH----LKCPGFEGKISYI  942
               ++K+ + + L P      K CL  +NDS+++L  S+ E+           F   +S +
Sbjct  85    DFISKITKIRGLKPREFQAAKDCLSTMNDSVYQLNRSIPELGQSGQLSAGQDFTWHVSNV  144

Query  941   ENLITTALIDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFA  792
             +  I+ AL D + C +  N+  ++      V+ ++   A +T N L L+  FA
Sbjct  145   QTWISAALTDENACLDMFNNPSMDGKIRALVRVRVFAAAQVTSNALALVYHFA  197


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/165 (25%), Positives = 80/165 (48%), Gaps = 1/165 (1%)
 Frame = -1

Query  767  NTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIAG  588
            NT+FIK+SC  T +P++C  SLS+ A  I  + ++LA+ A+S++ +  +     + +I  
Sbjct  33   NTNFIKTSCKNTLYPSVCIQSLSAYANTIQLSEQQLAQAALSISLKKAKLATDFISKITK  92

Query  587  KIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELK-GIDLHTIIDDIKEWLKSVK  411
              GL P+E  +   C    + S+  +  S+  L    +L  G D    + +++ W+ +  
Sbjct  93   IRGLKPREFQAAKDCLSTMNDSVYQLNRSIPELGQSGQLSAGQDFTWHVSNVQTWISAAL  152

Query  410  SNYESCIEELETEQIKEKVTEEVTRLMREMEPFSEIALALFSSFA  276
            ++  +C++      +  K+   V   +      +  ALAL   FA
Sbjct  153  TDENACLDMFNNPSMDGKIRALVRVRVFAAAQVTSNALALVYHFA  197



>ref|XP_009139088.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=202

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 83/166 (50%), Gaps = 9/166 (5%)
 Frame = -1

Query  1262  TEFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQN  1083
             TEF++ SCE T YPELC  SL  +  EI K    LA  A+  +L  ++S    V+ +   
Sbjct  36    TEFVKASCETTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMTDY  95

Query  1082  KSLPPEAATNMKHCLEQVNDSIHKLKMSLVEMKHLKCPGFEGK-----ISYIENLITTAL  918
             K +       +  C+E++ D++ +L+ SL E+KHL+  G  G+     +  +    + AL
Sbjct  96    KGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLE-EGESGEDFWLCLGNVRTWTSAAL  154

Query  917   IDYDRCPNGMNDTGLN---EPAVKDQIAMVAHMTLNGLTLMKKFAA  789
              D   C +G     ++   +  +++ I  VA  T N L L+  FA+
Sbjct  155   TDETTCLDGFGGKAMDGELKRLIREHILRVAQDTSNALALINVFAS  200


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/171 (22%), Positives = 93/171 (54%), Gaps = 9/171 (5%)
 Frame = -1

Query  770  ENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGEIA  591
            ++T+F+K+SC+ T +P +C+ SLSS A +I   P++LA+ A++++    +     + ++ 
Sbjct  34   DDTEFVKASCETTTYPELCFQSLSSYASEIKKRPRQLAETALAVSLARAKSAKTYVSDMT  93

Query  590  GKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELK-GIDLHTIIDDIKEWLKSV  414
               G++ +++ ++  C +    ++  ++ SL  L+ + E + G D    + +++ W  + 
Sbjct  94   DYKGITERQHEAVSDCIEEMGDTVDRLRSSLKELKHLEEGESGEDFWLCLGNVRTWTSAA  153

Query  413  KSNYESCIEELETE----QIKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
             ++  +C++    +    ++K  + E + R+ ++       ALAL + FA+
Sbjct  154  LTDETTCLDGFGGKAMDGELKRLIREHILRVAQDTSN----ALALINVFAS  200



>ref|XP_010430352.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=264

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 96/170 (56%), Gaps = 6/170 (4%)
 Frame = -1

Query  776  GRENTDFIKSSCDKTPFPNICYASLSSSACDIAANPKRLAKNAISLTQRTTEFTVRRMGE  597
             + N D+IK+SC+ T +  +CY SLS  A  I ++P++LA  A++LT  + +   + +  
Sbjct  93   NQTNLDYIKTSCNLTLYKTLCYISLSPYASKIISSPQKLAITALNLTLTSAKSASKFIKN  152

Query  596  IAGKIGLSPKENMSIHVCEDLSHKSILYMQDSLSNLETINELKGIDLHTIIDDIKEWLKS  417
            ++   GL+P E +++  C +    S++ +QDS+  L++IN         ++ D++ W+ +
Sbjct  153  VSHGGGLAPLEAVAVADCVEEIGDSVISLQDSIRELDSINHKDSRKFEMVMSDVQTWVSA  212

Query  416  VKSNYESCIEELETEQ--IKEKVTEEVTRLMREMEPFSEIALALFSSFAA  273
              ++ ++C++ L   +  +K+ V + V ++ R     +  +LAL + +A+
Sbjct  213  ALTDDDTCMDSLRRVKTVVKDLVRQHVVKVAR----LTSNSLALINMYAS  258


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 81/161 (50%), Gaps = 4/161 (2%)
 Frame = -1

Query  1259  EFIQTSCEGTPYPELCSMSLPKHDREIGKDSELLAHAAVNAALDISRSLTGMVAKVAQNK  1080
             ++I+TSC  T Y  LC +SL  +  +I    + LA  A+N  L  ++S +  +  V+   
Sbjct  98    DYIKTSCNLTLYKTLCYISLSPYASKIISSPQKLAITALNLTLTSAKSASKFIKNVSHGG  157

Query  1079  SLPPEAATNMKHCLEQVNDSIHKLKMSLVEM---KHLKCPGFEGKISYIENLITTALIDY  909
              L P  A  +  C+E++ DS+  L+ S+ E+    H     FE  +S ++  ++ AL D 
Sbjct  158   GLAPLEAVAVADCVEEIGDSVISLQDSIRELDSINHKDSRKFEMVMSDVQTWVSAALTDD  217

Query  908   DRCPNGMNDT-GLNEPAVKDQIAMVAHMTLNGLTLMKKFAA  789
             D C + +     + +  V+  +  VA +T N L L+  +A+
Sbjct  218   DTCMDSLRRVKTVVKDLVRQHVVKVARLTSNSLALINMYAS  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3840081377382