BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78109_g1_i1 len=159 path=[1:0-158]

Length=159
                                                                      Score     E

ref|XP_007031068.1|  TOPLESS-related 3                                82.4    1e-16   
ref|XP_002319498.2|  WD-40 repeat family protein                      82.4    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007031064.1|  TOPLESS-related 3 isoform 1                      81.6    4e-16   
ref|XP_007031066.1|  TOPLESS-related 3 isoform 3                      81.3    4e-16   
gb|KHG26583.1|  Topless-related 3 -like protein                       81.3    5e-16   
ref|XP_010546752.1|  PREDICTED: topless-related protein 3 isoform X2  80.5    1e-15   
ref|XP_010546750.1|  PREDICTED: topless-related protein 3 isoform X1  80.5    1e-15   
ref|XP_009611828.1|  PREDICTED: topless-related protein 3-like is...  80.5    1e-15   
ref|XP_009611827.1|  PREDICTED: topless-related protein 3-like is...  80.1    1e-15   
ref|XP_009785868.1|  PREDICTED: topless-related protein 3-like        80.1    1e-15   
ref|XP_009346203.1|  PREDICTED: topless-related protein 2-like is...  79.7    2e-15   
ref|XP_009346204.1|  PREDICTED: topless-related protein 2-like is...  79.3    2e-15   
gb|KDP23429.1|  hypothetical protein JCGZ_23262                       78.2    3e-15   
ref|XP_011023731.1|  PREDICTED: topless-related protein 3-like        79.3    3e-15   
ref|XP_002307097.2|  WD-40 repeat family protein                      79.0    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008390610.1|  PREDICTED: topless-related protein 2-like        79.0    3e-15   
ref|XP_004158753.1|  PREDICTED: topless-related protein 3-like        79.0    3e-15   
ref|XP_004144768.1|  PREDICTED: topless-related protein 3-like        79.0    4e-15   
ref|XP_011036914.1|  PREDICTED: topless-related protein 3             78.6    4e-15   
ref|XP_008453896.1|  PREDICTED: topless-related protein 3-like        78.6    4e-15   
ref|XP_010674104.1|  PREDICTED: topless-related protein 3-like        78.2    5e-15   
ref|XP_007144973.1|  hypothetical protein PHAVU_007G198900g           78.2    6e-15   
ref|XP_010524852.1|  PREDICTED: topless-related protein 3-like is...  78.2    7e-15   
ref|XP_010524851.1|  PREDICTED: topless-related protein 3-like is...  78.2    7e-15   
ref|XP_008353208.1|  PREDICTED: topless-related protein 2-like        78.2    7e-15   
ref|XP_008340770.1|  PREDICTED: topless-related protein 2             77.8    8e-15   
ref|XP_009766750.1|  PREDICTED: topless-related protein 3-like is...  77.8    9e-15   
ref|XP_009766749.1|  PREDICTED: topless-related protein 3-like is...  77.8    9e-15   
emb|CDP17223.1|  unnamed protein product                              77.8    9e-15   
ref|XP_009616373.1|  PREDICTED: topless-related protein 3-like        77.4    1e-14   
ref|XP_007227035.1|  hypothetical protein PRUPE_ppa000503mg           77.0    1e-14   
ref|XP_008223259.1|  PREDICTED: topless-related protein 2             77.0    1e-14   
ref|XP_011092107.1|  PREDICTED: topless-related protein 3-like        77.0    2e-14   
emb|CDX92100.1|  BnaA05g23070D                                        76.3    3e-14   
ref|XP_009146056.1|  PREDICTED: topless-related protein 2-like        76.3    3e-14   
ref|XP_003626186.1|  hypothetical protein MTR_7g112460                75.9    3e-14   
ref|XP_007204953.1|  hypothetical protein PRUPE_ppa000487mg           75.9    4e-14   
ref|XP_004296880.1|  PREDICTED: topless-related protein 2-like        75.9    4e-14   
ref|XP_010245461.1|  PREDICTED: topless-related protein 2-like is...  75.9    4e-14   
ref|XP_010245460.1|  PREDICTED: topless-related protein 2-like is...  75.9    4e-14   
ref|XP_002512473.1|  WD-repeat protein, putative                      75.5    5e-14   Ricinus communis
gb|KDO81758.1|  hypothetical protein CISIN_1g001190mg                 75.5    5e-14   
gb|KCW60528.1|  hypothetical protein EUGRSUZ_H03269                   75.5    6e-14   
ref|XP_010024093.1|  PREDICTED: topless-related protein 3 isoform X1  75.1    6e-14   
gb|KCW60526.1|  hypothetical protein EUGRSUZ_H03269                   75.1    6e-14   
ref|XP_004494565.1|  PREDICTED: topless-related protein 3-like        75.1    6e-14   
ref|XP_010024094.1|  PREDICTED: topless-related protein 3 isoform X2  75.1    7e-14   
ref|XP_008245640.1|  PREDICTED: topless-related protein 3             74.7    9e-14   
emb|CDX95900.1|  BnaC05g36510D                                        74.7    9e-14   
gb|KDO81760.1|  hypothetical protein CISIN_1g001190mg                 74.7    1e-13   
emb|CDY50500.1|  BnaC01g44380D                                        73.9    1e-13   
ref|XP_010528913.1|  PREDICTED: topless-related protein 3-like        74.7    1e-13   
ref|XP_010313267.1|  PREDICTED: topless-related protein 3 isoform X1  74.7    1e-13   
ref|XP_006344707.1|  PREDICTED: topless-related protein 3-like is...  74.7    1e-13   
ref|XP_006344709.1|  PREDICTED: topless-related protein 3-like is...  74.7    1e-13   
ref|XP_006344708.1|  PREDICTED: topless-related protein 3-like is...  74.7    1e-13   
ref|XP_004230269.1|  PREDICTED: topless-related protein 3 isoform X3  74.3    1e-13   
ref|XP_010313271.1|  PREDICTED: topless-related protein 3 isoform X2  74.3    1e-13   
ref|XP_007031067.1|  Transducin family protein / WD-40 repeat fam...  74.7    1e-13   
gb|KDO81755.1|  hypothetical protein CISIN_1g001190mg                 74.3    1e-13   
gb|KDO81759.1|  hypothetical protein CISIN_1g001190mg                 74.3    1e-13   
gb|KDO81757.1|  hypothetical protein CISIN_1g001190mg                 74.3    1e-13   
ref|XP_006472151.1|  PREDICTED: topless-related protein 3-like        74.3    1e-13   
ref|XP_006433483.1|  hypothetical protein CICLE_v10000084mg           74.3    1e-13   
ref|XP_003591186.1|  WD repeat-containing protein                     74.3    1e-13   
ref|XP_004508183.1|  PREDICTED: topless-related protein 2-like        74.3    1e-13   
gb|KDO81756.1|  hypothetical protein CISIN_1g001190mg                 74.3    1e-13   
ref|XP_004495685.1|  PREDICTED: topless-related protein 3-like is...  74.3    1e-13   
ref|XP_004495684.1|  PREDICTED: topless-related protein 3-like is...  74.3    1e-13   
ref|XP_009369993.1|  PREDICTED: topless-related protein 2-like        74.3    1e-13   
ref|XP_004495686.1|  PREDICTED: topless-related protein 3-like is...  74.3    1e-13   
gb|ABD28351.1|  Lissencephaly type-1-like homology motif; CTLH, C...  74.3    1e-13   Medicago truncatula
ref|XP_010043204.1|  PREDICTED: topless-related protein 3-like        74.3    1e-13   
ref|XP_010259449.1|  PREDICTED: topless-related protein 2 isoform X2  73.9    2e-13   
ref|XP_010259448.1|  PREDICTED: topless-related protein 2 isoform X1  73.9    2e-13   
ref|XP_010259450.1|  PREDICTED: topless-related protein 2 isoform X3  73.9    2e-13   
ref|XP_006606545.1|  PREDICTED: topless-related protein 3-like        73.9    2e-13   
ref|XP_007035678.1|  TOPLESS-related 2 isoform 4                      73.6    2e-13   
ref|XP_007035675.1|  TOPLESS-related 2 isoform 1                      73.6    2e-13   
ref|XP_007035676.1|  TOPLESS-related 2 isoform 2                      73.6    2e-13   
ref|XP_007035677.1|  TOPLESS-related 2 isoform 3                      73.6    2e-13   
ref|XP_006841513.1|  hypothetical protein AMTR_s00003p00142040        73.6    2e-13   
emb|CDY50502.1|  BnaC01g44400D                                        73.6    2e-13   
ref|XP_009114175.1|  PREDICTED: topless-related protein 2             73.6    2e-13   
ref|XP_006406802.1|  hypothetical protein EUTSA_v10019939mg           73.6    2e-13   
ref|XP_010094719.1|  Topless-related protein 3                        73.6    2e-13   
ref|XP_010086586.1|  Topless-related protein 3                        73.6    2e-13   
emb|CDX88252.1|  BnaA06g28430D                                        73.2    3e-13   
ref|XP_009151171.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  73.2    3e-13   
ref|XP_010462722.1|  PREDICTED: protein TOPLESS-like                  73.2    3e-13   
emb|CDX80607.1|  BnaC07g28370D                                        73.2    3e-13   
ref|XP_010465706.1|  PREDICTED: topless-related protein 2-like        73.2    3e-13   
ref|XP_002870186.1|  predicted protein                                73.2    3e-13   
ref|XP_010938347.1|  PREDICTED: topless-related protein 2-like is...  73.2    3e-13   
ref|XP_010938346.1|  PREDICTED: topless-related protein 2-like is...  73.2    3e-13   
ref|XP_008388509.1|  PREDICTED: topless-related protein 3-like        72.8    4e-13   
gb|KHN03954.1|  Topless-related protein 3                             72.8    4e-13   
ref|XP_006577218.1|  PREDICTED: topless-related protein 3-like        72.8    4e-13   
ref|XP_009338219.1|  PREDICTED: topless-related protein 3 isoform X2  72.8    5e-13   
gb|AAD48936.1|AF160760_4  contains similarity to Pfam family PF00...  72.4    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009338217.1|  PREDICTED: topless-related protein 3 isoform X1  72.4    5e-13   
ref|XP_002283157.1|  PREDICTED: topless-related protein 3             72.4    5e-13   Vitis vinifera
emb|CAN79774.1|  hypothetical protein VITISV_013612                   72.4    5e-13   Vitis vinifera
ref|XP_010487553.1|  PREDICTED: topless-related protein 2-like        72.4    6e-13   
ref|NP_198055.3|  Topless-related protein 3                           72.4    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504697.1|  PREDICTED: topless-related protein 2             72.4    6e-13   
ref|NP_001190409.1|  Topless-related protein 3                        72.4    7e-13   
ref|XP_006299477.1|  hypothetical protein CARUB_v10015642mg           72.4    7e-13   
dbj|BAA95777.1|  unnamed protein product                              72.0    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188306.2|  Topless-related 2 protein                           71.6    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394928.1|  hypothetical protein EUTSA_v10003550mg           71.6    1e-12   
gb|KFK39016.1|  hypothetical protein AALP_AA3G189500                  71.6    1e-12   
ref|XP_010440213.1|  PREDICTED: topless-related protein 2-like        71.6    1e-12   
ref|XP_010449856.1|  PREDICTED: topless-related protein 2-like        71.6    1e-12   
ref|XP_006414395.1|  hypothetical protein EUTSA_v10024263mg           71.6    1e-12   
gb|KFK27551.1|  hypothetical protein AALP_AA8G398300                  71.6    1e-12   
ref|XP_009421409.1|  PREDICTED: topless-related protein 2-like        71.6    1e-12   
ref|XP_002883029.1|  hypothetical protein ARALYDRAFT_479149           71.6    1e-12   
ref|XP_006604796.1|  PREDICTED: topless-related protein 3-like        71.6    1e-12   
gb|KDO71780.1|  hypothetical protein CISIN_1g001178mg                 71.2    1e-12   
gb|KDO71781.1|  hypothetical protein CISIN_1g001178mg                 71.2    1e-12   
gb|EPS69182.1|  hypothetical protein M569_05580                       71.2    2e-12   
ref|XP_006589131.1|  PREDICTED: topless-related protein 3-like is...  70.9    2e-12   
ref|XP_006589130.1|  PREDICTED: topless-related protein 3-like is...  70.9    2e-12   
gb|KHN16088.1|  Topless-related protein 3                             70.9    2e-12   
ref|XP_008370406.1|  PREDICTED: topless-related protein 3-like is...  70.1    4e-12   
ref|XP_008370405.1|  PREDICTED: topless-related protein 3-like is...  70.1    4e-12   
ref|XP_010921588.1|  PREDICTED: topless-related protein 2-like is...  70.1    4e-12   
ref|XP_010921589.1|  PREDICTED: topless-related protein 2-like is...  69.7    5e-12   
ref|XP_008795824.1|  PREDICTED: topless-related protein 2-like        69.7    5e-12   
ref|XP_007163345.1|  hypothetical protein PHAVU_001G227000g           69.7    5e-12   
ref|XP_007163344.1|  hypothetical protein PHAVU_001G227000g           69.7    6e-12   
ref|XP_009382516.1|  PREDICTED: topless-related protein 2-like is...  69.7    6e-12   
ref|XP_009382517.1|  PREDICTED: topless-related protein 2-like is...  69.3    6e-12   
ref|XP_009382518.1|  PREDICTED: topless-related protein 2-like is...  69.3    6e-12   
gb|AES91919.2|  topless-like protein                                  69.3    6e-12   
ref|XP_003609722.1|  WD repeat-containing protein                     69.3    6e-12   
ref|XP_008655511.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  69.3    7e-12   
ref|XP_006644007.1|  PREDICTED: topless-related protein 2-like        68.6    1e-11   
ref|NP_001042616.1|  Os01g0254100                                     68.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73338.1|  hypothetical protein OsI_01216                        68.6    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006489020.1|  PREDICTED: topless-related protein 2-like is...  68.6    1e-11   
ref|XP_006419483.1|  hypothetical protein CICLE_v10004197mg           68.6    1e-11   
ref|XP_006489019.1|  PREDICTED: topless-related protein 2-like is...  68.6    1e-11   
ref|XP_004487868.1|  PREDICTED: topless-related protein 2-like        68.2    2e-11   
ref|XP_006285940.1|  hypothetical protein CARUB_v10007460mg           68.2    2e-11   
ref|XP_008673871.1|  PREDICTED: topless-related protein 2 isoform X1  67.8    3e-11   
ref|XP_008673872.1|  PREDICTED: topless-related protein 2 isoform X2  67.8    3e-11   
tpg|DAA53973.1|  TPA: hypothetical protein ZEAMMB73_351755            67.8    3e-11   
ref|XP_004967836.1|  PREDICTED: topless-related protein 2-like        67.4    3e-11   
gb|EMT25315.1|  hypothetical protein F775_09004                       67.4    3e-11   
emb|CDY05552.1|  BnaA02g31390D                                        66.6    5e-11   
ref|XP_009129893.1|  PREDICTED: topless-related protein 3             66.6    6e-11   
ref|XP_009595073.1|  PREDICTED: topless-related protein 4-like is...  66.2    9e-11   
ref|XP_009595072.1|  PREDICTED: topless-related protein 4-like is...  66.2    9e-11   
ref|XP_009803412.1|  PREDICTED: topless-related protein 4-like is...  66.2    9e-11   
ref|XP_009803406.1|  PREDICTED: topless-related protein 4-like is...  66.2    1e-10   
ref|XP_008790866.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  65.5    1e-10   
emb|CDP10439.1|  unnamed protein product                              65.5    1e-10   
gb|KDO80172.1|  hypothetical protein CISIN_1g001163mg                 65.1    2e-10   
gb|KDO80173.1|  hypothetical protein CISIN_1g001163mg                 65.1    2e-10   
emb|CDY25010.1|  BnaC02g39980D                                        65.1    2e-10   
ref|XP_006450874.1|  hypothetical protein CICLE_v10007287mg           64.7    2e-10   
gb|KDO80174.1|  hypothetical protein CISIN_1g001163mg                 64.3    3e-10   
ref|XP_006358294.1|  PREDICTED: topless-related protein 4-like is...  64.3    4e-10   
ref|XP_006358293.1|  PREDICTED: topless-related protein 4-like is...  64.3    4e-10   
ref|XP_004242769.1|  PREDICTED: topless-related protein 4-like is...  64.3    4e-10   
ref|XP_010323294.1|  PREDICTED: topless-related protein 4-like is...  64.3    4e-10   
emb|CDM82632.1|  unnamed protein product                              63.9    5e-10   
gb|KHG04331.1|  Topless-related 2 -like protein                       63.9    5e-10   
gb|EMS62858.1|  Topless-related protein 2                             63.9    5e-10   
dbj|BAJ88304.1|  predicted protein                                    62.8    9e-10   
dbj|BAJ96033.1|  predicted protein                                    63.2    1e-09   
dbj|BAJ91882.1|  predicted protein                                    62.8    1e-09   
dbj|BAJ85297.1|  predicted protein                                    63.2    1e-09   
ref|XP_010906011.1|  PREDICTED: protein TOPLESS                       62.8    1e-09   
ref|XP_008813124.1|  PREDICTED: protein TOPLESS-like isoform X1       62.0    2e-09   
ref|XP_009400780.1|  PREDICTED: topless-related protein 1-like        62.0    2e-09   
ref|XP_008801888.1|  PREDICTED: protein TOPLESS-like                  62.0    3e-09   
ref|XP_010927352.1|  PREDICTED: protein TOPLESS                       62.0    3e-09   
gb|KDP30260.1|  hypothetical protein JCGZ_17042                       61.6    3e-09   
gb|KFK25571.1|  hypothetical protein AALP_AA8G132300                  60.8    5e-09   
ref|XP_008788791.1|  PREDICTED: topless-related protein 1-like is...  60.5    9e-09   
ref|XP_008788792.1|  PREDICTED: topless-related protein 1-like is...  60.5    9e-09   
gb|KEH37175.1|  topless-like protein                                  60.1    1e-08   
emb|CAN64663.1|  hypothetical protein VITISV_035348                   58.9    3e-08   Vitis vinifera
ref|XP_002265778.1|  PREDICTED: topless-related protein 4             58.9    3e-08   Vitis vinifera
ref|XP_010928279.1|  PREDICTED: protein TOPLESS-like                  58.9    3e-08   
ref|XP_010533140.1|  PREDICTED: topless-related protein 4-like        58.5    4e-08   
ref|XP_004165893.1|  PREDICTED: LOW QUALITY PROTEIN: protein TOPL...  58.2    5e-08   
ref|XP_004152185.1|  PREDICTED: protein TOPLESS-like                  58.2    5e-08   
gb|KGN52925.1|  hypothetical protein Csa_4G006320                     58.2    6e-08   
ref|XP_008454191.1|  PREDICTED: protein TOPLESS                       58.2    6e-08   
ref|XP_009396205.1|  PREDICTED: topless-related protein 1-like        57.8    6e-08   
ref|XP_009407206.1|  PREDICTED: protein TOPLESS-like                  57.8    7e-08   
ref|XP_006381123.1|  hypothetical protein POPTR_0006s06570g           57.4    8e-08   
ref|XP_002308068.1|  WD-40 repeat family protein                      57.4    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010244893.1|  PREDICTED: topless-related protein 1-like is...  57.4    9e-08   
ref|XP_010244894.1|  PREDICTED: topless-related protein 1-like is...  57.4    9e-08   
ref|XP_010244892.1|  PREDICTED: topless-related protein 1-like is...  57.4    1e-07   
ref|XP_010244887.1|  PREDICTED: topless-related protein 1-like is...  57.4    1e-07   
gb|KCW80034.1|  hypothetical protein EUGRSUZ_C013682                  56.6    1e-07   
ref|XP_009395915.1|  PREDICTED: topless-related protein 1-like        57.4    1e-07   
ref|XP_002527178.1|  WD-repeat protein, putative                      57.0    1e-07   Ricinus communis
ref|XP_011017799.1|  PREDICTED: topless-related protein 4-like is...  57.0    1e-07   
ref|XP_002517701.1|  WD-repeat protein, putative                      57.0    1e-07   Ricinus communis
gb|KDP37032.1|  hypothetical protein JCGZ_06088                       56.6    2e-07   
ref|XP_007155033.1|  hypothetical protein PHAVU_003G167500g           56.6    2e-07   
gb|EYU21655.1|  hypothetical protein MIMGU_mgv1a000483mg              56.6    2e-07   
ref|XP_007155032.1|  hypothetical protein PHAVU_003G167500g           56.6    2e-07   
ref|XP_007155034.1|  hypothetical protein PHAVU_003G167500g           56.6    2e-07   
ref|XP_007155035.1|  hypothetical protein PHAVU_003G167500g           56.6    2e-07   
emb|CDO98161.1|  unnamed protein product                              56.6    2e-07   
ref|XP_001768092.1|  predicted protein                                56.2    2e-07   
gb|KCW80023.1|  hypothetical protein EUGRSUZ_C01361                   56.2    2e-07   
ref|XP_009395323.1|  PREDICTED: protein TOPLESS-like isoform X3       56.2    2e-07   
ref|XP_009395322.1|  PREDICTED: protein TOPLESS-like isoform X2       56.2    2e-07   
ref|XP_009395318.1|  PREDICTED: protein TOPLESS-like isoform X1       56.2    2e-07   
ref|XP_009396116.1|  PREDICTED: protein TOPLESS-like isoform X2       56.2    3e-07   
ref|XP_009396112.1|  PREDICTED: protein TOPLESS-like isoform X1       56.2    3e-07   
ref|XP_011017797.1|  PREDICTED: topless-related protein 4-like is...  56.2    3e-07   
ref|XP_011017798.1|  PREDICTED: topless-related protein 4-like is...  55.8    3e-07   
ref|XP_007013513.1|  Transducin family protein / WD-40 repeat fam...  55.8    3e-07   
ref|XP_007013512.1|  Transducin family protein / WD-40 repeat fam...  55.8    3e-07   
ref|XP_007013509.1|  WUS-interacting protein 2 isoform 4              55.8    3e-07   
gb|KCW80031.1|  hypothetical protein EUGRSUZ_C013682                  55.5    3e-07   
ref|XP_010250289.1|  PREDICTED: protein TOPLESS-like isoform X3       55.8    3e-07   
ref|XP_010250287.1|  PREDICTED: protein TOPLESS-like isoform X1       55.8    3e-07   
ref|XP_010250290.1|  PREDICTED: protein TOPLESS-like isoform X4       55.8    3e-07   
ref|XP_007013508.1|  WUS-interacting protein 2 isoform 3              55.8    3e-07   
ref|XP_010250288.1|  PREDICTED: protein TOPLESS-like isoform X2       55.8    3e-07   
ref|XP_007013506.1|  WUS-interacting protein 2 isoform 1              55.8    3e-07   
ref|XP_007204297.1|  hypothetical protein PRUPE_ppa000492mg           55.8    3e-07   
ref|XP_007013510.1|  WUS-interacting protein 2 isoform 5              55.8    3e-07   
ref|XP_010497362.1|  PREDICTED: protein TOPLESS                       55.8    3e-07   
ref|XP_010687938.1|  PREDICTED: topless-related protein 4             55.8    4e-07   
ref|XP_008242803.1|  PREDICTED: topless-related protein 4-like        55.8    4e-07   
ref|NP_563981.1|  protein TOPLESS                                     55.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAF82145.1|AC034256_9  Strong similarity to an unknown protein...  55.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405760.1|  PREDICTED: protein TOPLESS-like isoform X1       55.5    4e-07   
ref|XP_010103710.1|  Topless-related protein 4                        55.5    4e-07   
ref|XP_006649759.1|  PREDICTED: protein TOPLESS-like                  55.5    4e-07   
ref|XP_008786937.1|  PREDICTED: topless-related protein 1-like        54.7    4e-07   
ref|XP_007013507.1|  WUS-interacting protein 2 isoform 2              55.5    4e-07   
ref|XP_008803470.1|  PREDICTED: topless-related protein 1-like is...  55.5    4e-07   
ref|XP_004287287.1|  PREDICTED: topless-related protein 4-like        55.5    5e-07   
ref|XP_009613434.1|  PREDICTED: topless-related protein 4 isoform X1  55.5    5e-07   
ref|XP_010656455.1|  PREDICTED: topless-related protein 4 isoform X5  55.5    5e-07   
ref|XP_007023214.1|  WUS-interacting protein 2 isoform 1              55.5    5e-07   
ref|XP_002285341.2|  PREDICTED: topless-related protein 4 isoform X3  55.5    5e-07   Vitis vinifera
ref|XP_008803471.1|  PREDICTED: topless-related protein 1-like is...  55.5    5e-07   
ref|XP_009405763.1|  PREDICTED: protein TOPLESS-like isoform X3       55.5    5e-07   
ref|XP_010656452.1|  PREDICTED: topless-related protein 4 isoform X1  55.5    5e-07   
ref|XP_010656454.1|  PREDICTED: topless-related protein 4 isoform X4  55.5    5e-07   
ref|XP_009613435.1|  PREDICTED: topless-related protein 4 isoform X2  55.5    5e-07   
ref|XP_010656453.1|  PREDICTED: topless-related protein 4 isoform X2  55.5    5e-07   
emb|CDX67950.1|  BnaA07g19900D                                        55.1    5e-07   
ref|XP_009104466.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  55.1    5e-07   
ref|XP_006855163.1|  hypothetical protein AMTR_s00051p00079490        55.1    5e-07   
gb|KDO50583.1|  hypothetical protein CISIN_1g0011592mg                54.7    5e-07   
ref|XP_006594237.1|  PREDICTED: topless-related protein 4-like is...  55.1    6e-07   
ref|XP_006594236.1|  PREDICTED: topless-related protein 4-like is...  55.1    6e-07   
ref|XP_003549747.1|  PREDICTED: topless-related protein 4-like is...  55.1    6e-07   
ref|XP_006600746.1|  PREDICTED: topless-related protein 4-like is...  55.1    6e-07   
gb|KHN22119.1|  Topless-related protein 4                             55.1    6e-07   
ref|XP_010462721.1|  PREDICTED: protein TOPLESS-like                  54.7    7e-07   
ref|XP_011073420.1|  PREDICTED: topless-related protein 4             55.1    7e-07   
gb|KCW80097.1|  hypothetical protein EUGRSUZ_C01424                   55.1    7e-07   
ref|XP_002887825.1|  hypothetical protein ARALYDRAFT_895943           54.7    7e-07   
emb|CDX79383.1|  BnaC06g19200D                                        54.7    7e-07   
ref|XP_001781989.1|  predicted protein                                54.7    7e-07   
ref|XP_002268265.1|  PREDICTED: protein TOPLESS                       54.7    7e-07   Vitis vinifera
ref|XP_004506964.1|  PREDICTED: protein TOPLESS-like                  54.7    7e-07   
gb|KDO50584.1|  hypothetical protein CISIN_1g0011592mg                54.3    8e-07   
ref|XP_002324641.2|  WD-40 repeat family protein                      54.7    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010928337.1|  PREDICTED: protein TOPLESS-like isoform X3       54.7    8e-07   
ref|XP_006595172.1|  PREDICTED: protein TOPLESS-like isoform X3       54.7    8e-07   
ref|XP_009772956.1|  PREDICTED: topless-related protein 4 isoform X2  54.7    8e-07   
ref|XP_009772955.1|  PREDICTED: topless-related protein 4 isoform X1  54.7    8e-07   
ref|XP_009395448.1|  PREDICTED: topless-related protein 1-like is...  54.7    8e-07   
gb|KHN38006.1|  Topless-related protein 1                             54.3    8e-07   
ref|XP_003543688.1|  PREDICTED: protein TOPLESS-like isoform X1       54.7    8e-07   
ref|XP_009395446.1|  PREDICTED: topless-related protein 1-like is...  54.7    8e-07   
ref|XP_009405761.1|  PREDICTED: protein TOPLESS-like isoform X2       54.7    8e-07   
gb|AAF27128.1|AC018849_16  unknown protein; 52184-57536               54.7    8e-07   
ref|XP_008788808.1|  PREDICTED: protein TOPLESS-like                  54.7    9e-07   
ref|NP_178164.3|  Topless-related protein 1                           54.7    9e-07   
ref|NP_849913.2|  Topless-related protein 1                           54.7    9e-07   
ref|XP_006301454.1|  hypothetical protein CARUB_v10021876mg           54.7    9e-07   
ref|XP_010472918.1|  PREDICTED: topless-related protein 1 isoform X3  54.7    9e-07   
ref|XP_010472916.1|  PREDICTED: topless-related protein 1 isoform X1  54.7    9e-07   
ref|XP_010472920.1|  PREDICTED: topless-related protein 1 isoform X4  54.7    9e-07   
ref|XP_010476664.1|  PREDICTED: protein TOPLESS-like                  54.7    9e-07   
ref|XP_010417699.1|  PREDICTED: topless-related protein 1-like        54.3    9e-07   
ref|XP_010928336.1|  PREDICTED: protein TOPLESS-like isoform X2       54.3    1e-06   
ref|XP_010928335.1|  PREDICTED: protein TOPLESS-like isoform X1       54.3    1e-06   
ref|XP_006389802.1|  hypothetical protein EUTSA_v10018037mg           54.3    1e-06   
ref|XP_010472917.1|  PREDICTED: topless-related protein 1 isoform X2  54.3    1e-06   
ref|XP_006389801.1|  hypothetical protein EUTSA_v10018037mg           54.3    1e-06   
ref|XP_010928339.1|  PREDICTED: protein TOPLESS-like isoform X5       54.3    1e-06   
ref|XP_006306622.1|  hypothetical protein CARUB_v10008139mg           54.3    1e-06   
ref|XP_006443165.1|  hypothetical protein CICLE_v100185902mg          53.5    1e-06   
ref|NP_001049587.1|  Os03g0254700                                     54.3    1e-06   
gb|EEC74885.1|  hypothetical protein OsI_10796                        54.3    1e-06   
ref|XP_010928338.1|  PREDICTED: protein TOPLESS-like isoform X4       54.3    1e-06   
ref|XP_010942722.1|  PREDICTED: protein TOPLESS-like                  54.3    1e-06   
ref|XP_010943652.1|  PREDICTED: topless-related protein 1-like is...  54.3    1e-06   
ref|XP_010943653.1|  PREDICTED: topless-related protein 1-like is...  54.3    1e-06   
ref|XP_010545756.1|  PREDICTED: topless-related protein 4             54.3    1e-06   
ref|XP_010691083.1|  PREDICTED: protein TOPLESS                       54.3    1e-06   
ref|XP_007138952.1|  hypothetical protein PHAVU_009G252100g           53.9    1e-06   
gb|KDO50585.1|  hypothetical protein CISIN_1g0011592mg                53.1    1e-06   
ref|XP_010047995.1|  PREDICTED: uncharacterized protein LOC104436835  54.3    1e-06   
ref|XP_006364222.1|  PREDICTED: topless-related protein 4-like        53.9    1e-06   
ref|XP_010318758.1|  PREDICTED: topless-related protein 4 isoform X2  53.9    1e-06   
ref|XP_004235952.1|  PREDICTED: topless-related protein 4 isoform X1  53.9    1e-06   
ref|XP_004486640.1|  PREDICTED: protein TOPLESS-like isoform X1       53.9    1e-06   
ref|XP_004486641.1|  PREDICTED: protein TOPLESS-like isoform X2       53.9    1e-06   
gb|KEH32128.1|  topless-like protein                                  53.9    2e-06   
ref|XP_003566431.1|  PREDICTED: topless-related protein 2-like is...  53.9    2e-06   
ref|XP_010034955.1|  PREDICTED: protein TOPLESS-like isoform X2       53.9    2e-06   
ref|XP_007220318.1|  hypothetical protein PRUPE_ppa000528m1g          53.5    2e-06   
ref|XP_010034954.1|  PREDICTED: protein TOPLESS-like isoform X1       53.9    2e-06   
ref|XP_010230707.1|  PREDICTED: topless-related protein 2-like is...  53.9    2e-06   
gb|KDO52285.1|  hypothetical protein CISIN_1g0012242mg                53.5    2e-06   
ref|XP_003609377.1|  WD repeat-containing protein                     53.9    2e-06   
ref|XP_010230706.1|  PREDICTED: topless-related protein 2-like is...  53.9    2e-06   
gb|AES91574.2|  topless-like protein                                  53.9    2e-06   
ref|XP_010097168.1|  Protein TOPLESS                                  53.9    2e-06   
gb|KDO52286.1|  hypothetical protein CISIN_1g0012242mg                53.1    2e-06   
gb|KDO52287.1|  hypothetical protein CISIN_1g0012242mg                53.1    2e-06   
ref|XP_006585625.1|  PREDICTED: protein TOPLESS-like isoform X1       53.5    2e-06   
gb|KDO50579.1|  hypothetical protein CISIN_1g0011592mg                53.5    2e-06   
ref|XP_004165979.1|  PREDICTED: topless-related protein 4-like        53.5    2e-06   
gb|KDO50578.1|  hypothetical protein CISIN_1g0011592mg                53.1    2e-06   
gb|KDO50581.1|  hypothetical protein CISIN_1g0011592mg                53.1    2e-06   
ref|XP_004508472.1|  PREDICTED: topless-related protein 4-like is...  53.5    2e-06   
ref|XP_004508471.1|  PREDICTED: topless-related protein 4-like is...  53.5    2e-06   
ref|XP_010920062.1|  PREDICTED: protein TOPLESS-like                  53.5    2e-06   
ref|XP_006443166.1|  hypothetical protein CICLE_v100185902mg          53.1    2e-06   
ref|XP_007135775.1|  hypothetical protein PHAVU_010G157700g           53.5    2e-06   
ref|XP_006443164.1|  hypothetical protein CICLE_v100185902mg          53.1    2e-06   
ref|XP_006584165.1|  PREDICTED: protein TOPLESS-like                  53.5    2e-06   
ref|XP_008234585.1|  PREDICTED: topless-related protein 1-like        53.5    2e-06   
ref|XP_011073378.1|  PREDICTED: protein TOPLESS                       53.5    2e-06   
ref|XP_006478899.1|  PREDICTED: protein TOPLESS-like isoform X1       53.5    2e-06   
ref|XP_006478900.1|  PREDICTED: protein TOPLESS-like isoform X2       53.5    2e-06   
emb|CDP21735.1|  unnamed protein product                              50.4    2e-06   
ref|XP_002981766.1|  hypothetical protein SELMODRAFT_115161           53.5    2e-06   
dbj|BAE98958.1|  hypothetical protein                                 53.5    2e-06   
ref|XP_010537925.1|  PREDICTED: protein TOPLESS-like                  53.5    2e-06   
gb|KHG11821.1|  Protein TOPLESS -like protein                         53.1    2e-06   
ref|XP_010241551.1|  PREDICTED: topless-related protein 1-like is...  53.1    2e-06   
ref|XP_010241550.1|  PREDICTED: topless-related protein 4-like is...  53.1    2e-06   
ref|XP_009361190.1|  PREDICTED: topless-related protein 1-like is...  53.1    3e-06   
ref|XP_009361201.1|  PREDICTED: topless-related protein 1-like is...  53.1    3e-06   
ref|XP_008376897.1|  PREDICTED: topless-related protein 1-like is...  53.1    3e-06   
ref|XP_008376892.1|  PREDICTED: topless-related protein 1-like is...  53.1    3e-06   
gb|AES68182.2|  topless-like protein                                  53.1    3e-06   
ref|XP_003597932.1|  WD repeat-containing protein, putative           53.1    3e-06   
gb|KEH39610.1|  topless-like protein                                  53.1    3e-06   
gb|AES68183.2|  topless-like protein                                  53.1    3e-06   
ref|XP_003597933.1|  WD repeat-containing protein, putative           53.1    3e-06   
gb|KEH39609.1|  topless-like protein                                  53.1    3e-06   
ref|XP_003597931.1|  WD repeat-containing protein, putative           53.1    3e-06   
gb|AAN62336.1|AF506028_3  CTV.2                                       53.1    3e-06   
ref|XP_006492117.1|  PREDICTED: protein TOPLESS-like isoform X2       53.1    3e-06   
ref|XP_006492116.1|  PREDICTED: protein TOPLESS-like isoform X1       53.1    3e-06   
ref|XP_007029513.1|  WD-40 repeat protein-like isoform 5              53.1    3e-06   
ref|XP_006427463.1|  hypothetical protein CICLE_v10024745mg           53.1    3e-06   
ref|XP_006427464.1|  hypothetical protein CICLE_v10024745mg           53.1    3e-06   
ref|XP_006427465.1|  hypothetical protein CICLE_v10024745mg           53.1    3e-06   
ref|XP_010532341.1|  PREDICTED: protein TOPLESS                       53.1    3e-06   
ref|XP_009397650.1|  PREDICTED: topless-related protein 1-like        52.8    3e-06   
ref|XP_006416884.1|  hypothetical protein EUTSA_v10006622mg           52.8    4e-06   
ref|XP_011020160.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
gb|KGN60698.1|  hypothetical protein Csa_2G007420                     52.8    4e-06   
ref|XP_011020159.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
ref|XP_011020157.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
ref|XP_004139298.1|  PREDICTED: topless-related protein 4-like        52.8    4e-06   
emb|CDY53312.1|  BnaA09g56690D                                        52.8    4e-06   
gb|KHG04944.1|  Topless-related 1 -like protein                       52.8    4e-06   
ref|XP_007029511.1|  WD-40 repeat protein-like isoform 3              52.8    4e-06   
ref|XP_008456943.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
ref|XP_008456978.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
ref|XP_008456972.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
ref|XP_008456966.1|  PREDICTED: topless-related protein 4-like is...  52.8    4e-06   
emb|CDX81729.1|  BnaC08g38720D                                        52.8    4e-06   
ref|XP_007029510.1|  WD-40 repeat protein-like isoform 2              52.8    4e-06   
ref|XP_007029509.1|  WD-40 repeat protein-like isoform 1              52.8    4e-06   
ref|XP_009117812.1|  PREDICTED: protein TOPLESS                       52.8    4e-06   
ref|XP_007023319.1|  TOPLESS-related 1 isoform 1                      52.8    4e-06   
gb|KCW70759.1|  hypothetical protein EUGRSUZ_F03923                   52.4    4e-06   
gb|KCW70755.1|  hypothetical protein EUGRSUZ_F03923                   52.8    4e-06   
ref|XP_010063532.1|  PREDICTED: protein TOPLESS isoform X2            52.8    4e-06   
gb|KCW80090.1|  hypothetical protein EUGRSUZ_C01417                   52.0    4e-06   
ref|XP_010250163.1|  PREDICTED: protein TOPLESS-like                  52.4    4e-06   
ref|XP_009125737.1|  PREDICTED: topless-related protein 4-like is...  52.4    4e-06   
gb|KCW70760.1|  hypothetical protein EUGRSUZ_F03923                   52.4    4e-06   
gb|KCW70758.1|  hypothetical protein EUGRSUZ_F03923                   52.4    4e-06   
gb|KCW70761.1|  hypothetical protein EUGRSUZ_F03923                   52.4    5e-06   
ref|XP_010063530.1|  PREDICTED: protein TOPLESS isoform X1            52.4    5e-06   
gb|EPS70365.1|  hypothetical protein M569_04393                       52.4    5e-06   
ref|XP_010026693.1|  PREDICTED: topless-related protein 4-like        52.4    5e-06   
gb|KHG27106.1|  Topless-related 1 -like protein                       52.4    5e-06   
ref|XP_008363005.1|  PREDICTED: topless-related protein 4-like        52.4    5e-06   
gb|KCW80012.1|  hypothetical protein EUGRSUZ_C01349                   51.6    5e-06   
ref|XP_009611336.1|  PREDICTED: protein TOPLESS-like                  52.0    6e-06   
ref|XP_002892877.1|  wus-interacting protein 1                        52.0    6e-06   
ref|XP_007029512.1|  WD-40 repeat protein-like isoform 4              52.0    6e-06   
ref|XP_002967579.1|  hypothetical protein SELMODRAFT_88677            52.0    6e-06   
ref|XP_010933383.1|  PREDICTED: topless-related protein 1-like is...  52.0    7e-06   
gb|ABG29319.1|  Beta transducin-like protein, putative                51.6    7e-06   
ref|XP_010933382.1|  PREDICTED: topless-related protein 1-like is...  52.0    7e-06   
gb|KCW59942.1|  hypothetical protein EUGRSUZ_H02668                   51.6    7e-06   
gb|EMS49891.1|  Topless-related protein 1                             52.0    7e-06   
gb|EMT24067.1|  hypothetical protein F775_25939                       51.6    8e-06   
ref|XP_003599718.1|  WD repeat-containing protein, putative           51.6    9e-06   
gb|AES86542.2|  topless-like protein                                  51.6    9e-06   
ref|XP_011092592.1|  PREDICTED: topless-related protein 1-like is...  51.6    9e-06   
ref|XP_011092591.1|  PREDICTED: topless-related protein 1-like is...  51.6    9e-06   
ref|XP_011092590.1|  PREDICTED: topless-related protein 1-like is...  51.6    9e-06   
ref|XP_004245913.1|  PREDICTED: topless-related protein 1-like is...  51.6    9e-06   
ref|XP_007150781.1|  hypothetical protein PHAVU_005G180100g           51.6    1e-05   
ref|XP_006352936.1|  PREDICTED: protein TOPLESS-like isoform X2       51.6    1e-05   
ref|XP_010325597.1|  PREDICTED: topless-related protein 1-like is...  51.6    1e-05   
ref|XP_008228737.1|  PREDICTED: protein TOPLESS                       51.6    1e-05   
ref|XP_010325598.1|  PREDICTED: topless-related protein 1-like is...  51.6    1e-05   
emb|CDY33387.1|  BnaC05g11960D                                        51.6    1e-05   
emb|CDY36584.1|  BnaA06g10370D                                        51.6    1e-05   
ref|XP_006369294.1|  WD-40 repeat family protein                      51.6    1e-05   
ref|XP_009148962.1|  PREDICTED: protein TOPLESS                       51.2    1e-05   
ref|XP_006352935.1|  PREDICTED: protein TOPLESS-like isoform X1       51.2    1e-05   
ref|XP_011036611.1|  PREDICTED: topless-related protein 1-like        51.2    1e-05   
ref|XP_009125736.1|  PREDICTED: topless-related protein 4-like is...  51.2    1e-05   
ref|XP_002324880.2|  WD-40 repeat family protein                      51.2    1e-05   
ref|XP_009351851.1|  PREDICTED: topless-related protein 1-like is...  51.2    1e-05   
ref|XP_011011325.1|  PREDICTED: protein TOPLESS-like                  51.2    1e-05   
ref|XP_009351850.1|  PREDICTED: topless-related protein 1-like is...  51.2    1e-05   
ref|XP_009351849.1|  PREDICTED: topless-related protein 1-like is...  51.2    1e-05   
ref|XP_008372696.1|  PREDICTED: protein TOPLESS                       51.2    1e-05   
ref|XP_009351848.1|  PREDICTED: topless-related protein 1-like is...  51.2    1e-05   
ref|XP_009363995.1|  PREDICTED: topless-related protein 4-like        51.2    1e-05   
ref|XP_006659155.1|  PREDICTED: protein TOPLESS-like                  51.2    1e-05   
gb|EYU29078.1|  hypothetical protein MIMGU_mgv1a000445mg              51.2    1e-05   
ref|XP_009338495.1|  PREDICTED: protein TOPLESS                       51.2    1e-05   
gb|KCW80104.1|  hypothetical protein EUGRSUZ_C01431                   50.4    2e-05   
ref|XP_002520011.1|  conserved hypothetical protein                   50.8    2e-05   
ref|XP_006597113.1|  PREDICTED: protein TOPLESS-like isoform X1       50.4    2e-05   
gb|KHN22427.1|  Topless-related protein 1                             50.4    2e-05   
ref|XP_011039630.1|  PREDICTED: topless-related protein 1-like is...  50.4    2e-05   
ref|XP_011039629.1|  PREDICTED: topless-related protein 1-like is...  50.4    2e-05   
ref|XP_010243111.1|  PREDICTED: protein TOPLESS-like                  50.4    2e-05   
ref|XP_009796750.1|  PREDICTED: protein TOPLESS-like                  50.4    2e-05   
ref|XP_009597373.1|  PREDICTED: topless-related protein 1-like is...  50.4    2e-05   
ref|XP_009597371.1|  PREDICTED: topless-related protein 1-like is...  50.4    2e-05   
gb|EYU23277.1|  hypothetical protein MIMGU_mgv1a000461mg              50.4    2e-05   
ref|XP_008798012.1|  PREDICTED: protein TOPLESS-like isoform X2       50.4    3e-05   
ref|XP_010318717.1|  PREDICTED: protein TOPLESS-like isoform X2       50.1    3e-05   
ref|XP_008798009.1|  PREDICTED: topless-related protein 1-like is...  50.1    3e-05   
ref|NP_001061055.1|  Os08g0162100                                     50.1    3e-05   
ref|XP_010318715.1|  PREDICTED: protein TOPLESS-like isoform X1       50.1    3e-05   
ref|XP_009801466.1|  PREDICTED: topless-related protein 1-like is...  50.1    3e-05   
ref|XP_009597375.1|  PREDICTED: topless-related protein 1-like is...  50.1    3e-05   
ref|XP_009801463.1|  PREDICTED: topless-related protein 1-like is...  50.1    3e-05   
ref|XP_009597374.1|  PREDICTED: topless-related protein 1-like is...  50.1    3e-05   
dbj|BAC99788.1|  WD-40 repeat protein-like                            50.1    3e-05   
ref|XP_010050137.1|  PREDICTED: topless-related protein 1-like        49.7    3e-05   
ref|XP_004307882.1|  PREDICTED: protein TOPLESS-like                  50.1    3e-05   
ref|XP_011074840.1|  PREDICTED: topless-related protein 1-like        50.1    3e-05   
emb|CDO98186.1|  unnamed protein product                              50.1    3e-05   
ref|XP_008337262.1|  PREDICTED: topless-related protein 4             49.7    4e-05   
gb|KCW80072.1|  hypothetical protein EUGRSUZ_C01404                   49.7    4e-05   
ref|XP_009348312.1|  PREDICTED: protein TOPLESS-like                  49.7    4e-05   
ref|XP_006854127.1|  hypothetical protein AMTR_s00048p00159380        49.7    4e-05   
gb|EYU21684.1|  hypothetical protein MIMGU_mgv1a000459mg              49.7    4e-05   
ref|XP_011044877.1|  PREDICTED: topless-related protein 1 isoform X1  49.3    5e-05   
ref|XP_011044878.1|  PREDICTED: topless-related protein 1 isoform X2  49.3    5e-05   
ref|XP_010539522.1|  PREDICTED: protein TOPLESS-like                  49.3    6e-05   
ref|XP_010278758.1|  PREDICTED: topless-related protein 1-like is...  49.3    6e-05   
ref|XP_010278757.1|  PREDICTED: topless-related protein 1-like is...  49.3    6e-05   
ref|XP_007214907.1|  hypothetical protein PRUPE_ppa000478mg           49.3    6e-05   
gb|ACN26367.1|  unknown                                               48.5    6e-05   
ref|XP_009368882.1|  PREDICTED: topless-related protein 4-like        48.9    7e-05   
ref|XP_006341391.1|  PREDICTED: protein TOPLESS-like                  48.9    7e-05   
ref|XP_010050604.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  48.9    7e-05   
ref|XP_006385279.1|  hypothetical protein POPTR_0003s02410g           48.1    8e-05   
ref|NP_001167872.2|  ramosa 1 enhancer locus 2                        48.9    9e-05   
gb|ABF48719.1|  WD-40 repeat protein-like                             48.1    9e-05   
ref|XP_004303268.1|  PREDICTED: protein TOPLESS-like                  48.5    9e-05   
ref|XP_002309645.1|  WD-40 repeat family protein                      48.5    9e-05   
ref|XP_009131086.1|  PREDICTED: topless-related protein 4-like        48.5    1e-04   
ref|XP_010050598.1|  PREDICTED: topless-related protein 4-like        48.5    1e-04   
gb|KCW80007.1|  hypothetical protein EUGRSUZ_C013433                  47.0    1e-04   
ref|XP_004984974.1|  PREDICTED: protein TOPLESS-like isoform X3       48.5    1e-04   
ref|XP_004984972.1|  PREDICTED: protein TOPLESS-like isoform X1       48.5    1e-04   
emb|CDY21881.1|  BnaC01g35670D                                        48.5    1e-04   
ref|XP_004984975.1|  PREDICTED: protein TOPLESS-like isoform X4       48.5    1e-04   
emb|CDY20161.1|  BnaA01g28410D                                        48.5    1e-04   
ref|XP_002443908.1|  hypothetical protein SORBIDRAFT_07g004180        48.5    1e-04   



>ref|XP_007031068.1| TOPLESS-related 3 [Theobroma cacao]
 gb|EOY11570.1| TOPLESS-related 3 [Theobroma cacao]
Length=715

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK P NEQNP+G+ATAN +PQHWQP SG LM N+V  VNLE+ VPCI L
Sbjct  352  GVQKLWKWPRNEQNPSGEATANVVPQHWQPNSGLLMTNDVSGVNLEEAVPCITL  405



>ref|XP_002319498.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE95421.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1124

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK P NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  787  GIQKLWKWPRNEQNPSGKATANVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  840



>ref|XP_007031064.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
 gb|EOY11566.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
Length=1132

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK P NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GVQKLWKWPRNEQNPSGKATANVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  842



>ref|XP_007031066.1| TOPLESS-related 3 isoform 3 [Theobroma cacao]
 gb|EOY11568.1| TOPLESS-related 3 isoform 3 [Theobroma cacao]
Length=1091

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK P NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GVQKLWKWPRNEQNPSGKATANVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  842



>gb|KHG26583.1| Topless-related 3 -like protein [Gossypium arboreum]
Length=1134

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK P NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  790  GVQKLWKWPRNEQNPSGKATANVVPQHWQPNSGLLMTNDVTGVNLEEAVPCIAL  843



>ref|XP_010546752.1| PREDICTED: topless-related protein 3 isoform X2 [Tarenaya hassleriana]
Length=1108

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LW+ P NEQNP+GKATAN +PQHWQP SG LM N++  VNLE++VPCIAL
Sbjct  771  GIQRLWRWPRNEQNPSGKATANVVPQHWQPSSGLLMANDISGVNLEEMVPCIAL  824



>ref|XP_010546750.1| PREDICTED: topless-related protein 3 isoform X1 [Tarenaya hassleriana]
Length=1110

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LW+ P NEQNP+GKATAN +PQHWQP SG LM N++  VNLE++VPCIAL
Sbjct  773  GIQRLWRWPRNEQNPSGKATANVVPQHWQPSSGLLMANDISGVNLEEMVPCIAL  826



>ref|XP_009611828.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1101

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN IPQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  757  GIQKLWKWARNEQNPSGKATANVIPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  810



>ref|XP_009611827.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1129

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN IPQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  785  GIQKLWKWARNEQNPSGKATANVIPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  838



>ref|XP_009785868.1| PREDICTED: topless-related protein 3-like [Nicotiana sylvestris]
Length=1129

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN IPQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  785  GIQKLWKWARNEQNPSGKATANVIPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  838



>ref|XP_009346203.1| PREDICTED: topless-related protein 2-like isoform X1 [Pyrus x 
bretschneideri]
Length=1167

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N+E+ VPCIAL
Sbjct  832  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSENVEEAVPCIAL  884



>ref|XP_009346204.1| PREDICTED: topless-related protein 2-like isoform X2 [Pyrus x 
bretschneideri]
Length=1141

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N+E+ VPCIAL
Sbjct  806  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSENVEEAVPCIAL  858



>gb|KDP23429.1| hypothetical protein JCGZ_23262 [Jatropha curcas]
Length=516

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   N+QNPTGKATA+++PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  173  GIQKLWKWTRNDQNPTGKATASAVPQHWQPNSGLLMANDVAGVNLEEAVPCIAL  226



>ref|XP_011023731.1| PREDICTED: topless-related protein 3-like [Populus euphratica]
Length=1124

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  787  GIQKLWKWQRNEQNPSGKATANVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  840



>ref|XP_002307097.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE94093.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1133

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK P NEQNP+GKATA+  PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  796  GIQKLWKWPRNEQNPSGKATASVAPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  849



>ref|XP_008390610.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1146

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N+E+ VPCIAL
Sbjct  811  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSENVEEAVPCIAL  863



>ref|XP_004158753.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
Length=1126

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  783  GIQKLWKWTRNEQNPSGKATANVVPQHWQPNSGLLMTNDVLGVNLEEAVPCIAL  836



>ref|XP_004144768.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
 gb|KGN60972.1| hypothetical protein Csa_2G033270 [Cucumis sativus]
Length=1127

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  784  GIQKLWKWTRNEQNPSGKATANVVPQHWQPNSGLLMTNDVLGVNLEEAVPCIAL  837



>ref|XP_011036914.1| PREDICTED: topless-related protein 3 [Populus euphratica]
Length=1127

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK P +EQNP+GKATA+ +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  790  GIQKLWKWPRSEQNPSGKATASVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  843



>ref|XP_008453896.1| PREDICTED: topless-related protein 3-like [Cucumis melo]
Length=1127

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  784  GIQKLWKWTRNEQNPSGKATANVVPQHWQPNSGLLMTNDVLGVNLEEAVPCIAL  837



>ref|XP_010674104.1| PREDICTED: topless-related protein 3-like [Beta vulgaris subsp. 
vulgaris]
Length=1096

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATA+ IPQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  753  GIQKLWKWSRNEQNPSGKATASVIPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  806



>ref|XP_007144973.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
 gb|ESW16967.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
Length=1132

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G QKLWK   NEQNPTGKATAN +PQHWQP SG LM N++  VNLE+ VPCIAL
Sbjct  789  GTQKLWKWARNEQNPTGKATANVVPQHWQPNSGLLMTNDISGVNLEEAVPCIAL  842



>ref|XP_010524852.1| PREDICTED: topless-related protein 3-like isoform X2 [Tarenaya 
hassleriana]
Length=1115

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA+++PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  778  GIQRLWKWARNEQNPSGKATASAVPQHWQPSSGLLMTNDVSGVNLEEAVPCIAL  831



>ref|XP_010524851.1| PREDICTED: topless-related protein 3-like isoform X1 [Tarenaya 
hassleriana]
Length=1117

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA+++PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  780  GIQRLWKWARNEQNPSGKATASAVPQHWQPSSGLLMTNDVSGVNLEEAVPCIAL  833



>ref|XP_008353208.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1137

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N+E+ VPCIAL
Sbjct  802  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSENVEEAVPCIAL  854



>ref|XP_008340770.1| PREDICTED: topless-related protein 2 [Malus domestica]
Length=1127

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N+E+ VPCIAL
Sbjct  792  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSENVEEAVPCIAL  844



>ref|XP_009766750.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
sylvestris]
Length=1131

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  788  GTQKLWKWARNEQNPSGKATANVVPQHWQPNSGLLMANDVSGVNLEEAVPCIAL  841



>ref|XP_009766749.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
sylvestris]
Length=1132

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GTQKLWKWARNEQNPSGKATANVVPQHWQPNSGLLMANDVSGVNLEEAVPCIAL  842



>emb|CDP17223.1| unnamed protein product [Coffea canephora]
Length=1132

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  788  GVQKLWKWVRNEQNPSGKATANLVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  841



>ref|XP_009616373.1| PREDICTED: topless-related protein 3-like [Nicotiana tomentosiformis]
Length=1132

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GTQKLWKWARNEQNPSGKATANVVPQHWQPNSGLLMANDVSGVNLEEAVPCIAL  842



>ref|XP_007227035.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
 gb|EMJ28234.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
Length=1125

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N E+ VPCIAL
Sbjct  791  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVPENFEEAVPCIAL  843



>ref|XP_008223259.1| PREDICTED: topless-related protein 2 [Prunus mume]
Length=1125

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  N E+ VPCIAL
Sbjct  791  GVQKLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVPENFEEAVPCIAL  843



>ref|XP_011092107.1| PREDICTED: topless-related protein 3-like [Sesamum indicum]
Length=1129

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATA+ IPQHWQP SG LM N++  VNLE+ VPCIAL
Sbjct  786  GIQKLWKWIRNEQNPSGKATASVIPQHWQPNSGLLMTNDISGVNLEEAVPCIAL  839



>emb|CDX92100.1| BnaA05g23070D [Brassica napus]
Length=1132

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATAN  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  786  GVQRLWKWSRNEQNPTGKATANLTPQHWQPNSGLLMANDVSENPESAVPCIAL  838



>ref|XP_009146056.1| PREDICTED: topless-related protein 2-like [Brassica rapa]
Length=1132

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATAN  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  786  GVQRLWKWSRNEQNPTGKATANLTPQHWQPNSGLLMANDVSENPESAVPCIAL  838



>ref|XP_003626186.1| hypothetical protein MTR_7g112460 [Medicago truncatula]
 gb|AES82404.1| topless-like protein [Medicago truncatula]
Length=1129

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP+GKATA+ +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  787  GVQKLWKWSRNDQNPSGKATASVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  840



>ref|XP_007204953.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
 gb|EMJ06152.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
Length=1134

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  V+LE+ VPCIAL
Sbjct  789  GVQKLWKWVRNEQNPSGKATASVVPQHWQPNSGLLMTNDVTGVDLEEAVPCIAL  842



>ref|XP_004296880.1| PREDICTED: topless-related protein 2-like [Fragaria vesca subsp. 
vesca]
Length=1124

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK  +N++NP+GKATA+ IPQHWQP SG LM N+V  N E+ VPCIAL
Sbjct  789  GVQKLWKWRSNDENPSGKATASVIPQHWQPNSGLLMTNDVPENCEEAVPCIAL  841



>ref|XP_010245461.1| PREDICTED: topless-related protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=1126

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA+  PQHWQP SG LM N+V DV LE+ VPCIAL
Sbjct  791  GIQRLWKWSRNEQNPSGKATASVAPQHWQPNSGLLMTNDVSDVTLEEAVPCIAL  844



>ref|XP_010245460.1| PREDICTED: topless-related protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=1129

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA+  PQHWQP SG LM N+V DV LE+ VPCIAL
Sbjct  791  GIQRLWKWSRNEQNPSGKATASVAPQHWQPNSGLLMTNDVSDVTLEEAVPCIAL  844



>ref|XP_002512473.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49925.1| WD-repeat protein, putative [Ricinus communis]
Length=1132

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   ++QNP+GKATA ++PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GIQKLWKWARSDQNPSGKATAGAVPQHWQPNSGLLMANDVSGVNLEEAVPCIAL  842



>gb|KDO81758.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1058

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  839



>gb|KCW60528.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1066

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP GKATA+ +PQHWQP SG LM N+V  VN+E+ VPCIAL
Sbjct  794  GVQKLWKWARNEQNPAGKATASVVPQHWQPSSGLLMTNDVSGVNIEEAVPCIAL  847



>ref|XP_010024093.1| PREDICTED: topless-related protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW60527.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1137

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP GKATA+ +PQHWQP SG LM N+V  VN+E+ VPCIAL
Sbjct  794  GVQKLWKWARNEQNPAGKATASVVPQHWQPSSGLLMTNDVSGVNIEEAVPCIAL  847



>gb|KCW60526.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1138

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP GKATA+ +PQHWQP SG LM N+V  VN+E+ VPCIAL
Sbjct  795  GVQKLWKWARNEQNPAGKATASVVPQHWQPSSGLLMTNDVSGVNIEEAVPCIAL  848



>ref|XP_004494565.1| PREDICTED: topless-related protein 3-like [Cicer arietinum]
Length=1151

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  807  GVQKLWKWVRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSGVNLDEAVPCIAL  860



>ref|XP_010024094.1| PREDICTED: topless-related protein 3 isoform X2 [Eucalyptus grandis]
Length=1130

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP GKATA+ +PQHWQP SG LM N+V  VN+E+ VPCIAL
Sbjct  787  GVQKLWKWARNEQNPAGKATASVVPQHWQPSSGLLMTNDVSGVNIEEAVPCIAL  840



>ref|XP_008245640.1| PREDICTED: topless-related protein 3 [Prunus mume]
Length=1134

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+ +PQHWQP SG LM N+V  V+LE+ VPCIAL
Sbjct  789  GVQKLWKWVRNEQNPSGKATASVVPQHWQPNSGLLMTNDVTGVDLEEAVPCIAL  842



>emb|CDX95900.1| BnaC05g36510D [Brassica napus]
Length=1136

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  791  GVQRLWKWSRNEQNPTGKATASVTPQHWQPNSGLLMANDVSENPESAVPCIAL  843



>gb|KDO81760.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=945

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  839



>emb|CDY50500.1| BnaC01g44380D [Brassica napus]
Length=505

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  162  GVQRLWKWSRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPETAVPCIAL  214



>ref|XP_010528913.1| PREDICTED: topless-related protein 3-like [Tarenaya hassleriana]
Length=1106

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   NEQNPTGKATA+ +PQ WQP SG LM N+V  VNLE+ VPCIAL
Sbjct  765  GIQKLWKWARNEQNPTGKATASVVPQLWQPNSGLLMTNDVSGVNLEEAVPCIAL  818



>ref|XP_010313267.1| PREDICTED: topless-related protein 3 isoform X1 [Solanum lycopersicum]
Length=1155

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQ+WQP SG LM N+ V +NLE+ VPCIAL
Sbjct  812  GTQKLWKWTRNEQNPSGKATANVVPQYWQPNSGLLMTNDIVGINLEEAVPCIAL  865



>ref|XP_006344707.1| PREDICTED: topless-related protein 3-like isoform X1 [Solanum 
tuberosum]
Length=1155

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQ+WQP SG LM N+ V +NLE+ VPCIAL
Sbjct  812  GTQKLWKWTRNEQNPSGKATANVVPQYWQPNSGLLMTNDIVGINLEEAVPCIAL  865



>ref|XP_006344709.1| PREDICTED: topless-related protein 3-like isoform X3 [Solanum 
tuberosum]
Length=1131

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQ+WQP SG LM N+ V +NLE+ VPCIAL
Sbjct  788  GTQKLWKWTRNEQNPSGKATANVVPQYWQPNSGLLMTNDIVGINLEEAVPCIAL  841



>ref|XP_006344708.1| PREDICTED: topless-related protein 3-like isoform X2 [Solanum 
tuberosum]
Length=1132

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQ+WQP SG LM N+ V +NLE+ VPCIAL
Sbjct  789  GTQKLWKWTRNEQNPSGKATANVVPQYWQPNSGLLMTNDIVGINLEEAVPCIAL  842



>ref|XP_004230269.1| PREDICTED: topless-related protein 3 isoform X3 [Solanum lycopersicum]
Length=1131

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQ+WQP SG LM N+ V +NLE+ VPCIAL
Sbjct  788  GTQKLWKWTRNEQNPSGKATANVVPQYWQPNSGLLMTNDIVGINLEEAVPCIAL  841



>ref|XP_010313271.1| PREDICTED: topless-related protein 3 isoform X2 [Solanum lycopersicum]
Length=1132

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
            G QKLWK   NEQNP+GKATAN +PQ+WQP SG LM N+ V +NLE+ VPCIAL
Sbjct  789  GTQKLWKWTRNEQNPSGKATANVVPQYWQPNSGLLMTNDIVGINLEEAVPCIAL  842



>ref|XP_007031067.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY11569.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=1761

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157   GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
             G++KLWK   +E+NP+GKATAN +PQHWQP SG LM N+V  V LE  VPCIAL
Sbjct  1383  GVRKLWKWLRDEENPSGKATANVVPQHWQPNSGLLMTNDVSGVKLEIAVPCIAL  1436



>gb|KDO81755.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1101

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  759  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  812



>gb|KDO81759.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1012

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  839



>gb|KDO81757.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1128

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  839



>ref|XP_006472151.1| PREDICTED: topless-related protein 3-like [Citrus sinensis]
Length=1128

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  839



>ref|XP_006433483.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
 gb|ESR46723.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
Length=1130

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  788  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  841



>ref|XP_003591186.1| WD repeat-containing protein [Medicago truncatula]
Length=1140

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+ +PQ WQP SG LM N++  VNLE+ VPCIAL
Sbjct  797  GVQKLWKWARNEQNPTGKATASVVPQRWQPNSGLLMTNDIAGVNLEEAVPCIAL  850



>ref|XP_004508183.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1125

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   NEQNPTGKAT + +PQHWQP +G LM N+V  N E+ VPCIAL
Sbjct  789  GIQKLWKWSRNEQNPTGKATTSVVPQHWQPNNGLLMTNDVPDNSEEAVPCIAL  841



>gb|KDO81756.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1096

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+++PQHW P SG LM N+V  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWHRNEQNPSGKATASAVPQHWLPSSGLLMANDVAGVNLEEAVPCIAL  839



>ref|XP_004495685.1| PREDICTED: topless-related protein 3-like isoform X2 [Cicer arietinum]
Length=1123

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+ +PQ WQP SG LM N++  VNLE+ VPCIAL
Sbjct  785  GVQKLWKWARNEQNPTGKATASVVPQRWQPNSGLLMTNDIAGVNLEEAVPCIAL  838



>ref|XP_004495684.1| PREDICTED: topless-related protein 3-like isoform X1 [Cicer arietinum]
Length=1124

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+ +PQ WQP SG LM N++  VNLE+ VPCIAL
Sbjct  786  GVQKLWKWARNEQNPTGKATASVVPQRWQPNSGLLMTNDIAGVNLEEAVPCIAL  839



>ref|XP_009369993.1| PREDICTED: topless-related protein 2-like [Pyrus x bretschneideri]
Length=1140

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   NEQN +GKATA+ +PQHWQP SG LM N+V  N+E+ VPCIAL
Sbjct  805  GVQKLWKWSRNEQNLSGKATASVVPQHWQPNSGLLMTNDVSENVEEAVPCIAL  857



>ref|XP_004495686.1| PREDICTED: topless-related protein 3-like isoform X3 [Cicer arietinum]
Length=1115

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+ +PQ WQP SG LM N++  VNLE+ VPCIAL
Sbjct  784  GVQKLWKWARNEQNPTGKATASVVPQRWQPNSGLLMTNDIAGVNLEEAVPCIAL  837



>gb|ABD28351.1| Lissencephaly type-1-like homology motif; CTLH, C-terminal to 
LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; 
Quinonprotein alcohol dehydrogenase-like [Medicago truncatula]
 gb|AES61437.2| topless-like protein [Medicago truncatula]
Length=1128

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+ +PQ WQP SG LM N++  VNLE+ VPCIAL
Sbjct  785  GVQKLWKWARNEQNPTGKATASVVPQRWQPNSGLLMTNDIAGVNLEEAVPCIAL  838



>ref|XP_010043204.1| PREDICTED: topless-related protein 3-like [Eucalyptus grandis]
 gb|KCW85231.1| hypothetical protein EUGRSUZ_B02075 [Eucalyptus grandis]
Length=1131

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP+GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  788  GVQKLWKWARNDQNPSGKATASVVPQHWQPSSGLLMANDVSGVNLDEAVPCIAL  841



>ref|XP_010259449.1| PREDICTED: topless-related protein 2 isoform X2 [Nelumbo nucifera]
Length=1135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATA+  PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  793  GIQKLWKWSRNEQNPSGKATASVAPQHWQPNSGLLMTNDVSDANPEEAVPCIAL  846



>ref|XP_010259448.1| PREDICTED: topless-related protein 2 isoform X1 [Nelumbo nucifera]
Length=1136

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATA+  PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  793  GIQKLWKWSRNEQNPSGKATASVAPQHWQPNSGLLMTNDVSDANPEEAVPCIAL  846



>ref|XP_010259450.1| PREDICTED: topless-related protein 2 isoform X3 [Nelumbo nucifera]
Length=1099

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            GIQKLWK   NEQNP+GKATA+  PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  756  GIQKLWKWSRNEQNPSGKATASVAPQHWQPNSGLLMTNDVSDANPEEAVPCIAL  809



>ref|XP_006606545.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN20263.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   +EQNPTGKATAN +P HWQP +G LM N++  VNLE+ VPCIAL
Sbjct  787  GIQKLWKWARSEQNPTGKATANVVPLHWQPNNGLLMTNDISGVNLEEAVPCIAL  840



>ref|XP_007035678.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
 gb|EOY06604.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
Length=1101

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   +EQNP+GKATA+ +PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  794  GIQKLWKWSRSEQNPSGKATASIVPQHWQPNSGLLMTNDVPDNSEDAVPCIAL  846



>ref|XP_007035675.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
 gb|EOY06601.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
Length=1133

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   +EQNP+GKATA+ +PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  794  GIQKLWKWSRSEQNPSGKATASIVPQHWQPNSGLLMTNDVPDNSEDAVPCIAL  846



>ref|XP_007035676.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
 gb|EOY06602.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
Length=1139

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   +EQNP+GKATA+ +PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  800  GIQKLWKWSRSEQNPSGKATASIVPQHWQPNSGLLMTNDVPDNSEDAVPCIAL  852



>ref|XP_007035677.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
 gb|EOY06603.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
Length=1107

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   +EQNP+GKATA+ +PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  800  GIQKLWKWSRSEQNPSGKATASIVPQHWQPNSGLLMTNDVPDNSEDAVPCIAL  852



>ref|XP_006841513.1| hypothetical protein AMTR_s00003p00142040 [Amborella trichopoda]
 gb|ERN03188.1| hypothetical protein AMTR_s00003p00142040 [Amborella trichopoda]
Length=801

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQKLWK   +EQNPTGKATA+ +PQHWQP SG LM N+V DVN E+ VPCIAL
Sbjct  498  AIQKLWKWSRSEQNPTGKATASVVPQHWQPNSGLLMKNDVLDVNPEEAVPCIAL  551



>emb|CDY50502.1| BnaC01g44400D [Brassica napus]
Length=1272

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  927  GVQRLWKWSRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPETAVPCIAL  979



>ref|XP_009114175.1| PREDICTED: topless-related protein 2 [Brassica rapa]
Length=1135

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  790  GVQRLWKWSRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPETAVPCIAL  842



>ref|XP_006406802.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
 gb|ESQ48255.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
Length=1131

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRLWKWSRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPEATVPCIAL  839



>ref|XP_010094719.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB56799.1| Topless-related protein 3 [Morus notabilis]
Length=1117

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP G+ATA+ +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GVQKLWKWVRNEQNPGGQATASVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  842



>ref|XP_010086586.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB21430.1| Topless-related protein 3 [Morus notabilis]
Length=1132

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP G+ATA+ +PQHWQP SG LM N+V  VNLE+ VPCIAL
Sbjct  789  GVQKLWKWVRNEQNPGGQATASVVPQHWQPNSGLLMTNDVSGVNLEEAVPCIAL  842



>emb|CDX88252.1| BnaA06g28430D [Brassica napus]
Length=1109

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA ++PQHWQP SG LM N+V  VNLE+  PCIAL
Sbjct  780  GIQRLWKWVRNEQNPSGKATAAAVPQHWQPNSGLLMTNDVSGVNLEEANPCIAL  833



>ref|XP_009151171.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 3 [Brassica 
rapa]
Length=1112

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA ++PQHWQP SG LM N+V  VNLE+  PCIAL
Sbjct  780  GIQRLWKWVRNEQNPSGKATAAAVPQHWQPNSGLLMTNDVSGVNLEEANPCIAL  833



>ref|XP_010462722.1| PREDICTED: protein TOPLESS-like, partial [Camelina sativa]
Length=1144

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q++WK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  945  GVQRIWKWSRNEQNPTGKATASVTPQHWQPSSGLLMTNDVPENPEGTVPCIAL  997



>emb|CDX80607.1| BnaC07g28370D [Brassica napus]
Length=1117

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA ++PQHWQP SG LM N+V  VNLE+  PCIAL
Sbjct  783  GIQRLWKWVRNEQNPSGKATAAAVPQHWQPNSGLLMTNDVSGVNLEEANPCIAL  836



>ref|XP_010465706.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q++WK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRIWKWSRNEQNPTGKATASLTPQHWQPSSGLLMTNDVPENAEGTVPCIAL  839



>ref|XP_002870186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46445.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1125

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   +EQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  786  GVQRLWKWSRSEQNPTGKATASVTPQHWQPNSGLLMTNDVPENPEGTVPCIAL  838



>ref|XP_010938347.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1134

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   +EQNP+GKATA+ +PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  791  GVQKLWKWSRSEQNPSGKATASFVPQHWQPNSGLLMTNDVPDTNPEEAVPCIAL  844



>ref|XP_010938346.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1135

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   +EQNP+GKATA+ +PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  792  GVQKLWKWSRSEQNPSGKATASFVPQHWQPNSGLLMTNDVPDTNPEEAVPCIAL  845



>ref|XP_008388509.1| PREDICTED: topless-related protein 3-like [Malus domestica]
Length=1135

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   NEQNP+GKATA+  P HWQP SG LM N+V  VNLE+ +PCIAL
Sbjct  791  GVQKLWKWVRNEQNPSGKATASVAPLHWQPNSGLLMANDVSGVNLEEAIPCIAL  844



>gb|KHN03954.1| Topless-related protein 3 [Glycine soja]
Length=1107

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   +EQNP GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  763  GVQKLWKWARSEQNPNGKATASVVPQHWQPNSGLLMTNDVAGVNLDEAVPCIAL  816



>ref|XP_006577218.1| PREDICTED: topless-related protein 3-like [Glycine max]
Length=1130

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   +EQNP GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  786  GVQKLWKWARSEQNPNGKATASVVPQHWQPNSGLLMTNDVAGVNLDEAVPCIAL  839



>ref|XP_009338219.1| PREDICTED: topless-related protein 3 isoform X2 [Pyrus x bretschneideri]
Length=1123

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+  P HWQP SG LM N+V  VNLE+ +PCIAL
Sbjct  779  GVQKLWKWVRNEQNPTGKATASVAPLHWQPNSGLLMANDVAGVNLEEAIPCIAL  832



>gb|AAD48936.1|AF160760_4 contains similarity to Pfam family PF0040 - WD domain, G-beta 
repeat; score=10.8, E=3.2, N-2 [Arabidopsis thaliana]
Length=892

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA  +PQHWQP SG LM N+V  VNLE   PCIAL
Sbjct  792  GIQRLWKWVPNEQNPSGKATATVVPQHWQPNSGLLMTNDVSGVNLENAAPCIAL  845



>ref|XP_009338217.1| PREDICTED: topless-related protein 3 isoform X1 [Pyrus x bretschneideri]
Length=1135

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+QKLWK   NEQNPTGKATA+  P HWQP SG LM N+V  VNLE+ +PCIAL
Sbjct  791  GVQKLWKWVRNEQNPTGKATASVAPLHWQPNSGLLMANDVAGVNLEEAIPCIAL  844



>ref|XP_002283157.1| PREDICTED: topless-related protein 3 [Vitis vinifera]
 emb|CBI39553.3| unnamed protein product [Vitis vinifera]
Length=1132

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP+GKAT+N +PQHWQP SG LM N+V  VN E+ VPCIAL
Sbjct  789  GVQKLWKWFRNDQNPSGKATSNVVPQHWQPNSGLLMTNDVSGVNPEEAVPCIAL  842



>emb|CAN79774.1| hypothetical protein VITISV_013612 [Vitis vinifera]
Length=1088

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP+GKAT+N +PQHWQP SG LM N+V  VN E+ VPCIAL
Sbjct  745  GVQKLWKWFRNDQNPSGKATSNVVPQHWQPNSGLLMTNDVSGVNPEEAVPCIAL  798



>ref|XP_010487553.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q++WK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRIWKWSRNEQNPTGKATASVTPQHWQPSSGLLMTNDVPENPEGTVPCIAL  839



>ref|NP_198055.3| Topless-related protein 3 [Arabidopsis thaliana]
 sp|Q84JM4.1|TPR3_ARATH RecName: Full=Topless-related protein 3 [Arabidopsis thaliana]
 gb|AAO42071.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50698.1| unknown protein [Arabidopsis thaliana]
 gb|AED93642.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1108

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA  +PQHWQP SG LM N+V  VNLE   PCIAL
Sbjct  775  GIQRLWKWVPNEQNPSGKATATVVPQHWQPNSGLLMTNDVSGVNLENAAPCIAL  828



>ref|XP_010504697.1| PREDICTED: topless-related protein 2 [Camelina sativa]
Length=1131

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q++WK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRIWKWSRNEQNPTGKATASVTPQHWQPSSGLLMTNDVPENPEGTVPCIAL  839



>ref|NP_001190409.1| Topless-related protein 3 [Arabidopsis thaliana]
 gb|AED93643.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1134

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKATA  +PQHWQP SG LM N+V  VNLE   PCIAL
Sbjct  801  GIQRLWKWVPNEQNPSGKATATVVPQHWQPNSGLLMTNDVSGVNLENAAPCIAL  854



>ref|XP_006299477.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
 gb|EOA32375.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
Length=1127

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNP+GKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  783  GVQRLWKWSRNEQNPSGKATASVTPQHWQPNSGLLMANDVPENPEATVPCIAL  835



>dbj|BAA95777.1| unnamed protein product [Arabidopsis thaliana]
Length=1161

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRLWKWIRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPEGSVPCIAL  839



>ref|NP_188306.2| Topless-related 2 protein [Arabidopsis thaliana]
 sp|Q9LRZ0.2|TPR2_ARATH RecName: Full=Topless-related protein 2 [Arabidopsis thaliana]
 gb|AEE75871.1| Topless-related 2 protein [Arabidopsis thaliana]
Length=1131

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRLWKWIRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPEGSVPCIAL  839



>ref|XP_006394928.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
 gb|ESQ32214.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
Length=1136

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+ WK   +EQNP+GKATA+ +PQHWQP SG LM N+V  VNLE+  PCIAL
Sbjct  802  GIQRFWKWVRSEQNPSGKATASVVPQHWQPNSGLLMTNDVSGVNLEEAAPCIAL  855



>gb|KFK39016.1| hypothetical protein AALP_AA3G189500 [Arabis alpina]
Length=1131

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNP+GKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRLWKWSRNEQNPSGKATASITPQHWQPNSGLLMANDVPDNPEGAVPCIAL  839



>ref|XP_010440213.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1115

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   +EQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  776  GVQRLWKWSRSEQNPTGKATASVTPQHWQPNSGLLMTNDVPENPEGTVPCIAL  828



>ref|XP_010449856.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1125

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   +EQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  786  GVQRLWKWSRSEQNPTGKATASVTPQHWQPNSGLLMTNDVPENPEGTVPCIAL  838



>ref|XP_006414395.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
 gb|ESQ55848.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
Length=1120

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   +EQNPTGKATA+  PQHWQP SG LM N+V  N E  VPCIAL
Sbjct  784  GVQRLWKWSRSEQNPTGKATASVTPQHWQPNSGLLMTNDVPENPEGTVPCIAL  836



>gb|KFK27551.1| hypothetical protein AALP_AA8G398300 [Arabis alpina]
Length=1125

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  PQHWQP SG LM N+V  N +  VPCIAL
Sbjct  786  GLQRLWKWSRNEQNPTGKATASITPQHWQPNSGLLMTNDVPENPDGTVPCIAL  838



>ref|XP_009421409.1| PREDICTED: topless-related protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=1134

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +PQHWQP SG LM N+  D N E+ VPCIAL
Sbjct  791  AIQRLWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDASDTNSEEAVPCIAL  844



>ref|XP_002883029.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59288.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
Length=1131

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   NEQNPTGKATA+  P HWQP SG LM N+V  N E  VPCIAL
Sbjct  787  GVQRLWKWSRNEQNPTGKATASVTPHHWQPNSGLLMANDVPENPEGAVPCIAL  839



>ref|XP_006604796.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN43327.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK    EQNP GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  786  GVQKLWKWARCEQNPNGKATASVVPQHWQPNSGLLMTNDVTGVNLDEAVPCIAL  839



>gb|KDO71780.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1131

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK    EQNP+GKATA   PQHWQPS G LM N+V  N E VVPC+AL
Sbjct  789  GVQKLWKWNRTEQNPSGKATAAVAPQHWQPSNGLLMTNDVPENAEDVVPCVAL  841



>gb|KDO71781.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1130

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK    EQNP+GKATA   PQHWQPS G LM N+V  N E VVPC+AL
Sbjct  789  GVQKLWKWNRTEQNPSGKATAAVAPQHWQPSNGLLMTNDVPENAEDVVPCVAL  841



>gb|EPS69182.1| hypothetical protein M569_05580, partial [Genlisea aurea]
Length=1123

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP GKATA+  PQHWQP SG LM N+   VNLE+ VPCIAL
Sbjct  790  GVQKLWKWLRNDQNPNGKATASITPQHWQPHSGLLMTNDTSGVNLEEAVPCIAL  843



>ref|XP_006589131.1| PREDICTED: topless-related protein 3-like isoform X2 [Glycine 
max]
Length=1153

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   +E NPTGKATAN +P HWQP +G LM N++  VNLE+ VPCIAL
Sbjct  810  GIQKLWKWARSELNPTGKATANVVPLHWQPNNGLLMTNDISGVNLEEAVPCIAL  863



>ref|XP_006589130.1| PREDICTED: topless-related protein 3-like isoform X1 [Glycine 
max]
Length=1129

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   +E NPTGKATAN +P HWQP +G LM N++  VNLE+ VPCIAL
Sbjct  786  GIQKLWKWARSELNPTGKATANVVPLHWQPNNGLLMTNDISGVNLEEAVPCIAL  839



>gb|KHN16088.1| Topless-related protein 3 [Glycine soja]
Length=1121

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQKLWK   +E NPTGKATAN +P HWQP +G LM N++  VNLE+ VPCIAL
Sbjct  786  GIQKLWKWARSELNPTGKATANVVPLHWQPNNGLLMTNDISGVNLEEAVPCIAL  839



>ref|XP_008370406.1| PREDICTED: topless-related protein 3-like isoform X2 [Malus domestica]
Length=1123

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP+GKATA+  P HWQP SG LM N++  VNLE+ +PCIAL
Sbjct  779  GVQKLWKWVRNDQNPSGKATASVAPLHWQPNSGLLMANDISGVNLEEAIPCIAL  832



>ref|XP_008370405.1| PREDICTED: topless-related protein 3-like isoform X1 [Malus domestica]
Length=1135

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   N+QNP+GKATA+  P HWQP SG LM N++  VNLE+ +PCIAL
Sbjct  791  GVQKLWKWVRNDQNPSGKATASVAPLHWQPNSGLLMANDISGVNLEEAIPCIAL  844



>ref|XP_010921588.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1136

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             +Q+LWK   +EQNP+GKATA+ +PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  793  AVQRLWKWSRSEQNPSGKATASVVPQHWQPNSGLLMTNDVSDTNPEEAVPCIAL  846



>ref|XP_010921589.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1135

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             +Q+LWK   +EQNP+GKATA+ +PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  792  AVQRLWKWSRSEQNPSGKATASVVPQHWQPNSGLLMTNDVSDTNPEEAVPCIAL  845



>ref|XP_008795824.1| PREDICTED: topless-related protein 2-like [Phoenix dactylifera]
Length=1029

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             +Q+LWK   +EQNP+GKATA+ +PQHWQP SG LM N+V D N E+ VPCIAL
Sbjct  686  AVQRLWKWSRSEQNPSGKATASVVPQHWQPSSGLLMTNDVSDTNPEEAVPCIAL  739



>ref|XP_007163345.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35339.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1130

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   +EQN  GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  787  GVQKLWKWSRSEQNLNGKATASVVPQHWQPSSGLLMTNDVSGVNLDEAVPCIAL  840



>ref|XP_007163344.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35338.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1102

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            G+QKLWK   +EQN  GKATA+ +PQHWQP SG LM N+V  VNL++ VPCIAL
Sbjct  759  GVQKLWKWSRSEQNLNGKATASVVPQHWQPSSGLLMTNDVSGVNLDEAVPCIAL  812



>ref|XP_009382516.1| PREDICTED: topless-related protein 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1164

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ++WK   NEQNP+GKATA+ +PQHWQP SG LM N+V D + E+ VPCIAL
Sbjct  800  AIQRVWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSDTSPEEAVPCIAL  853



>ref|XP_009382517.1| PREDICTED: topless-related protein 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1143

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ++WK   NEQNP+GKATA+ +PQHWQP SG LM N+V D + E+ VPCIAL
Sbjct  801  AIQRVWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSDTSPEEAVPCIAL  854



>ref|XP_009382518.1| PREDICTED: topless-related protein 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=1142

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ++WK   NEQNP+GKATA+ +PQHWQP SG LM N+V D + E+ VPCIAL
Sbjct  800  AIQRVWKWSRNEQNPSGKATASVVPQHWQPNSGLLMTNDVSDTSPEEAVPCIAL  853



>gb|AES91919.2| topless-like protein [Medicago truncatula]
Length=1122

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   N+QNP+GKAT   +PQHWQ PSG LM N+V    E+ VPCIAL
Sbjct  786  GIQKLWKWSRNDQNPSGKATTTVVPQHWQPPSGLLMTNDVPDGSEEPVPCIAL  838



>ref|XP_003609722.1| WD repeat-containing protein [Medicago truncatula]
Length=991

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   N+QNP+GKAT   +PQHWQ PSG LM N+V    E+ VPCIAL
Sbjct  655  GIQKLWKWSRNDQNPSGKATTTVVPQHWQPPSGLLMTNDVPDGSEEPVPCIAL  707



>ref|XP_008655511.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Zea mays]
Length=1462

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157   GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
              IQ+LWK   NEQNP+GKATA+ +P HWQP SG +M N+  D N E+ +PCIAL
Sbjct  1125  AIQRLWKWSRNEQNPSGKATASVVPHHWQPNSGLVMTNDTSDTNPEEAIPCIAL  1178



>ref|XP_006644007.1| PREDICTED: topless-related protein 2-like [Oryza brachyantha]
Length=1128

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +PQHWQP SG +M N+  D N E+ VPCIAL
Sbjct  785  AIQRLWKWARNEQNPSGKATASVVPQHWQPNSGLVMQNDTADTNPEEAVPCIAL  838



>ref|NP_001042616.1| Os01g0254100 [Oryza sativa Japonica Group]
 dbj|BAD81067.1| putative CTV.2 [Oryza sativa Japonica Group]
 dbj|BAF04530.1| Os01g0254100 [Oryza sativa Japonica Group]
 gb|EEE54253.1| hypothetical protein OsJ_01134 [Oryza sativa Japonica Group]
 dbj|BAL44268.1| ASPR2 protein [Oryza sativa Japonica Group]
Length=1129

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   N+QNP+GKATAN +PQHWQP SG +M N+  D N E  VPCIAL
Sbjct  786  AIQRLWKWARNDQNPSGKATANVVPQHWQPNSGLVMQNDTADTNPEDAVPCIAL  839



>gb|EAY73338.1| hypothetical protein OsI_01216 [Oryza sativa Indica Group]
Length=1118

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   N+QNP+GKATAN +PQHWQP SG +M N+  D N E  VPCIAL
Sbjct  775  AIQRLWKWARNDQNPSGKATANVVPQHWQPNSGLVMQNDTADTNPEDAVPCIAL  828



>ref|XP_006489020.1| PREDICTED: topless-related protein 2-like isoform X2 [Citrus 
sinensis]
Length=1131

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK    E NP+GKATA   PQHWQPS G LM N+V  N E VVPC+AL
Sbjct  789  GVQKLWKWNRTELNPSGKATAAVAPQHWQPSNGLLMTNDVPENAEDVVPCVAL  841



>ref|XP_006419483.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
 gb|ESR32723.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
Length=1131

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK    E NP+GKATA   PQHWQPS G LM N+V  N E VVPC+AL
Sbjct  789  GVQKLWKWNRTELNPSGKATAAVAPQHWQPSNGLLMTNDVPENAEDVVPCVAL  841



>ref|XP_006489019.1| PREDICTED: topless-related protein 2-like isoform X1 [Citrus 
sinensis]
Length=1130

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK    E NP+GKATA   PQHWQPS G LM N+V  N E VVPC+AL
Sbjct  789  GVQKLWKWNRTELNPSGKATAAVAPQHWQPSNGLLMTNDVPENAEDVVPCVAL  841



>ref|XP_004487868.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1122

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   +E NPTGKATA+ +PQHW+PS G LM N+V  + E  VPCIAL
Sbjct  798  GVQKLWKWSFSELNPTGKATASVVPQHWRPSNGILMTNDVPSDCEMAVPCIAL  850



>ref|XP_006285940.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
 gb|EOA18838.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
Length=1107

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+Q+LWK   +EQNP+GKATA+  PQHWQP SG LM N+V  N    VPCIAL
Sbjct  768  GVQRLWKWSRSEQNPSGKATASVTPQHWQPNSGLLMTNDVPENPNGTVPCIAL  820



>ref|XP_008673871.1| PREDICTED: topless-related protein 2 isoform X1 [Zea mays]
Length=1125

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +P HWQP SG +M N+  D N E+ VPCIAL
Sbjct  787  AIQRLWKWSRNEQNPSGKATASVVPHHWQPNSGLVMTNDTADTNPEEAVPCIAL  840



>ref|XP_008673872.1| PREDICTED: topless-related protein 2 isoform X2 [Zea mays]
Length=1109

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +P HWQP SG +M N+  D N E+ VPCIAL
Sbjct  771  AIQRLWKWSRNEQNPSGKATASVVPHHWQPNSGLVMTNDTADTNPEEAVPCIAL  824



>tpg|DAA53973.1| TPA: hypothetical protein ZEAMMB73_351755 [Zea mays]
Length=1086

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +P HWQP SG +M N+  D N E+ VPCIAL
Sbjct  787  AIQRLWKWSRNEQNPSGKATASVVPHHWQPNSGLVMTNDTADTNPEEAVPCIAL  840



>ref|XP_004967836.1| PREDICTED: topless-related protein 2-like [Setaria italica]
Length=1130

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA  +P HWQP SG +M N+  D N E+ VPCIAL
Sbjct  787  AIQRLWKWSRNEQNPSGKATAGVVPHHWQPNSGLVMTNDTADTNPEEAVPCIAL  840



>gb|EMT25315.1| hypothetical protein F775_09004 [Aegilops tauschii]
Length=1081

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  819  AIQRLWKWNRNEQNPSGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  872



>emb|CDY05552.1| BnaA02g31390D [Brassica napus]
Length=1111

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKAT   +PQ WQP SG LM N+V  VNLE+  PCIAL
Sbjct  777  GIQRLWKWVRNEQNPSGKATTAVVPQQWQPNSGLLMANDVSGVNLEESNPCIAL  830



>ref|XP_009129893.1| PREDICTED: topless-related protein 3 [Brassica rapa]
Length=1116

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   NEQNP+GKAT   +PQ WQP SG LM N+V  VNLE+  PCIAL
Sbjct  781  GIQRLWKWVRNEQNPSGKATTAVVPQQWQPNSGLLMANDVSGVNLEESNPCIAL  834



>ref|XP_009595073.1| PREDICTED: topless-related protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1134

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+NPTGKA A+ +PQ WQPS G LM N++ D N E  VPC AL
Sbjct  799  AVHKLWKWPRNERNPTGKANASIVPQLWQPSNGTLMTNDITDTNPEDAVPCFAL  852



>ref|XP_009595072.1| PREDICTED: topless-related protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1137

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+NPTGKA A+ +PQ WQPS G LM N++ D N E  VPC AL
Sbjct  802  AVHKLWKWPRNERNPTGKANASIVPQLWQPSNGTLMTNDITDTNPEDAVPCFAL  855



>ref|XP_009803412.1| PREDICTED: topless-related protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=1134

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+NPTGKA A+ +PQ WQPS G LM N++ D N E  VPC AL
Sbjct  799  AVHKLWKWPRNERNPTGKANASIVPQLWQPSNGTLMTNDITDTNPEDAVPCFAL  852



>ref|XP_009803406.1| PREDICTED: topless-related protein 4-like isoform X1 [Nicotiana 
sylvestris]
Length=1137

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+NPTGKA A+ +PQ WQPS G LM N++ D N E  VPC AL
Sbjct  802  AVHKLWKWPRNERNPTGKANASIVPQLWQPSNGTLMTNDITDTNPEDAVPCFAL  855



>ref|XP_008790866.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Phoenix dactylifera]
Length=1138

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            G+Q+LWK    EQNP+GKATA+ +P H QP SG LM N+V D N E+ VPCIAL
Sbjct  793  GVQRLWKWSRREQNPSGKATASVVPHHCQPNSGLLMTNDVPDTNPEEAVPCIAL  846



>emb|CDP10439.1| unnamed protein product [Coffea canephora]
Length=1136

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -3

Query  154  IQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
            + KLWK P N++NPTGKATA  +PQ WQP SG LM N++ D N E  VPC AL
Sbjct  802  VHKLWKWPRNDRNPTGKATAGVVPQLWQPASGILMTNDISDTNPEDAVPCFAL  854



>gb|KDO80172.1| hypothetical protein CISIN_1g001163mg [Citrus sinensis]
Length=1015

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+N TGKAT N  PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  798  AVHKLWKWPRNERNSTGKATTNQAPQLWQPPSGILMTNDISDTNPEDAVPCFAL  851



>gb|KDO80173.1| hypothetical protein CISIN_1g001163mg [Citrus sinensis]
Length=954

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+N TGKAT N  PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  798  AVHKLWKWPRNERNSTGKATTNQAPQLWQPPSGILMTNDISDTNPEDAVPCFAL  851



>emb|CDY25010.1| BnaC02g39980D [Brassica napus]
Length=1112

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LWK   +EQNP+GKAT   +PQ WQP SG LM N+V  VNLE+  PCIAL
Sbjct  778  GIQRLWKWVRSEQNPSGKATTAVVPQQWQPNSGLLMANDVSGVNLEESNPCIAL  831



>ref|XP_006450874.1| hypothetical protein CICLE_v10007287mg [Citrus clementina]
 ref|XP_006475891.1| PREDICTED: topless-related protein 4-like [Citrus sinensis]
 gb|ESR64114.1| hypothetical protein CICLE_v10007287mg [Citrus clementina]
 gb|KDO80171.1| hypothetical protein CISIN_1g001163mg [Citrus sinensis]
Length=1134

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+N TGKAT N  PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  798  AVHKLWKWPRNERNSTGKATTNQAPQLWQPPSGILMTNDISDTNPEDAVPCFAL  851



>gb|KDO80174.1| hypothetical protein CISIN_1g001163mg [Citrus sinensis]
Length=1097

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+N TGKAT N  PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  761  AVHKLWKWPRNERNSTGKATTNQAPQLWQPPSGILMTNDISDTNPEDAVPCFAL  814



>ref|XP_006358294.1| PREDICTED: topless-related protein 4-like isoform X2 [Solanum 
tuberosum]
Length=1133

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P N+++PTGKA A+ +PQ WQP SG LM N+  D N E+VVPC AL
Sbjct  798  AVHKLWKWPRNDRHPTGKANASIVPQLWQPASGTLMTNDTNDTNPEEVVPCFAL  851



>ref|XP_006358293.1| PREDICTED: topless-related protein 4-like isoform X1 [Solanum 
tuberosum]
Length=1134

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P N+++PTGKA A+ +PQ WQP SG LM N+  D N E+VVPC AL
Sbjct  799  AVHKLWKWPRNDRHPTGKANASIVPQLWQPASGTLMTNDTNDTNPEEVVPCFAL  852



>ref|XP_004242769.1| PREDICTED: topless-related protein 4-like isoform X1 [Solanum 
lycopersicum]
Length=1135

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P N+++PTGKA A+ +PQ WQP SG LM N+  D N E+VVPC AL
Sbjct  800  AVHKLWKWPRNDRHPTGKANASIVPQLWQPASGTLMTNDTNDTNPEEVVPCFAL  853



>ref|XP_010323294.1| PREDICTED: topless-related protein 4-like isoform X2 [Solanum 
lycopersicum]
Length=1134

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P N+++PTGKA A+ +PQ WQP SG LM N+  D N E+VVPC AL
Sbjct  799  AVHKLWKWPRNDRHPTGKANASIVPQLWQPASGTLMTNDTNDTNPEEVVPCFAL  852



>emb|CDM82632.1| unnamed protein product [Triticum aestivum]
Length=1130

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  787  AIQRLWKWNRNEQNPSGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  840



>gb|KHG04331.1| Topless-related 2 -like protein [Gossypium arboreum]
Length=1039

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVDVNLEKVVPCIAL  2
            G+QKLWK   +EQN +GKATA+ IPQ WQP SG  M N+V  N E  VPCIAL
Sbjct  700  GVQKLWKWSRSEQNSSGKATASIIPQLWQPNSGLHMTNDVPENSEDAVPCIAL  752



>gb|EMS62858.1| Topless-related protein 2 [Triticum urartu]
Length=1197

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP+GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  824  AIQRLWKWNRNEQNPSGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  877



>dbj|BAJ88304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  266  AIQRLWKWNRNEQNPNGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  319



>dbj|BAJ96033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  787  AIQRLWKWNRNEQNPNGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  840



>dbj|BAJ91882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  427  AIQRLWKWNRNEQNPNGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  480



>dbj|BAJ85297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             IQ+LWK   NEQNP GKATA+ +PQHWQP SG +M N++ +   E+ VPCIAL
Sbjct  787  AIQRLWKWNRNEQNPNGKATASVVPQHWQPNSGLVMANDIGETPPEESVPCIAL  840



>ref|XP_010906011.1| PREDICTED: protein TOPLESS [Elaeis guineensis]
Length=1135

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM NE+ D N E+ VPC AL
Sbjct  795  AIHLLWKWPRNERNSSGKATASVTPQLWQPPSGILMTNEITDANTEEAVPCFAL  848



>ref|XP_008813124.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813126.1| PREDICTED: protein TOPLESS-like isoform X2 [Phoenix dactylifera]
 ref|XP_008813127.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813128.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813129.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
Length=1136

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM NE+ D N E+ VPC AL
Sbjct  796  AIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDANPEEAVPCFAL  849



>ref|XP_009400780.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1138

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNE-VDVNLEKVVPCIAL  2
             I KLWK   NE+NP+GK+ A+  PQ WQPS G LM NE  D N E+V PCIAL
Sbjct  796  AIHKLWKWVRNERNPSGKSNASVAPQLWQPSNGALMTNETTDTNPEEVTPCIAL  849



>ref|XP_008801888.1| PREDICTED: protein TOPLESS-like [Phoenix dactylifera]
Length=1135

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM NE+ D N E+ VPC AL
Sbjct  795  AIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDTNPEEAVPCFAL  848



>ref|XP_010927352.1| PREDICTED: protein TOPLESS [Elaeis guineensis]
Length=1137

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM NE+ D N E+ VPC AL
Sbjct  797  AIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDTNPEEAVPCFAL  850



>gb|KDP30260.1| hypothetical protein JCGZ_17042 [Jatropha curcas]
Length=1130

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++NP GKATAN +PQ WQP SG LM N++ + N E  VPC AL
Sbjct  794  AVHKLWKWQRNDRNPNGKATANVVPQLWQPASGILMTNDISETNPEDAVPCFAL  847



>gb|KFK25571.1| hypothetical protein AALP_AA8G132300 [Arabis alpina]
Length=568

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEVD-VNLEKVVPCIAL  2
            GIQ+LW+   +EQNP GKAT +  P++WQP +G  M N+V  V+LE   PCIAL
Sbjct  258  GIQRLWRWVPHEQNPDGKATTSVFPEYWQPETGFRMANDVSGVHLEGATPCIAL  311



>ref|XP_008788791.1| PREDICTED: topless-related protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=1104

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM N++ D N E+VVPC AL
Sbjct  764  AIHLLWKWPRNERNSSGKATASVSPQLWQPPSGILMTNDITDANPEEVVPCFAL  817



>ref|XP_008788792.1| PREDICTED: topless-related protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=1159

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM N++ D N E+VVPC AL
Sbjct  819  AIHLLWKWPRNERNSSGKATASVSPQLWQPPSGILMTNDITDANPEEVVPCFAL  872



>gb|KEH37175.1| topless-like protein [Medicago truncatula]
Length=972

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPSGR-LMVNEVDVNLEKVVPCIAL  2
            GIQKLWK   NE NPTGKAT   +PQHW P+   LM N+V  N +  +PCI +
Sbjct  661  GIQKLWKWSPNELNPTGKATTRFVPQHWTPNNDILMTNDVLKNCDSAIPCIDI  713



>emb|CAN64663.1| hypothetical protein VITISV_035348 [Vitis vinifera]
Length=1129

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NPTGKA  +  PQ WQP SG LM N++ + NLE  VPC AL
Sbjct  793  AVHKLWKWQRNERNPTGKACTSVSPQLWQPSSGILMTNDISETNLEDAVPCFAL  846



>ref|XP_002265778.1| PREDICTED: topless-related protein 4 [Vitis vinifera]
 emb|CBI36337.3| unnamed protein product [Vitis vinifera]
Length=1138

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NPTGKA  +  PQ WQP SG LM N++ + NLE  VPC AL
Sbjct  802  AVHKLWKWQRNERNPTGKACTSVSPQLWQPSSGILMTNDISETNLEDAVPCFAL  855



>ref|XP_010928279.1| PREDICTED: protein TOPLESS-like [Elaeis guineensis]
 ref|XP_010928280.1| PREDICTED: protein TOPLESS-like [Elaeis guineensis]
Length=1104

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM N++ D N E+ VPC AL
Sbjct  764  AIHLLWKWPRNERNSSGKATASVSPQLWQPPSGILMTNDITDANPEEAVPCFAL  817



>ref|XP_010533140.1| PREDICTED: topless-related protein 4-like [Tarenaya hassleriana]
Length=1131

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N +GKATAN  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  795  AVHKLWKWQKNDRNMSGKATANVTPQLWQPASGILMTNDISDTNPEDTVPCFAL  848



>ref|XP_004165893.1| PREDICTED: LOW QUALITY PROTEIN: protein TOPLESS-like [Cucumis 
sativus]
Length=1139

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   +E+N TGKATAN +PQ WQP SG LM N+V D + E+ VPC AL
Sbjct  798  AIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVADTSSEEAVPCFAL  851



>ref|XP_004152185.1| PREDICTED: protein TOPLESS-like [Cucumis sativus]
Length=1139

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   +E+N TGKATAN +PQ WQP SG LM N+V D + E+ VPC AL
Sbjct  798  AIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVADTSSEEAVPCFAL  851



>gb|KGN52925.1| hypothetical protein Csa_4G006320 [Cucumis sativus]
Length=1085

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   +E+N TGKATAN +PQ WQP SG LM N+V D + E+ VPC AL
Sbjct  744  AIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVADTSSEEAVPCFAL  797



>ref|XP_008454191.1| PREDICTED: protein TOPLESS [Cucumis melo]
 ref|XP_008454192.1| PREDICTED: protein TOPLESS [Cucumis melo]
 ref|XP_008454193.1| PREDICTED: protein TOPLESS [Cucumis melo]
Length=1139

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   +E+N TGKATAN +PQ WQP SG LM N+V D + E+ VPC AL
Sbjct  798  AIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVADTSSEEAVPCFAL  851



>ref|XP_009396205.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396206.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1138

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             I KLWK   NE+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  796  AIHKLWKWTRNERNPSGKSTASVAPQLWQPSNGILMTNETSDNNPEEATACIAL  849



>ref|XP_009407206.1| PREDICTED: protein TOPLESS-like [Musa acuminata subsp. malaccensis]
Length=1136

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM NE+ D N ++VV C AL
Sbjct  795  AIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDTNPDEVVHCFAL  848



>ref|XP_006381123.1| hypothetical protein POPTR_0006s06570g [Populus trichocarpa]
 gb|ERP58920.1| hypothetical protein POPTR_0006s06570g [Populus trichocarpa]
Length=1131

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++NP+GKA A+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  795  AVHKLWKWQRNDRNPSGKANASVPPQLWQPSSGILMTNDISDTNPEDAVPCFAL  848



>ref|XP_002308068.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE91591.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1132

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++NP+GKA A+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  795  AVHKLWKWQRNDRNPSGKANASVPPQLWQPSSGILMTNDISDTNPEDAVPCFAL  848



>ref|XP_010244893.1| PREDICTED: topless-related protein 1-like isoform X3 [Nelumbo 
nucifera]
Length=1136

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+ VD N E  VPC AL
Sbjct  798  AIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVDTNPEDAVPCFAL  851



>ref|XP_010244894.1| PREDICTED: topless-related protein 1-like isoform X4 [Nelumbo 
nucifera]
Length=1135

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+ VD N E  VPC AL
Sbjct  797  AIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVDTNPEDAVPCFAL  850



>ref|XP_010244892.1| PREDICTED: topless-related protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=1161

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+ VD N E  VPC AL
Sbjct  797  AIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVDTNPEDAVPCFAL  850



>ref|XP_010244887.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244888.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244889.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244890.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=1162

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNE-VDVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+ VD N E  VPC AL
Sbjct  798  AIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVDTNPEDAVPCFAL  851



>gb|KCW80034.1| hypothetical protein EUGRSUZ_C013682, partial [Eucalyptus grandis]
Length=436

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   +++N TGKAT + +PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  273  AVHKLWKWQKSDRNLTGKATTSVLPQLWQPPSGILMTNDISDTNPEDAVPCFAL  326



>ref|XP_009395915.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1133

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM NE+ D N E+ V C AL
Sbjct  793  AIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDTNPEEAVHCFAL  846



>ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF35191.1| WD-repeat protein, putative [Ricinus communis]
Length=1134

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N +GKATA+ +PQ WQP SG LM N++ D N E  VPC AL
Sbjct  798  AVHKLWKWQRNDRNLSGKATASVVPQLWQPSSGILMTNDISDTNPEDSVPCFAL  851



>ref|XP_011017799.1| PREDICTED: topless-related protein 4-like isoform X3 [Populus 
euphratica]
Length=1101

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  765  AVHKLWKWQRNDRNLTGKATASVPPQLWQPSSGILMTNDISDTNPEDAVPCFAL  818



>ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44865.1| WD-repeat protein, putative [Ricinus communis]
Length=1115

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   +E+N TGKATAN  PQ WQP SG LM N++ D N E+ VPC AL
Sbjct  775  AIHLLWKWQRSERNSTGKATANVSPQLWQPSSGILMTNDITDTNPEEAVPCFAL  828



>gb|KDP37032.1| hypothetical protein JCGZ_06088 [Jatropha curcas]
Length=1140

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   +E+N +GKATAN  PQ WQP SG LM NE+ D N E+ VPC AL
Sbjct  800  AIHLLWKWQRSERNSSGKATANVSPQLWQPSSGILMTNEITDTNPEEAVPCFAL  853



>ref|XP_007155033.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27027.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1129

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NP+ KAT N +PQ WQP SG LM N++ D N E  V C AL
Sbjct  794  AVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLMTNDISDTNPEDAVSCFAL  847



>gb|EYU21655.1| hypothetical protein MIMGU_mgv1a000483mg [Erythranthe guttata]
Length=1126

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   +E+N TGKATA   PQ WQP SG LM N++ + NLE+ VPC AL
Sbjct  790  AVHKLWKWQRSERNVTGKATAAVPPQLWQPSSGILMTNDISETNLEEAVPCFAL  843



>ref|XP_007155032.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27026.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1128

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NP+ KAT N +PQ WQP SG LM N++ D N E  V C AL
Sbjct  793  AVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLMTNDISDTNPEDAVSCFAL  846



>ref|XP_007155034.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27028.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1131

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NP+ KAT N +PQ WQP SG LM N++ D N E  V C AL
Sbjct  796  AVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLMTNDISDTNPEDAVSCFAL  849



>ref|XP_007155035.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27029.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1132

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NP+ KAT N +PQ WQP SG LM N++ D N E  V C AL
Sbjct  797  AVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLMTNDISDTNPEDAVSCFAL  850



>emb|CDO98161.1| unnamed protein product [Coffea canephora]
Length=1134

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+N TGKAT    PQ WQP SG LM N++ + NLE+ VPC AL
Sbjct  798  AVHKLWKWQRNERNLTGKATTAVPPQLWQPSSGILMTNDISETNLEEAVPCFAL  851



>ref|XP_001768092.1| predicted protein [Physcomitrella patens]
 gb|EDQ67164.1| predicted protein [Physcomitrella patens]
Length=1158

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+N +GKATA+  PQ WQP SG LM N++ + N E  VPCIAL
Sbjct  816  AVHKLWKWQRNERNVSGKATASVTPQLWQPASGILMTNDISETNPEDAVPCIAL  869



>gb|KCW80023.1| hypothetical protein EUGRSUZ_C01361 [Eucalyptus grandis]
Length=905

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             ++KLWK   + QN TGKATA+ +PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  632  AVRKLWKWQKSVQNLTGKATASVLPQLWQPPSGILMTNDISDTNPEDAVPCFAL  685



>ref|XP_009395323.1| PREDICTED: protein TOPLESS-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1129

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             I KLWK    E+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  786  AIHKLWKWTRTERNPSGKSTASVAPQLWQPSNGVLMANETSDSNPEEATACIAL  839



>ref|XP_009395322.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1143

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             I KLWK    E+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  800  AIHKLWKWTRTERNPSGKSTASVAPQLWQPSNGVLMANETSDSNPEEATACIAL  853



>ref|XP_009395318.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395319.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395321.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1145

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             I KLWK    E+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  802  AIHKLWKWTRTERNPSGKSTASVAPQLWQPSNGVLMANETSDSNPEEATACIAL  855



>ref|XP_009396116.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1136

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  794  AVHKLWKWTRNERNPSGKSTASVAPQLWQPSNGILMTNETGDGNPEEATACIAL  847



>ref|XP_009396112.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396113.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396115.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1138

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  796  AVHKLWKWTRNERNPSGKSTASVAPQLWQPSNGILMTNETGDGNPEEATACIAL  849



>ref|XP_011017797.1| PREDICTED: topless-related protein 4-like isoform X1 [Populus 
euphratica]
Length=1126

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  790  AVHKLWKWQRNDRNLTGKATASVPPQLWQPSSGILMTNDISDTNPEDAVPCFAL  843



>ref|XP_011017798.1| PREDICTED: topless-related protein 4-like isoform X2 [Populus 
euphratica]
Length=1125

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  789  AVHKLWKWQRNDRNLTGKATASVPPQLWQPSSGILMTNDISDTNPEDAVPCFAL  842



>ref|XP_007013513.1| Transducin family protein / WD-40 repeat family protein isoform 
8 [Theobroma cacao]
 gb|EOY31132.1| Transducin family protein / WD-40 repeat family protein isoform 
8 [Theobroma cacao]
Length=1055

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  799  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  852



>ref|XP_007013512.1| Transducin family protein / WD-40 repeat family protein isoform 
7 [Theobroma cacao]
 gb|EOY31131.1| Transducin family protein / WD-40 repeat family protein isoform 
7 [Theobroma cacao]
Length=1057

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  801  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  854



>ref|XP_007013509.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
 gb|EOY31128.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
Length=1132

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  796  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  849



>gb|KCW80031.1| hypothetical protein EUGRSUZ_C013682, partial [Eucalyptus grandis]
 gb|KCW80032.1| hypothetical protein EUGRSUZ_C013682, partial [Eucalyptus grandis]
 gb|KCW80033.1| hypothetical protein EUGRSUZ_C013682, partial [Eucalyptus grandis]
Length=614

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   +++N TGKAT + +PQ WQ PSG LM N++ D N E  VPC AL
Sbjct  273  AVHKLWKWQKSDRNLTGKATTSVLPQLWQPPSGILMTNDISDTNPEDAVPCFAL  326



>ref|XP_010250289.1| PREDICTED: protein TOPLESS-like isoform X3 [Nelumbo nucifera]
Length=1135

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N +GKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  797  AIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIADTNPEDAVPCFAL  850



>ref|XP_010250287.1| PREDICTED: protein TOPLESS-like isoform X1 [Nelumbo nucifera]
Length=1137

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N +GKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  799  AIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIADTNPEDAVPCFAL  852



>ref|XP_010250290.1| PREDICTED: protein TOPLESS-like isoform X4 [Nelumbo nucifera]
Length=1134

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N +GKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  796  AIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIADTNPEDAVPCFAL  849



>ref|XP_007013508.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 ref|XP_007013511.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31127.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31130.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
Length=1135

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  799  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  852



>ref|XP_010250288.1| PREDICTED: protein TOPLESS-like isoform X2 [Nelumbo nucifera]
Length=1136

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N +GKATA+  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  798  AIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIADTNPEDAVPCFAL  851



>ref|XP_007013506.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
 gb|EOY31125.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
Length=1137

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  801  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  854



>ref|XP_007204297.1| hypothetical protein PRUPE_ppa000492mg [Prunus persica]
 gb|EMJ05496.1| hypothetical protein PRUPE_ppa000492mg [Prunus persica]
Length=1130

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+N T KATA+++PQ WQP SG LM N++ D N E  VPC AL
Sbjct  796  AVHKLWKWQRNERNTT-KATASTVPQLWQPASGILMTNDISDTNPEDAVPCFAL  848



>ref|XP_007013510.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
 gb|EOY31129.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
Length=1136

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  800  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  853



>ref|XP_010497362.1| PREDICTED: protein TOPLESS [Camelina sativa]
Length=1132

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+V + N E+ VPC AL
Sbjct  791  AIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFAL  844



>ref|XP_010687938.1| PREDICTED: topless-related protein 4 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687939.1| PREDICTED: topless-related protein 4 [Beta vulgaris subsp. vulgaris]
Length=1135

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P N++N TGKATA+  PQ WQP SG LM N++ D N E  V C AL
Sbjct  799  AVHKLWKWPRNDRNMTGKATASIPPQLWQPSSGILMTNDLSDTNPEDAVSCFAL  852



>ref|XP_008242803.1| PREDICTED: topless-related protein 4-like [Prunus mume]
Length=1131

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NE+N T KATA+++PQ WQP SG LM N++ D N E  VPC AL
Sbjct  797  AVHKLWKWQRNERNTT-KATASTVPQLWQPASGILMTNDISDTNPEDAVPCFAL  849



>ref|NP_563981.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_849672.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031050.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031051.1| protein TOPLESS [Arabidopsis thaliana]
 sp|Q94AI7.1|TPL_ARATH RecName: Full=Protein TOPLESS; AltName: Full=WUS-interacting 
protein 1 [Arabidopsis thaliana]
 gb|AAK76687.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13188.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29356.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29357.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29358.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29359.1| protein TOPLESS [Arabidopsis thaliana]
Length=1131

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+V + N E+ VPC AL
Sbjct  790  AIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFAL  843



>gb|AAF82145.1|AC034256_9 Strong similarity to an unknown protein T21F11.18 gi|6730738 
from Arabidopsis thaliana BAC T21F11 gb|AC018849 and contains 
multiple WD PF|00400 domains. ESTs gb|Z34157, gb|AA006273, 
gb|AA605431, gb|W43588, gb|W43605, gb|Z34559, gb|R90037, gb|AI994125 
come from this gene [Arabidopsis thaliana]
Length=1153

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK   NE+N TGKATA+  PQ WQP SG LM N+V + N E+ VPC AL
Sbjct  812  AIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFAL  865



>ref|XP_009405760.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1169

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEV-DVNLEKVVPCIAL  2
             I  LWK P NE+N +GKATA+  PQ WQ PSG LM N++ D N E+ V C AL
Sbjct  828  AIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNDITDTNPEEPVHCFAL  881



>ref|XP_010103710.1| Topless-related protein 4 [Morus notabilis]
 gb|EXB96852.1| Topless-related protein 4 [Morus notabilis]
Length=1130

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N  GKAT + +PQ WQP SG LM N++ D N E+ VPC AL
Sbjct  794  AVHKLWKWQRNDRNVAGKATTSVVPQLWQPTSGILMTNDISDTNPEEAVPCFAL  847



>ref|XP_006649759.1| PREDICTED: protein TOPLESS-like [Oryza brachyantha]
Length=1132

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQ-PSGRLMVNEVDVNLEKVVPCIAL  2
             +  LWK P N++N TGKATA+  PQ WQ PSG LM N++  N E+ V C AL
Sbjct  794  AVHLLWKWPRNDRNSTGKATASVSPQLWQPPSGILMTNDITDNPEEAVHCFAL  846



>ref|XP_008786937.1| PREDICTED: topless-related protein 1-like [Phoenix dactylifera]
Length=438

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             I KLWK    E+NP+GK+TA+ +PQ WQPS G LM NE  D N E+   CIAL
Sbjct  74   AIHKLWKWQRTERNPSGKSTASVVPQLWQPSNGILMTNETNDSNPEEANACIAL  127



>ref|XP_007013507.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
 gb|EOY31126.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
Length=1144

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N TGKAT +  PQ WQP SG LM N++ D N E  VPC AL
Sbjct  808  AVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTNPEDAVPCFAL  861



>ref|XP_008803470.1| PREDICTED: topless-related protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=1136

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQPS-GRLMVNEV-DVNLEKVVPCIAL  2
             I KLWK    E+NP+GK+TA+  PQ WQPS G LM NE  D N E+   CIAL
Sbjct  794  AIHKLWKWQRTERNPSGKSTASVAPQLWQPSNGILMTNETNDSNPEEASACIAL  847



>ref|XP_004287287.1| PREDICTED: topless-related protein 4-like [Fragaria vesca subsp. 
vesca]
Length=1120

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++   GKATA+ +PQ WQP SG LM N++ D N E  VPC AL
Sbjct  784  AVHKLWKWQRNDRTAIGKATASIVPQLWQPASGILMTNDISDTNPEDAVPCFAL  837



>ref|XP_009613434.1| PREDICTED: topless-related protein 4 isoform X1 [Nicotiana tomentosiformis]
Length=1136

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK P NE+N TGKA+    PQ WQP SG LM N++ + N E+ VPC AL
Sbjct  802  AVHKLWKWPRNERNVTGKASTAVPPQLWQPSSGILMTNDISETNPEEAVPCFAL  855



>ref|XP_010656455.1| PREDICTED: topless-related protein 4 isoform X5 [Vitis vinifera]
Length=1096

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N T KATA+  PQ WQP SG LM NE+ D N E  VPC AL
Sbjct  760  AVHKLWKWQRNDRNITTKATASVAPQLWQPSSGILMTNEISDTNPEDAVPCFAL  813



>ref|XP_007023214.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
 gb|EOY25836.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
Length=1129

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   NEQN TGKAT++  PQ WQP SG +M N++ + N E  VPC AL
Sbjct  797  AVHKLWKWQKNEQNLTGKATSSLQPQLWQPSSGIMMTNDIRETNQEDAVPCFAL  850



>ref|XP_002285341.2| PREDICTED: topless-related protein 4 isoform X3 [Vitis vinifera]
 emb|CBI28228.3| unnamed protein product [Vitis vinifera]
Length=1133

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  157  GIQKLWKLPNNEQNPTGKATANSIPQHWQP-SGRLMVNEV-DVNLEKVVPCIAL  2
             + KLWK   N++N T KATA+  PQ WQP SG LM NE+ D N E  VPC AL
Sbjct  797  AVHKLWKWQRNDRNITTKATASVAPQLWQPSSGILMTNEISDTNPEDAVPCFAL  850



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519368764968