BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7805_g1_i1 len=2022 path=[2000:0-1812 3813:1813-2021]

Length=2022
                                                                      Score     E

emb|CAC29040.1|  catechol oxidase                                       581   0.0      Ipomoea batatas [batate]
emb|CAC83610.1|  catechol oxidase                                       580   0.0      Ipomoea batatas [batate]
sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    583   0.0      Ipomoea batatas [batate]
dbj|BAA92317.1|  polyphenol oxidase I                                   578   0.0      Ipomoea batatas [batate]
emb|CAC83609.1|  catechol oxidase                                       571   0.0      Ipomoea batatas [batate]
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    571   0.0      Ipomoea batatas [batate]
gb|AAW78869.1|  polyphenol oxidase                                      570   0.0      Ipomoea batatas [batate]
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    509   5e-169   
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 509   6e-169   
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    493   1e-162   
ref|XP_010100574.1|  Polyphenol oxidase                                 493   1e-162   
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         491   3e-162   
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    491   5e-162   
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             490   2e-161   
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 490   2e-161   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     489   5e-161   Vitis vinifera
gb|ACM43505.1|  polyphenoloxidase                                       489   5e-161   Camellia nitidissima
dbj|BAO79387.1|  polyphenol_oxidase                                     489   5e-161   
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             488   6e-161   Populus trichocarpa [western balsam poplar]
gb|AAU12257.1|  polyphenol oxidase                                      488   9e-161   Populus trichocarpa x Populus deltoides
ref|XP_010100570.1|  Polyphenol oxidase                                 487   2e-160   
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    486   3e-160   
gb|AEL95440.1|  polyphenol oxidase                                      486   6e-160   
emb|CDO99592.1|  unnamed protein product                                482   1e-158   
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    481   2e-158   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    479   1e-157   
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     482   2e-157   
gb|ADR78836.1|  polyphenol oxidase                                      479   2e-157   
emb|CDP06093.1|  unnamed protein product                                478   5e-157   
gb|AHF20575.1|  polyphenol oxidase                                      476   3e-156   
gb|AII22011.1|  polyphenol oxidase-9                                    474   7e-156   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       475   1e-155   Taraxacum officinale [dandelion]
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    474   1e-155   
gb|AAO16865.1|  polyphenol oxidase                                      474   1e-155   Ananas comosus
gb|ADI44162.1|  polyphenol oxidase 1                                    474   2e-155   
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    473   5e-155   
gb|AII22006.1|  polyphenol oxidase-4                                    473   5e-155   
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    473   7e-155   
gb|AEY78528.1|  polyphenol oxidase                                      473   8e-155   
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    472   1e-154   
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       471   2e-154   
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       471   4e-154   
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     470   7e-154   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             469   1e-153   
gb|AEG78292.1|  polyphenol oxidase                                      469   1e-153   
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    469   2e-153   Solanum lycopersicum
emb|CDP22269.1|  unnamed protein product                                463   2e-153   
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    469   2e-153   
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        468   4e-153   
gb|ABY84850.1|  polyphenol oxidase                                      464   8e-153   Cydonia oblonga [wen po]
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             467   1e-152   
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    467   1e-152   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    467   2e-152   
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    466   3e-152   
gb|AEQ30073.1|  polyphenol oxidase                                      466   3e-152   
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    465   3e-152   
gb|AAW65103.1|  polyphenol oxidase                                      464   1e-151   Prunus salicina var. cordata
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    464   1e-151   
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    463   3e-151   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   462   6e-151   
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             462   6e-151   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    462   7e-151   
dbj|BAB64530.1|  polyphenol oxidase                                     462   9e-151   Pyrus pyrifolia [sha li]
gb|AEE61322.1|  polyphenol oxidase I                                    462   1e-150   
gb|AHC98007.1|  PPO                                                     461   1e-150   
gb|AAB22610.1|  polyphenoloxidase                                       461   1e-150   Solanum lycopersicum
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    461   2e-150   Ricinus communis
gb|ADI44161.1|  polyphenol oxidase 2                                    461   3e-150   
gb|ADF59058.2|  polyphenol oxidase IV                                   460   4e-150   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    460   4e-150   
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    459   8e-150   
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             459   1e-149   
gb|ADC92563.1|  polyphenol oxidase                                      459   1e-149   
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    459   2e-149   
gb|AAA02877.1|  propolyphenol oxidase                                   458   2e-149   Solanum tuberosum [potatoes]
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    458   2e-149   Solanum tuberosum [potatoes]
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             458   3e-149   
gb|AFC36521.1|  polyphenol oxidase                                      458   3e-149   
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                458   3e-149   Malus domestica [apple tree]
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    459   4e-149   
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                457   5e-149   
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    457   6e-149   
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    459   2e-148   
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                455   3e-148   
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    456   4e-148   
dbj|BAO79386.1|  polyphenol_oxidase                                     456   4e-148   
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             455   5e-148   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    454   1e-147   
gb|AII22007.1|  polyphenol oxidase-5                                    454   2e-147   
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    454   2e-147   
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    454   2e-147   Vitis vinifera
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             452   4e-147   
gb|EYU34166.1|  hypothetical protein MIMGU_mgv1a003279mg                452   4e-147   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                452   5e-147   
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    452   6e-147   
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       452   8e-147   
gb|AED02598.1|  polyphenol oxidase                                      451   9e-147   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             451   9e-147   
gb|AFL03159.1|  polyphenol oxidase                                      452   1e-146   
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    451   1e-146   
gb|EYU26236.1|  hypothetical protein MIMGU_mgv1a027162mg                451   1e-146   
gb|ABS88291.1|  polyphenol oxidase                                      451   1e-146   Pyrus x bretschneideri [bai li]
gb|AHH92831.1|  polyphenol oxidase                                      451   2e-146   
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    451   2e-146   
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    452   2e-146   
emb|CAA73103.1|  polyphenol oxidase                                     450   3e-146   Nicotiana tabacum [American tobacco]
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    450   3e-146   
dbj|BAA21677.1|  polyphenol oxidase                                     450   6e-146   Malus domestica [apple tree]
dbj|BAA21676.1|  polyphenol oxidase                                     449   6e-146   Malus domestica [apple tree]
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  450   6e-146   
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    449   6e-146   
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             449   7e-146   
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...    449   8e-146   
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             447   8e-146   
emb|CBZ41491.1|  polyphenol oxidase precursor (chloroplast)             450   9e-146   
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    449   1e-145   
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...    447   1e-145   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    448   2e-145   
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...    448   2e-145   
gb|AAU12256.1|  polyphenol oxidase                                      447   2e-145   Populus trichocarpa x Populus deltoides
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    447   3e-145   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    449   4e-145   
gb|ABE96885.1|  polyphenol oxidase                                      444   4e-145   Nicotiana tabacum [American tobacco]
gb|EPS59410.1|  polyphenoloxidase                                       446   5e-145   
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     447   6e-145   
gb|AEO00529.1|  polyphenol oxidase                                      447   7e-145   
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    446   1e-144   
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             446   1e-144   
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             447   1e-144   
gb|AGC54425.1|  polyphenol oxidase 1                                    447   1e-144   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    446   2e-144   
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    446   2e-144   
emb|CAN62983.1|  hypothetical protein VITISV_035472                     446   2e-144   Vitis vinifera
gb|AAP33165.1|  polyphenol oxidase                                      446   2e-144   Medicago sativa [alfalfa]
gb|AAO16863.1|  polyphenol oxidase                                      444   3e-144   Ananas comosus
gb|AHX26182.1|  polyphenol oxidase                                      444   3e-144   
gb|AGK83468.1|  polyphenol oxidase                                      444   5e-144   
ref|XP_003593515.1|  Polyphenol oxidase                                 445   7e-144   
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    444   7e-144   
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            444   9e-144   Ananas comosus
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    444   1e-143   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    443   1e-143   
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    444   1e-143   
gb|ACJ04908.1|  polyphenol oxidase                                      444   1e-143   Camellia sinensis [black tea]
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 444   2e-143   
gb|ACN86310.1|  polyphenol oxidase                                      444   2e-143   Juglans regia
gb|ADF59059.2|  polyphenol oxidase V                                    443   3e-143   
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    442   4e-143   
gb|EPS57764.1|  polyphenol oxidase                                      440   5e-143   
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    442   6e-143   
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             441   6e-143   
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    442   8e-143   
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    441   2e-142   
ref|XP_007025703.1|  Larreatricin hydroxylase                           441   2e-142   
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    441   2e-142   
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    438   4e-142   
gb|ACN38060.1|  polyphenol oxidase                                      440   5e-142   Camellia sinensis [black tea]
gb|ACF17425.1|  polyphenol oxidase                                      440   5e-142   Camellia sinensis [black tea]
gb|ABR10907.1|  polyphenol oxidase                                      439   5e-142   Camellia sinensis [black tea]
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    439   7e-142   Solanum lycopersicum
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg                439   9e-142   
gb|ADP89908.1|  polyphenol oxidase                                      435   1e-141   
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...    438   1e-141   
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    439   2e-141   Vicia faba [broad bean]
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    438   2e-141   
gb|ABR24120.1|  polyphenol oxidase                                      438   2e-141   Camellia sinensis [black tea]
gb|ABR57236.1|  polyphenol oxidase                                      438   2e-141   Camellia sinensis [black tea]
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    438   2e-141   
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    437   3e-141   
gb|ABF19601.1|  polyphenol oxidase                                      437   4e-141   Camellia ptilophylla
gb|ACR82078.1|  polyphenol oxidase                                      437   7e-141   Camellia sinensis [black tea]
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    434   1e-140   
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    436   1e-140   
gb|ABF19602.1|  polyphenol oxidase                                      436   1e-140   Camellia sinensis var. assamica [Assam tea]
dbj|BAM15849.1|  hypothetical protein                                   436   2e-140   
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...    434   3e-140   
ref|XP_010100566.1|  Polyphenol oxidase                                 434   3e-140   
gb|AGU01537.1|  polyphenol oxidase                                      436   4e-140   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             434   4e-140   
gb|AAK13242.1|  polyphenol oxidase                                      434   1e-139   Trifolium pratense [peavine clover]
gb|ACM09905.1|  polyphenol oxidase 1/4                                  433   2e-139   Trifolium pratense [peavine clover]
sp|Q6UIL3.1|LAHY_LARTR  RecName: Full=(+)-larreatricin hydroxylas...    432   2e-139   Larrea tridentata
gb|ACJ04909.1|  polyphenol oxidase                                      433   2e-139   
gb|AAK13244.1|  polyphenol oxidase                                      433   2e-139   Trifolium pratense [peavine clover]
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    431   3e-139   
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                432   4e-139   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    432   4e-139   
gb|AFH00996.1|  polyphenol oxidase II                                   432   5e-139   
gb|ABR57235.1|  polyphenol oxidase                                      432   7e-139   Camellia sinensis [black tea]
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...    431   7e-139   
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          430   9e-139   Sorghum bicolor [broomcorn]
gb|AHX26181.1|  polyphenol oxidase                                      430   1e-138   
gb|ACB12082.1|  polyphenol oxidase                                      430   1e-138   Triticum monococcum subsp. aegilopoides [wild einkorn]
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       430   1e-138   Populus trichocarpa x Populus deltoides
gb|ABK62804.1|  polyphenol oxidase                                      430   2e-138   Triticum aestivum [Canadian hard winter wheat]
gb|ABX09994.1|  chloroplast polyphenol oxidase                          430   2e-138   Taraxacum officinale [dandelion]
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             429   3e-138   Populus trichocarpa [western balsam poplar]
gb|ACB12081.1|  polyphenol oxidase                                      429   3e-138   Triticum urartu
gb|EYU34165.1|  hypothetical protein MIMGU_mgv1a003246mg                430   3e-138   
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    430   3e-138   
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    429   4e-138   
gb|ACB12083.1|  polyphenol oxidase                                      429   4e-138   Triticum monococcum [einkorn wheat]
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    430   4e-138   
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    430   5e-138   
gb|AES87890.2|  polyphenoloxidase                                       429   5e-138   
dbj|BAM15848.1|  hypothetical protein                                   428   2e-137   
gb|ABM68052.1|  polyphenol oxidase                                      428   2e-137   Trifolium pratense [peavine clover]
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    428   2e-137   
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    426   2e-137   
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    427   5e-137   
gb|AHX26180.1|  polyphenol oxidase                                      425   5e-137   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    427   6e-137   
gb|ACJ70698.1|  polyphenol oxidase                                      426   6e-137   Cynara cardunculus var. scolymus [artichoke]
ref|XP_010100568.1|  Polyphenol oxidase                                 426   7e-137   
gb|AAC28935.1|  polyphenol oxidase precursor                            426   8e-137   Prunus armeniaca
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                426   9e-137   
gb|AGK88243.1|  polyphenol oxidase                                      425   1e-136   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    425   2e-136   
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          423   3e-136   Sorghum bicolor [broomcorn]
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             425   3e-136   
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      425   4e-136   
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    424   6e-136   
gb|ACN78382.1|  polyphenol oxidase                                      419   6e-136   Solanum quitoense [lulo]
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            422   9e-136   Populus tremuloides
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...    424   9e-136   
gb|AAA85122.1|  polyphenol oxidase                                      423   1e-135   Solanum tuberosum [potatoes]
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    423   1e-135   
gb|ADG85002.1|  polyphenol oxidase                                      422   2e-135   
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    422   2e-135   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...    421   4e-135   
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    422   4e-135   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...    421   6e-135   
gb|AEY79826.1|  polyphenol oxidase                                      420   7e-135   
ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    421   8e-135   
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     421   1e-134   
gb|ABG23057.1|  polyphenol oxidase                                      420   1e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870          420   2e-134   Sorghum bicolor [broomcorn]
gb|ABG23062.1|  polyphenol oxidase                                      419   2e-134   Oryza sativa Indica Group [Indian rice]
gb|ABG23075.1|  polyphenol oxidase                                      419   2e-134   Oryza rufipogon [common wild rice]
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    420   2e-134   
gb|ABG23073.1|  polyphenol oxidase                                      419   2e-134   Oryza rufipogon [common wild rice]
gb|ACS15319.1|  polyphenol oxidase                                      419   2e-134   Oryza sativa [red rice]
ref|XP_010100567.1|  Polyphenol oxidase                                 420   3e-134   
dbj|BAA08234.1|  polyphenol oxidase                                     419   3e-134   Phytolacca americana [common pokeberry]
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    419   4e-134   
gb|ACS15330.1|  polyphenol oxidase                                      418   5e-134   Oryza sativa [red rice]
gb|AHN09736.1|  aurone synthase                                         419   5e-134   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                418   5e-134   
gb|ABG23042.1|  polyphenol oxidase                                      418   5e-134   Oryza sativa Indica Group [Indian rice]
gb|ABG23092.1|  polyphenol oxidase                                      418   6e-134   Oryza rufipogon [common wild rice]
gb|ABG23097.1|  polyphenol oxidase                                      418   6e-134   Oryza barthii [African wild rice]
gb|ABG23077.1|  polyphenol oxidase                                      418   7e-134   Oryza nivara
gb|ABG23059.1|  polyphenol oxidase                                      418   7e-134   Oryza sativa Indica Group [Indian rice]
gb|ABG23061.1|  polyphenol oxidase                                      418   7e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...    418   8e-134   
gb|ACS15326.1|  polyphenol oxidase                                      417   8e-134   Oryza sativa [red rice]
gb|ABG23083.1|  polyphenol oxidase                                      418   8e-134   Oryza rufipogon [common wild rice]
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             419   9e-134   
gb|ABG23093.1|  polyphenol oxidase                                      417   9e-134   Oryza rufipogon [common wild rice]
gb|AAS00454.1|  polyphenol oxidase                                      416   9e-134   Triticum aestivum [Canadian hard winter wheat]
gb|ABG23086.1|  polyphenol oxidase                                      417   9e-134   Oryza rufipogon [common wild rice]
gb|ACS15337.1|  polyphenol oxidase                                      417   1e-133   Oryza sativa [red rice]
gb|ABK62803.1|  polyphenol oxidase                                      417   1e-133   Triticum aestivum [Canadian hard winter wheat]
gb|ABG23065.1|  polyphenol oxidase                                      417   1e-133   Oryza nivara
gb|ABM68051.1|  polyphenol oxidase                                      418   1e-133   Trifolium pratense [peavine clover]
gb|ABG23098.1|  polyphenol oxidase                                      417   1e-133   Oryza officinalis
dbj|BAH36897.1|  polyphenol oxidase                                     417   1e-133   Triticum aestivum [Canadian hard winter wheat]
gb|ABG23085.1|  polyphenol oxidase                                      417   1e-133   Oryza rufipogon [common wild rice]
gb|ACB12086.1|  polyphenol oxidase                                      417   1e-133   Aegilops tauschii
gb|AEM45933.1|  polyphenol oxidase                                      416   2e-133   
gb|AEM45934.1|  polyphenol oxidase                                      416   2e-133   
gb|ABG23070.1|  polyphenol oxidase                                      417   2e-133   Oryza rufipogon [common wild rice]
gb|ABI96939.1|  putative polyphenol oxidase                             412   2e-133   Neillia thyrsiflora
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...    417   2e-133   
gb|ABG23084.1|  polyphenol oxidase                                      416   2e-133   Oryza rufipogon [common wild rice]
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    417   3e-133   
ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    416   5e-133   
gb|ABG23067.1|  polyphenol oxidase                                      416   6e-133   Oryza rufipogon [common wild rice]
gb|AHZ59731.1|  copper-containing polyphenol oxidase                    414   7e-133   
gb|AEY79825.1|  polyphenol oxidase                                      414   8e-133   
emb|CAH66802.1|  H0215F08.13                                            415   9e-133   
gb|AGC55012.1|  polyphenoloxidase                                       416   1e-132   
gb|AEM45931.1|  polyphenol oxidase                                      414   1e-132   
gb|ABG23066.1|  polyphenol oxidase                                      414   1e-132   
gb|ABG23072.1|  polyphenol oxidase                                      414   2e-132   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg                415   2e-132   
gb|AAW58109.2|  polyphenol oxidase                                      415   2e-132   
gb|ABG23081.1|  polyphenol oxidase                                      414   2e-132   
gb|ABI96948.1|  putative polyphenol oxidase                             410   2e-132   
gb|ABA62017.1|  polyphenol oxidase                                      414   2e-132   
dbj|BAJ10871.1|  polyphenol oxidase                                     414   2e-132   
dbj|BAH36895.1|  polyphenol oxidase                                     412   4e-132   
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg                414   5e-132   
gb|ABI96934.1|  putative polyphenol oxidase                             409   6e-132   
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    414   7e-132   
ref|XP_007211883.1|  hypothetical protein PRUPE_ppa003608mg             412   1e-131   
gb|AEY79824.1|  polyphenol oxidase                                      412   1e-131   
gb|ACB12084.1|  polyphenol oxidase                                      412   1e-131   
gb|ABI96937.1|  putative polyphenol oxidase                             407   1e-131   
gb|ABK62801.1|  polyphenol oxidase                                      412   2e-131   
gb|ABG23087.1|  polyphenol oxidase                                      411   3e-131   
gb|ABI96942.1|  putative polyphenol oxidase                             407   3e-131   
emb|CDP06099.1|  unnamed protein product                                411   3e-131   
gb|ABI96950.1|  putative polyphenol oxidase                             407   3e-131   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    411   5e-131   
ref|XP_007025704.1|  Larreatricin hydroxylase                           409   5e-131   
gb|ABI96935.1|  putative polyphenol oxidase                             406   5e-131   
gb|ABI96945.1|  putative polyphenol oxidase                             406   6e-131   
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                411   7e-131   
gb|ABN13632.1|  polyphenol oxidase                                      409   1e-130   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    407   1e-130   
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    409   1e-130   
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    410   1e-130   
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    410   1e-130   
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    412   2e-130   
dbj|BAM15846.1|  hypothetical protein                                   410   2e-130   
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    408   2e-130   
gb|ABK62802.1|  polyphenol oxidase                                      409   2e-130   
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    409   3e-130   
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)             409   3e-130   
dbj|BAJ10872.1|  polyphenol oxidase                                     408   4e-130   
dbj|BAK03848.1|  predicted protein                                      408   4e-130   
gb|AEM45935.1|  polyphenol oxidase                                      407   4e-130   
gb|ABI96951.1|  putative polyphenol oxidase                             404   5e-130   
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...    408   6e-130   
gb|AFS28698.1|  putative polyphenol oxidase                             404   7e-130   
gb|AFS28697.1|  putative polyphenol oxidase                             404   9e-130   
gb|ABI96927.1|  putative polyphenol oxidase                             403   9e-130   
ref|XP_010100571.1|  Polyphenol oxidase                                 406   1e-129   
gb|ABI96944.1|  putative polyphenol oxidase                             403   1e-129   
gb|ABI96946.1|  putative polyphenol oxidase                             402   1e-129   
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          407   1e-129   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...    407   2e-129   
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          407   2e-129   
gb|AEM45936.1|  polyphenol oxidase                                      406   2e-129   
gb|ABG23045.1|  polyphenol oxidase                                      406   2e-129   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          407   2e-129   
gb|ABI96926.1|  putative polyphenol oxidase                             402   2e-129   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          407   2e-129   
gb|AAT75166.1|  polyphenol oxidase                                      406   2e-129   
pdb|1BT1|A  Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet...    398   2e-129   
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       406   2e-129   
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             406   3e-129   
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       407   3e-129   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg                405   4e-129   
gb|AFW59500.1|  putative polyphenol oxidase family protein              407   4e-129   
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    406   5e-129   
gb|ABI96938.1|  putative polyphenol oxidase                             401   5e-129   
ref|NP_001053932.1|  Os04g0624500                                       405   8e-129   
gb|ABI96930.1|  putative polyphenol oxidase                             400   1e-128   
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     405   1e-128   
ref|XP_010100565.1|  Polyphenol oxidase                                 405   1e-128   
gb|ABI96949.1|  putative polyphenol oxidase                             400   2e-128   
gb|ABI96928.1|  putative polyphenol oxidase                             400   2e-128   
gb|ABG23047.1|  polyphenol oxidase                                      403   2e-128   
gb|ABG23060.1|  polyphenol oxidase                                      403   3e-128   
ref|XP_011076536.1|  PREDICTED: polyphenol oxidase I, chloroplast...    404   3e-128   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    402   4e-128   
gb|ABI96941.1|  putative polyphenol oxidase                             398   6e-128   
ref|XP_010686564.1|  PREDICTED: polyphenol oxidase, chloroplastic...    404   6e-128   
emb|CAE03510.2|  OSJNBa0053K19.18                                       402   8e-128   
dbj|BAA08235.1|  polyphenol oxidase                                     398   1e-127   
ref|XP_003593517.1|  Polyphenol oxidase A1                              402   2e-127   
ref|XP_003605693.1|  Polyphenol oxidase A1                              397   2e-127   
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                401   3e-127   
gb|AAK13243.1|  polyphenol oxidase                                      402   3e-127   
dbj|BAP82256.1|  polyphenol oxidase                                     400   4e-127   
gb|AAA85121.1|  polyphenol oxidase                                      401   4e-127   
dbj|BAP82254.1|  polyphenol oxidase                                     400   5e-127   
gb|ABI96929.1|  putative polyphenol oxidase                             395   6e-127   
dbj|BAP82255.1|  polyphenol oxidase                                     400   6e-127   
gb|ABG23090.1|  polyphenol oxidase                                      399   7e-127   
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    401   1e-126   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...    400   1e-126   
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    398   5e-126   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...    398   6e-126   
gb|KHN07285.1|  Polyphenol oxidase A1, chloroplastic                    397   7e-126   
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    395   9e-126   
ref|XP_009352971.1|  PREDICTED: polyphenol oxidase, chloroplastic...    391   9e-126   
gb|ABI96940.1|  putative polyphenol oxidase                             392   1e-125   
dbj|BAP82257.1|  polyphenol oxidase                                     396   1e-125   
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                397   1e-125   
gb|ABI96947.1|  putative polyphenol oxidase                             392   1e-125   
ref|NP_001149552.1|  polyphenol oxidase II                              392   4e-125   
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    396   4e-125   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    394   8e-125   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    396   8e-125   
gb|ABI96931.1|  putative polyphenol oxidase                             390   1e-124   
gb|EEC78048.1|  hypothetical protein OsI_17489                          394   1e-124   
gb|ABI96925.1|  putative polyphenol oxidase                             390   1e-124   
gb|ABI96932.1|  putative polyphenol oxidase                             389   2e-124   
gb|ABI96933.1|  putative polyphenol oxidase                             389   3e-124   
gb|ABI96943.1|  putative polyphenol oxidase                             389   3e-124   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg             394   5e-124   
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    394   5e-124   
gb|KHN08552.1|  Polyphenol oxidase A1, chloroplastic                    391   8e-124   
gb|AGT28745.1|  aurone synthase                                         392   1e-123   
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    391   9e-123   
gb|AGT28746.1|  aurone synthase                                         390   1e-122   
gb|AAC69365.1|  polyphenol oxidase                                      381   3e-122   
dbj|BAP82258.1|  polyphenol oxidase                                     387   5e-122   
gb|EYU34162.1|  hypothetical protein MIMGU_mgv1a005754mg                383   8e-122   
dbj|BAB89047.1|  putative polyphenol oxidase                            386   1e-121   
gb|ABI96936.1|  putative polyphenol oxidase                             381   3e-121   
pir||S34786  catechol oxidase (EC 1.10.3.1) precursor - potato (f...    382   4e-120
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    382   5e-120   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...    382   1e-119   
gb|ACS15325.1|  polyphenol oxidase                                      375   3e-119   
emb|CDP06098.1|  unnamed protein product                                380   4e-119   
gb|ACS15320.1|  polyphenol oxidase                                      373   1e-118   
gb|AAT06525.1|  polyphenol oxidase                                      372   2e-118   
emb|CCD61125.1|  polyphenol oxidase precursor (chloroplast)             379   3e-118   
gb|EEC71623.1|  hypothetical protein OsI_04042                          376   5e-118   
dbj|BAH36896.1|  polyphenol oxidase                                     375   7e-118   
gb|EMT09670.1|  Polyphenol oxidase, chloroplastic                       371   9e-118   
ref|XP_006646401.1|  PREDICTED: polyphenol oxidase, chloroplastic...    376   1e-117   
gb|AII22009.1|  polyphenol oxidase-7                                    376   2e-117   
ref|XP_006370119.1|  hypothetical protein POPTR_0001s39670g             370   2e-117   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220          375   3e-117   
gb|ABJ90144.1|  polyphenol oxidase                                      374   1e-116   
gb|EMT06707.1|  Polyphenol oxidase A1, chloroplastic                    372   2e-116   
ref|XP_006644832.1|  PREDICTED: polyphenol oxidase, chloroplastic...    371   1e-115   
gb|ACR61398.1|  polyphenol oxidase                                      370   3e-115   
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          370   3e-115   
ref|XP_002458568.1|  hypothetical protein SORBIDRAFT_03g035850          367   3e-114   
gb|AII22005.1|  polyphenol oxidase-3                                    367   1e-113   
gb|AII22008.1|  polyphenol oxidase-6                                    367   2e-113   
dbj|BAJ90144.1|  predicted protein                                      363   6e-113   
gb|AII22010.1|  polyphenol oxidase-8                                    364   7e-113   
emb|CAH66801.1|  H0215F08.12                                            360   1e-112   
gb|AFN53703.1|  putative phenol oxidase                                 357   3e-112   
pdb|2P3X|A  Chain A, Crystal Structure Of Grenache (Vitis Vinifer...    353   4e-112   
gb|AFW87458.1|  putative polyphenol oxidase family protein              359   2e-111   
ref|XP_010263628.1|  PREDICTED: aureusidin synthase-like                359   3e-111   
ref|NP_001147867.1|  polyphenol oxidase precursor                       359   3e-111   
ref|XP_010645091.1|  PREDICTED: aureusidin synthase-like                358   1e-110   
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...    358   2e-110   
gb|ADF59060.1|  polyphenol oxidase 6 precursor                          357   5e-110   
gb|AFH00998.1|  polyphenol oxidase III                                  357   5e-110   
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...    354   3e-109   
gb|EEC78047.1|  hypothetical protein OsI_17486                          351   4e-109   
ref|XP_004965883.1|  PREDICTED: aureusidin synthase-like                354   4e-109   
ref|XP_003567194.1|  PREDICTED: polyphenol oxidase I, chloroplast...    353   4e-109   
ref|XP_008809956.1|  PREDICTED: polyphenol oxidase I, chloroplast...    352   2e-108   
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684             352   2e-108   
ref|XP_010254790.1|  PREDICTED: aureusidin synthase-like                352   2e-108   
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...    352   3e-108   
ref|XP_010910148.1|  PREDICTED: polyphenol oxidase, chloroplastic...    352   3e-108   
gb|ACB12087.1|  truncated polyphenol oxidase                            347   4e-108   
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154             351   5e-108   
emb|CCD61126.1|  polyphenol oxidase precursor (chloroplast)             352   6e-108   
ref|XP_002306113.2|  hypothetical protein POPTR_0004s16380g             350   1e-107   
emb|CDM84541.1|  unnamed protein product                                348   3e-107   
ref|XP_010921586.1|  PREDICTED: polyphenol oxidase, chloroplastic...    348   6e-107   
ref|XP_010680712.1|  PREDICTED: polyphenol oxidase, chloroplastic...    347   2e-106   
gb|ACJ76786.1|  tyrosinase polyphenol oxidase                           346   3e-106   
gb|EMS49817.1|  Polyphenol oxidase, chloroplastic                       345   5e-106   
gb|AEH41425.1|  polyphenol oxidase-like protein                         344   2e-105   
ref|XP_004292030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    342   4e-105   
ref|XP_006384507.1|  hypothetical protein POPTR_0004s16380g             343   6e-105   
ref|XP_004295273.1|  PREDICTED: polyphenol oxidase, chloroplastic...    342   7e-105   
ref|XP_006377743.1|  hypothetical protein POPTR_0011s10940g             337   9e-105   
ref|XP_011037508.1|  PREDICTED: aureusidin synthase-like                342   1e-104   
ref|XP_009380367.1|  PREDICTED: polyphenol oxidase I, chloroplast...    341   2e-104   
ref|XP_006583808.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    341   4e-104   
ref|XP_002980680.1|  hypothetical protein SELMODRAFT_178277             340   6e-104   
ref|XP_007042162.1|  Uncharacterized protein isoform 4                  338   7e-104   
gb|ACR61399.1|  polyphenol oxidase                                      339   7e-104   
ref|XP_002976938.1|  hypothetical protein SELMODRAFT_175858             340   7e-104   
ref|XP_002990877.1|  hypothetical protein SELMODRAFT_132508             339   9e-104   
ref|XP_002980542.1|  hypothetical protein SELMODRAFT_178281             340   1e-103   
ref|XP_007042160.1|  Uncharacterized protein isoform 2                  338   2e-103   
emb|CCE45701.1|  polyphenol oxidase precursor (chloroplast)             340   2e-103   
ref|XP_010110268.1|  Polyphenol oxidase A1                              338   2e-103   
dbj|BAM15847.1|  hypothetical protein                                   339   3e-103   
ref|XP_006583806.1|  PREDICTED: polyphenol oxidase II, chloroplas...    338   4e-103   
ref|XP_006583805.1|  PREDICTED: polyphenol oxidase II, chloroplas...    338   4e-103   
ref|XP_007042159.1|  Uncharacterized protein isoform 1                  338   7e-103   
ref|XP_002982245.1|  hypothetical protein SELMODRAFT_116300             337   1e-102   
ref|XP_002976812.1|  hypothetical protein SELMODRAFT_175861             336   2e-102   
ref|XP_007025707.1|  Larreatricin hydroxylase isoform 2                 327   5e-101   
gb|AAK29783.1|  polyphenol oxidase                                      322   7e-100   
ref|XP_010099507.1|  Polyphenol oxidase                                 326   1e-99    
ref|XP_002969567.1|  hypothetical protein SELMODRAFT_170754             328   2e-99    
ref|XP_010110269.1|  Polyphenol oxidase                                 327   3e-99    
ref|XP_010099505.1|  Polyphenol oxidase                                 325   3e-99    
sp|P43310.1|PPO_SPIOL  RecName: Full=Polyphenol oxidase, chloropl...    328   6e-99    
emb|CAA62377.1|  polyphenol oxidase                                     328   1e-98    
emb|CBI37659.3|  unnamed protein product                                324   1e-98    
ref|XP_009388016.1|  PREDICTED: polyphenol oxidase, chloroplastic...    324   1e-97    
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213             323   2e-97    
ref|XP_009388329.1|  PREDICTED: polyphenol oxidase, chloroplastic...    321   2e-96    
ref|XP_002970835.1|  hypothetical protein SELMODRAFT_94153              319   2e-96    
gb|KHN07287.1|  Polyphenol oxidase A1, chloroplastic                    313   2e-95    
gb|ABG23091.1|  polyphenol oxidase                                      314   3e-94    
gb|ABG23046.1|  polyphenol oxidase                                      314   3e-94    
ref|XP_008809953.1|  PREDICTED: polyphenol oxidase, chloroplastic...    310   3e-94    
gb|ACB45128.1|  polyphenol oxidase                                      304   2e-93    
ref|XP_002990879.1|  hypothetical protein SELMODRAFT_11755              308   3e-93    
gb|ABG23096.1|  polyphenol oxidase                                      311   6e-93    



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/501 (61%), Positives = 367/501 (73%), Gaps = 12/501 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQE  504
             IH P +SKC  P  D+P +A I   CCPP+ T+ V+ Y++P   P  M+ R       +E
Sbjct  3     IHAPEISKCVVPPKDLPPDA-IVDNCCPPLATN-VIPYKVPRTSPSAMKIRPAIHRMDKE  60

Query  505   YINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFH  684
             YI K+E A+  MK L    P +F QQA +HCAYCNGGY Q  +P +EIQVHNSWLFFPFH
Sbjct  61    YIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFH  120

Query  685   RWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAI  864
             RWYLYFYE+ILGKLI DPTF LP+WNWD  +GM +P  F +  S LYD NRN ++LP  +
Sbjct  121   RWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRNQSHLP-LV  179

Query  865   VDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP-SPGQGSVEG  1041
             +DL YAG D  ++D+E I+ NL  +Y+SMVTN GT ELF+GK Y  G  P + G GS+E 
Sbjct  180   MDLGYAGTDNDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIEN  239

Query  1042  IPHTPVHRWVGDSVDQP-NGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KD  1209
             IPHTPVHRWVGD   +  NGEDMGNFYSAGRD LFY HH+NVDRMW IWQ+L G    +D
Sbjct  240   IPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRD  299

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGAA  1386
             FTD  WL+A+F+FYDEN+Q VRV   D +DN  +GY YE+++LP          K TG A
Sbjct  300   FTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLA  359

Query  1387  AASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDV  1566
             A S APFVTDVFP+TLDKVVQVKV RPK SR+K EKE EEE+L I GIEVA+DQYA+FDV
Sbjct  360   ARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFDV  419

Query  1567  YLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
             YLND D+P+ GK+KA+YAG FAHLPHK   S   +TS+ LGLNEPLEDLGAEDDD VLVT
Sbjct  420   YLNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDAVLVT  479

Query  1747  LAPQVGGGVVDVDSIRIEYST  1809
             LAP+VGGGVV V++I+I Y +
Sbjct  480   LAPKVGGGVVTVENIKIVYGS  500



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/501 (61%), Positives = 367/501 (73%), Gaps = 12/501 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQE  504
             IH P +SKC  P  D+P +A I   CCPP+ T+ V+ Y++P   P  M+ R       +E
Sbjct  3     IHAPEISKCVVPPKDLPPDA-IVDNCCPPLATN-VIPYKVPKTSPSAMKIRPAIHRMDKE  60

Query  505   YINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFH  684
             YI K+E A+  MK L    P +F QQA +HCAYCNGGY Q  +P +EIQVHNSWLFFPFH
Sbjct  61    YIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFH  120

Query  685   RWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAI  864
             RWYLYFYE+ILGKLI DPTF LP+WNWD  +GM +P  F +  S LYD NRN ++LP  +
Sbjct  121   RWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRNQSHLP-LV  179

Query  865   VDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP-SPGQGSVEG  1041
             +DL YAG D  ++D+E I+ NL  +Y+SMVTN GT ELF+GK Y  G  P + G GS+E 
Sbjct  180   MDLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIEN  239

Query  1042  IPHTPVHRWVGDSVDQP-NGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KD  1209
             IPHTPVHRWVGD   +  NGEDMGNFYSAGRD LFY HH+NVDRMW IWQ+L G    +D
Sbjct  240   IPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRD  299

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGAA  1386
             FTD  WL+A+F+FYDEN+Q VRV   D +DN  +GY YE+++LP          K TG A
Sbjct  300   FTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLA  359

Query  1387  AASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDV  1566
             A S APFVTDVFP+TLDKVVQVKV RPK SR+K EKE EEE+L I GIEVA+DQYA+FDV
Sbjct  360   ARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFDV  419

Query  1567  YLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
             YLND D+P+ GK+KA+YAG FAHLPHK   S   +TS+ LGLNEPLEDLGAEDDD VLVT
Sbjct  420   YLNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDPVLVT  479

Query  1747  LAPQVGGGVVDVDSIRIEYST  1809
             LAP+VGGGVV V++I+I Y +
Sbjct  480   LAPKVGGGVVTVENIKIVYGS  500



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/559 (58%), Positives = 396/559 (71%), Gaps = 26/559 (5%)
 Frame = +1

Query  160   LRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIH  339
              +VSC A N ++             +DRR+VLLGLGGL G A+L   P+A A      IH
Sbjct  47    FKVSCNAPNGDSQPK----------LDRRDVLLGLGGLAGAASLINNPLAFAE----PIH  92

Query  340   YPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQEYI  510
              P +SKC  P  D+P +A I   CCPP+ T+ V+ Y++P   P  M+ R       +EYI
Sbjct  93    APEISKCVVPPKDLPPDA-IVDNCCPPLATN-VIPYKVPKTSPSAMKIRPAIHRMDKEYI  150

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+E A+  MK L    P +F QQA +HCAYCNGGY Q  +P +EIQVHNSWLFFPFHRW
Sbjct  151   AKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRW  210

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI DPTF LP+WNWD  +GM +P  F +  S LYD NRN ++LP  ++D
Sbjct  211   YLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRNQSHLP-LVMD  269

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP-SPGQGSVEGIP  1047
             L YAG D  ++D+E I+ NL  +Y+SMVTN GT ELF+GK Y  G  P + G GS+E IP
Sbjct  270   LGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENIP  329

Query  1048  HTPVHRWVGDSVDQP-NGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KDFT  1215
             HTPVHRWVGD   +  NGEDMGNFYSAGRD LFY HH+NVDRMW IWQ+L G    +DFT
Sbjct  330   HTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRDFT  389

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGAAAA  1392
             D  WL+A+F+FYDEN+Q VRV   D +DN  +GY YE+++LP          K TG AA 
Sbjct  390   DSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLAAR  449

Query  1393  SNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYL  1572
             S APFVTDVFP+TLDKVVQVKV RPK SR+K EKE EEE+L I GIEVA+DQYA+FDVYL
Sbjct  450   SKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFDVYL  509

Query  1573  NDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLA  1752
             ND D+P+ GK+KA+YAG FAHLPHK   S   +TS+ LGLNEPLEDLGAEDDD VLVTLA
Sbjct  510   NDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDAVLVTLA  569

Query  1753  PQVGGGVVDVDSIRIEYST  1809
             P+VGGGVV V++I+I Y +
Sbjct  570   PKVGGGVVTVENIKIVYGS  588



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/559 (58%), Positives = 397/559 (71%), Gaps = 26/559 (5%)
 Frame = +1

Query  160   LRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIH  339
              +VSC A N ++             +DRR+VLLGLGGL G A+L   P+A A      IH
Sbjct  47    FKVSCNAPNGDSQPK----------LDRRDVLLGLGGLAGAASLINNPLAFAE----PIH  92

Query  340   YPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQEYI  510
              P +SKC  P  D+P +A I   CCPP+ T+ V+ Y++P   P  M+ R       +EYI
Sbjct  93    APEISKCVVPPKDLPPDA-IVDNCCPPLATN-VIPYKVPKTSPSAMKIRPAIHRMDKEYI  150

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+E A+  MK L    P +F QQA +HCAYCNGGY Q  +P +EIQVHNSWLFFPFHRW
Sbjct  151   AKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRW  210

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI DPTF LP+WNWD  +GM +P  F +  S LYD NRN ++LP  ++D
Sbjct  211   YLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRNQSHLP-LVMD  269

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP-SPGQGSVEGIP  1047
             L YAG D  ++D+E I+ NL  +Y+SMVTN GT ELF+GK Y  G  P + G GS+E IP
Sbjct  270   LGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENIP  329

Query  1048  HTPVHRWVGDSVDQP-NGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KDFT  1215
             HTPVHRWVGD   +  NGEDMGNFYSAGRD LFY HH+NVDRMW IWQ+L G    +DFT
Sbjct  330   HTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRDFT  389

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGAAAA  1392
             D  WL+A+F+FYDEN+Q VRV   D +DN  +GY YE+++LP          K TG AA 
Sbjct  390   DSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLAAR  449

Query  1393  SNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYL  1572
             S APFVTDVFP+TLDKVVQVKV RPK SR+K EKE EEE+L I+GIEVA+DQYA+FDVYL
Sbjct  450   SKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIEGIEVAIDQYAKFDVYL  509

Query  1573  NDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLA  1752
             ND D+P+ GK+KA+YAG FAHLPHK   S   +TS+ LGLNEPLEDLGAEDDD VLVTLA
Sbjct  510   NDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDAVLVTLA  569

Query  1753  PQVGGGVVDVDSIRIEYST  1809
             P+VGGGVV V++I+I Y +
Sbjct  570   PKVGGGVVTVENIKIVYGS  588



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/497 (59%), Positives = 364/497 (73%), Gaps = 8/497 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             I  P +SKC  P +D+P  A +   CCPPV ++ ++DY+IP    M+ R  A    ++ I
Sbjct  3     IQAPEISKCVVPPADLPPGA-VVDNCCPPVASN-IVDYKIPVVTTMKVRPAAHTMDKDAI  60

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+  A+  M+ L    P +F QQA +HCAYCNGGY Q  FP +EIQVHNSWLFFPFHRW
Sbjct  61    AKFARAVDLMRALPGDDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHRW  120

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI DP+F LP+WNWDN  GM +P+    +TSSLYD+NRN ++LPP +VD
Sbjct  121   YLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPVVVD  180

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L Y G D  ++D++ I +NL  +Y+ MVTN GT ELF+GK Y  G  PSPG GS+E  PH
Sbjct  181   LGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIETSPH  240

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG---GKDFTDD  1221
              P+HRWVGD  +  N EDMGNFYSAGRD  FY HH+NVDRMW IWQ+L G    +D+TD 
Sbjct  241   IPIHRWVGDPRNT-NNEDMGNFYSAGRDIAFYCHHSNVDRMWAIWQQLAGKPRKRDYTDS  299

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA-AAASN  1398
              WLNA+FLFYDEN Q V+V   D +DN  MGY Y  + LPWL SKP P+K  G  A+ S 
Sbjct  300   DWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASKSK  359

Query  1399  APFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
             APFV  VFPVTLDKVVQVKV+RPK SR+  EKE EEE+L+I+G+EV +D+YA+FDVYLND
Sbjct  360   APFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIEGVEVEIDKYAKFDVYLND  419

Query  1579  SDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
             SD P GGKDKA+YAG  AHLPHK +     +T++ LGLNEPLEDLGAEDDDT+LV LAP+
Sbjct  420   SDDPSGGKDKAEYAGSSAHLPHKHKGMKKIRTTLSLGLNEPLEDLGAEDDDTILVALAPK  479

Query  1759  VGGGVVDVDSIRIEYST  1809
             VGGGVV VD+I++ Y +
Sbjct  480   VGGGVVSVDNIKVVYGS  496



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/484 (60%), Positives = 355/484 (73%), Gaps = 8/484 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             I  P +SKC  P +D+P  A +   CCPPV ++ ++DY++P    M+ R  A    ++ I
Sbjct  3     IQAPEISKCVVPPADLPPGA-VVDNCCPPVASN-IVDYKLPAVTTMKVRPAAHTMDKDAI  60

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+  A+  MK L    P +F QQA +HCAYCNGGY Q  FP +EIQVHNSWLFFPFHRW
Sbjct  61    AKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHRW  120

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI DP+F LP+WNWDN  GM +P+    +TSSLYD+NRN ++LPP +VD
Sbjct  121   YLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPVVVD  180

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L Y G D  ++D++ I +NL  +Y+ MVTN GT ELF+GK Y  G  PSPG GS+E  PH
Sbjct  181   LGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIETSPH  240

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG---GKDFTDD  1221
              P+HRWVGD  +  N EDMGNFYSAGRD  FY HH+NVDRMW IWQ+L G    +D+TD 
Sbjct  241   IPIHRWVGDPRNT-NNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAGKPRKRDYTDS  299

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA-AAASN  1398
              WLNA+FLFYDEN Q V+V   D +DN  MGY Y  + LPWL SKP P+K  G  A+ S 
Sbjct  300   DWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASKSK  359

Query  1399  APFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
             APFV  VFPVTLDKVVQVKV+RPK SR+  EKE EEE+L+I GIEV +D+YA+FDVYLND
Sbjct  360   APFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIVGIEVEIDKYAKFDVYLND  419

Query  1579  SDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
             SD P GGKDKA+YAG FAHLPHK +     +T++ LGLNEPLEDLGAEDDDT+LVTLAP+
Sbjct  420   SDDPSGGKDKAEYAGSFAHLPHKHKGMKKIRTTLSLGLNEPLEDLGAEDDDTILVTLAPK  479

Query  1759  VGGG  1770
             VGGG
Sbjct  480   VGGG  483



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/562 (58%), Positives = 397/562 (71%), Gaps = 32/562 (6%)
 Frame = +1

Query  160   LRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIH  339
              +VSC A N ++             +DRR+VLLGLGGL G A+L   P+A A      IH
Sbjct  47    FKVSCNAPNGDSQPK----------LDRRDVLLGLGGLAGAASLINNPLAFAE----PIH  92

Query  340   YPNVSKCHYP-SDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQEYI  510
              P +SKC  P  D+P +A I  +CCPP+ T+ V+  ++P   P  M+ R       +EYI
Sbjct  93    APEISKCVVPPKDLPPDA-IVDSCCPPLATN-VIPSKVPKTSPSAMKIRPAIHRMDKEYI  150

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+E A+  MK L    P +F QQA +HCAYCNGGY Q  +P +EIQVHNSWLFFPFHRW
Sbjct  151   AKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRW  210

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLINDPTF LP+WNWD  +GM +P  F +  S LYD NR  ++LP  ++D
Sbjct  211   YLYFYERILGKLINDPTFGLPFWNWDTPAGMLIPQYFRNQNSPLYDENRLQSHLP-LVMD  269

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP-SPGQGSVEGIP  1047
             L YAG D  ++D+E I+ NL  +Y+SMVTN GT ELF+GK Y  G  P + G GS+E IP
Sbjct  270   LGYAGTDTDVTDDERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENIP  329

Query  1048  HTPVHRWVGDSVDQP---NGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK----  1206
             HTPVHRWVGD   QP   NGEDMGNFYSAGRD LFY HH+NVDRMW IWQ+L GGK    
Sbjct  330   HTPVHRWVGDV--QPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQL-GGKGRRR  386

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGA  1383
             DFTD  WL+A+F+FYDEN+Q  RV   D +DN  +GY YE+++LP          K TG 
Sbjct  387   DFTDSDWLDATFIFYDENKQAYRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGL  446

Query  1384  AAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
             AA S APFVTDVFP+TLDKVVQVKV RPK SR+K EKE EEE+L I+GIEVA+DQYA+FD
Sbjct  447   AARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIEGIEVAIDQYAKFD  506

Query  1564  VYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLV  1743
             VYLND D+P+ GK+KA+YAG FAHLPHK   S   +TS+ LGLNEPLEDLGAEDDD VLV
Sbjct  507   VYLNDEDEPEAGKEKAEYAGSFAHLPHKHTGSKKIRTSLSLGLNEPLEDLGAEDDDAVLV  566

Query  1744  TLAPQVGGGVVDVDSIRIEYST  1809
             TLAP+VGGG V V++I+I Y +
Sbjct  567   TLAPKVGGGDVTVENIKIVYGS  588



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   509 bits (1311),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 296/566 (52%), Positives = 374/566 (66%), Gaps = 23/566 (4%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             +K +  R  +SCKA  P+N  DD+  +P S   DRRNVL+GLGG YG   L   P A A 
Sbjct  46    RKPSARRSTISCKA--PSN--DDSEQNPLSAKFDRRNVLIGLGGFYGAVGLRSDPFALAD  101

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFA  495
                  I  P+++KC   +D+PA A  T  CCPP PT  +LD+++P+   P+R R  A  A
Sbjct  102   ----PISAPDLTKCGK-ADLPAGAKAT-NCCPP-PTTKILDFKLPSSNSPLRVRPAAHLA  154

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
              ++YI KY  A+  MK L    P SF QQAN+HCAYC+G + Q GFP  E+QVHNSWLFF
Sbjct  155   DKDYIAKYAKAIELMKALPADDPRSFMQQANVHCAYCDGAHHQVGFPNLELQVHNSWLFF  214

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHR+YLYFYEKILG LI DPTFALPYWNWD   GM MP +F    S LYDANRNP + P
Sbjct  215   PFHRYYLYFYEKILGSLIGDPTFALPYWNWDAPDGMKMPALFADPKSPLYDANRNPKHAP  274

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             P +VDL+Y G+D   S+++ ++ NL  +YR MV+NG + +LF+G  Y  G    PG GS+
Sbjct  275   PMLVDLDYNGEDPTTSNQDQLSSNLTIMYRQMVSNGKSAKLFLGSDYRAGDDADPGAGSL  334

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--D  1209
             E IPH PVH W GD+  QPN EDMGNFYSA RDP+F+SHH+NVDRMW +W+ L G +  D
Sbjct  335   ENIPHGPVHVWCGDN-RQPNLEDMGNFYSAARDPIFFSHHSNVDRMWTVWKTLGGSRRID  393

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAA  1389
             FTD  WLNA+FLFYDEN Q VRV  KDC++   +GY Y+   +PWLKSKP+P KT    A
Sbjct  394   FTDPDWLNAAFLFYDENAQAVRVKVKDCLETTNLGYVYQDVDIPWLKSKPTPRKTAKKVA  453

Query  1390  --------ASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                     A+  P     FPV LDKVV+  V RPK  R+K EKE+EEEVLVI+GIE   D
Sbjct  454   KAFGKVAHAAEIPRPIVQFPVKLDKVVRTLVKRPKQKRSKKEKEEEEEVLVIEGIEFERD  513

Query  1546  QYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
              + +FDVY+ND        D+ ++AG F ++PHK +     KT +RLG+ + LEDL  ED
Sbjct  514   AFVKFDVYINDEHDSLSSPDQTEFAGSFVNVPHKHKHHKKMKTRLRLGITDLLEDLVCED  573

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD +LVTLAP+  G  V V +I+IE+
Sbjct  574   DDEILVTLAPKYAGEQVTVGNIKIEF  599



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   509 bits (1311),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 285/573 (50%), Positives = 379/573 (66%), Gaps = 28/573 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKA----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPI  306
             ++RN     VSCKA     NP+ ST +      ++  DRR+VL+GLGGLYG  +L G P+
Sbjct  37    RRRNFVSRAVSCKATNGDQNPSPSTKNVEECSLNKF-DRRDVLVGLGGLYGATSLNG-PL  94

Query  307   ASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQI-PTGGPMRKRVP  483
             A AA V      P+V+KC   +D+PA A     CCPP P+  +LD+++ P+  P R R  
Sbjct  95    AFAAPVSP----PDVTKCGK-ADLPAGAKPV-NCCPP-PSTKILDFKLRPSNSPPRIRPA  147

Query  484   AQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
                  +EY+ K+  AL  MK L    P SF QQAN+HCAYC+G Y Q GFP  ++QVHNS
Sbjct  148   VHLVDKEYLAKFSRALELMKALPEDDPRSFTQQANVHCAYCDGAYHQIGFPDLDLQVHNS  207

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHR+YLYF+EKILGKLI+DPTFA+P+WNWD+ +GM MP ++ +  S LYD NRNP
Sbjct  208   WLFFPFHRYYLYFFEKILGKLIDDPTFAIPFWNWDSPAGMQMPAIYANPNSPLYDENRNP  267

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+ PP ++DL++ G +   S  + I+ NL  +YR MV+NG T +LF+G  Y  G  P PG
Sbjct  268   NHQPPTLLDLDFNGTEESSSTRDQISSNLNVMYRQMVSNGKTAKLFLGNAYRAGDQPDPG  327

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              GS+E IPH P+H W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW +W K LGG
Sbjct  328   AGSLENIPHGPIHIWCGDN-RQPNLEDMGNFYSAGRDPIFYAHHSNVDRMWSVW-KTLGG  385

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYs---------slpwlk  1350
             K  DFTD  WL++ FLFYDEN   VRV  +DC+D   MGYDY+           +   + 
Sbjct  386   KRTDFTDSDWLDSGFLFYDENANLVRVKVRDCLDTRKMGYDYQKVDIPWLRAKPTPRRIA  445

Query  1351  skpspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDG  1527
             SK + +     AA +    ++DV FP+ L+ VV ++VSRPK SR+KAEKE+EEEVLVI+ 
Sbjct  446   SKVARALGVAHAAETKKKVLSDVQFPLVLNNVVSLEVSRPKKSRSKAEKEEEEEVLVIEN  505

Query  1528  IEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLE  1707
             IE   DQ  +FDVY+ND D    G D  ++AG F ++PHK    +   T +RLGL + LE
Sbjct  506   IEFDRDQLVKFDVYINDEDDTTIGPDNTEFAGSFINVPHKHRHGNKMTTCLRLGLTDLLE  565

Query  1708  DLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             +LGAEDDD V+VTL P+ G G+  +  ++I+++
Sbjct  566   ELGAEDDDGVVVTLVPKSGKGLAKIGGVKIDFA  598



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   493 bits (1269),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 329/506 (65%), Gaps = 18/506 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++S+C   +D+PA A  T  CCPPV +  ++D+++P    P R R  A  A++EYI
Sbjct  100   ISPPDLSECGA-ADLPAGAQPTN-CCPPV-SSKIIDFKLPPKNSPFRIRPAAHLASKEYI  156

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  MK L    P SF QQA++HCAYCNG Y Q GFP  ++QVHNSWLF P+HR+
Sbjct  157   AKYKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRY  216

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYEKILGKLINDPTFALP+WNWD  +GM MP MF    S LYD  R+P + PP ++D
Sbjct  217   YLYFYEKILGKLINDPTFALPFWNWDAPAGMQMPAMFADPNSPLYDKLRDPKHQPPKLID  276

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   D   ++E+ I+ NL  +YR +V++  TT LFMG  Y  G  P PGQG++E IPH
Sbjct  277   LDYTXTDSNDTNEQQISSNLSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPH  336

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-KDFTDDSW  1227
              PVH W GD   QPN EDMGNFYSA RDP+F+SHH+NVDRMW +W+ L G  KDFTD  W
Sbjct  337   GPVHIWCGDRT-QPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDW  395

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYs-----------slpwlkskpspskT  1374
             L+A F+FYDEN Q VRV  +DC+D   + Y Y+                  K        
Sbjct  396   LDAGFVFYDENAQLVRVKVRDCLDPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHK  455

Query  1375  TGAAAASNAPFVTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
             +G A A+  P  +  VFP+ LD  ++V V RP+ SR+K EKE EEEVLVI GIE+  D++
Sbjct  456   SGVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKF  515

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
              +FD+++ND D P    D  ++AG F ++PH+        T +R+G++E LEDL AEDDD
Sbjct  516   VKFDIFINDEDDPVSRPDNTEFAGSFVNVPHQHSHGKKKNTILRIGISELLEDLEAEDDD  575

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEYST  1809
             +V+VTL P+ G  V+ +  I IE ++
Sbjct  576   SVVVTLVPRYGADVITIGGIEIELAS  601



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   493 bits (1268),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 270/563 (48%), Positives = 363/563 (64%), Gaps = 27/563 (5%)
 Frame = +1

Query  163   RVSCKANNPNNS---TDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVA  333
             ++SCKANN ++    T+D A+   +  +DRRNVLLGLG L G+A L   P A AA     
Sbjct  48    KLSCKANNNDHDLSPTNDVASKTSNPKLDRRNVLLGLGSLGGLAGLRADPFAFAA----P  103

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYI  510
             I  P++S+C   +D P+  D    CCPPV +  ++D+++P   G +R R PA      Y 
Sbjct  104   ISAPDISQCG-AADFPSGVDPV-NCCPPV-SAQIVDFKLPASPGKLRVRPPAHAVDSAYT  160

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K++ A   MK L  S P SF QQA+IHCAYC+G Y+Q GFP  +IQVHNSWLFFPFHRW
Sbjct  161   AKFKRAFELMKALPDSDPRSFKQQASIHCAYCDGAYEQIGFPDLDIQVHNSWLFFPFHRW  220

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKLI+DP+FA+P+WNWD  +GM +P ++    S LYD  RN ++ PP++VD
Sbjct  221   YLYFFERILGKLIDDPSFAMPFWNWDAPAGMQIPAIYADRRSPLYDQFRNKSHQPPSLVD  280

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L++ G+D  +S++  I  NL  +YR MV+N  +  +FMG+ Y  G    PG GS E IPH
Sbjct  281   LDFNGRDESISNQAQIQSNLTIMYRQMVSNSRSARIFMGESYRAGDETDPGPGSFENIPH  340

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
               VH W GD+  QP GEDMGNFYSAGRDP+F++HH+N+DRMW +W K LGGK  DFTD  
Sbjct  341   GSVHTWTGDNT-QPYGEDMGNFYSAGRDPIFFAHHSNIDRMWNVW-KTLGGKRQDFTDPD  398

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss----------lpwlkskpspskT  1374
             WL+ASFLFYDEN Q VRV  +D +D+  +GY Y+                +         
Sbjct  399   WLDASFLFYDENSQLVRVKVRDSLDSRKLGYTYQDIELPWLNTRPRPRRVVDKVKRAFAR  458

Query  1375  TGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
              G A A   P  T  FP+TLDK V+  VSRPK SR+K EK++ +EVLVI GIE   +   
Sbjct  459   IGVARADEYP--TANFPLTLDKPVKTLVSRPKKSRSKKEKDEADEVLVIQGIEFDRNVPI  516

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             +FDV++ND D    G DK+++AG F  +PH+ +S +   T +RL + E LEDL AE+D+ 
Sbjct  517   KFDVFINDEDDALTGPDKSEFAGSFVSVPHRHKSKTKMNTGLRLDITELLEDLDAEEDEN  576

Query  1735  VLVTLAPQVGGGVVDVDSIRIEY  1803
             V+VTL P+VG G V +  ++IE+
Sbjct  577   VVVTLVPKVGIGHVSIGGLKIEF  599



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   491 bits (1265),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 279/576 (48%), Positives = 371/576 (64%), Gaps = 38/576 (7%)
 Frame = +1

Query  139   KKRNQ---TRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIA  309
             KKR+    +RL +SCKA N +                RR++L+GLGGLYG   +   P A
Sbjct  33    KKRSNPHISRLPISCKATNADQQNPTT----------RRDILIGLGGLYGATTIGNDPSA  82

Query  310   SAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPA  486
              A  V      P+++KC   +D+PANA +   CCPP P+  +LD+++P+   P+R R  A
Sbjct  83    LAKPVAA----PDLTKCG-KADLPANA-LPTNCCPP-PSTKILDFKLPSSNNPLRIRPAA  135

Query  487   QFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
               A   Y+ KY  A+  MK L    P SF QQA++HCAYC+G Y Q GFP  ++Q+HNSW
Sbjct  136   HLADDAYVAKYSKAIELMKALPDDDPRSFKQQASVHCAYCDGAYHQVGFPDLDLQIHNSW  195

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             LFFPFHR+YLYFYEKILGKLI+DP FALP+WNWD+ +GM +P MF+S  S+LYD  R+ +
Sbjct  196   LFFPFHRYYLYFYEKILGKLIDDPNFALPFWNWDSPAGMQIPKMFVSPKSALYDQYRHKS  255

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             + PP ++DL+Y+G +   S++E ++ NL  +YR MV+NG T +LF G  Y +G  P PG 
Sbjct  256   HQPPTLIDLDYSGTESSYSNQEQLSSNLTIMYRQMVSNGKTAKLFFGNAYRSGDEPDPGA  315

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK  1206
             GS+E IPH PVH W GDS  QPN EDMGNFYSAGRDP+F++HHANVDRMW +W+ L G K
Sbjct  316   GSIENIPHGPVHLWTGDST-QPNKEDMGNFYSAGRDPIFFAHHANVDRMWTLWKTLGGSK  374

Query  1207  --DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Ysslpwl  1347
               + TD  WLNA FLFYDEN   VRV  KD +D   +GY Y+                  
Sbjct  375   RTEITDTDWLNAEFLFYDENANLVRVKVKDSIDYKKLGYGYQDVEVPWLKSKPTPRKVIK  434

Query  1348  kskpspskTTGAAAASNAPFVTDV--FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
             K   +      A AA N   +T +  FP+ L+KV +V V RPK SR+K EKE+EEEVL++
Sbjct  435   KIVKALHHGQEAKAAENNQNLTPISSFPLVLEKVTRVLVKRPKKSRSKKEKEEEEEVLLV  494

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSVRLGLNE  1698
             DGIE A +   +FDVY+ND D     K DK+++AG F  +PH     +  KT +RLGL +
Sbjct  495   DGIEFARESAVKFDVYINDEDDSTSTKPDKSEFAGSFVSVPHTHSHGTKMKTCLRLGLTD  554

Query  1699  PLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
              LEDLGAEDDD VLVTL P+ G G+V +D+I+++++
Sbjct  555   LLEDLGAEDDDEVLVTLVPRYGIGLVKIDAIKVDFA  590



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   491 bits (1265),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 284/571 (50%), Positives = 358/571 (63%), Gaps = 34/571 (6%)
 Frame = +1

Query  163   RVSCKA----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDV  330
             RVSCKA     NP+N+++DA   P  R +DRRNVLLGLGGLYGVA L   P A A  V  
Sbjct  47    RVSCKATNSDQNPSNNSNDA--QPLGRTLDRRNVLLGLGGLYGVAGLGTDPFAFAKPVAP  104

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
                 P+VSKC   +D+P  A  T  CCPPV    + D+Q+P    +R R  A    + YI
Sbjct  105   ----PDVSKCG-AADLPTGAQKT-DCCPPV-AKKIFDFQLPPQSKLRVRPAAHAVDKAYI  157

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P SF QQANIHCAYC+G Y Q GFP  E+Q+H SWLFFPFHR+
Sbjct  158   EKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHGSWLFFPFHRY  217

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLINDP+FALP+WNWD  +GM +P MF +  S LYD  RN N+ PP ++D
Sbjct  218   YLYFYERILGKLINDPSFALPFWNWDAPAGMQLPGMFANPKSPLYDKFRNANHQPPKLID  277

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             LNY  KD  +SDE  I  NL  +YR MV+N    +LF G  Y  G  PSPG G++E  PH
Sbjct  278   LNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYRAGDEPSPGGGAIETTPH  337

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD+  QPN EDMGNFYSAGRDP+F+SHH+NVDR+W +W K LGGK  DFTD  
Sbjct  338   GPVHIWTGDNT-QPNLEDMGNFYSAGRDPIFFSHHSNVDRLWTVW-KTLGGKREDFTDSD  395

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Ysslpwlkskpspsk  1371
             WL++ FLFYDEN   VRV  +DC+D+  +GY Y+                    K    K
Sbjct  396   WLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWTSHKPTPRRVKDVIKKFGHK  455

Query  1372  TTGAAAASNAPFVTDV-----FPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIE  1533
               G   A  A   T V     FP++L   + + V+RP +  R++ EK+ EEEVLVI GIE
Sbjct  456   LHGHGVAHAAETSTKVVAGAHFPISLASKISIAVARPQQKKRSQKEKDHEEEVLVIQGIE  515

Query  1534  VAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDL  1713
                D   +FDVY+ND D    G DK+++AG F  +PH+ + +    T +RLGL + LEDL
Sbjct  516   FDRDVGVKFDVYVNDEDDLPSGPDKSEFAGSFVSVPHRHKHTKKINTVLRLGLTDLLEDL  575

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
              AEDD+T++VTL P+ G   V +  I+IE++
Sbjct  576   DAEDDETIVVTLIPRYGAEHVKIGGIKIEFA  606



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   490 bits (1261),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 331/507 (65%), Gaps = 24/507 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYI  510
             I  P+V+KC  P D+P  A I   CCPP  T  +LD+++P+    +R R  A    ++YI
Sbjct  100   IMAPDVTKCG-PPDLPKGA-IRTNCCPPSTT-KILDFKLPSPSNTLRIRPAAHLVDKDYI  156

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+  A+  MK L    P SF  QA++HCAYC+G Y  FGF   ++QVH SWLF PFHR+
Sbjct  157   TKFNKAIKLMKALPNDDPRSFKNQADVHCAYCDGAYDHFGFQDLDLQVHASWLFLPFHRY  216

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             Y+YF+EKI GKLINDPTFA+P+WNWD   GMT+P+++ +  SSLYDA R+  + PP++VD
Sbjct  217   YIYFFEKICGKLINDPTFAIPFWNWDAPDGMTIPDIYTNKKSSLYDALRDAKHQPPSLVD  276

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G D  L+  +  + NL  +YR MV++  T  LFMG  Y  G   +PG GS+E IPH
Sbjct  277   LDYNGIDENLNPSKQTSTNLKILYRQMVSSSKTASLFMGNPYRAGDEANPGAGSIENIPH  336

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDS  1224
              PVH W GD   Q NGE MGNFYSA RDP+FY+HHAN+DRMW IW K LGG  KDFTD  
Sbjct  337   DPVHIWTGDR-SQRNGEHMGNFYSAARDPIFYAHHANIDRMWSIW-KTLGGRRKDFTDKD  394

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Ysslpwlkskpspsk  1371
             WL++SF FYDEN   VRV  +DC+D+  +GY Y+            S     + K    K
Sbjct  395   WLDSSFSFYDENADLVRVKVRDCLDSKNLGYVYQDVKIPWLKTKPSSKSEKSRRKAEHHK  454

Query  1372  TTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
                A A  + PF  DVFP +LDKV++V V RPK SR K +KE+EEE+LV++GIEV  D +
Sbjct  455   RDVARADEHIPFAKDVFPASLDKVIKVLVPRPKKSRNKKQKEEEEEILVVEGIEVKSDLF  514

Query  1552  ARFDVYLNDSDQPDGGK---DKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
              +FDV++ND D  DG +   DK ++AG F ++PH  +     KT +RLG++E LEDLGAE
Sbjct  515   VKFDVFVNDED--DGVRATADKTEFAGSFVNVPHNHKHGKNVKTRLRLGISELLEDLGAE  572

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DDD VLVTL P+  GG V +  I+IE+
Sbjct  573   DDDNVLVTLVPKTKGGEVSIKRIKIEH  599



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   490 bits (1262),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 283/564 (50%), Positives = 363/564 (64%), Gaps = 26/564 (5%)
 Frame = +1

Query  166   VSCKA----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVA  333
             VSCKA     NP  S+ +   S      DRR+VL+GLGGLYG A+L+    + AA     
Sbjct  60    VSCKATNGDQNPTPSSKNTEKSFLLNKFDRRDVLIGLGGLYGAASLSQDQFSLAA----P  115

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYI  510
             I  P + KC   +++P  AD T  CCPPV +  +LD++ P+   P+R R  A      YI
Sbjct  116   ISAPELEKCGN-AELPEGADPT-NCCPPV-SRKILDFKPPSSNSPLRVRPAAHLVDDAYI  172

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSWLFFPFHR+
Sbjct  173   AKYSRAIELMKALPADDPRNFMQQANVHCAYCDGAYDQVGFPDLELQVHNSWLFFPFHRY  232

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKILGKLI+DPTFALP+WNWD+ +GM MP M+ +T S LY+  RN ++ PP +VD
Sbjct  233   YLYFFEKILGKLIDDPTFALPFWNWDSPAGMKMPAMYGNTKSPLYNELRNRSHYPPTLVD  292

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G D   +  + +  NL  +YR MV+NG T  LF+G  +  G  P  G GSVE +PH
Sbjct  293   LDYNGTDETTTTRDQLTSNLRIMYRQMVSNGKTARLFLGGPFRAGDEPYQGFGSVENVPH  352

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDSW  1227
              PVH W GD+  QPNGEDMG FYSA RDP+FY+HH+NVDRMW +W+ L    KDFTD  W
Sbjct  353   GPVHVWCGDNT-QPNGEDMGTFYSAARDPIFYAHHSNVDRMWAVWKTLGKKRKDFTDPDW  411

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGA---  1383
             LNASFLFYDEN   VRV  +DC+DN ++GY Y+     +        K      +G    
Sbjct  412   LNASFLFYDENANLVRVKVRDCLDNRSLGYVYQDVDIPWLKTKPTPRKLRKKVASGGPGI  471

Query  1384  --AAASNAPFV--TDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
               AA  N   V  ++ FP+ LDK+V V V RPK SR+K EKE EEE+LVID IE+  D +
Sbjct  472   ALAAEINKKKVIASNQFPIVLDKIVSVDVPRPKKSRSKKEKEDEEEILVIDQIELDGDSF  531

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
             A+FDVY+ND D    G D  ++AG F ++PHK +     +T +RLGL + LEDLGAEDDD
Sbjct  532   AKFDVYVNDEDDLTIGPDNTEFAGSFVNVPHKHKGGKKMRTCLRLGLTDLLEDLGAEDDD  591

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEY  1803
             +V+VTL P+ G G V + SI+IE+
Sbjct  592   SVVVTLVPKYGKGNVKIGSIKIEF  615



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   489 bits (1258),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 328/506 (65%), Gaps = 18/506 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++S+C   +D+PA A  T  CCPPV +  ++D+++P    P+R R  A  A++EYI
Sbjct  100   ISPPDLSECGA-ADLPAGAQPTN-CCPPV-SSKIIDFKLPPKNSPLRIRPAAHLASKEYI  156

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  MK L    P SF QQA++HCAYCNG Y Q GFP  ++QVHNSWLF P+HR+
Sbjct  157   AKYKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRY  216

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYEKILGKLINDPTFALP+WNWD  +GM MP MF    S LYD  R+  + PP ++D
Sbjct  217   YLYFYEKILGKLINDPTFALPFWNWDAPAGMQMPAMFADPNSPLYDKLRDAKHQPPKLID  276

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   D   ++E+ I+ NL  +YR +V++  TT LFMG  Y  G  P PGQG++E IPH
Sbjct  277   LDYNLTDSNDTNEQQISSNLSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPH  336

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-KDFTDDSW  1227
              PVH W GD   QPN EDMGNFYSA RDP+F+SHH+NVDRMW +W+ L G  KDFTD  W
Sbjct  337   GPVHIWCGDRT-QPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDW  395

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYs-----------slpwlkskpspskT  1374
             L+A F+FYDEN Q VRV  +DC+D   + Y Y                   K        
Sbjct  396   LDAGFVFYDENAQLVRVKVRDCLDPTKLRYAYHEVDIPWLKSRPKPRQILKKVVNKLKHK  455

Query  1375  TGAAAASNAPFVTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
             +G A A+  P  +  VFP+ LD  ++V V RP+ SR+K EKE EEEVLVI GIE+  D++
Sbjct  456   SGVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKF  515

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
              +FD+++ND D P    D  ++AG F ++PH+        T +R+G++E LEDL AEDDD
Sbjct  516   VKFDIFINDEDDPVSRPDNTEFAGSFVNVPHQHSHGKKKNTILRIGISELLEDLEAEDDD  575

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEYST  1809
             +V+VTL P+ G  V+ +  I IE ++
Sbjct  576   SVVVTLVPRYGADVITIGGIEIELAS  601



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   489 bits (1258),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 277/572 (48%), Positives = 360/572 (63%), Gaps = 28/572 (5%)
 Frame = +1

Query  142   KRNQTRLRVSCKA-----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPI  306
             + ++   ++SCK+      NPN ++ +     G   +DRRNVLLGLGG      LA  P+
Sbjct  36    RNHRHSFKISCKSTDNDNQNPNTTSKNEETFLGK--LDRRNVLLGLGGYSAATILAN-PL  92

Query  307   ASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPA  486
             A AA V      P+++KC   +D+PA A  T  CCPP  T  ++D++ P    MR R  A
Sbjct  93    AFAAPVTA----PDLAKCG-AADLPAGAKPT-NCCPPKAT-KIIDFKFPQSNSMRVRPAA  145

Query  487   QFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
               A  EYI K+  AL  MK L    P SF QQAN+HCAYC+G Y Q GFP  ++QVHNSW
Sbjct  146   HLADAEYIAKFSKALALMKALPEDDPRSFKQQANVHCAYCDGAYHQVGFPELDLQVHNSW  205

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             LFFPFHR+YL+F+E+ILG LI DP+FA+P+WNWD+ +GM MP M+    S LYD  R+  
Sbjct  206   LFFPFHRYYLHFFERILGSLIGDPSFAIPFWNWDSPNGMQMPAMYADPNSPLYDVLRDAK  265

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             + PP +VDL+Y G D   +D +  + NL  +YR MV++  +  LF+G  Y  G  P PG 
Sbjct  266   HQPPTLVDLDYNGSDPTTTDAQQKSSNLNVMYRQMVSSSKSARLFLGSPYRAGDEPDPGA  325

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK  1206
             GS+E IPH PVH W GD   QPN EDMGNFYSAGRD +FY HHANVDRMW IW K LGGK
Sbjct  326   GSLENIPHGPVHIWCGDRT-QPNLEDMGNFYSAGRDSIFYGHHANVDRMWSIW-KTLGGK  383

Query  1207  --DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlksk  1356
               DFTD  WLNA F+FYDEN Q VRV  KDC+D+  +GY Y+            P +   
Sbjct  384   RQDFTDPDWLNAGFVFYDENAQLVRVKVKDCLDSRKLGYVYQDVDIPWLNTRPAPRVSKL  443

Query  1357  pspskTTGAAAASNAP-FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIE  1533
                    G A A++ P    +VFP  LDK V+V V RPK SR+K EK+ EEE+LVI+GIE
Sbjct  444   SRKINKAGVAMAADTPSTAAEVFPKKLDKAVRVMVPRPKKSRSKKEKDDEEEILVIEGIE  503

Query  1534  VAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDL  1713
             V  D + +FDV++ND  +   G +  ++AG F ++PHK +     KT +RLG+ E LE+L
Sbjct  504   VDRDVFVKFDVFINDEHEVVIGPNDTEFAGSFVNVPHKHKHGKKIKTILRLGITELLEEL  563

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             GAEDDD VLVTL P+ G G V +  ++IE+ +
Sbjct  564   GAEDDDGVLVTLVPKNGAGAVTIGGVKIEFDS  595



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   489 bits (1258),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 328/506 (65%), Gaps = 18/506 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++S+C   +D+PA A  T  CCPPV +  ++D+++P    P R R  A  A++EYI
Sbjct  101   ISPPDLSECGA-ADLPAGAQPT-NCCPPV-SSKIIDFKLPPKNSPFRIRPAAHLASKEYI  157

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  MK L    P SF QQA++HCAYCNG Y Q GFP  ++QVHNSWLF P+HR+
Sbjct  158   AKYKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRY  217

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYEKILGKLINDPTFALP+WNWD  +GM MP MF    S LYD  R+  + PP ++D
Sbjct  218   YLYFYEKILGKLINDPTFALPFWNWDAPAGMQMPAMFADPNSPLYDKLRDAKHQPPKLID  277

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   D   ++E+ I+ NL  +YR +V++  TT LFMG  Y  G  P PGQG++E IPH
Sbjct  278   LDYNLTDSNDTNEQQISSNLSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPH  337

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-KDFTDDSW  1227
              PVH W GD   QPN EDMGNFYSA RDP+F+SHH+NVDRMW +W+ L G  KDFTD  W
Sbjct  338   GPVHIWCGDRT-QPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDW  396

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYs-----------slpwlkskpspskT  1374
             L+A F+FYDEN Q VRV  +DC+D   + Y Y+                  K        
Sbjct  397   LDAGFVFYDENAQLVRVKVRDCLDPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHK  456

Query  1375  TGAAAASNAPFVTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
             +G A A+  P  +  VFP+ LD  ++V V RP+ SR+K EKE EEEVLVI GIE+  D++
Sbjct  457   SGVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKF  516

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
              +FD+++ND D P    D  ++AG F ++PH+        T +R+G++E LEDL AEDDD
Sbjct  517   VKFDIFINDEDDPVSRPDNTEFAGSFVNVPHQHSHGKKKNTILRIGISELLEDLEAEDDD  576

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEYST  1809
             +V+VTL P+ G  V+ +  I IE ++
Sbjct  577   SVVVTLVPRYGADVITIGGIEIELAS  602



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   488 bits (1257),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 271/574 (47%), Positives = 349/574 (61%), Gaps = 38/574 (7%)
 Frame = +1

Query  139   KKRNQTRL-RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             KKRN     R SC+A      T+D + +P +R       LL   G    A     P A A
Sbjct  33    KKRNHRYTPRFSCRA------TNDDSQNPTTR-----RDLLIGLGGLYGATSLSDPFAFA  81

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQF  492
             A V      P++SKC   +D+P  A+ T  CCPPVP+  +LD++ P +  P+R R  A  
Sbjct  82    APVSA----PDISKCGR-ADLPTGANETN-CCPPVPSTKILDFKRPPSNAPLRVRPAAHL  135

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY+ A+  MK L    P SF QQA++HCAYCNG Y Q GFP  EIQVHNSWLF
Sbjct  136   ADKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNSWLF  195

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILGKLI+DPTFALP+WNWD+  GM +P M+    S LYD+ RN N+ 
Sbjct  196   FPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPNSPLYDSLRNKNHQ  255

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DL+++G D   S+EE ++ NL  +YR MV+NG T  LF G  Y  G  P P  G 
Sbjct  256   PPTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYRAGDEPGPEPGP  315

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E IPH PVH W GD+  QPN EDMGNFYSA RDP+F+ HH+NVDRMW +W K LGG+  
Sbjct  316   IENIPHGPVHIWTGDNT-QPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVW-KTLGGRRT  373

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslp  1341
             D TD  WLNASF FYDEN  PVRV  +DC+D+  +GY Y+                +   
Sbjct  374   DLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPRRSAKKV  433

Query  1342  wlkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
                      +   A    NA      FP+ L+KV+ VKV+RPK SR+K EKE EEE+LVI
Sbjct  434   ASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDEEELLVI  493

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEP  1701
              G+E    +  +FDVY+ND D      DK ++AG F ++PHK +      T  RL L + 
Sbjct  494   QGLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKMTTCFRLALTDL  553

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             LEDL  E DD+++VTL P+ G G+  +  I+IE+
Sbjct  554   LEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKIEF  587



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   488 bits (1255),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 271/574 (47%), Positives = 349/574 (61%), Gaps = 38/574 (7%)
 Frame = +1

Query  139   KKRNQTRL-RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             KKRN     R SC+A      T+D + +P +R       LL   G    A     P A A
Sbjct  33    KKRNHRYTPRFSCRA------TNDDSQNPTTR-----RDLLIGLGGLYGATSLSDPFAFA  81

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQF  492
             A V      P++SKC   +D+P  A+ T  CCPPVP+  +LD++ P +  P+R R  A  
Sbjct  82    APVSA----PDISKCGR-ADLPTGANETN-CCPPVPSTKILDFKRPPSNAPLRVRPAAHL  135

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY+ A+  MK L    P SF QQA++HCAYCNG Y Q GFP  EIQVHNSWLF
Sbjct  136   ADKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNSWLF  195

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILGKLI+DPTFALP+WNWD+  GM +P M+    S LYD+ RN N+ 
Sbjct  196   FPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPHSPLYDSLRNKNHQ  255

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DL+++G D   S+EE ++ NL  +YR MV+NG T  LF G  Y  G  P P  G 
Sbjct  256   PPTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYRAGDEPGPEPGP  315

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E IPH PVH W GD+  QPN EDMGNFYSA RDP+F+ HH+NVDRMW +W K LGG+  
Sbjct  316   IENIPHGPVHIWTGDNT-QPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVW-KTLGGRRT  373

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslp  1341
             D TD  WLNASF FYDEN  PVRV  +DC+D+  +GY Y+                +   
Sbjct  374   DLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPRRSAKKV  433

Query  1342  wlkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
                      +   A    NA      FP+ L+KV+ VKV+RPK SR+K EKE EEE+LVI
Sbjct  434   ASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDEEELLVI  493

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEP  1701
              G+E    +  +FDVY+ND D      DK ++AG F ++PHK +      T  RL L + 
Sbjct  494   QGLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKMTTCFRLALTDL  553

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             LEDL  E DD+++VTL P+ G G+  +  I+IE+
Sbjct  554   LEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKIEF  587



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   487 bits (1253),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 254/505 (50%), Positives = 345/505 (68%), Gaps = 25/505 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC  P+D P  A  T  CCPP+ +  ++DY++P    +R R       + YI KY 
Sbjct  93    PDLSKCG-PADFPPGATPT-NCCPPI-SSKIIDYKLPPVSKLRVRPATHTVDEAYIAKYN  149

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK+L  S P SF QQ++IHCAYC+G Y Q GFP  E+QVH SWLFFPFHRWYLYF
Sbjct  150   RAVQLMKDLPDSDPRSFSQQSDIHCAYCDGSYDQVGFPNLELQVHESWLFFPFHRWYLYF  209

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YE+ILGKLI+DPTFALP+WNWD+  GM  P ++ +  S LYD  R+ N+ PP  VDL+Y+
Sbjct  210   YERILGKLIDDPTFALPFWNWDSPPGMQFPALYANAKSPLYDKLRDANHQPPVTVDLDYS  269

Query  883   GKDRGL---SDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHT  1053
               D G+   S +  ++ NL  +YR ++ NG    LF+G+ Y  G  PSPG GS+E +PH 
Sbjct  270   KADAGVPTTSKDVQVSANLKIMYRQIIANGKNARLFLGEPYREGDDPSPGPGSLENVPHG  329

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSW  1227
             PVH W GDS  QPN E+MGNFYSA RDP+F+SHH+N+DR+W +W K LGGK  DFTD  W
Sbjct  330   PVHLWTGDST-QPNFENMGNFYSAARDPIFFSHHSNIDRLWSVW-KTLGGKRNDFTDPDW  387

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             LN+ FLFYDEN+Q VRV   DC+D+  +GY Y+   +PWL++KP+P +T  A A S++  
Sbjct  388   LNSGFLFYDENKQLVRVRVGDCLDSKKLGYVYQDVDIPWLQTKPTPLRTKRAVARSSSTL  447

Query  1408  V------------TDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
             V            T V FP+ LDKV+   VSRPK SR+K EK+ EEEVLVI+GIE   + 
Sbjct  448   VGAALAADTKKTTTRVKFPIKLDKVISTVVSRPKKSRSKNEKDDEEEVLVIEGIEFDRNN  507

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDD  1728
               +FDVY+ND D+   G + +++AG F ++PHK++  + T+T++RLG+ + LE+L AEDD
Sbjct  508   PVKFDVYVNDEDE--SGPENSEFAGSFVNVPHKKKGDNKTRTNLRLGITDLLEELEAEDD  565

Query  1729  DTVLVTLAPQVGGGVVDVDSIRIEY  1803
             D+V+VTL P+ G G+V +  I+I++
Sbjct  566   DSVVVTLVPKFGKGLVTISGIKIDF  590



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   486 bits (1252),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 269/574 (47%), Positives = 347/574 (60%), Gaps = 38/574 (7%)
 Frame = +1

Query  139   KKRNQTRL-RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             KKRN     RVSC+A      T+D + +P +R       +L   G    A     P A A
Sbjct  33    KKRNHRYTPRVSCRA------TNDDSQNPTTR-----RDILIGLGGLYGATSLSDPFAFA  81

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQF  492
             A V      P++SKC   +D+P   + T  CCPPVP+  +LD++ P+   P+R R  A  
Sbjct  82    APVSA----PDISKCSR-ADLPTGVNETN-CCPPVPSTKILDFKRPSSNAPLRVRPAAHL  135

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY  A+  MK L    P SF QQA++HCAYCNG Y Q GFP  +IQVHNSWLF
Sbjct  136   ANKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNSWLF  195

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILGKLI+DPTFALP+WNWD+  GM +P M+    S LYD+ RN N+ 
Sbjct  196   FPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPNSPLYDSLRNKNHQ  255

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DL+++G D   S+ E I+ NL  +YR MV+NG T  LF G  Y  G  P P  G 
Sbjct  256   PPTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYRAGDEPGPEAGP  315

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E IPH PVH W GD+  QPN EDMGNFYSA RDP+F+ HH+NVDRMW +W K LGG+  
Sbjct  316   IENIPHGPVHIWTGDNT-QPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVW-KTLGGRRT  373

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslp  1341
             D TD  WLNASF FYDEN  PVRV  +DC+D   +GY Y+                +   
Sbjct  374   DLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPRRSAKKV  433

Query  1342  wlkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
                      +   A   +NA      FP+ L++V+ VKV+RPK SR+K EKE EEE+LVI
Sbjct  434   ASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDEEELLVI  493

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEP  1701
              G+E    +  +FDVY+ND D      DK ++AG F ++PHK +      T  RL L + 
Sbjct  494   QGLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKINTCFRLALTDL  553

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             LEDL  E DD+V+VTL P+ G G+  +  I+IE+
Sbjct  554   LEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKIEF  587



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   486 bits (1250),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 269/574 (47%), Positives = 347/574 (60%), Gaps = 38/574 (7%)
 Frame = +1

Query  139   KKRNQTRL-RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             KKRN     RVSC+A      T+D + +P +R       +L   G    A     P A A
Sbjct  33    KKRNHRYTPRVSCRA------TNDDSQNPTTR-----RDILIGLGGLYGATSLSDPFAFA  81

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQF  492
             A V      P++SKC   +D+P   + T  CCPPVP+  +LD++ P+   P+R R  A  
Sbjct  82    APVSA----PDISKCSR-ADLPTGVNETN-CCPPVPSTKILDFKRPSSNAPLRVRPAAHL  135

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY  A+  MK L    P SF QQA++HCAYCNG Y Q GFP  +IQVHNSWLF
Sbjct  136   ADKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNSWLF  195

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILGKLI+DPTFALP+WNWD+  GM +P M+    S LYD+ RN N+ 
Sbjct  196   FPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPNSPLYDSLRNKNHQ  255

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DL+++G D   S+ E I+ NL  +YR MV+NG T  LF G  Y  G  P P  G 
Sbjct  256   PPTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYRAGDEPGPEAGP  315

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E IPH PVH W GD+  QPN EDMGNFYSA RDP+F+ HH+NVDRMW +W K LGG+  
Sbjct  316   IENIPHGPVHIWTGDNT-QPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVW-KTLGGRRT  373

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslp  1341
             D TD  WLNASF FYDEN  PVRV  +DC+D   +GY Y+                +   
Sbjct  374   DLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPRRSAKKV  433

Query  1342  wlkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
                      +   A   +NA      FP+ L++V+ VKV+RPK SR+K EKE EEE+LVI
Sbjct  434   ASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDEEELLVI  493

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEP  1701
              G+E    +  +FDVY+ND D      DK ++AG F ++PHK +      T  RL L + 
Sbjct  494   QGLEFDKTKALKFDVYINDEDDSLSAPDKTEFAGSFVNVPHKHKHGKKINTCFRLALTDL  553

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             LEDL  E DD+V+VTL P+ G G+  +  I+IE+
Sbjct  554   LEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKIEF  587



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   482 bits (1240),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 279/567 (49%), Positives = 363/567 (64%), Gaps = 38/567 (7%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             KKRN    +VSC+A N            G R   RRNVL+GLGGLYG A+LA  P A AA
Sbjct  35    KKRNH-HFKVSCQATN------------GERNASRRNVLIGLGGLYGAASLAADPFALAA  81

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFA  495
                  I  P+VSKC  P+D+P+ A  T  CCPP P  T++D+++P     +R R  A   
Sbjct  82    ----PIQAPDVSKCG-PADLPSGATPTN-CCPP-PATTIVDFKLPAPSNTLRVRPAAHLV  134

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
              + YI K++ A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+QVHNSWLF 
Sbjct  135   DEAYIAKFQRAVQLMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPNLELQVHNSWLFL  194

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHR+YLYFYE+ILGKLINDPTFA+P+WNWD Q GM +P+++   TS LYD  R+ ++ P
Sbjct  195   PFHRYYLYFYERILGKLINDPTFAMPFWNWDAQGGMRLPDIYTDPTSPLYDTLRDGSHQP  254

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             P ++DL++ G D  +SD + +++N   +YR MV+N  T  LF G  Y  G  P PG G +
Sbjct  255   PTMIDLDFNGTDSNISDSQQLSQNYTIMYRQMVSNSRTPRLFFGSPYRAGDDPDPGAGQL  314

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--D  1209
             E IPH PVH W GD   QPN EDMGNFYSAGRDP+FY+HH+N+DRMW +W K LGG+  D
Sbjct  315   ENIPHGPVHVWTGDRT-QPNLEDMGNFYSAGRDPIFYAHHSNIDRMWTLW-KTLGGRRQD  372

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYs-----------slpwlksk  1356
              TD  WLNASF+FYDEN Q VRV  +DC+D   +GY Y+              L  +  K
Sbjct  373   ITDTDWLNASFVFYDENAQMVRVRVRDCLDTTKLGYSYQTVDTPWLNSRPTPRLTKVARK  432

Query  1357  pspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
                     AA  S++P  TD+FP  LDK+++V V RPK  R+K EK+++EE+LVI+ IEV
Sbjct  433   IKKLVVANAADHSHSP--TDIFPAKLDKIIKVMVKRPKKKRSKKEKDEKEEILVIEKIEV  490

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLG  1716
               D +A+FD+Y+ND D P    +  ++AG F ++PHK +     KT + L L E LEDL 
Sbjct  491   ERDAFAKFDIYINDEDDPKSTPENTEFAGSFVNVPHKHKHGKKIKTHLNLSLTEILEDLD  550

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             AEDD+ V+VTL P+VG   V +  I+I
Sbjct  551   AEDDEHVMVTLVPRVGCDAVTIGGIKI  577



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   481 bits (1239),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 276/567 (49%), Positives = 348/567 (61%), Gaps = 29/567 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H+K +  R  +SCKA     S DD+  +P S  +DRRNVL+GLGG YG   L   P A A
Sbjct  45    HRKPSIRRSTISCKAL----SNDDSEQNPMSVKLDRRNVLIGLGGFYGAVGLRSDPFALA  100

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQF  492
               + V    P+ ++C   +           CCPP PT  VLD+++P+   P R R  A  
Sbjct  101   EPISV----PDFTQCGKVNPC------AKACCPP-PTTEVLDFKLPSSNSPTRVRPAAHL  149

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY  A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+QVH SWLF
Sbjct  150   ADEDYIAKYAEAIRLMKALPADDPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLF  209

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILG LI DPTFALPYWNWD   GM MP MF    S LYD NRNP++ 
Sbjct  210   FPFHRYYLYFYEKILGSLIKDPTFALPYWNWDAPGGMKMPAMFTDPHSPLYDFNRNPDHA  269

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP +VDLNY  +   L    LI  NL  +YR MV++G T +LF+G  Y  G   +PG GS
Sbjct  270   PPMLVDLNYNCEH--LPPSNLIHNNLSIMYRQMVSSGKTAKLFLGHAYRAGDHANPGAGS  327

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E +PH  VH W GD   QPN EDMG  YSA RDPLF++HH+NVDRMW +W+ L G K  
Sbjct  328   IELMPHNTVHNWCGD-YRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTLGGPKRT  386

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskps  1362
             DFT   WLNASFLFYDEN+Q VRV  KDC++   +GY Y+           +P   +   
Sbjct  387   DFTHPDWLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDIPWRNSKPVPRKIAIKV  446

Query  1363  pskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
                + G A  +  P     FPV LDKVV   V RPK  R+K EKE++EEVLVI+GIE+  
Sbjct  447   TETSGGIADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSKKEKEEKEEVLVIEGIELES  506

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
             D + +FDV++ND        D  ++AG F ++PHK +     KT + LG+ E LEDL  E
Sbjct  507   DAFVKFDVHINDEQASLSSPDMTEFAGSFVNVPHKHKPGKKMKTKLTLGITELLEDLMCE  566

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD+ +LVTL P+ GG  V + +I+IE+
Sbjct  567   DDEKILVTLNPRYGGEDVIISNIKIEF  593



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   479 bits (1234),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 281/567 (50%), Positives = 351/567 (62%), Gaps = 29/567 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H+K +  R  +SCKA     S DD+  +P S  +DRRN L+GLGG YG   L   P A A
Sbjct  45    HRKPSIRRSTISCKAL----SNDDSEQNPMSVKLDRRNALIGLGGFYGAVGLRSDPFALA  100

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQF  492
               + V + +    K       P   D    CCPP PT  VLD+++P +  P R R  A  
Sbjct  101   DPISV-LDFTQCGKVK-----PCVKD----CCPP-PTTKVLDFKLPPSNSPTRVRPAAHL  149

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY  A   MK L    P SF QQAN+HCAYC+G Y Q GFP  E+QVH+SWLF
Sbjct  150   ADKDYIAKYAEATKLMKALPADDPRSFMQQANVHCAYCDGYYHQVGFPNLELQVHDSWLF  209

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILG LI DPTFALPYWNWD   GM MP MF    S LYDANRNP + 
Sbjct  210   FPFHRYYLYFYEKILGNLIGDPTFALPYWNWDAPDGMKMPAMFTDPQSPLYDANRNPEHA  269

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
              P +VDLNY  K    SD E  + NL  +YR +V+ G T +LF+G  Y  G   SPG+GS
Sbjct  270   QPTLVDLNYNCKHPPPSDLE--SNNLAIMYRQIVSCGKTAKLFLGHAYRAGDQASPGRGS  327

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E +PH  VH W GD   QP  EDMG FYSAGRDPLF++HH+NVDRMW +W+ L G K  
Sbjct  328   IENMPHNTVHDWCGD-YRQPKREDMGIFYSAGRDPLFFAHHSNVDRMWTLWKTLGGRKRT  386

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskps  1362
             DFTD  WLNA+FLFYDEN Q +RV  KDC++   +GY Y+        Y  +P  K+K  
Sbjct  387   DFTDPDWLNATFLFYDENAQAMRVKVKDCLETSNLGYKYQDVDIPWRNYKPVPRKKAKKL  446

Query  1363  pskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
             P  +   A  +  P     FPV LDKVV   V RPK  R+K EKE+EEEVL I+GIE+  
Sbjct  447   PKSSGKIADVAGIPRHIVHFPVKLDKVVSTWVKRPKQKRSKKEKEEEEEVLAIEGIELES  506

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
             D + +FDV++ND        DK ++AG F ++PHK +     KT + LG+ + LEDL  E
Sbjct  507   DAFVKFDVHINDKQDSLSSPDKTEFAGSFVNVPHKHKPGKKMKTKLTLGITDLLEDLMRE  566

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             +D+ VLVTLAP+ GG  V + +I+IE+
Sbjct  567   EDEKVLVTLAPRCGGEDVIISNIKIEF  593



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   482 bits (1240),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 276/567 (49%), Positives = 348/567 (61%), Gaps = 29/567 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H+K +  R  +SCKA     S DD+  +P S  +DRRNVL+GLGG YG   L   P A A
Sbjct  109   HRKPSIRRSTISCKAL----SNDDSEQNPMSVKLDRRNVLIGLGGFYGAVGLRSDPFALA  164

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQF  492
               + V    P+ ++C   +           CCPP PT  VLD+++P+   P R R  A  
Sbjct  165   EPISV----PDFTQCGKVNPC------AKACCPP-PTTEVLDFKLPSSNSPTRVRPAAHL  213

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A ++YI KY  A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+QVH SWLF
Sbjct  214   ADEDYIAKYAEAIRLMKALPADDPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLF  273

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYEKILG LI DPTFALPYWNWD   GM MP MF    S LYD NRNP++ 
Sbjct  274   FPFHRYYLYFYEKILGSLIKDPTFALPYWNWDAPGGMKMPAMFTDPHSPLYDFNRNPDHA  333

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP +VDLNY  +   L    LI  NL  +YR MV++G T +LF+G  Y  G   +PG GS
Sbjct  334   PPMLVDLNYNCEH--LPPSNLIHNNLSIMYRQMVSSGKTAKLFLGHAYRAGDHANPGAGS  391

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             +E +PH  VH W GD   QPN EDMG  YSA RDPLF++HH+NVDRMW +W+ L G K  
Sbjct  392   IELMPHNTVHNWCGD-YRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTLGGPKRT  450

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskps  1362
             DFT   WLNASFLFYDEN+Q VRV  KDC++   +GY Y+           +P   +   
Sbjct  451   DFTHPDWLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDIPWRNSKPVPRKIAIKV  510

Query  1363  pskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
                + G A  +  P     FPV LDKVV   V RPK  R+K EKE++EEVLVI+GIE+  
Sbjct  511   TETSGGIADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSKKEKEEKEEVLVIEGIELES  570

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
             D + +FDV++ND        D  ++AG F ++PHK +     KT + LG+ E LEDL  E
Sbjct  571   DAFVKFDVHINDEQASLSSPDMTEFAGSFVNVPHKHKPGKKMKTKLTLGITELLEDLMCE  630

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD+ +LVTL P+ GG  V + +I+IE+
Sbjct  631   DDEKILVTLNPRYGGEDVIISNIKIEF  657



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   479 bits (1233),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 323/506 (64%), Gaps = 22/506 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINKY  519
             P++S C  P D+P+ A  T  CCPP  +D ++D+++P     +R R  A    + YI KY
Sbjct  94    PDLSNCG-PPDLPSGAKPT-DCCPP-KSDKIIDFKLPPQSNQLRVRPAAHVVDKNYIEKY  150

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK L    P +F QQANIHCAYC+  Y Q GFP  E+QVHN WLFFP HR+YLY
Sbjct  151   SKAIALMKALPEDDPRNFTQQANIHCAYCDAAYDQVGFPDLELQVHNCWLFFPCHRYYLY  210

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYEKILGKLINDPTFALP+WNWD+  GM +P ++ +  S LYD  RN  + PP ++DL+Y
Sbjct  211   FYEKILGKLINDPTFALPFWNWDSPPGMQLPALYANLKSPLYDTLRNAGHQPPTLLDLDY  270

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
              G D   +  + +  NL  +YR +V+NG   +LF G  + +G  P PG GS+E IP+ PV
Sbjct  271   NGTDETTTKRDQLTSNLTIMYRQVVSNGKNPKLFFGGAFRSGEEPDPGAGSIENIPYGPV  330

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWLN  1233
             H W GD+  QPN E+MGNFYSA RDP+F++HH+NVDRMW IW K LGG  KD TD  WLN
Sbjct  331   HLWSGDNT-QPNLENMGNFYSAARDPMFFAHHSNVDRMWTIW-KTLGGKRKDITDPDWLN  388

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------YsslpwlkskpspskT  1374
             A FLFYDEN+Q VRV  +DC+D   +GY Y+               S     +    +  
Sbjct  389   AGFLFYDENKQLVRVKVRDCLDEKKLGYVYQDVDIPWLKTRPTPRKSKLSKVASAVRALG  448

Query  1375  TGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAMDQY  1551
                AA S     T  FPV LD V++  V RPK   R+K EKE+EEEVLVIDGIE   D  
Sbjct  449   VAQAAVSKKTVTTTDFPVILDSVIRTVVDRPKKKRRSKQEKEEEEEVLVIDGIEFDRDLP  508

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
              +FDVY+ND D    G DK+++AG F  +P KQ++    KT +RLGL + LEDL AEDDD
Sbjct  509   VKFDVYVNDEDDLPSGPDKSEFAGSFVSVPRKQKNQKKLKTCLRLGLTDLLEDLEAEDDD  568

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEYST  1809
             +V+VTL P+ G G+V +  ++IE+++
Sbjct  569   SVVVTLVPRTGKGLVSIGELKIEFAS  594



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   478 bits (1229),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 288/561 (51%), Positives = 358/561 (64%), Gaps = 24/561 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KRN  +  VSCK N  +   D+         +DRR+VLLGLGGLYG +NL   P A AA 
Sbjct  37    KRNYRQFTVSCKNNESHEQVDN---------LDRRDVLLGLGGLYGASNLIINPFAMAA-  86

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPM-RKRVPAQFAT  498
                 I  P +SKC  P+D+P  A +T  CCPPVP   V+DY++P    + R R  A    
Sbjct  87    ---PIAAPEISKCGPPADLPPGAVVTDNCCPPVP-GKVIDYKLPPPPKVNRFRPAAHLVK  142

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
             ++YI K   A+  MK L    P +F QQAN+HCAYCNG Y Q G   +EI VH SWLFFP
Sbjct  143   KDYIEKLNKAVELMKALPADDPRNFTQQANVHCAYCNGAYVQPG-SDQEISVHYSWLFFP  201

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             FHRWYLYFYE+ILGKLI DP+F LP+WNWDN  GMT+P++FM  +S+LY+ NRN ++LPP
Sbjct  202   FHRWYLYFYERILGKLIGDPSFGLPFWNWDNIGGMTIPSIFMDQSSALYNENRNQSHLPP  261

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS--PGQGS  1032
              +VDL Y G DR  +  E I  NL  +YR MV+N  T   F GK+Y  G  P+   G GS
Sbjct  262   TVVDLGYNGTDRDATCTERIENNLAIMYRQMVSNATTGRDFFGKEYRAGDQPNAFAGAGS  321

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-KD  1209
             +E  PH P+HRWVGD   QPNGED+GNFYSAGRD LFYSHHANVDRMW IWQ+L G  K+
Sbjct  322   IEASPHIPLHRWVGDP-RQPNGEDLGNFYSAGRDVLFYSHHANVDRMWTIWQQLGGKRKE  380

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGAA  1386
               D  WLN+SF+FYDEN QPVRV  +D   N  MGY YE   +P          + +  A
Sbjct  381   VPDPDWLNSSFIFYDENAQPVRVKVRDSFSNDRMGYIYEKVDIPWLKNKPVPRVRKSRVA  440

Query  1387  AASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDV  1566
               S AP    VFP  L+K+V+V V RPK SR+K +KE+EEE LV+ GIE +MD+Y +FDV
Sbjct  441   FTSGAPPADKVFPGPLNKIVKVLVKRPKLSRSKRQKEEEEERLVVYGIEFSMDKYVKFDV  500

Query  1567  YLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
             ++ND D       K++Y G FA+LPHK +S    KT+    L E LEDL  EDDD +LVT
Sbjct  501   FINDEDDNPNDFAKSEYVGSFANLPHKVKSGMKAKTTQTFELTEILEDLDVEDDDALLVT  560

Query  1747  LAPQVGGGVVDVDSIRIEYST  1809
             L P      + +D I+IE +T
Sbjct  561   LVPNTA---LTIDGIKIEVAT  578



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   476 bits (1226),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 324/507 (64%), Gaps = 20/507 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYI  510
             I  P  +KC   +D+P  A     CCPP  T  +LD+++P+   P+R R  A  A   YI
Sbjct  96    ISTPEPTKCGK-ADLPNYAKPPTNCCPPTST-KILDFKLPSSQSPLRIRPAAHLADDAYI  153

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P SF QQA +HCAYCNG Y Q GFP  +IQVHNSWLFFPFHR+
Sbjct  154   AKYSKAVKLMKALPEDDPRSFMQQAKVHCAYCNGAYDQVGFPDLQIQVHNSWLFFPFHRY  213

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKILGKLI+DPTFALPYWNWD+  GM +P ++ +  S LYD  RN N+ PP IVD
Sbjct  214   YLYFHEKILGKLIDDPTFALPYWNWDSPKGMQLPALYANPKSPLYDQYRNKNHQPPTIVD  273

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   +    ++E I+ NL  +YR M++NG T +LF+G  Y  G  P PG GS+E IPH
Sbjct  274   LDYNATEGPTPEQETISSNLTIMYRQMISNGKTAKLFLGSPYRAGDEPDPGAGSIENIPH  333

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              P+H W GD+  Q N E+MGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  +FTD  
Sbjct  334   NPLHVWTGDNF-QRNLENMGNFYSAGRDPIFYAHHSNVDRMWTIW-KTLGGKRTEFTDPD  391

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlkskpsp  1365
             WL+A+FL YDEN   VRV  +DC+D+  + Y Y+                +  +      
Sbjct  392   WLDAAFLLYDENANLVRVKVRDCIDHKKLRYAYQEVEIPWLKSRPTPRRLIKKMAKVFHH  451

Query  1366  skTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                   AA +     T+ FP+ LDKV++  VSRPK SR+K EKE+EEE+LVI+GIE   D
Sbjct  452   HDQVAQAAETQNLTPTNSFPLKLDKVIRTMVSRPKKSRSKKEKEEEEEILVINGIEFERD  511

Query  1546  QYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
                +FDVY+ND      G +K+++AG F ++PH  +     KT +RLG+ + LEDLGAED
Sbjct  512   AVVKFDVYVNDEHDSPSGPNKSEFAGSFVNVPHAHKHGKKMKTCLRLGITDLLEDLGAED  571

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             DD V+V L P++G G V +  I+IE +
Sbjct  572   DDNVVVALVPRIGKGQVRIGGIKIELA  598



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   474 bits (1220),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 253/497 (51%), Positives = 330/497 (66%), Gaps = 14/497 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P + KC   +DVP     T  CCPPV +  +LD++ P +  P+R R  A     EYI
Sbjct  76    ISAPEMEKCGR-ADVPEGVQTT-DCCPPV-SKRILDFKPPFSNSPVRVRPAAHLVDDEYI  132

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P SF QQAN+HCAYC G Y Q GFP  E+QVHNSWLFFPFHR+
Sbjct  133   RKYSKAIELMKALPHDDPRSFMQQANVHCAYCEGAYDQVGFPNLELQVHNSWLFFPFHRY  192

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILG LI+DPTF LP+WNWD+ +GM MP+MFM T SSLYD  RN  + PP +VD
Sbjct  193   YLYFFERILGHLIDDPTFGLPFWNWDSPAGMWMPDMFMDTNSSLYDKFRNSRHYPPTMVD  252

Query  871   LNYAGKDRGLS--DEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
             L+Y G+D   +  +++ +  NL  +YR MV+N  T  LF+G  +  G  P  G GS+E +
Sbjct  253   LDYNGEDEHETKMNKDQVKSNLSIMYRQMVSNAKTPRLFLGGPFRAGDEPYQGSGSIENV  312

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL--LGGKDFTD  1218
             PH PVH W GD   QPNGEDMG FYSA RDP+FY+HH+NVDRMW +W+ +  +  KDF D
Sbjct  313   PHGPVHVWCGDD-KQPNGEDMGTFYSAARDPIFYAHHSNVDRMWSVWKTIENINRKDFDD  371

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASN  1398
               WLNASFLFYDEN   VRV  +DC+D+  +GY Y++  LPWLK KP+P K T    A  
Sbjct  372   PDWLNASFLFYDENANLVRVKVRDCLDHRNLGYVYQFVDLPWLKEKPTPRKLTKKNKAPP  431

Query  1399  APFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
              P  +  F   LDK V+V V RP+ SR+K EKE++EE+LVID IE+  D + +FDVY+ND
Sbjct  432   PPVSSTEF--VLDKPVRVNVERPRKSRSKTEKEEKEEILVID-IELKGDLFVKFDVYVND  488

Query  1579  SDQPDG--GKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLA  1752
              D      G +  ++AG + ++P+K +   T KT +RLGL + LEDLGA+DDD ++VTL 
Sbjct  489   EDDAGSNIGSENTEFAGSYVNVPNKHKQGKTLKTRLRLGLTDLLEDLGADDDDGIVVTLV  548

Query  1753  PQVGGGVVDVDSIRIEY  1803
             P+ G G + +  I+IE+
Sbjct  549   PKYGKGNIKISGIKIEF  565



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   475 bits (1222),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 334/507 (66%), Gaps = 23/507 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGP-MRKRVPAQFATQEYI  510
             I  P+++KC  P+D+P  A +   CCPP  T  ++D+++P     +R R  A  A ++YI
Sbjct  94    IMAPDLTKCG-PADLPQGA-VATNCCPPF-TKNIIDFKLPPPSTNLRVRPAAHLANKDYI  150

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  ++QVHNSWLF PFHR 
Sbjct  151   AKFNKAIELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLDLQVHNSWLFLPFHRH  210

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKI GKLINDP FA+P+WNWD   GMT+P ++ +  S LYDA R+  + PP++VD
Sbjct  211   YLYFFEKICGKLINDPNFAIPFWNWDTPDGMTIPAIYANKNSQLYDALRDGKHQPPSLVD  270

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L++ G+D  LS  +  + NL  +YR MV++  T  LFMG  Y  G   +PG GS+E IPH
Sbjct  271   LDFNGEDENLSKSKQTSTNLTIMYRQMVSSSKTASLFMGSPYRAGDEANPGGGSLESIPH  330

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD  +QPNGEDMGNFYSA RDP+FY+HHAN+DRMW +W K LGG+  DFTD  
Sbjct  331   GPVHIWTGDR-NQPNGEDMGNFYSAARDPIFYAHHANIDRMWSVW-KTLGGRRNDFTDKD  388

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss----------lpwlkskpspskT  1374
             WL+++FLFYDEN + VRV  +D +D+  +GY Y+                        K 
Sbjct  389   WLDSAFLFYDENAELVRVKVRDALDSKKLGYVYQDVGIPWLETKPEPRLKRALSKIKKKL  448

Query  1375  TGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
               A A  + PF  DVFP TLDKV++V V RPK SR+K +K+ EEE+LVI+GIEV  D++ 
Sbjct  449   AVARADEHIPFAKDVFPATLDKVIKVLVPRPKKSRSKKQKDAEEEILVIEGIEVKRDEFV  508

Query  1555  RFDVYLNDSDQPDGGK---DKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             +FDV++ND D  DG +   DK ++AG F ++PHK +   + KT +RLG++E L+DLGA+D
Sbjct  509   KFDVFVNDED--DGMRATADKTEFAGSFVNVPHKHKHGKSVKTRLRLGISELLDDLGADD  566

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             DD VLVTL P+  G  V +  ++IEY 
Sbjct  567   DDNVLVTLVPKNKGDEVSIKGMKIEYE  593



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   474 bits (1221),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 273/573 (48%), Positives = 352/573 (61%), Gaps = 29/573 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             K R   R RVSCKA N    +D   A P     DRRNVLLGLGGLYGV  L   P A A 
Sbjct  35    KPRQFIRTRVSCKATN----SDQNDAQPPVPKFDRRNVLLGLGGLYGVVGLGSDPFAFAK  90

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFAT  498
              V      P+VSKC   +D+P N      CCPP P+  ++D+++P+  P+R R  A    
Sbjct  91    PV----APPDVSKCGA-ADLP-NGVAPTDCCPPTPS-KIIDFKLPSPTPLRVRPAAHAVD  143

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
               YI KY  A+  MK L    P SF  QAN+HCAYC+G Y Q GFP  E+Q+HNSWLFFP
Sbjct  144   DAYIAKYTKAMELMKALPDDDPRSFKNQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFP  203

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             FHR+YLYFYE+ILGKLINDPTFALP+WNWDN +GM +P +F +  S LYD  R   + PP
Sbjct  204   FHRYYLYFYERILGKLINDPTFALPFWNWDNPAGMQLPALFANPKSPLYDQFRAAAHQPP  263

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
              ++DL++ G +   S+   I  NL  +YR MV+N    +LF G  Y  G  P PG GS+E
Sbjct  264   TLIDLDFNGTEDNTSNTTQINSNLSIMYRQMVSNAKNAQLFFGNPYRAGDEPDPGGGSIE  323

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFT  1215
             G PH PVH W GD+  QPN EDMGNFYSAGRDP+F+SHH+NVDRMW IW+ L    KD T
Sbjct  324   GTPHGPVHLWTGDNT-QPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAPKNKDIT  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------------Ysslpwlks  1353
             D  WL++ FLFYDEN   VRV  +DC+++  +GY Y+               S + +   
Sbjct  383   DSDWLDSGFLFYDENANMVRVKVRDCLESKNLGYVYQDVDIPWLNSKPTPRRSKVAFSNI  442

Query  1354  kpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGI  1530
                      A + +    +TD FP+TL + + V V RP +  R+K EKE EEE+LVI+GI
Sbjct  443   AKKLGVANAAGSKAKVVKITD-FPLTLSRKISVAVPRPKQKKRSKKEKEDEEEILVIEGI  501

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDVY+ND D    G DK+++AG F  +PH+ + +    T +RLGL + LED
Sbjct  502   EFDRDVAVKFDVYINDEDDLPSGPDKSEFAGSFVSVPHRHKHTKKINTVLRLGLTDLLED  561

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             L AEDD+TV+VTL P+     V +  I+IE+++
Sbjct  562   LDAEDDETVVVTLIPRYAADKVKIGGIKIEFAS  594



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   474 bits (1219),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/501 (50%), Positives = 332/501 (66%), Gaps = 16/501 (3%)
 Frame = +1

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFAT  498
             V   I  P++S C  P+D+PA A  T  CCPP  + T++D+++P    P+R R  AQ   
Sbjct  86    VGAPIQAPDISTCGPPADLPATAPPT-DCCPPYQS-TIVDFKLPPRSDPLRVRPAAQSVD  143

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
              +Y+ KY+ A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  EIQVH+SWLFFP
Sbjct  144   ADYLAKYKKAVELMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHSSWLFFP  203

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             +HR+YLYF E+ILGKLI D TFALP+WNWD   GM +P ++   +S LYD  RN  + PP
Sbjct  204   WHRFYLYFNERILGKLIGDDTFALPFWNWDAPGGMQIPAIYADASSPLYDKLRNAKHQPP  263

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
              +VDL+Y G D   + E+ IA NL  +YR +++ G T ELFMG  Y  G  P PG G++E
Sbjct  264   TLVDLDYNGTDPTFTPEQQIAHNLTIMYRQVISGGKTPELFMGAAYRAGDAPDPGAGTLE  323

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-KDFT  1215
              +PH  +H W GD  +QPN EDMG FY+A RDP+F++HH NVDRMW +W+KL G  +DFT
Sbjct  324   LVPHNTMHLWTGDP-NQPNDEDMGTFYAAARDPIFFAHHGNVDRMWYVWRKLGGTHRDFT  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAAS  1395
             D  WLNASFLFYDEN Q VRV  KDC++  A+ Y Y+   +PW+ +KP+P KT G AA S
Sbjct  383   DPDWLNASFLFYDENAQLVRVKVKDCLEADALRYTYQDVDIPWISAKPTPKKTPGGAAPS  442

Query  1396  NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN  1575
                     FPV LDK V   V+RPKT R+      EEEVLV++GIE+  D   +FDVY+N
Sbjct  443   T---TEATFPVVLDKPVSATVARPKTGRSTG----EEEVLVVEGIELDKDVAVKFDVYIN  495

Query  1576  DSDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLV  1743
               D    G + +++AG F  +P      ++  +  KT++RLG+ + LED+GAEDD++VLV
Sbjct  496   APDNEGVGPEASEFAGSFVQVPHKHKKGKKEKARIKTTLRLGITDLLEDIGAEDDESVLV  555

Query  1744  TLAPQVGGGVVDVDSIRIEYS  1806
             TL P++G G+V V  +RI++S
Sbjct  556   TLVPRIGEGLVKVGGLRIDFS  576



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   474 bits (1221),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 289/569 (51%), Positives = 364/569 (64%), Gaps = 33/569 (6%)
 Frame = +1

Query  163   RVSCKA----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDV  330
             RVSCKA     NP+N+++DA   P  R +DRRNVLLGLGGLYGVA L   P A A  V  
Sbjct  47    RVSCKATNSDQNPSNNSNDA--QPLGRTLDRRNVLLGLGGLYGVAGLGTDPFAFAKPV--  102

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
                 P+VSKC   +D+P  A  T  CCPPV    + D+Q+P    +R R  A    + YI
Sbjct  103   --APPDVSKCG-AADLPTGAQKT-DCCPPV-AQKIFDFQLPPQSKLRVRPAAHAVDKAYI  157

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P SF QQANIHCAYC+G Y Q GFP  E+Q+H+SWLFFPFHR+
Sbjct  158   EKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHDSWLFFPFHRY  217

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLINDP+FA P+WNWD  +GM +P MF +  S LYD  RN N+ PP ++D
Sbjct  218   YLYFYERILGKLINDPSFASPFWNWDAPAGMQLPGMFANPKSPLYDKFRNANHQPPKLID  277

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             LNY  KD  +SDE  I  NL  +YR MV+N    +LF G  Y  G  PSPG G++E  PH
Sbjct  278   LNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYRAGDEPSPGGGAIETTPH  337

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD+  QPN EDMGNFYSAGRDP+F+SHH+NVDR+W +W K LGGK  DFTD  
Sbjct  338   GPVHIWTGDNT-QPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSVW-KTLGGKREDFTDSD  395

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------YsslpwlkskpspskTTG  1380
             WL++ FLFYDEN   VRV  +DC+D+  +GY Y+            P        +K  G
Sbjct  396   WLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPTPRRSKLAKAAKAIG  455

Query  1381  AA-AASNAPFVTDV--FPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQ  1548
              A AAS+ P V     FP+ LD  +   V RP +  R+K EKE EEE+LVI GIE   D 
Sbjct  456   VARAASSGPKVVGRSDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDM  515

Query  1549  YARFDVYLNDSDQPD--GGKDKAQYAGGFAHLP--HKQESSSTTKTSVRLGLNEPLEDLG  1716
               +FDVY+ND +  D  G  D +++AG F ++P  HK +    TK+ +RLGL + LEDLG
Sbjct  516   AVKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLG  575

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             AEDD++V+VTL P+ G   + +D+I+IE+
Sbjct  576   AEDDESVVVTLVPRYGTKSLKIDTIKIEF  604



>ref|XP_008442274.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis melo]
Length=576

 Score =   473 bits (1216),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 277/562 (49%), Positives = 363/562 (65%), Gaps = 31/562 (6%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             R+SCKA+N N   D   ++P    IDRR++L+GL GLYG + L+  P  + A     I  
Sbjct  27    RISCKASNHN---DQNTSNPK---IDRRDILIGLTGLYGSSTLSQSPHFALA---APIQT  77

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             PN+SKC  P D+P  AD T  CCPP P  T+LD+Q P    +R R  A  A Q YI KY+
Sbjct  78    PNISKCG-PPDLPPGADPT-NCCPP-PATTILDFQPPPPTKLRVRPAAHLADQNYIEKYK  134

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQAN+HCAYCNG Y Q GFP E +QVHNSWLFFPFHR+YLYF
Sbjct  135   KAIELMKALPEDDPRSFTQQANVHCAYCNGAYDQIGFPVE-VQVHNSWLFFPFHRFYLYF  193

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             +EKILG+LI D +FALP+WN+D   GM MP M+    SSLYD  RN N+LPP +VDL++ 
Sbjct  194   HEKILGELIGDSSFALPFWNYDAPGGMKMPRMYAEEKSSLYDELRNENHLPPRLVDLDFG  253

Query  883   G-KDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
             G  D  + D+  I  NL  +YR MV+   T  LF G  YV G  PSPG GSVE IPH PV
Sbjct  254   GVDDPNIGDDAQIRSNLSIMYRQMVSGSRTPSLFFGSAYVEGDEPSPGGGSVENIPHGPV  313

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWLN  1233
             H W GD+ DQPN E+MGNFYSA RDP+F++HH+NVDR+W +W K LGG  KD  +  WLN
Sbjct  314   HVWCGDN-DQPNFENMGNFYSAARDPIFFAHHSNVDRLWSVW-KTLGGRRKDLQNPEWLN  371

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAAS  1395
             ASF+FY+E  QPVRV+ +DC+D+ ++GY Y+        + P  +     +   G A+A 
Sbjct  372   ASFIFYNEKAQPVRVHVRDCLDSKSLGYTYQPVDLPWLQTRPTPRRAQKTTVAFGIASAL  431

Query  1396  NA-PFVTDV------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
              A P  + V      FP+T+   V V+V RPK SR+K EKE+EEEVLVI GI    +   
Sbjct  432   AAGPSSSRVKPANIKFPITVKSPVSVEVKRPKKSRSKKEKEEEEEVLVIYGIGFDPNNGI  491

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             +FDV++ND D  +   D  ++AG F ++PHKQ      KT +R+G+ E LEDL A++DD+
Sbjct  492   KFDVFINDEDDKEIKPDNTEFAGSFVNVPHKQAHKKKVKTGLRVGITEVLEDLEADNDDS  551

Query  1735  VLVTLAPQVGGGVVDVDSIRIE  1800
             ++VT+ P++G G+  +  ++IE
Sbjct  552   IIVTIVPKIGAGLFSIGGLKIE  573



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   473 bits (1216),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 325/501 (65%), Gaps = 18/501 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINKY  519
             P+ + C  P D+P  A     CCPP P+  ++D+ +P +  P++ R  A     +Y+ K+
Sbjct  87    PDFTHCGRP-DLPIGA-ANINCCPP-PSTKIVDFVLPPSNAPLQTRPAAHLVNDDYLAKF  143

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK L  S P SF QQAN+HCAYC+G Y Q GFP  ++QVHNSWLFFPFHR+YLY
Sbjct  144   SKAIELMKALPASDPRSFMQQANVHCAYCDGAYHQLGFPDLDLQVHNSWLFFPFHRFYLY  203

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILGKLI+DPTFA+P+WNWD+ +GM MP ++ +  S LYD  RN  + PP ++DL+Y
Sbjct  204   FFEKILGKLIDDPTFAMPFWNWDSPAGMQMPAIYANPNSPLYDKLRNARHKPPTLLDLDY  263

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
              G D  LS ++ I+ NL  +YR MV+NG T +LF+G  Y  G  P PG GS+E IPH  V
Sbjct  264   NGVDETLSSKDQISSNLNVMYRQMVSNGKTAKLFLGNAYRAGEEPDPGAGSLENIPHGLV  323

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLN  1233
             H W GD+  Q N E+MGNFYSAGRDP+FY+HH+NVDRMW +W K LGGK  DFTD  WL+
Sbjct  324   HIWCGDNTQQ-NFENMGNFYSAGRDPIFYAHHSNVDRMWSVW-KTLGGKRTDFTDSDWLD  381

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss----lpwlkskpspskTTGAAAASNA  1401
             ++FLFYDEN   VRV  +DC+D   + Y+Y+             K   SK   A   +NA
Sbjct  382   SAFLFYDENANLVRVKVRDCLDTKKLRYEYQNVEIPWLKTKPTPKRVISKVKRALGVANA  441

Query  1402  PFVTDV------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
                  +      FP+ LD +V ++V+RPK SR++ E+E+EEEVLVI+ IE    Q  +FD
Sbjct  442   AETKKMVVRNFKFPLVLDDIVSLEVARPKKSRSRKEEEEEEEVLVIENIEFDRHQVVKFD  501

Query  1564  VYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLV  1743
             VY+ND D    G D  ++AG F ++PHK +      T +RLGL   LE+L AEDDD V+V
Sbjct  502   VYINDEDDTVIGPDNTEFAGSFVNVPHKHKHGKKMATFLRLGLTYLLEELDAEDDDGVVV  561

Query  1744  TLAPQVGGGVVDVDSIRIEYS  1806
             TL P+ G G+  +  I+IE++
Sbjct  562   TLVPKFGKGLAKIGGIKIEFA  582



>ref|XP_011082867.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=586

 Score =   473 bits (1216),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 286/568 (50%), Positives = 364/568 (64%), Gaps = 21/568 (4%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSR-----IIDRRnvllglgglygvanlagg  300
             H  +   +  +SCKA N N   D+   SPG         DRRN+L+G+GGLYG ANL   
Sbjct  30    HNAKRTRQFNLSCKARNGN---DEQRESPGKEETFQGKFDRRNLLVGMGGLYGAANLVSA  86

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRV  480
               + A      I  P++SKC   +++     +   CCPP+   ++ DY++P    MR R 
Sbjct  87    DYSPA--FASPISAPDLSKCTRGTNLNTQQPLDVNCCPPLSQKSI-DYKLPPVTKMRFRP  143

Query  481   PAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHN  660
              A  A+QEYI KYE A+  MK L    P SF QQAN+HCAYCN  Y+Q G P+  +Q+HN
Sbjct  144   AAHLASQEYIAKYEKAVELMKALPEDDPRSFMQQANVHCAYCNLTYEQTGDPSLRLQIHN  203

Query  661   SWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRN  840
              W FFP+HRWYL+FYE+ILGKLI+DPTF LP+WNWDN  GM MPNMF+   S LY+  RN
Sbjct  204   CWHFFPWHRWYLFFYERILGKLIDDPTFGLPFWNWDNPPGMVMPNMFVKKDSPLYNPRRN  263

Query  841   PNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSP  1020
              ++LPPA  DLNYAGK       ++I  NL  +Y  MV N  T E F G KYVTGT P P
Sbjct  264   QDHLPPATTDLNYAGKP-TTDPSKIIPNNLTEMYSEMVRNVSTLEDFYGAKYVTGTKPDP  322

Query  1021  GQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG  1200
             G G+VE   HT +H WVG +   P+GEDMGNFYSAGR+PLF+SHHANVDR+W IW+ L G
Sbjct  323   GPGTVERGSHTALHVWVGQAT--PSGEDMGNFYSAGREPLFFSHHANVDRLWSIWRGLRG  380

Query  1201  G--KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDY-EYsslpwlkskpspsk  1371
                KDF +  WLNA+FLFYDEN Q VRV   D ++N  MGY + E           +  K
Sbjct  381   SKPKDFPESDWLNANFLFYDENAQLVRVKVGDTLENQKMGYVWQEVDLPWLKNRPTARVK  440

Query  1372  TTGAAAASNAPFVTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
              +  A  S AP  T+ VFPV LDKVV+V V RPK SR+K +KEKEEE+LVIDGIEV   +
Sbjct  441   KSKVATTSTAPKATETVFPVKLDKVVKVLVDRPKKSRSKKDKEKEEELLVIDGIEVDTAK  500

Query  1549  YARFDVYLNDS-DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             + RF+VY+ND  D+ D   DKA+YAG ++ +PHK  +  T+K  +RLGL E LEDL  ED
Sbjct  501   FVRFEVYINDEDDKADEIIDKAEYAGCYSQVPHKNSTKVTSK--IRLGLTELLEDLDVED  558

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             DD +LV+L P+ GG  + +  I+I Y++
Sbjct  559   DDKILVSLVPRAGGEDITIGGIKIIYAS  586



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   473 bits (1217),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 281/577 (49%), Positives = 360/577 (62%), Gaps = 33/577 (6%)
 Frame = +1

Query  139   KKRNQTRL-RVSCKANN-----PNNSTDDAAASPGSRIIDRRnvllglgglygvanlagg  300
             KKR Q  + R+S KA N     P  S++D   S      DRR+VL+GLGG  G A+L+  
Sbjct  38    KKRKQYFVPRISYKATNGDEHYPKFSSNDGQTSLNK--FDRRDVLVGLGGFCGFASLSSD  95

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQI-PTGGPMRKR  477
             P A AA V      P+++KC   +++PA A  T  CCPP  +  +L +++ P+  P+R R
Sbjct  96    PFAVAAPVSA----PDLAKCG-KANLPAGAKQT-NCCPPT-SKKILGFKLHPSNAPLRIR  148

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A      YI KY  A+  MK L    P  F QQAN+HCAYC+G Y Q GFP  E+QVH
Sbjct  149   PAAHLVDDAYIAKYSRAIELMKALPADDPRGFMQQANVHCAYCDGAYDQIGFPNLELQVH  208

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
             NSWLFFPFHR+YLYFYEKILGKLI DPTFALP+WNWD+  GM MP M+ +  S LYD  R
Sbjct  209   NSWLFFPFHRYYLYFYEKILGKLIEDPTFALPFWNWDSPPGMQMPAMYANPKSPLYDNFR  268

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             N ++ PP +VDL+Y   D   ++++ ++ NL  +YR MV+NG T +LF G  Y  G  P 
Sbjct  269   NASHQPPTLVDLDYNRTDETTTNKDQLSSNLKIMYRQMVSNGKTAKLFFGNAYRAGDEPD  328

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG GS+E IPH PVH W GD   QPN EDMGNFYSA RDP+FYSHH+N+DRMW IW K L
Sbjct  329   PGLGSIENIPHGPVHLWCGDKT-QPNLEDMGNFYSAARDPIFYSHHSNIDRMWTIW-KTL  386

Query  1198  GG---KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss--------lpw  1344
             GG   K+FTD  WL+A FLFYDEN   VRV  +DC+DN  +GYDY+            P 
Sbjct  387   GGKKRKEFTDPDWLDAGFLFYDENANLVRVKVRDCLDNKKLGYDYQKVDIPWLNTKPTPR  446

Query  1345  lkskpspskTTGAAAASNAPFVT----DVFPVTLDKVVQVKVSRPKTSRTKAekekeeeV  1512
              +       T G A A+    +       FP+ LDK +   V RPK SR+K EKE+EEEV
Sbjct  447   KRIVNKVRSTFGVAHAAETRRIQLTARSQFPLVLDKTMSTLVPRPKKSRSKKEKEEEEEV  506

Query  1513  LVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGL  1692
             LVI+GI+   D   +FDVY+ND      G D  ++AG F ++PHK +     KT +RLGL
Sbjct  507   LVIEGIDFERDAQVKFDVYINDEHDVPSGPDDTEFAGSFVNVPHKHKHGKKIKTCLRLGL  566

Query  1693  NEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
              + +EDL AEDDD+V+VTL P+ G G+  +  I+IE+
Sbjct  567   TDLIEDLEAEDDDSVVVTLVPRYGKGLARIGGIKIEF  603



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   472 bits (1215),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 271/573 (47%), Positives = 356/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGGLYGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGLYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC  P+D+P  A +   CCPP P+  ++D+++P    +R R PA    Q
Sbjct  91    ---PIAPPDVSKCG-PADLPQGA-VPTNCCPP-PSTKIIDFKLPAPAKLRIRPPAHAVDQ  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +KY  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+Q+HNSWLFFPF
Sbjct  145   AYRDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPELELQIHNSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EKILGKLINDPTFALP+WNWD+ +GM +P ++    S LYD  R+ N+ PP 
Sbjct  205   HRYYLYFFEKILGKLINDPTFALPFWNWDSPAGMPLPAIYADPKSPLYDKLRSANHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             +VDL+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG
Sbjct  265   LVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRAGDEPDPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH PVH W GD+  QPN EDMGNFYSAGRDP+F++HH+NVDRMW IW K LGGK  D T
Sbjct  325   TPHAPVHLWTGDNT-QPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIW-KTLGGKRTDLT  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALSKV  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGI  1530
                     AA AS++  V    FP++L   +   V RPK  +   + ++ EEE+LVI+GI
Sbjct  443   AKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDVY+ND D    G DK ++AG F  +PH  +      T +RLGL + LE+
Sbjct  503   EFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHKHKKKMNTILRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V +  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKFGA--VKIGGIKIEFAS  593



>gb|AFO55218.1| chloroplast polyphenol oxidase II [Eriobotrya japonica]
Length=576

 Score =   471 bits (1212),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 254/551 (46%), Positives = 340/551 (62%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N   D     G   +DRRN+L+GLG           P A AA V      
Sbjct  37    RVRCKATKGDNDNLDQ----GPARLDRRNMLIGLGAGGLYGAAGN-PFAFAAPVSA----  87

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP  T T++D+++P  GP+R R  AQ   ++  Y+ K
Sbjct  88    PDLTTCG-PADKPDGSTID--CCPPT-TTTIIDFKLPDSGPLRTRPAAQNVAKDPAYLAK  143

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  144   YKKAIQLMRELPDDDPRSHAQQAMVHCSYCDGGYPQVGYTDLEIQVHYCWLFFPFHRWYL  203

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WNWD  +GM +P +F  T+SSLYD  RN  + PP ++DLN
Sbjct  204   YFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDLN  263

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y+G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  PSPG G++E IPH  
Sbjct  264   YSGTDDDVDDATRITENLTTMYQQMVSKAASHRLFYGEPYSAGDDPSPGAGNIESIPHNN  323

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q NGEDMG FYSAGRDPLFYSHH+NVDRMW I++  LGG D     WL+ 
Sbjct  324   IHFWTGDPT-QTNGEDMGAFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKTDWLDT  382

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV  +D +D   +GY Y+ +           +   T    AA ++  +
Sbjct  383   EFLFYDEKKNLVRVKVRDSLDTTKLGYVYDENVSIPWLESKPTARKSTNKRKAAVSSSDL  442

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP TL   + V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FDVY+ND   
Sbjct  443   TTTFPATLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDDAD  502

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+LGAE D +++VTL P+VG 
Sbjct  503   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSITSLLEELGAETDSSLVVTLVPKVGK  560

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  561   GPITIGGFSIE  571



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   471 bits (1211),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 271/565 (48%), Positives = 350/565 (62%), Gaps = 32/565 (6%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RVSCKA N +N  D A        +DRRNVLLGLGGLYGVA L   P A A  V      
Sbjct  41    RVSCKAKNSDNQNDQAQTK-----LDRRNVLLGLGGLYGVAGLGTDPFAFAKPVTP----  91

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC   +D+P  A  T  CCPP P   ++D+++P  G +R R  A    Q YI KY 
Sbjct  92    PDLSKCGA-ADLPTGATPTN-CCPP-PATKIIDFKLPAPGKLRVRPAAHAVDQAYIEKYS  148

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+Q+HNSWLFFPFHR+YLYF
Sbjct  149   KAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRYYLYF  208

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YEKILGKLINDPTFALP+WNWD+ +GM +P +F +  S LYD  R  ++ PP ++DL+Y 
Sbjct  209   YEKILGKLINDPTFALPFWNWDSPAGMQLPALFANPKSPLYDKFRAASHQPPTLIDLDYN  268

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S+E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG PH PVH
Sbjct  269   GTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIEGTPHGPVH  328

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNA  1236
              W GD+  QPN EDMGNFYSA RDP+F+SHH+NVDRMW IW K LGGK  D +   WL++
Sbjct  329   LWTGDNT-QPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIW-KTLGGKRTDISQSDWLDS  386

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------YsslpwlkskpspskTT  1377
              FLFY+EN + VRV  +D +++ ++GY Y+               +   L          
Sbjct  387   GFLFYNENAELVRVKVRDSLESKSLGYVYQEVEIPWLQSKPTPRRAKLALSKIKKKLGVA  446

Query  1378  GAAAASNAPFVTDVFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
              AA +S        FP+ L+  +   V RP +  R K EKE+EEE+LVI+GIE   D   
Sbjct  447   HAAESSTQIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDRDVAV  506

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             +FDVY+ND D    G DK ++AG F  +PH+ +      T +RLGL + LEDL AEDD++
Sbjct  507   KFDVYVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEDLDAEDDES  566

Query  1735  VLVTLAPQVGGGVVDVDSIRIEYST  1809
             V+VTL P+ G   V +  ++IE+++
Sbjct  567   VVVTLVPKYGA--VKIGGVKIEFAS  589



>ref|XP_010325653.1| PREDICTED: polyphenol oxidase E, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   470 bits (1209),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 277/565 (49%), Positives = 356/565 (63%), Gaps = 31/565 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H +RNQ+  +VSC ANN + + D          +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  40    HGRRNQS-FKVSCNANNVDKNPD---------AVDRRNVLLGLGGLYGAANLA--PLATA  87

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + V    D+  +CCPPVP   D+V  Y+ P+   +R R PA 
Sbjct  88    A----PIPPPDLKSCGT-AHVKEGVDVIYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAH  142

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EY+ KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  143   AADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFS  199

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  200   WLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDEKRNQ  259

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + GK+      +++  NL  +YR MVTN      F G  Y  G+ PSPG
Sbjct  260   NHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGSEPSPG  319

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
             QG++E IPHTPVH W GD   Q NGEDMGNFYSAG DP+FY HHANVDRMW  W KL+GG
Sbjct  320   QGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNEW-KLIGG  378

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D TD  WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP    ++
Sbjct  379   KRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSSS  438

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G    ++   V+ VFP+  LD+ +   ++RP +SRT  EK ++EE+L  + I      Y 
Sbjct  439   GKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKISYDDRNYV  498

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH   S++   TSV  +L + E LED+G ED
Sbjct  499   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSVTFKLAITELLEDIGLED  558

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +DT+ VTL P+ GG  V ++S+ I+
Sbjct  559   EDTIAVTLVPKAGGEEVSIESVEIK  583



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   469 bits (1208),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 269/565 (48%), Positives = 351/565 (62%), Gaps = 32/565 (6%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RVSCKA N +N  D A        +DRRNVLLGLGGLYGVA L   P A A  V+     
Sbjct  41    RVSCKAKNSDNQNDQAQTK-----LDRRNVLLGLGGLYGVAGLGTDPFAFAKPVNP----  91

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC   +D+P  A  T  CCPP P   ++D+++P  G +R R  A    Q YI KY 
Sbjct  92    PDLSKCGA-ADLPTGATPTN-CCPP-PATKIIDFKLPAPGKLRIRPAAHAVDQAYIEKYS  148

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+Q+HNSWLFFPFHR+YLYF
Sbjct  149   KAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRYYLYF  208

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YEKILGKLINDPTFALP+WNWD+ +GM +P +F +  S LYD  R  ++ PP ++DL+Y 
Sbjct  209   YEKILGKLINDPTFALPFWNWDSPAGMQLPALFANPKSPLYDKFRAASHQPPTLIDLDYN  268

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S+E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG PH PVH
Sbjct  269   GTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIEGTPHGPVH  328

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNA  1236
              W GD+  QPN EDMGNFYSA RDP+F+SHH+NVDRMW IW K LGGK  D +   WL++
Sbjct  329   LWTGDNT-QPNLEDMGNFYSAARDPIFFSHHSNVDRMWSIW-KTLGGKRTDISHSDWLDS  386

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------YsslpwlkskpspskTT  1377
              FLFY+EN + VRV  +D +++ ++GY Y+               +   +          
Sbjct  387   GFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLAVSKIAKKLGVA  446

Query  1378  GAAAASNAPFVTDVFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
              AA +S        FP+ L+  +   V RP +  R K EKE+EEE+LVI+GIE   D   
Sbjct  447   HAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDRDVAV  506

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             +FDVY+ND D    G DK ++AG F  +PH+ +      T +RLGL + LED+ AEDD++
Sbjct  507   KFDVYVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEDIDAEDDES  566

Query  1735  VLVTLAPQVGGGVVDVDSIRIEYST  1809
             V+VTL P+ G   V +  ++IE+++
Sbjct  567   VVVTLVPKYGA--VKIGGVKIEFAS  589



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   469 bits (1208),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 267/573 (47%), Positives = 355/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGGLYGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGLYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC   +D+P  A+ T  CCPP P   ++D+++P    +R R PA    +
Sbjct  91    ---PIAPPDVSKCGS-ADLPQGAEAT-NCCPP-PATKIIDFKLPAPAKLRIRPPAHAVDK  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVHNSWLFFPF
Sbjct  145   AYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EK+LGKLINDPTFA+P+WNWD+ +GM +P ++    S LYD  R+  + PP 
Sbjct  205   HRYYLYFFEKMLGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKFRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             ++DL+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG
Sbjct  265   LIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH PVH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  D  
Sbjct  325   TPHGPVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIW-KTLGGKRTDLA  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALGKI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGI  1530
                     AA AS++  V    FP++L   +   V RPK   R+K  +  EEE+LVI+GI
Sbjct  443   AKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKGQRDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + LE+
Sbjct  503   EFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V++  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>sp|Q08307.1|PPOE_SOLLC RecName: Full=Polyphenol oxidase E, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78299.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=587

 Score =   469 bits (1206),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 276/565 (49%), Positives = 356/565 (63%), Gaps = 31/565 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H +RNQ+  +VSC ANN + + D          +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  40    HGRRNQS-FKVSCNANNVDKNPD---------AVDRRNVLLGLGGLYGAANLA--PLATA  87

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + V    D+  +CCPPVP   D+V  Y+ P+   +R R PA 
Sbjct  88    A----PIPPPDLKSCGT-AHVKEGVDVIYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAH  142

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EY+ KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  143   AADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFS  199

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  200   WLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDEKRNQ  259

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + GK+      +++  NL  +YR MVTN      F G  Y  G+ PSPG
Sbjct  260   NHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGSEPSPG  319

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
             QG++E IPHTPVH W GD   Q NGEDMGNFYSAG DP+FY HHANVDRMW  W KL+GG
Sbjct  320   QGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNEW-KLIGG  378

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D TD  WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP    ++
Sbjct  379   KRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSSS  438

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G    ++   V+ VFP+  LD+ +   ++RP +SRT  EK ++EE+L  + I      Y 
Sbjct  439   GKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKISYDDRNYV  498

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH   S++   TS+  +L + E LED+G ED
Sbjct  499   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSLTFKLAITELLEDIGLED  558

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +DT+ VTL P+ GG  V ++S+ I+
Sbjct  559   EDTIAVTLVPKAGGEEVSIESVEIK  583



>emb|CDP22269.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 292/423 (69%), Gaps = 5/423 (1%)
 Frame = +1

Query  538   MKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYFYEKIL  717
             MK L    P +F QQAN+HCAYCNG Y Q G   +EIQVHNSWLFFPFHRWYLYFYE+IL
Sbjct  1     MKALPADDPRNFTQQANVHCAYCNGAYIQSG-SDQEIQVHNSWLFFPFHRWYLYFYERIL  59

Query  718   GKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYAGKDRG  897
             GKLI DP+F LP+WNWDN  GMT+P++F   +S+LY+ NRN ++LPP +VDL Y G D  
Sbjct  60    GKLIGDPSFGLPFWNWDNIGGMTLPSIFQDQSSALYNQNRNQSHLPPTVVDLGYNGTDTD  119

Query  898   LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVHRWVGD  1077
              +D E I  NL  +YR MVTN  T + F GK+Y  G  PSPG GS+E IPH P+HRWVGD
Sbjct  120   ATDIERIKNNLAIMYRQMVTNSTTAKDFFGKEYRAGDAPSPGAGSIEAIPHIPIHRWVGD  179

Query  1078  SVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-KDFTDDSWLNASFLFYD  1254
                QPNGEDMGNFYSAGRD +FYSHHANVDRMW IWQ+L G  K+  D  WLN+SF+FYD
Sbjct  180   P-RQPNGEDMGNFYSAGRDIVFYSHHANVDRMWTIWQQLGGKRKEVPDPDWLNSSFIFYD  238

Query  1255  ENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAA-ASNAPFVTDVFPVT  1431
             EN QPV V   DC  N  MGY Y+   +PW+K+KP    T    A  S AP    VFP  
Sbjct  239   ENAQPVCVKVGDCFSNDKMGYIYQKVDIPWVKNKPVARVTKSRVAFTSGAPQADKVFPGP  298

Query  1432  LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKA  1611
             L+K V+V V RPK SR+K +KE+EEE LV+ GIE +MD+Y +FDV++ND D       K+
Sbjct  299   LNKTVKVLVKRPKLSRSKKQKEEEEERLVVSGIEFSMDKYVKFDVFINDEDDNPNDFAKS  358

Query  1612  QYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSI  1791
             +Y G FAHLPHK +     KT+    L E LEDL  E+DD +LVTL P+    +  +DSI
Sbjct  359   EYVGSFAHLPHKVKGDMKVKTTQTFELTEILEDLDVEEDDALLVTLVPKSKTALT-IDSI  417

Query  1792  RIE  1800
             +IE
Sbjct  418   KIE  420



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   469 bits (1208),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 244/513 (48%), Positives = 329/513 (64%), Gaps = 18/513 (4%)
 Frame = +1

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
             A +   +  PN + C   +D+P+NA     CCPP  T+ V     PT   +R R PA   
Sbjct  94    ASLAAPVQTPNPTACG-AADLPSNAQGLN-CCPPRATNIVDFVLPPTPNTLRVRPPAHLV  151

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
               +Y  K+  A++ MK L  + P SF QQAN+HCAYCNG Y   GFP  ++QVHNSWLF+
Sbjct  152   DDQYRQKFNRAISLMKALPSTDPRSFTQQANVHCAYCNGSYSPVGFPNLDLQVHNSWLFY  211

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHRWYLYF+E+ILG LINDPTFA+P+WNWD  +GM MP ++    S LYD+ R+  + P
Sbjct  212   PFHRWYLYFFERILGTLINDPTFAIPFWNWDTPAGMVMPALYTDPNSPLYDSVRDRAHQP  271

Query  856   PAIVDLNYAGKDRG-LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             P ++DLNY   D   LS++++I+ NL  +YR MVTN  T  LF+G+ Y  GT P+PG GS
Sbjct  272   PKVLDLNYDLTDANDLSNQQMISANLTLMYRQMVTNSSTARLFLGQPYRAGTRPNPGGGS  331

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-D  1209
             VE +PH  VH W GD  +QPN EDMGNFYSA RDPLFY+HHAN+DRMW IW+ L G + D
Sbjct  332   VENVPHGTVHVWTGDR-NQPNFEDMGNFYSAARDPLFYAHHANIDRMWSIWKTLGGNRQD  390

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------Ysslpwlkskpsps  1368
             FT+  WL+ASF+FYDEN Q VRV  +DC++   +GY+Y+        +         S S
Sbjct  391   FTETDWLDASFIFYDENAQAVRVRVRDCLNTARLGYNYQNVDLPWRNAQPLRTSRVSSIS  450

Query  1369  kTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
              T  AA A  +   T V FP  L+K ++  V+RPK SR+K+EK++EEE LVI+   +  D
Sbjct  451   STPQAANAMESKTTTTVKFPRPLNKSIRTNVARPKKSRSKSEKDREEEELVIEVDVLRHD  510

Query  1546  QYARFDVYLNDSDQPDGGKD--KAQYAGGFAHLPHKQ---ESSSTTKTSVRLGLNEPLED  1710
             +YA+FDVY+ND D     K   KA+YAG F ++PH+    E      T+ R+GL E +++
Sbjct  511   KYAKFDVYINDEDDVPSKKMQVKAEYAGSFVNVPHRHKQGEDKHKLTTTFRVGLTELIQE  570

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             LGA+DDD + V L P+ G   V + +++IEY +
Sbjct  571   LGADDDDGITVNLVPRAGKDNVVIKNVKIEYDS  603



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   468 bits (1205),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 270/573 (47%), Positives = 355/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGG+YGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGIYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC   +D+P  A+ T  CCPP P   ++D+++P    +R R PA    Q
Sbjct  91    ---PIAPPDVSKCGS-ADLPPGAEAT-NCCPP-PATKIIDFKLPAPAKLRIRPPAHAVDQ  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVHNSWLFFPF
Sbjct  145   AYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EKILGKLINDPTFA+P+WNWD+ +GM +P ++ +  S LYD  R+  + PP 
Sbjct  205   HRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYANPKSPLYDKFRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             +VDL+Y G +  +S E  I  NL  +YR MV+N     LF G  Y  G  P PG GS+EG
Sbjct  265   LVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNARLFFGNPYRAGDEPDPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH PVH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  D T
Sbjct  325   TPHGPVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWNIW-KTLGGKRTDLT  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYGYQDVDIPWLSSKPTPRRAKVALSKI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGI  1530
                     AA AS++  V    FP++L   +   V RP +  R+K  KE EEE+LVI+GI
Sbjct  443   AKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + L +
Sbjct  503   EFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLGE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V +  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKYGA--VKIGGIKIEFAS  593



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   464 bits (1194),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 240/510 (47%), Positives = 320/510 (63%), Gaps = 24/510 (5%)
 Frame = +1

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             AI  P+VSKC   +D+P  A++T  CCPP P   ++D+++P    +R R PA    + Y 
Sbjct  2     AIAPPDVSKCG-SADLPPGAEVT-NCCPP-PATKIIDFKLPAPAKLRVRPPAHAVDKAYR  58

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
             +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVHNSWLFFPFHR+
Sbjct  59    DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRY  118

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKILGKLINDPTFA+P+WNWD+  GM +P ++    S LYD  R+  + PP ++D
Sbjct  119   YLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPTIYTDPKSPLYDKFRSAKHQPPTLID  178

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG PH
Sbjct  179   LDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGTPH  238

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  D TD  
Sbjct  239   GPVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIW-KTLGGKRTDLTDSD  296

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlkskpsp  1365
             WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L      
Sbjct  297   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALSKIAKK  356

Query  1366  skTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVA  1539
                  AA AS++  V    FP++L   +   V RP +  R+K  KE EEE+LVI+GIE  
Sbjct  357   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKAKEDEEEILVIEGIEFD  416

Query  1540  MDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGA  1719
              D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + LE++ A
Sbjct  417   RDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEEIEA  476

Query  1720  EDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             EDDD+V+VTL P+ G   V +  I+IE+++
Sbjct  477   EDDDSVVVTLVPKYGA--VKIGGIKIEFAS  504



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   467 bits (1201),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/496 (50%), Positives = 328/496 (66%), Gaps = 10/496 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYI  510
             I  P+++ C  P+  P     T  CCPP  T  +LD+++P+    +R R  A    ++YI
Sbjct  100   IMAPDITLCG-PATFPEGV-ATTNCCPP-STTKILDFKVPSQANTLRVRPAAHLVNKDYI  156

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY   +  MK L    P +F QQA++HCAYC+G Y Q GF   E QVH SWLF+PFHR+
Sbjct  157   AKYNKVVQLMKALPEDDPRNFMQQASVHCAYCDGTYDQLGFQDLEFQVHASWLFYPFHRY  216

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKI GKLI+DP F +P+WNWD   GMT+P ++ +  SSLYD+ R+  + PP++VD
Sbjct  217   YLYFFEKICGKLIDDPNFTIPFWNWDAPDGMTIPYIYTNKNSSLYDSLRDAKHQPPSLVD  276

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G DR LS  +  + NL  +YR MV    TT LF+G  Y  G  PSPG G +E +PH
Sbjct  277   LDYNGVDRNLSPSKQTSTNLNIMYRQMVMASKTTSLFLGSPYRAGDDPSPGGGIMENVPH  336

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG-GKDFTDDSW  1227
             TPVH W GD   QPN EDMGNFYSAGRDP+FY+HHANVDRMW IW+ L+G  KD+TD  W
Sbjct  337   TPVHNWTGDR-SQPNVEDMGNFYSAGRDPIFYAHHANVDRMWSIWKSLVGERKDYTDTDW  395

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             L++ FLFYDEN   VRV  +DC+D+  +GY Y+   +PWL SKP P       A  N  F
Sbjct  396   LDSLFLFYDENADLVRVKVRDCLDSKNLGYVYQDVDIPWLNSKPYPRLKKRLRAYKNVLF  455

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAek----ekeeeVLVIDGIEVAMDQYARFDVYLN  1575
               DVFP +LDK+++V V RPK  R++ E      +EEE+LVI+GIEV MD++ +FDV +N
Sbjct  456   AKDVFPGSLDKLIKVMVPRPKKLRSQEENGHDEVEEEEILVIEGIEVKMDKFVKFDVLVN  515

Query  1576  DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAP  1755
             + D+     DK ++AG F ++PHK +     KT +RLG++E L+DLGAEDD  VLVTL P
Sbjct  516   EDDEKKATADKTEFAGSFVNIPHKHKPGKNMKTRLRLGISELLKDLGAEDDKNVLVTLVP  575

Query  1756  QVGGGVVDVDSIRIEY  1803
             +  GG + +D I+IEY
Sbjct  576   KTKGGEIRIDEIKIEY  591



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   467 bits (1201),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 273/570 (48%), Positives = 366/570 (64%), Gaps = 24/570 (4%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSR-IIDRRnvllglgglygvanlaggPIASA  315
             K+R +   +VSC+A +       +    GS   +DRRNVL+GLGGLYG   L    +A  
Sbjct  39    KRRYRMVRKVSCEATDGEKKPTRSGNEEGSLGRLDRRNVLIGLGGLYGATGLGADRLAFG  98

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQF  492
             A     I  P++SKC   +++PA A  T  CCPP  ++ ++D+++P+   PMR R  A  
Sbjct  99    A----PIMPPDLSKCG-AANLPAGAKPT-NCCPPASSE-IVDFKLPSSSEPMRVRPAAHM  151

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
               +EYI KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSWLF
Sbjct  152   VDEEYIAKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLF  211

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYFYE++LGKLI+DPTFALPYWNWD  +GM MP M+ +  S LYD  R+  + 
Sbjct  212   FPFHRYYLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYANPNSPLYDKLRDAKHQ  271

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DLNY  +D  ++ E+L+  NL  +YR +V+NG T +LF+G  Y  G  P PG GS
Sbjct  272   PPTMIDLNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFGS  331

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG-GKD  1209
             +E +PH PVH W GD   QPN E+MGNFYSA RDP+FY+HH+NVDRMW IW+KL G  KD
Sbjct  332   LENVPHGPVHLWAGDRT-QPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGGRRKD  390

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------Ysslpwlkskps  1362
             F D  WLNA FL YDEN+Q VRV  +DC+D   + Y Y+           +   L +   
Sbjct  391   FKDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQ  450

Query  1363  pskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
               K T        P V++ FP  LD   +V V RP+ SR+K EKE EEE+LVID +E+  
Sbjct  451   KLKITDRGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVELER  509

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-ESSSTTKTSVRLGLNEPLEDLGA  1719
             D   +FDVY+ND D+P    DK+++AG F ++PHK  +  S  KT +R G++E LEDL A
Sbjct  510   DTVVKFDVYINDEDEP--SPDKSEFAGSFVNVPHKHGKKMSKLKTCLRFGISELLEDLEA  567

Query  1720  EDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             EDDD V+VT+ P++GG +V +  I+I +++
Sbjct  568   EDDDEVVVTIVPRIGGDLVTIGGIKIVFAS  597



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   467 bits (1201),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 272/566 (48%), Positives = 362/566 (64%), Gaps = 22/566 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNS----TDDAAASPGSRIIDRRnvllglgglygvanlaggPIA  309
             K++    R+SCKA    +     T +A  S G   +DRR++L+GLGGLYG A   G    
Sbjct  37    KKSHVHPRISCKATRDEHEKPTHTTEAIGSSGK--LDRRDMLIGLGGLYGAAAGLG---V  91

Query  310   SAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPA  486
             +   + + I  P++SKC  P+D+P+ A  T  CCPP  T  ++D+++P    P+R R  A
Sbjct  92    NRKALGLPIEAPDISKCG-PADLPSGATPT-DCCPPF-TSKIIDFKLPPRSDPLRIRPAA  148

Query  487   QFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
                  EY+ KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  EIQVHNSW
Sbjct  149   HLVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHNSW  208

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             +FFP+HR+YLYF+EKILGKLI D TFALP+WNWD  +GM MP+++   +SSLYD  R+  
Sbjct  209   IFFPWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMRMPSIYTDPSSSLYDKLRDAK  268

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             + PP ++DL++ G+D   +  + I  NL  +YR ++ NG T +LFMG  Y  G  P+PG 
Sbjct  269   HQPPYLIDLDFNGRDPSFTQAQQIDHNLNIMYRQVIANGKTAQLFMGSPYHAGDQPNPGG  328

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-  1203
             GS+E +PH  VH W GD  +QPNGEDMG  YSA RDP+F++HH+NVDRMW +W K+LGG 
Sbjct  329   GSLENVPHGTVHVWTGDR-NQPNGEDMGTLYSAARDPIFFAHHSNVDRMWYVW-KMLGGK  386

Query  1204  -KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTG  1380
              KDF D  WLN SFLFYDEN   VRV  KDC+D   + Y Y+   +PWLK++P+P  T  
Sbjct  387   HKDFEDKDWLNTSFLFYDENADLVRVKIKDCLDTQWLRYTYQDVEIPWLKARPTPKGTVA  446

Query  1381  A--AAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             A   A S        FPVTL+  V   V RPK SR+  EK+ EEEVLV++GIE   D + 
Sbjct  447   AKKGARSLRAVTEAAFPVTLESSVSATVRRPKVSRSSKEKKDEEEVLVVEGIEFDRDMFI  506

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK---TSVRLGLNEPLEDLGAED  1725
             +FDVY+N  ++       +++AG F ++PHK   S   K   T++RLG+ E LEDLGAE 
Sbjct  507   KFDVYINTPEEEGVDPGSSEFAGSFVNVPHKHNHSKKEKKLRTALRLGITELLEDLGAEA  566

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD+VLVTL P+ G G   V  +RIE+
Sbjct  567   DDSVLVTLVPRKGKGKAKVGGLRIEF  592



>ref|XP_008364152.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08583.1| polyphenol oxidase IVa [Malus domestica]
Length=587

 Score =   466 bits (1198),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 252/551 (46%), Positives = 338/551 (61%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N   D     G   +DRRN+L+GLG     +       A AA V      
Sbjct  48    RVRCKATKGDNDNLDQ----GLARLDRRNMLIGLGTGGLYSAAGNS-FAFAAPVSA----  98

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP+ T T++D+++P  GP+R R+ AQ   +   Y+ K
Sbjct  99    PDLTTCG-PADKPDGSTID--CCPPI-TTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAK  154

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  155   YKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYL  214

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WNWD  +GM +P +F  T+SSLYD NRN  + PP ++DLN
Sbjct  215   YFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTBTSSSLYDQNRNTAHQPPKLLDLN  274

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  P PG G++E  PH  
Sbjct  275   YGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAGNIETTPHNN  334

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H WVGD   Q NGEDMG FYSAGRDPLFYSHH+NVDRMW I++  LGG D     WL+A
Sbjct  335   IHLWVGDPT-QTNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEXTDWLDA  393

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV  +D +D   +GY Y+             +   T    A  ++  +
Sbjct  394   XFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNKRKATVSSSDL  453

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP TL   + V+V+RP  T RT A+K+  +EVLVI GIE A ++  +FDVY+ND  +
Sbjct  454   TTTFPATLSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVKFDVYVNDDAE  513

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D +++VTL P+VG 
Sbjct  514   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSIMSLLEELDAETDXSLVVTLVPKVGK  571

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  572   GPITIGGFSIE  582



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   466 bits (1199),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 280/579 (48%), Positives = 373/579 (64%), Gaps = 35/579 (6%)
 Frame = +1

Query  139   KKRNQTRLRVSCK--ANN-------PNNSTDDAAASPGSRIIDRRnvllglgglygvanl  291
             +KR+    +VSCK  +NN       PN S+ D   +P  + +DRR VLLGLGGLYGV  L
Sbjct  31    QKRSLLTSKVSCKVTSNNSDHLRKSPNTSSKDGELTP--KKVDRREVLLGLGGLYGVTTL  88

Query  292   aggPIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPM  468
             +  P++ AA V      P++S+C   +D+PA A  T  CCPP  ++ ++D+++P +  P+
Sbjct  89    SSDPLSFAAPVSA----PDLSRCGK-ADLPAGAKPTN-CCPP-KSNKIIDFKLPPSNSPL  141

Query  469   RKRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEI  648
             R R  A  A  EYI KY  A+  MK L    P +F QQA++HCAYC+G Y Q GFP  ++
Sbjct  142   RIRPAAHLADNEYIAKYYKAVELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLDL  201

Query  649   QVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYD  828
             QV NSWLFFPFHR+YLYFYEKILGKLI DPTF +P+WNWD+  G  MP MF +  S LYD
Sbjct  202   QVRNSWLFFPFHRYYLYFYEKILGKLIGDPTFVMPFWNWDSPPGTPMPAMFANPKSPLYD  261

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
               RN N+ PP + DL+Y+G D   ++E+ I+ NL  +YR MV+N  T  LF+G  Y  G 
Sbjct  262   TLRNSNHQPPTLADLDYSGTDVTTTNEKQISSNLKVMYRQMVSNSKTPRLFLGNTYRAGD  321

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
              P PG G++E +PH P+H W GD+  QPN E+MGNFYSA RDP+FY+HH+NVDRMW +W 
Sbjct  322   EPDPGAGALENLPHGPIHLWCGDT-KQPNFENMGNFYSAARDPIFYAHHSNVDRMWTVW-  379

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskps  1362
             K LGGK  +FTD  WLNA FLFYDEN   VRV  +DC+D+  +GY Y+   +PWL++KP 
Sbjct  380   KTLGGKRTNFTDPDWLNAGFLFYDENANLVRVKVRDCLDSKKLGYVYQDVDVPWLRTKPK  439

Query  1363  pskTTGAAAASNAPFV-----------TDVFPVTLDKVVQVKVSRPKTSRTKAekekeee  1509
             P K     A    P             +  FP+ LD +    V RPK SR+K EKE+EEE
Sbjct  440   PKKLRKKVAKLLGPVALAAEINTKLTPSSQFPLVLDSIKSTVVPRPKKSRSKKEKEEEEE  499

Query  1510  VLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLG  1689
             +LVID I    +   +FDVY+ND DQ   G +  ++AG F ++PHK +     KT +RLG
Sbjct  500   ILVIDNIGFEREAVVKFDVYVNDEDQA-IGPENTEFAGSFVNVPHKHKHGKKMKTCLRLG  558

Query  1690  LNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             L + LEDL AEDDD+V+VTL P+ G G+V +  I+I+++
Sbjct  559   LTDLLEDLEAEDDDSVVVTLVPKYGKGLVSIGGIKIDFA  597



>ref|XP_004146644.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis sativus]
 gb|KGN64656.1| hypothetical protein Csa_1G073640 [Cucumis sativus]
Length=577

 Score =   465 bits (1197),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 263/574 (46%), Positives = 354/574 (62%), Gaps = 35/574 (6%)
 Frame = +1

Query  142   KRNQTRL---RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIAS  312
             ++ +T L   R+SCKA N N+        P  +I  R  ++   G             A 
Sbjct  17    RKTKTLLITPRISCKATNHNDQN-----FPNPKIDRRDILIGLTGLYGSSTLSQSTHFAL  71

Query  313   AADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQF  492
             AA ++     PN+SKC  P D+P  AD T  CCPP P  T+LD+Q P    +R R  A  
Sbjct  72    AAPIET----PNISKCG-PPDLPPGADAT-NCCPP-PATTILDFQPPPPSKLRVRPAAHL  124

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
             A + YI KY+ A+  MK L    P SF QQAN+HCAYCNG Y Q GFP E +QVHNSWLF
Sbjct  125   ADRNYIEKYKKAVELMKALPEDDPRSFTQQANVHCAYCNGAYDQVGFPVE-VQVHNSWLF  183

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR+YLYF+EKILG+LI DP+FALP+WN+D   GM MP M+    SSLYD  RN N+L
Sbjct  184   FPFHRFYLYFHEKILGELIGDPSFALPFWNYDAPDGMKMPGMYAEEKSSLYDELRNENHL  243

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP +VDL++ G D  + D+  I  NL  +YR MV+   T  LF G  YV G  PSPG GS
Sbjct  244   PPRLVDLDFGGVDPNIGDDAQIKSNLSIMYRQMVSGSRTPSLFFGSAYVAGDEPSPGGGS  303

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--  1206
             VE IPH PVH W GD+ DQPN E+MGNFYSA RDP+F++HH+N+DR+W +W K LGG+  
Sbjct  304   VENIPHGPVHVWCGDT-DQPNFENMGNFYSAARDPIFFAHHSNIDRLWSVW-KTLGGRRQ  361

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------Ysslpwlkskp  1359
             +  +  WLNASF+FYDE  QP+RV  +DC+D+ ++GY Y+           +    +   
Sbjct  362   NLQNPEWLNASFIFYDEKAQPIRVRVRDCLDSKSLGYIYQPVDLPWLQTRPTPRRAQKTS  421

Query  1360  spskTTGAAAASNAPFVTDV------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
             + +     A A+  P  + V      FP+T+   V V+V RPK SR+K EKE+EEEVLVI
Sbjct  422   TVAFGIAPALAAGGPSSSRVKPANIKFPITVKSPVSVEVKRPKKSRSKKEKEEEEEVLVI  481

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEP  1701
              GI    +   +FDV++ND D  +   D  ++AG F ++PHK       KT +R+G+ E 
Sbjct  482   YGIGFDPNNGIKFDVFINDEDDKEIKPDNTEFAGSFVNVPHKHGHKKKVKTGLRVGITEE  541

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             LEDL A++DD+++VT+ P++G G+  +D ++IE+
Sbjct  542   LEDLEADNDDSIIVTILPRIGAGLFSIDGLKIEF  575



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   464 bits (1194),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 268/565 (47%), Positives = 350/565 (62%), Gaps = 32/565 (6%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RVSCKA N +N  D A        +DRRNVLLGLGGLYGVA L   P A A  V+     
Sbjct  41    RVSCKAKNSDNQNDQAQTK-----LDRRNVLLGLGGLYGVAGLGTDPFAFAKPVNP----  91

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC   +D+P  A  T  CCPP+ T  ++D+++P  G +R R  A    Q YI KY 
Sbjct  92    PDLSKCGA-ADLPTGATPTN-CCPPLAT-KIIDFKLPAPGKLRVRPAAHAVDQAYIEKYS  148

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+Q+HNSWLFFPFHR+ LYF
Sbjct  149   KAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRYCLYF  208

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YEKILGKLINDPTFALP+WNWD+ +GM +P +F +  S LYD  R  ++ PP ++DL+Y 
Sbjct  209   YEKILGKLINDPTFALPFWNWDSPAGMQLPALFANPKSPLYDKFRAASHQPPTLIDLDYN  268

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S+E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG PH PVH
Sbjct  269   GTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIEGTPHGPVH  328

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNA  1236
              W GD+  Q N EDMGNFYSA RDP+F+SHH+NVDRMW IW K LGGK  D +   WL++
Sbjct  329   LWTGDNT-QSNFEDMGNFYSAARDPIFFSHHSNVDRMWSIW-KTLGGKRTDISQSDWLDS  386

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------YsslpwlkskpspskTT  1377
              FLFY+EN + VRV  +D +++ ++GY Y+               +   L          
Sbjct  387   GFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLELSKIKKKLGVA  446

Query  1378  GAAAASNAPFVTDVFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
              AA +S        FP+ L+  +   V RP +  R K EKE+EEE+LVI+GIE   D   
Sbjct  447   QAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDRDVAV  506

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             +FDVY+ND D    G DK ++AG F  +PH+ +      T +RLGL + LED+ AEDD++
Sbjct  507   KFDVYVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEDIEAEDDES  566

Query  1735  VLVTLAPQVGGGVVDVDSIRIEYST  1809
             V+VTL P+ G   V +  ++IE+++
Sbjct  567   VVVTLVPKYGA--VKIGGVKIEFAS  589



>ref|XP_008364151.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=582

 Score =   464 bits (1193),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 250/559 (45%), Positives = 346/559 (62%), Gaps = 22/559 (4%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             +++ +  LRV+ K    N++ D   A      +DRRN+L+GLG       +   P A AA
Sbjct  36    QRKPKQCLRVAQKTKGDNDNLDQGLAR-----LDRRNMLIGLGAGGLYGAVGN-PFAFAA  89

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFAT  498
              V      P+++ C  P++ P  + I   CCPP  T T++D+++P  GP+R R  AQ   
Sbjct  90    PVSA----PDLTTCG-PANKPDGSTID--CCPPT-TTTIIDFELPDSGPLRTRPAAQDVA  141

Query  499   Q--EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
                EY+ KY+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLF
Sbjct  142   NDPEYLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLF  201

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHRWYLYFYEKI+G+LI DPTFALP+WNWD  +GM +P +F+ T+SSLYD  RN  + 
Sbjct  202   FPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFIDTSSSLYDQYRNAAHQ  261

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DLNY G D  + D   I ENL  +Y+ MV+N  +  LF G+ Y  G  PSPG G+
Sbjct  262   PPKLLDLNYGGTDDDVDDATRIKENLTTMYKQMVSNATSHRLFYGEPYSAGDEPSPGAGN  321

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDF  1212
             +E  PH  +H W GD   Q NGEDMG FYSA RDPLFYSHH+NVDRMW I++  LGG D 
Sbjct  322   IETTPHNNIHLWAGDPT-QTNGEDMGTFYSAARDPLFYSHHSNVDRMWXIYKDKLGGTDI  380

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAA  1386
              +  WL+A FLFYDE +  VRV  +D +D   +GY Y+ +           +   T    
Sbjct  381   ENTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDENVSIPWLESKPTTRKSTNKRK  440

Query  1387  AASNAPFVTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
             A  ++  ++  FP TL  ++ V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FD
Sbjct  441   AXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETVKFD  500

Query  1564  VYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLV  1743
             VY+ND      GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D++++V
Sbjct  501   VYVNDDADSLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSITSLLEELDAETDNSLVV  558

Query  1744  TLAPQVGGGVVDVDSIRIE  1800
             TL P+VG G + +    IE
Sbjct  559   TLVPKVGKGPITIGGFSIE  577



>ref|XP_008371330.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
Length=587

 Score =   463 bits (1191),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 251/551 (46%), Positives = 337/551 (61%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N   D     G   +DRRN+L+GLG     +       A AA V      
Sbjct  48    RVRCKATKGDNDNLDQ----GLARLDRRNMLIGLGTGGLYSAAGNS-FAFAAPVSA----  98

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP+ T T++D+++P  GP+R R+ AQ   +   Y+ K
Sbjct  99    PDLTTCG-PADKPDGSTID--CCPPI-TTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAK  154

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  155   YKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYL  214

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WNWD  +GM +P +F  T+SSLYD NRN  + PP ++DLN
Sbjct  215   YFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTBTSSSLYDQNRNTAHQPPKLLDLN  274

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  P PG G++E  PH  
Sbjct  275   YGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAGNIETTPHNN  334

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H WVGD   Q NGEDMG FYSAGRDPL YSHH+NVDRMW I++  LGG D     WL+A
Sbjct  335   IHLWVGDPT-QTNGEDMGTFYSAGRDPLXYSHHSNVDRMWSIYKDKLGGTDIEXTDWLDA  393

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV  +D +D   +GY Y+             +   T    A  ++  +
Sbjct  394   EFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNKRKATVSSSDL  453

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP TL   + V+V+RP  T RT A+K+  +EVLVI GIE A ++  +FDVY+ND  +
Sbjct  454   TTTFPATLSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVKFDVYVNDDAE  513

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D +++VTL P+VG 
Sbjct  514   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSIMSLLEELDAETDSSLVVTLVPKVGK  571

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  572   GPITIGGFSIE  582



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   462 bits (1190),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 259/567 (46%), Positives = 349/567 (62%), Gaps = 38/567 (7%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRR--nvllglgglygvanlaggPIASAADVDVAI  336
             +V+CKA N  N +   + +     +DRR   ++   G        +  P A AA V    
Sbjct  40    KVTCKATNEQNPSSKDSLNK----LDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSA--  93

Query  337   HYPNVSKCHYPSDVPANADIT-GTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
               P++SKC         AD T   CCPP  T+ ++++++P +   +R R  A  +   YI
Sbjct  94    --PDISKC-------GKADTTTDNCCPPKSTN-IINFKLPPSNSSLRVRPAAHLSDDAYI  143

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P SF  QAN+HCAYC+G Y Q GFP  ++Q+HNSWLFFPFHR+
Sbjct  144   AKYSKAIELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRY  203

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYEKILGKLI+DPTFALP+WNWD+  GM MP MF +  S LYD  RN N+ PP ++D
Sbjct  204   YLYFYEKILGKLIDDPTFALPFWNWDSPPGMQMPPMFANPNSPLYDKLRNANHQPPTLLD  263

Query  871   LNY--AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
             L+Y     D+  + ++ I+ NL  +YR MV+NG T++LF+G  Y  G  P PG GS+E  
Sbjct  264   LDYNETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDDPEPGSGSIENA  323

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTD  1218
             PH PVH W GD+  QPN E+MGNFYSAGRDP+F++HH+N+DRMW IW + LGGK  +FT+
Sbjct  324   PHNPVHLWCGDNT-QPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIW-RTLGGKRTNFTE  381

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Ysslpwlkskpsp  1365
               WL+++FLFYDEN   VRV  +DC+D   +GY Y+                  K     
Sbjct  382   PDWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKA  441

Query  1366  skTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                  AA         +VFP+ LD+V+   V RPK SR+K EKE+EEEVLV+D IE   D
Sbjct  442   FGVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERD  501

Query  1546  QYARFDVYLN-DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
                +FDVY+N D D+   G D +++AG F ++PHK +     KTS+RLGL + LEDLGAE
Sbjct  502   ARVKFDVYINEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKMKTSLRLGLTDLLEDLGAE  561

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DDD+V+VTL P+ G G+  +  I+I++
Sbjct  562   DDDSVIVTLVPKFGKGLARIGGIKIDF  588



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   462 bits (1190),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 260/569 (46%), Positives = 348/569 (61%), Gaps = 38/569 (7%)
 Frame = +1

Query  157   RLRVSCKANNPNNSTDDAAASPGSRIIDRR--nvllglgglygvanlaggPIASAADVDV  330
             + +V+CKA N  N +   + +     +DRR   ++   G        +  P A AA V  
Sbjct  38    KRKVTCKATNEQNPSSKDSLNK----LDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSA  93

Query  331   AIHYPNVSKCHYPSDVPANADIT-GTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQE  504
                 P++SKC         AD T   CCPP  T+ ++++++P +   +R R  A  A   
Sbjct  94    ----PDISKC-------GKADTTTDNCCPPKSTN-IINFKLPPSNSSLRVRPAAHLADDA  141

Query  505   YINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFH  684
             YI KY  A+  MK L    P SF  QAN+HCAYC+G Y Q GFP  ++Q+HNSWLFFPFH
Sbjct  142   YIAKYSKAIELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFH  201

Query  685   RWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAI  864
             R+YLYFYEKILGKLI+DPTFALP+WNWD+  GM MP MF    S LYD  RN N+ PP +
Sbjct  202   RYYLYFYEKILGKLIDDPTFALPFWNWDSPPGMQMPPMFAKPNSPLYDKLRNANHQPPTL  261

Query  865   VDLNY--AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
             +DL+Y     D+  + ++ I+ NL  +YR MV+NG T++LF+G  Y  G  P PG GS+E
Sbjct  262   LDLDYNETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDEPEPGSGSIE  321

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DF  1212
               PH PVH W GD+  QPN E+MGNFYSAGRDP+F++HH+N+DRMW IW + LGGK  +F
Sbjct  322   NTPHNPVHLWCGDNT-QPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIW-RTLGGKRTNF  379

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Ysslpwlkskp  1359
             T+  WL+++FLFYDEN   VRV  +DC+D   +GY Y+                  K   
Sbjct  380   TEPDWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVA  439

Query  1360  spskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
                    AA         +VFP+ LD+V+   V RPK SR+K EKE+EEEVLV+D IE  
Sbjct  440   KAFGVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFE  499

Query  1540  MDQYARFDVYLN-DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLG  1716
              D   +FDVY+N D D    G D +++AG F ++PHK +     KTS+RLGL + LEDLG
Sbjct  500   RDARVKFDVYINEDEDGMPIGPDNSEFAGSFVNVPHKHKHGKKMKTSLRLGLTDLLEDLG  559

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             AEDDD+V+VTL P+ G G+  +  I+I++
Sbjct  560   AEDDDSVVVTLVPKFGKGLARIGGIKIDF  588



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   462 bits (1189),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 259/567 (46%), Positives = 349/567 (62%), Gaps = 38/567 (7%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRR--nvllglgglygvanlaggPIASAADVDVAI  336
             +V+CKA N  N +   + +     +DRR   ++   G        +  P A AA V    
Sbjct  40    KVTCKATNEQNPSSKDSLNK----LDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVST--  93

Query  337   HYPNVSKCHYPSDVPANADIT-GTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
               P++SKC         AD T   CCPP  T+ ++++++P +   +R R  A  +   YI
Sbjct  94    --PDISKC-------GKADTTTDNCCPPKSTN-IINFKLPPSNSSLRVRPAAHLSDDAYI  143

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P SF  QAN+HCAYC+G Y Q GFP  ++Q+HNSWLFFPFHR+
Sbjct  144   AKYSKAIELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRY  203

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYEKILGKLI+DPTFALP+WNWD+  GM MP MF +  S LYD  RN N+ PP ++D
Sbjct  204   YLYFYEKILGKLIDDPTFALPFWNWDSPPGMQMPPMFANPNSPLYDKLRNANHQPPTLLD  263

Query  871   LNY--AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
             L+Y     D+  + ++ I+ NL  +YR MV+NG T++LF+G  Y  G  P PG GS+E  
Sbjct  264   LDYNETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDDPEPGSGSIENA  323

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTD  1218
             PH PVH W GD+  QPN E+MGNFYSAGRDP+F++HH+N+DRMW IW + LGGK  +FT+
Sbjct  324   PHNPVHLWCGDNT-QPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIW-RTLGGKRTNFTE  381

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Ysslpwlkskpsp  1365
               WL+++FLFYDEN   VRV  +DC+D   +GY Y+                  K     
Sbjct  382   PDWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKA  441

Query  1366  skTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                  AA         +VFP+ LD+V+   V RPK SR+K EKE+EEEVLV+D IE   D
Sbjct  442   FGVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERD  501

Query  1546  QYARFDVYLN-DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
                +FDVY+N D D+   G D +++AG F ++PHK +     KTS+RLGL + LEDLGAE
Sbjct  502   ARVKFDVYINEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKMKTSLRLGLTDLLEDLGAE  561

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DDD+V+VTL P+ G G+  +  I+I++
Sbjct  562   DDDSVIVTLVPKFGKGLARIGGIKIDF  588



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   462 bits (1189),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 266/573 (46%), Positives = 355/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGGLYGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGLYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC   +D+P  A+ T  CCPP P   ++D+++P    +R R PA    +
Sbjct  91    ---PIAPPDVSKCGS-ADLPQGAEAT-NCCPP-PATKIIDFKLPAPAKLRIRPPAHAVDK  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVHNSWLFFPF
Sbjct  145   AYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EKILGKLINDPTFA+P+WNWD+ +GM +P ++    S LYD  R+  + PP 
Sbjct  205   HRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKFRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             ++DL+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG
Sbjct  265   LIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH PVH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  D  
Sbjct  325   TPHGPVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIW-KTLGGKRTDLA  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALGKI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGI  1530
                     AA AS++  V    FP++L   +   V RPK  +   + ++ EEE+LVI+GI
Sbjct  443   AKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + LE+
Sbjct  503   EFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V++  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   462 bits (1188),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 266/573 (46%), Positives = 355/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGGLYGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGLYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC   +D+P  A+ T  CCPP P   ++D+++P    +R R PA    +
Sbjct  91    ---PIAPPDVSKCGS-ADLPQGAEAT-NCCPP-PATKIIDFKLPAPAKLRIRPPAHAVDK  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVHNSWLFFPF
Sbjct  145   AYRDKFYKAMGLMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EKILGKLINDPTFA+P+WNWD+ +GM +P ++    S LYD  R+  + PP 
Sbjct  205   HRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKSPLYDKFRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             ++DL+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG
Sbjct  265   LIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH PVH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  D  
Sbjct  325   TPHGPVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIW-KTLGGKRTDLA  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALGKI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGI  1530
                     AA AS++  V    FP++L   +   V RPK  +   + ++ EEE+LVI+GI
Sbjct  443   AKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + LE+
Sbjct  503   EFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V++  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   461 bits (1187),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 271/564 (48%), Positives = 360/564 (64%), Gaps = 26/564 (5%)
 Frame = +1

Query  145   RNQTR-LRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             +N +R  ++SCK++N      D  + P     DRRN+L+GLGGLYG   LA  P + AA 
Sbjct  37    KNPSRSYKISCKSSN-----HDHESPPPPSKFDRRNLLIGLGGLYGATTLATSPFSFAA-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFAT  498
                 I  P+V++C  P+D+PA A  T  CCPP+ T  +LD+Q P     +R R  A  A 
Sbjct  91    ---PISGPDVTQCG-PADLPAGATPTN-CCPPL-TGEILDFQFPAPPAKLRIRPAAHLAD  144

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
               YI K+  A+  M+ L    P SF QQAN+HCAYC+G Y Q GFP  E+QVHNSWLFFP
Sbjct  145   DAYIAKFNRAVELMRALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQVHNSWLFFP  204

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             FHR+YLYFYE+IL KLI+DP+FA+PYWNWD  +GM +P ++ + +S+LYD  R+  + PP
Sbjct  205   FHRYYLYFYERILAKLIDDPSFAMPYWNWDAPAGMPIPRIYANPSSALYDPLRDKAHQPP  264

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
             A+VDLNY+G D   +  +    NL  +YR MV+N  T  LF G  Y  G  P+PG GS+E
Sbjct  265   ALVDLNYSGTDPATTANQQAQTNLTVMYRQMVSNSKTPRLFFGSPYRRGEDPNPGGGSIE  324

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DF  1212
             GIPH PVH W GD   QPN E+MGNFYSA RDP+FY+HH+N+DRMW +W K LGG+  D 
Sbjct  325   GIPHGPVHVWTGDRT-QPNTENMGNFYSAARDPIFYAHHSNIDRMWSVW-KTLGGRRQDI  382

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskpsps  1368
             TD  +L+A+FLFYDEN + VRV  +DC+D   +GY Y+            P + S     
Sbjct  383   TDPDFLDAAFLFYDENAKMVRVKVRDCLDPRKLGYAYQDVEIPWANSRPTPRVSSVLRKL  442

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
             K  G A A++A    +VFP  LD+V++V V RPK  R+K EK++ EE+LVI GIEV  D 
Sbjct  443   KKLGRAKAADAQSPREVFPAKLDRVLKVMVKRPKKKRSKKEKDELEEILVIKGIEVDRDT  502

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDD  1728
             Y +FDVY+ND D      +  ++AG F ++PHK +     KT +RL +++ LEDL AEDD
Sbjct  503   YVKFDVYINDEDDEITTAENTEFAGSFVNVPHKHKHDKKIKTQLRLSISDILEDLDAEDD  562

Query  1729  DTVLVTLAPQVGGGVVDVDSIRIE  1800
             + VLVTL P   G  + +  I+IE
Sbjct  563   EHVLVTLVPTNAGDAITIHDIKIE  586



>gb|AAB22610.1| polyphenoloxidase (chloroplast) [Solanum lycopersicum]
Length=587

 Score =   461 bits (1187),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 275/565 (49%), Positives = 354/565 (63%), Gaps = 31/565 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H +RNQ+  +VSC ANN + + D          +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  40    HGRRNQS-FKVSCNANNVDKNPD---------AVDRRNVLLGLGGLYGAANLA--PLATA  87

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + V    D+  +CCPPVP   D+V  Y+ P+   +R R PA 
Sbjct  88    A----PIPPPDLKSCG-TAHVKEGVDVIYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAH  142

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EY+ KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  143   AADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFS  199

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  200   WLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDEKRNQ  259

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + GK+      +++  NL  +YR MVTN      F G  Y+    PSPG
Sbjct  260   NHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYLWVLNPSPG  319

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
             QG++E IPHTPVH W GD   Q NGEDMGNFYSAG DP+FY HHANVDRMW  W KL+GG
Sbjct  320   QGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNEW-KLIGG  378

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D TD  WLN+ F FYDEN  P RV  +D +D+  MG+DY     PW   KP    ++
Sbjct  379   KRRDLTDKDWLNSEFFFYDENRNPYRVKVRDVLDSKKMGFDYAPMPTPWRNFKPIRKSSS  438

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G    ++   V+ VFP+  LD+ +   ++RP +SRT  EK ++EE+L  + I      Y 
Sbjct  439   GKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKISYDDRNYV  498

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH   S++   TSV  +L + E LED+G ED
Sbjct  499   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSVTFKLAITELLEDIGLED  558

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +DT+ VTL P+ GG  V ++S+ I+
Sbjct  559   EDTIAVTLIPKAGGEGVSIESVEIK  583



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   461 bits (1186),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 326/506 (64%), Gaps = 24/506 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYINKY  519
             P+++KC   +D+P++A  T  CCPP P+  +LD+++P+   P+R R  A      Y+ KY
Sbjct  86    PDLTKCG-KADLPSSAKPTN-CCPP-PSTKILDFKLPSSNSPLRIRPAAHVVDDAYLAKY  142

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK L    P SF QQAN+HCAYC+G Y Q G P  ++QVHNSWLFFPFHR++LY
Sbjct  143   SKAIELMKALPDDDPRSFMQQANVHCAYCDGAYHQVGLPDLDLQVHNSWLFFPFHRYFLY  202

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILGKLI+DPTFALP+WNWD+ +GM +P +++   S LYD  RN N+ PP +VDL+Y
Sbjct  203   FHEKILGKLIDDPTFALPFWNWDSPAGMQLPAIYVDPKSPLYDQFRNKNHQPPTLVDLDY  262

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
              G +   S +EL++ NL  +YR MV+NG T  LF G  Y  G    PG GS+E IPH PV
Sbjct  263   NGSENPTSKQELLSSNLTIMYRQMVSNGKTARLFHGSAYRAGDEADPGAGSIENIPHGPV  322

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLN  1233
             H W GD+  QPN EDMGNFYSA RDP+F++HH+NVDRMW IW+ L G K  +FTD  WL+
Sbjct  323   HVWCGDNT-QPNLEDMGNFYSAARDPIFFAHHSNVDRMWTIWKTLGGNKRTEFTDPDWLD  381

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslpwlkskpsps  1368
             A F+FYDEN  PVRV  +DC+D   +GY Y+                      K      
Sbjct  382   AEFIFYDENANPVRVKVRDCIDTKKLGYIYQDVDIPWLKSRPKSRRLIKKVANKVFHHDG  441

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
             +   AA   N P +T  FP+ LDKV+     RPK SR+K EKE+EEEVL+ID IE   + 
Sbjct  442   QAAHAAETLNLPPIT-AFPLVLDKVISTVAKRPKKSRSKKEKEEEEEVLLIDAIEFERNA  500

Query  1549  YARFDVYLNDS-DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
               +FDVY+ND  D      D +++AG F ++PHK +     KT +RLGL + LED+GAED
Sbjct  501   LVKFDVYVNDEHDSTSARPDNSEFAGSFVNIPHKHKHGKKMKTCLRLGLTDLLEDMGAED  560

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DDTV+VTL P+ G G+V +  I I+Y
Sbjct  561   DDTVVVTLVPRYGKGLVKIGGIMIDY  586



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   461 bits (1187),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 270/564 (48%), Positives = 353/564 (63%), Gaps = 25/564 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             R+ CK+ + N S  D    P    +DRRNVL+GLGGLYGV      P A A  V      
Sbjct  45    RIICKSTSSNQSPSDEHKHPHQTNVDRRNVLIGLGGLYGVGLGGADPFAFAKPV----AP  100

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC   +D+P  A     CCPP+ +D ++D+  P+  P+R R  A    Q YI+KY 
Sbjct  101   PDLSKCGA-ADLPPGATPIN-CCPPI-SDKIVDFTFPSSSPLRVRPAAHAVDQAYIDKYS  157

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L  S P SF QQA+IHCAYC+G Y Q GFP  E+Q+H SWLFFPFHR+YLYF
Sbjct  158   KAIELMKALPDSDPRSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFFPFHRYYLYF  217

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YEKILGKLI+DPTFALP+WNWD+  GM +P +F    S LY+  RN N+ PP ++DL++ 
Sbjct  218   YEKILGKLIDDPTFALPFWNWDSPPGMKLPALFADPKSPLYNELRNANHQPPTLLDLDWN  277

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
               D   ++ + I+ NL  +YR MV+N    +LF G  Y  GT PSPG GS+E  PH P+H
Sbjct  278   LTDTPTTEADQISSNLKIMYRQMVSNAKKQQLFFGTAYRAGTDPSPGSGSIESTPHGPIH  337

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDSWLNAS  1239
              W GD+  QPN EDMGNFYSA RDP+F+SHH+NVDRMW +W+      KD TD  WL+  
Sbjct  338   VWTGDNT-QPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTFGATNKDITDPDWLDTG  396

Query  1240  FLFYDENEQPVRVYAKDCMDNIAMGYDYE--------YsslpwlkskpspskTTGAA-AA  1392
             FLFYDEN Q VRV  +DC+D+  +GY Y+            P        +K  G A AA
Sbjct  397   FLFYDENAQLVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPTPRRSKLAKAAKAIGVARAA  456

Query  1393  SNAPFVT--DVFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
             S+ P V     FP+ LD  +   V RP +  R+K EKE EEE+LVI GIE   D   +FD
Sbjct  457   SSGPKVVGRSDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDMAVKFD  516

Query  1564  VYLNDSDQPD--GGKDKAQYAGGFAHLP--HKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
             VY+ND +  D  G  D +++AG F ++P  HK +    TK+ +RLGL + LEDLGAEDD+
Sbjct  517   VYVNDLEDDDEPGKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLGAEDDE  576

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEY  1803
             +V+VTL P+ G   + +D+I+IE+
Sbjct  577   SVVVTLVPRYGTKSLKIDTIKIEF  600



>gb|ADF59058.2| polyphenol oxidase IV [Pyrus x bretschneideri]
Length=587

 Score =   460 bits (1184),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 250/551 (45%), Positives = 338/551 (61%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N + D     G   +DRRN+L+GLG           P A AA     I  
Sbjct  48    RVRCKATKGDNDSLDQ----GLARLDRRNMLIGLGAGGLYGAAGN-PFAFAA----PISA  98

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP  T T++D+++P  GP+R R  AQ   ++  Y+ K
Sbjct  99    PDLTTCG-PADKPDGSTID--CCPPT-TTTIIDFKLPDKGPLRTRPAAQDVAKDPAYLAK  154

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  155   YKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYL  214

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKILG+LI DPTFALP+WNWD  +GM +P +F  T+SSLYD  RN  + PP ++DLN
Sbjct  215   YFYEKILGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDLN  274

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y+G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  PSPG G++E IPH  
Sbjct  275   YSGTDDDVDDPTRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPSPGAGNIESIPHNN  334

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q NGEDMG FYS+GRDPLFYSHH+NVDRMW I++  LGG D     WL+ 
Sbjct  335   IHFWTGDPT-QTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKTDWLDT  393

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV  +D +D   +GY Y+             +   T    A+ ++  +
Sbjct  394   EFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNKRKASVSSSDL  453

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP  L   + V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FDV++ND   
Sbjct  454   TTTFPAVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVFVNDDAD  513

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D +++VTL P+VG 
Sbjct  514   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSIASLLEELAAETDSSLVVTLVPKVGK  571

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  572   GPITIGGFSIE  582



>ref|XP_008371328.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=587

 Score =   460 bits (1184),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 252/551 (46%), Positives = 336/551 (61%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N   D     G   +DRRN+L+GLG           P A AA V      
Sbjct  48    RVXCKATKGDNENLDQ----GLARLDRRNMLIGLGAGGLYGAAGN-PFAFAAPVSA----  98

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP  T T++D+++P  GP+R R+ AQ   +   Y+ K
Sbjct  99    PDLTTCG-PADKPDGSTID--CCPPT-TTTIIDFKLPDRGPLRTRLAAQDVAKNPAYLAK  154

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P SF QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  155   YKKAIELMRALPDDDPRSFAQQAKVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYL  214

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WNWD  +GM +P +F  T+SSLYD  RN  + PP ++D N
Sbjct  215   YFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDFN  274

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y+G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  PSPG G++E IPH  
Sbjct  275   YSGTDDBVDDATXIKENLTTMYQQMVSKATSHRLFFGEPYSAGDDPSPGAGNIESIPHNN  334

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q NGEDMG FYS+GRDPLFYSHH+NVDRMW I++  LGG D     WL+ 
Sbjct  335   IHFWTGDPT-QTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKTDWLDT  393

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV   D +D   +GY Y+                 T    AA ++  +
Sbjct  394   EFLFYDEKKNLVRVKVCDSLDTKKLGYVYDEKVPIPWLKSKPTXRKSTNKRKAAVSSSDL  453

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP TL   + V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FDVY+ND   
Sbjct  454   TTTFPATLSBTISVEVTRPSATKRTTAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDDAD  513

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D +++VTL P+VG 
Sbjct  514   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSITSLLEELDAETDSSLVVTLVPKVGK  571

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  572   GPITIGGFSIE  582



>ref|XP_009334438.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=586

 Score =   459 bits (1182),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 250/551 (45%), Positives = 337/551 (61%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N   D     G   +DRRN+L+GLG           P A AA     I  
Sbjct  47    RVRCKATKGDNDNLDQ----GLARLDRRNMLIGLGAGGLYGAAGN-PFAFAA----PISA  97

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP  T T++D+++P  GP+R R  AQ   ++  Y+ K
Sbjct  98    PDLTTCG-PADKPDGSTID--CCPPS-TTTIIDFELPDSGPLRTRPAAQDVAKDPAYLAK  153

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  154   YKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYL  213

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKILG+LI DPTFALP+WNWD  +GM +P +F  T+SSLYD  RN  + PP ++DLN
Sbjct  214   YFYEKILGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSSLYDQYRNAAHQPPKLLDLN  273

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y+G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  PSPG G++E IPH  
Sbjct  274   YSGTDDDVDDPTRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPSPGAGNIESIPHNN  333

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q NGEDMG FYS+GRDPLFYSHH+NVDRMW I++  LGG D     WL+ 
Sbjct  334   IHFWTGDPT-QTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGTDIEKTDWLDT  392

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV  +D +D   +GY Y+             +   T    A+ ++  +
Sbjct  393   EFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNKRKASVSSSDL  452

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP  L   + V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FDV++ND   
Sbjct  453   TTTFPAVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVFVNDDAD  512

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D +++VTL P+VG 
Sbjct  513   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSIASLLEELAAETDSSLVVTLVPKVGK  570

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  571   GPITIGGFSIE  581



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   459 bits (1180),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 239/501 (48%), Positives = 318/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C     +P+ +D    CCPP  T+ + +++ P+   PMR R  A    Q Y+
Sbjct  84    IAPPDITQCEL-VPLPSESD-PSNCCPPTSTE-IKNFEFPSASSPMRIRPAAHLVDQAYV  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  E+Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLELQIHFSWLFFPWHRL  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPESPLYDPLRDANHQPPTLLD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D        EEL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PHT +H W GD  +Q NGE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GGK  D  
Sbjct  321   TPHTQIHYWTGDP-NQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKREDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF+DEN++ VRV  KD +D   +GY ++     + +           K+  
Sbjct  380   DSDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTRATPKLTRQEKSRR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             AA  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  440   AAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG D +++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDNSEFAGSFVNVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ GG  V V +++IE+
Sbjct  558   VTLVPRSGGDSVTVANVKIEF  578



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   459 bits (1181),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 272/570 (48%), Positives = 365/570 (64%), Gaps = 24/570 (4%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSR-IIDRRnvllglgglygvanlaggPIASA  315
             K+R +   +VSC+A +       +    GS   +DRRNVL+GLGGLYG   L  G +A  
Sbjct  39    KRRYRMVRKVSCEATDGEKKPTRSGNEEGSLGRLDRRNVLIGLGGLYGATGLCAGRLAFG  98

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQF  492
             A     I  P++SKC   +++PA A  T  C PP  ++ ++D+++P+   PMR R  A  
Sbjct  99    A----PIMPPDLSKCG-AANLPAGAKPTNRC-PPASSE-IVDFKLPSSSEPMRVRPAAHM  151

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
               +EYI KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSWLF
Sbjct  152   VDEEYIAKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLF  211

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             F FHR+YLYFYE++LGKLI+DPTFALPYWNWD  +GM MP M+ +  S LYD  R+  + 
Sbjct  212   FSFHRYYLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYANPNSPLYDKLRDAKHQ  271

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PP ++DLNY  +D  ++ E+L+  NL  +YR +V+NG T +LF+G  Y  G  P PG GS
Sbjct  272   PPTMIDLNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFGS  331

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG-GKD  1209
             +E +PH PVH W GD   QPN E+MGNFYSA RDP+FY+HH+NVDRMW IW+KL G  KD
Sbjct  332   LENVPHGPVHLWAGDRT-QPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGGRRKD  390

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------Ysslpwlkskps  1362
             F D  WLNA FL YDEN+Q VRV  +DC+D   + Y Y+           +   L +   
Sbjct  391   FKDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQ  450

Query  1363  pskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
               K T        P V++ FP  LD   +V V RP+ SR+K EKE EEE+LVID +E+  
Sbjct  451   KLKITDRGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVELER  509

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-ESSSTTKTSVRLGLNEPLEDLGA  1719
             D   +FDVY+ND D+P    DK+++AG F ++PHK  +  S  KT +R G++E LEDL A
Sbjct  510   DTVVKFDVYINDEDEP--SPDKSEFAGSFVNVPHKHGKKMSKLKTCLRFGISELLEDLEA  567

Query  1720  EDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             EDDD V+VT+ P++GG +V +  I+I +++
Sbjct  568   EDDDEVVVTIVPRIGGDLVTIGGIKIVFAS  597



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   459 bits (1181),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 271/562 (48%), Positives = 350/562 (62%), Gaps = 29/562 (5%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRII-DRRnvllglgglygvanlaggPIASAADVDVAIH  339
             R +C  N  NN T + +    S I+  RRNVLLGLGGL G   L   P A AA     I 
Sbjct  49    RTTCSENQ-NNPTPNPSEGELSHIVGHRRNVLLGLGGLCGAVTLNNNPFAFAA----PIS  103

Query  340   YPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINK  516
              P+++ C  P D PA A+ T  CCPP  +  ++D++ P +  P+R R  A     EY+ K
Sbjct  104   PPDLNTCG-PPDTPAGANPTN-CCPP--SSKIIDFKFPPSNQPLRVRPAAHLVNDEYLAK  159

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ AL  MK L    P +F QQAN+HCAYC+G Y Q GFP  ++Q+HNSWLFFPFHRWYL
Sbjct  160   YKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSWLFFPFHRWYL  219

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKILG LINDPTFALP+WNWD   GM +P+++    S LYD  RN N+ PP +VDL+
Sbjct  220   YFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYADPKSPLYDTLRNANHQPPTLVDLD  279

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             +  +D  +S+ + I+ NL  +YR +V+NG T  LF+G  Y  G  P PG GSVE +PH  
Sbjct  280   FNLED-PISNGK-ISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPGFGSVENVPHGS  337

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWL  1230
             VH W GD ++QPN EDMG FYSA RDP+F+SHH+N+DRMW IW K LGG  KDFTD  WL
Sbjct  338   VHLWTGD-INQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIW-KTLGGKRKDFTDSDWL  395

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------YsslpwlkskpspskTTG  1380
              + FLFYDEN+  VRV  KDC+D   +GY Y+           +       K + ++  G
Sbjct  396   ESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSRVQKVALAQNFG  455

Query  1381  AAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYAR  1557
               AA  A    +V FP+ LD VV   V RP  SR+K EKE+EEEVLVI+GIE   +   +
Sbjct  456   VGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLVIEGIEFERNTPVK  515

Query  1558  FDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSST-TKTSVRLGLNEPLEDLGAEDDDT  1734
             FDV++ND D      D  ++AG F  +PH  +  +    T +RLGL + LE+L AEDDD+
Sbjct  516   FDVFINDEDDKQIRPDNTEFAGSFVSVPHSHKHKNKDIITCLRLGLTDLLEELEAEDDDS  575

Query  1735  VLVTLAPQVGGGVVDVDSIRIE  1800
             V VTL P+ G G V +  I+I+
Sbjct  576   VRVTLVPRYGKGRVKIRGIKIK  597



>gb|AAA02877.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=583

 Score =   458 bits (1179),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 275/565 (49%), Positives = 352/565 (62%), Gaps = 27/565 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H +RNQ+  +VSC ANN     D    +     +DRRNVLLGLGGLYG ANLA  P+ASA
Sbjct  32    HGRRNQS-FKVSCNANNNVGEHDKNLDA-----VDRRNVLLGLGGLYGAANLA--PLASA  83

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             +     I  P++  C   + V    D++ +CCPPVP   D+V  Y+ P+   +R R PA 
Sbjct  84    S----PIPPPDLKSCGV-AHVKEGVDVSYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAH  138

Query  490   FATQEYINKYEAALTAMKNLDPSH--PHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EY+ KY+ A + M+ LD     P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  139   AADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFS  195

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  196   WLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDDKRNQ  255

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + GK+      +++  NL  +YR MVTN      F G  Y  GT PSPG
Sbjct  256   NHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGTEPSPG  315

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
             QG++E IPHTPVH W GD   Q NGE+MGNFYSAG DPLFY HHANVDRMW  W KL+GG
Sbjct  316   QGTIENIPHTPVHIWTGDKPRQKNGENMGNFYSAGLDPLFYCHHANVDRMWDEW-KLIGG  374

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D ++  WLN+ F FYDEN  P RV  +D +D+  MG+ Y     PW   KP    T 
Sbjct  375   KRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPMPTPWRNFKPIRKTTA  434

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G    ++   VT VFP+  LD+ +   ++RP +SRT  EK ++EE+L    I     QY 
Sbjct  435   GIVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFKKIAYDDTQYV  494

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH   +++   TSV   + + E LED+G ED
Sbjct  495   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHATSVTFTVAITELLEDIGLED  554

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +DT+ VTL P+VGG  V ++S+ I+
Sbjct  555   EDTIAVTLVPKVGGEGVSIESVEIK  579



>sp|Q06355.1|PPOB_SOLTU RecName: Full=Catechol oxidase B, chloroplastic; AltName: Full=Polyphenol 
oxidase; Short=PPO; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA02879.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=588

 Score =   458 bits (1179),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 274/565 (48%), Positives = 353/565 (62%), Gaps = 27/565 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H +RNQ+  +VSC ANN     D    +     +DRRNVLLGLGGLYG ANLA  P+ASA
Sbjct  37    HGRRNQS-FKVSCNANNNVGEHDKNLDT-----VDRRNVLLGLGGLYGAANLA--PLASA  88

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             +     I  P++  C   + V    D+T +CCPPVP   D+V  Y+ P    +R R PA 
Sbjct  89    S----PIPPPDLKSCGV-AHVTEGVDVTYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAH  143

Query  490   FATQEYINKYEAALTAMKNLDPSH--PHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EY+ KY+ A + M+ LD     P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  144   AADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFS  200

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  201   WLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDDKRNQ  260

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + G++      +++  NL  +YR MVTN      F G  Y  GT PSPG
Sbjct  261   NHRNGTIIDLGHFGQEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGTEPSPG  320

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              G++E IPHTPVH W GDS  Q NGE+MGNFYSAG DP+FY HHANVDRMW  W KL+GG
Sbjct  321   MGTIENIPHTPVHIWTGDSPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDEW-KLIGG  379

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D ++  WLN+ F FYDEN  P RV  +DC+D+  MG+ Y     PW   KP    T 
Sbjct  380   KRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPMPTPWRNFKPIRKTTA  439

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G    ++   VT VFP+  LD+ +   ++RP +SRT  EK ++EE+L  + +     +Y 
Sbjct  440   GKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKVAYDDTKYV  499

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH   +++   TSV  +L + E LED G ED
Sbjct  500   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSVTFKLAITELLEDNGLED  559

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +DT+ VTL P+VGG  V ++S+ I+
Sbjct  560   EDTIAVTLVPKVGGEGVSIESVEIK  584



>ref|XP_007211389.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
 gb|EMJ12588.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
Length=594

 Score =   458 bits (1179),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 235/505 (47%), Positives = 320/505 (63%), Gaps = 16/505 (3%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRV  480
             P A AA V      P+ ++C  P+D P  + I   CCPP+ T T++D+++P  GP+R R 
Sbjct  96    PFAFAAPVSA----PDFTECG-PADKPDGSTID--CCPPI-TKTIIDFKLPDPGPLRTRR  147

Query  481   PAQFATQE--YINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQV  654
             PAQ   ++  Y+ KY+ A+  M+ L    P S  QQA +HC+YC+GGY Q GFP  EIQV
Sbjct  148   PAQDLAKDPVYLAKYKKAVALMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQV  207

Query  655   HNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDAN  834
             H  WLF+PFHRWYLYFYEKI+G+LI DPTFALP+WNWD  +GM +P +F   TSSLYD  
Sbjct  208   HFCWLFYPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDPTSSLYDQY  267

Query  835   RNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP  1014
             RN  + PP ++DLNY G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G   
Sbjct  268   RNAAHQPPKLLDLNYGGSDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDA  327

Query  1015  SPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
             SPG G++E IPH  +H W GD   Q NGE+MG FYSAGRDPLFYSHH+NVDRMW I++ L
Sbjct  328   SPGAGNIESIPHNNIHLWSGDP-KQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDL  386

Query  1195  LGGKDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpsps  1368
             LGG D     WLN  FLFYDE +  VRV  +D +D   +GY Y+                
Sbjct  387   LGGTDIDKTDWLNTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDNKVPIPWLKAKPNPRK  446

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAMD  1545
                   AA ++  +T  FP TL   + V+V+RP T+ RT  +K+ ++EVLVI GIE A +
Sbjct  447   SQNQRKAAVSSGDLTTAFPATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFAGN  506

Query  1546  QYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             +  +FDV++ND    + GKD++++AG F H+PHKQ+ +   KT++RL + + LE+L AE 
Sbjct  507   EPLKFDVFVNDDADSEAGKDQSEFAGSFIHVPHKQKKN--IKTNLRLSITKLLEELDAET  564

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             D +++VTL P++G G + +    IE
Sbjct  565   DKSLVVTLVPKLGKGPITIGGFSIE  589



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   458 bits (1179),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 267/561 (48%), Positives = 354/561 (63%), Gaps = 26/561 (5%)
 Frame = +1

Query  166   VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHYP  345
             VSCKA+N  N  ++ ++S  S   DRR++LLGLG LYG  NL   P A AA     I  P
Sbjct  46    VSCKASN-GNQNNEGSSSLNS--FDRRDILLGLGSLYGATNLVSDPFALAA----LIAAP  98

Query  346   NVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKY  519
             ++S C   +   +++  + +  CCPP  T+ +LD++ P    +R R  A      Y+ K+
Sbjct  99    DLSLCENSTVTSSSSGTSISVPCCPPKTTN-ILDFKPPRFSTIRLRPAAHLVDANYLEKF  157

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK L    P SF QQAN+HCAYCNG Y Q GFP +++QVH SWLFFPFHR YLY
Sbjct  158   TKAIELMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLY  217

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILGKLI DP FA+P+WNWD+  GM +P +++   S LYD  RN N+ PP ++DL+Y
Sbjct  218   FYERILGKLIGDPNFAMPFWNWDSPPGMAIPKIYVDPNSPLYDEKRNVNHQPPNMLDLDY  277

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
             AG +  LS  + I  NL  +YR MVT   T  LF G  Y  G  PSPG GS+E  PHT V
Sbjct  278   AGTEEELSKRDQIKSNLSVMYRQMVTY-KTASLFFGAAYRAGDDPSPGMGSIENNPHTAV  336

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLN  1233
             HRWVGD   QP  EDMGNFYSAGRDPLF++HH+NVDR+W IW+ L G K  DFTD  WL+
Sbjct  337   HRWVGDK-RQPFSEDMGNFYSAGRDPLFFAHHSNVDRLWSIWRTLPGKKRTDFTDTDWLD  395

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAAAS-  1395
             +SFLFYDEN   VRV  +D ++    GYDY+     +        K    K+ G A A+ 
Sbjct  396   SSFLFYDENANLVRVKVRDSLNMKTFGYDYQKANIPWLKNKPNPRKSGRGKSGGQAVAAE  455

Query  1396  --NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
               N   +++ FP+ LDK+V+V+V RPK SRTK EKE EEEVLV+  I++  D   +FDVY
Sbjct  456   TKNITPISNAFPIALDKLVRVEVPRPKKSRTKLEKEDEEEVLVLQNIQLDRDAAVKFDVY  515

Query  1570  LNDSDQ--PDGGKDKAQYAGGFAHLPHKQESSSTT-KTSVRLGLNEPLEDLGAEDDDTVL  1740
             +ND D   P   +D +++AG F +LPH    +     T++ L L + LEDL  E D+++L
Sbjct  516   INDEDDETPTEPED-SEFAGSFTNLPHNHHKTGMKLNTNLTLPLTDLLEDLNVEGDESIL  574

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ G G+V + +I+I+Y
Sbjct  575   VTLVPKEGKGLVSIGNIKIDY  595



>gb|AAK56323.1|AF380300_1 polyphenol oxidase 2 precursor [Malus domestica]
Length=586

 Score =   458 bits (1178),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 250/550 (45%), Positives = 335/550 (61%), Gaps = 20/550 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CKA   +N   D     G   +DRRN+L+GLG     +       A AA V      
Sbjct  48    RVRCKATKGDNDNLDQ----GLARLDRRNMLIGLGTGGLYSAAGNS-FAFAAPVSA----  98

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++ C  P+D P  + I   CCPP+ T T++D+++P  GP+R R+ AQ   +   Y+ K
Sbjct  99    PDLTTCG-PADKPDGSTID--CCPPI-TTTIIDFKLPDRGPLRTRIAAQDVAKNPAYLAK  154

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  155   YKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYL  214

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WN D  +GM +P +F  T+SSLYD NRN  + PP ++DLN
Sbjct  215   YFYEKIMGELIGDPTFALPFWNRDAPAGMYIPEIFTDTSSSLYDQNRNTAHQPPKLLDLN  274

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  P PG G++E  PH  
Sbjct  275   YGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAGNIETTPHNN  334

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H WVGD   Q NGEDMG FYSAGRDPLFYSHH+NVDRMW I++  LGG D  +  WL+A
Sbjct  335   IHLWVGDPT-QTNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGTDIENTDWLDA  393

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF-VT  1413
              FLFYDE +  VRV  +D +D   +GY Y+               +          F +T
Sbjct  394   EFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTLVSRRIRERPQFIFDLT  453

Query  1414  DVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQP  1590
               FP TL   + V+V+RP  T RT A+K+  +EVLVI GIE A ++  +FDVY+ND  + 
Sbjct  454   TTFPATLSDTISVEVTRPSATKRTAAQKKAHDEVLVIKGIEFAGNEPVKFDVYVNDDAES  513

Query  1591  DGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGG  1770
               GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D +++VTL P+VG G
Sbjct  514   LAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSIMSLLEELDAETDSSLVVTLVPKVGKG  571

Query  1771  VVDVDSIRIE  1800
              + +    IE
Sbjct  572   PITIGGFSIE  581



>gb|KHN46329.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=624

 Score =   459 bits (1181),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 259/576 (45%), Positives = 346/576 (60%), Gaps = 31/576 (5%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVDVA  333
             +VSC +N  N++ +     P   I+   +RR+VL+G GGLYG + L      +   +   
Sbjct  52    KVSCHSNQNNSAPNPEEGKPSHNIVAGKNRRDVLIGFGGLYGASTLTNNNNNNPLAIAAP  111

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYI  510
             I  P++  C  P D+   A     CCPP+ + T++D+++P+ G P+R R  A      YI
Sbjct  112   ILPPDLKTCG-PPDLATGAKPVN-CCPPI-SSTIIDFKLPSSGAPLRVRPAAHLVNDVYI  168

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  AL  MK L P+ P +F QQAN+HCAYC+G Y Q GFP  ++QVHN WLFFP+HRW
Sbjct  169   AKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQVHNCWLFFPYHRW  228

Query  691   YLYFYEKILGKLINDPTFALPYWNWDN-QSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             YLYFYE+ILG LI DPTFALP+WNWDN + GMT+P+ ++   S LYD  RN N+ PP ++
Sbjct  229   YLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKNSPLYDPLRNLNHQPPVLI  288

Query  868   DLNYAGKD-------RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             DL+Y  +D         +   E IA NL  +YR++++NG    LF+G  Y  G  P PG 
Sbjct  289   DLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGSPYRAGDEPEPGA  348

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK  1206
             GS+E +PH PVH W GD   +PN E+MG FYSA RDP+F+SHHANVDRMW IW+ + GGK
Sbjct  349   GSLENVPHGPVHSWTGDK-REPNRENMGIFYSAARDPIFFSHHANVDRMWSIWKTIPGGK  407

Query  1207  --DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------------Ysslpw  1344
               DFTD  WL ++F FYDEN+  VRV  KD +D   +GY Y+                  
Sbjct  408   RRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLKNKPKPKRSKA  467

Query  1345  lkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVID  1524
              K   +     GAA A      +  FP+TLD  V   V RPK  R+K EKE+EEEVLVID
Sbjct  468   KKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKLLRSKEEKEEEEEVLVID  527

Query  1525  GIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-ESSSTTKTSVRLGLNEP  1701
             GIE   ++  +FDV++ND D         ++AG F  +PH     +   KT  R+GL + 
Sbjct  528   GIEFDRNKAVKFDVFINDEDDKVITPSNTEFAGSFVSVPHSHVHKNKKIKTCFRVGLTDL  587

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             LEDL AE+DD++LVTL P+ G G+V +  I+IE  T
Sbjct  588   LEDLEAENDDSILVTLVPKYGKGLVTIRDIKIELET  623



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   457 bits (1177),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 280/564 (50%), Positives = 367/564 (65%), Gaps = 27/564 (5%)
 Frame = +1

Query  145   RNQTRL-RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             R Q R  +VSCK+  P+N  D  +A+PG    DRRNVL+GLGGLYG   LA  P + AA 
Sbjct  34    RKQNRCPKVSCKS--PDN--DQESAAPGK--FDRRNVLIGLGGLYGATTLAASPFSFAA-  86

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFAT  498
                 I  P+++KC  P+D+P  A  T  CCPP PT  ++D++ P     MR R  A  A 
Sbjct  87    ---PISAPDITKCG-PADLPPGAAPTN-CCPP-PTAKIIDFKFPPPSTTMRVRPAAHLAD  140

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
             + YI K+  A+  M+ L    P SF QQA++HCAYC+G Y Q GFP  E+QVHNSWLFFP
Sbjct  141   EAYIAKFNKAVELMRALPEDDPRSFKQQASVHCAYCDGAYDQVGFPNLELQVHNSWLFFP  200

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             FHR+YLYF+E+ILGKLI+DPTFA+P+WNWD+  GM +P M+ +  S LYD+ R+  + PP
Sbjct  201   FHRYYLYFFERILGKLIDDPTFAMPFWNWDSPGGMRIPAMYANPNSPLYDSLRDQRHQPP  260

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
              ++DLNY+G D  +S ++    NL  +YR MV+N  T  LF G  Y  G  P+PG GS+E
Sbjct  261   TVLDLNYSGTDPTISADQQTRRNLTVMYRQMVSNSRTARLFFGSPYRRGDDPNPGSGSIE  320

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DF  1212
              IPH PVH W GD  +QPN E+MGNFYSAGRDP+FY+HH+N+DR+W IW K LGG+  D 
Sbjct  321   NIPHGPVHVWTGDR-NQPNFENMGNFYSAGRDPIFYAHHSNIDRLWSIW-KTLGGRRQDI  378

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskpsps  1368
             TD  +L+ASF+FYDEN Q VRV  +DC+D+  +GY Y+            P + S     
Sbjct  379   TDRDFLDASFVFYDENAQMVRVKVRDCLDHTKLGYVYQDVEIPWLDSRPTPRVSSVLRKL  438

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
             K  G A A++     DVFP TLDKV++V V RPK  R+K EK++ EE+LVI+GIE+  D 
Sbjct  439   KKLGKANAADTHSPKDVFPATLDKVLKVMVKRPKKKRSKKEKDELEEILVIEGIELDRDV  498

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDD  1728
             YA+FDVY+ND D      +  ++AG F ++PHK +     KT +RL + E +EDL A+DD
Sbjct  499   YAKFDVYINDEDDEITTPENTEFAGSFVNVPHKHKHGKKIKTQLRLSITEIMEDLDADDD  558

Query  1729  DTVLVTLAPQVGGGVVDVDSIRIE  1800
             D VLVTL P   G  V V  I+IE
Sbjct  559   DHVLVTLVPTNAGDAVTVHGIKIE  582



>ref|XP_008225002.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Prunus mume]
Length=594

 Score =   457 bits (1177),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 314/491 (64%), Gaps = 12/491 (2%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+ ++C  P+D P  + I   CCPP+ T T++D+++P  GP+R R PAQ   ++  Y+ K
Sbjct  106   PDFTECG-PADKPDGSTID--CCPPI-TKTIIDFKLPDRGPLRTRRPAQDLAKDPVYLAK  161

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             ++ A+  M+ L    P S  QQA +HC+YC+GGY Q GFP  EIQVH+ WLF+PFHRWYL
Sbjct  162   FKKAIALMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQVHSCWLFYPFHRWYL  221

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WNWD  +GM +P +F   TSSLYD  RN  + PP ++DLN
Sbjct  222   YFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDPTSSLYDQYRNAAHQPPKLLDLN  281

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G   SPG G++E +PH  
Sbjct  282   YGGSDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGETYSAGDASSPGAGNIESLPHNN  341

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q NGE+MG FYSAGRDPLFYSHH+NVDRMW I++ LLGG D     WLN 
Sbjct  342   IHLWTGDP-KQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDLLGGTDIDKADWLNT  400

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +  VRV  +D +D   +GY Y+                      AA ++  +
Sbjct  401   EFLFYDEKKNLVRVKVRDSLDTRKLGYVYDNKVPIPWLKAKPNPRKSQNKRKAAVSSGDL  460

Query  1411  TDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP TL   + V+V+RP T+ RT  +K+ ++EVLVI GIE A ++  +FDV++ND   
Sbjct  461   TTTFPATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFAGNEPLKFDVFVNDDAD  520

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
              + GKD++++AG F H+PHKQ      KT++RL + + LE+L AE D +++VTL P++G 
Sbjct  521   SEAGKDQSEFAGSFIHVPHKQ--GKNIKTNLRLSITKLLEELDAETDTSLVVTLVPKLGK  578

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  579   GPITIGGFSIE  589



>ref|XP_006594327.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=670

 Score =   459 bits (1180),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 259/576 (45%), Positives = 346/576 (60%), Gaps = 31/576 (5%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVDVA  333
             +VSC +N  N++ +     P   I+   +RR+VL+G GGLYG + L      +   +   
Sbjct  98    KVSCHSNQNNSAPNPEEGKPSHNIVAGKNRRDVLIGFGGLYGASTLTNNNNNNPLAIAAP  157

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYI  510
             I  P++  C  P D+   A     CCPP+ + T++D+++P+ G P+R R  A      YI
Sbjct  158   ILPPDLKTCG-PPDLATGAKPVN-CCPPI-SSTIIDFKLPSSGAPLRVRPAAHLVNDVYI  214

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  AL  MK L P+ P +F QQAN+HCAYC+G Y Q GFP  ++QVHN WLFFP+HRW
Sbjct  215   AKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQVHNCWLFFPYHRW  274

Query  691   YLYFYEKILGKLINDPTFALPYWNWDN-QSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             YLYFYE+ILG LI DPTFALP+WNWDN + GMT+P+ ++   S LYD  RN N+ PP ++
Sbjct  275   YLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKNSPLYDPLRNLNHQPPVLI  334

Query  868   DLNYAGKD-------RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             DL+Y  +D         +   E IA NL  +YR++++NG    LF+G  Y  G  P PG 
Sbjct  335   DLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGSPYRAGDEPEPGA  394

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK  1206
             GS+E +PH PVH W GD   +PN E+MG FYSA RDP+F+SHHANVDRMW IW+ + GGK
Sbjct  395   GSLENVPHGPVHSWTGDK-REPNRENMGIFYSAARDPIFFSHHANVDRMWSIWKTIPGGK  453

Query  1207  --DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------------Ysslpw  1344
               DFTD  WL ++F FYDEN+  VRV  KD +D   +GY Y+                  
Sbjct  454   RRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLKNKPKPKRSKA  513

Query  1345  lkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVID  1524
              K   +     GAA A      +  FP+TLD  V   V RPK  R+K EKE+EEEVLVID
Sbjct  514   KKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKLLRSKEEKEEEEEVLVID  573

Query  1525  GIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-ESSSTTKTSVRLGLNEP  1701
             GIE   ++  +FDV++ND D         ++AG F  +PH     +   KT  R+GL + 
Sbjct  574   GIEFDRNKAVKFDVFINDEDDKVITPSNTEFAGSFVSVPHSHVHKNKKIKTCFRVGLTDL  633

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             LEDL AE+DD++LVTL P+ G G+V +  I+IE  T
Sbjct  634   LEDLEAENDDSILVTLVPKYGKGLVTIRDIKIELET  669



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   455 bits (1171),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 269/566 (48%), Positives = 365/566 (64%), Gaps = 29/566 (5%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             ++   R  +SCK+ N N+  + A         DRR+VL+GLGGLYG   L+  P A AA 
Sbjct  35    RKPSHRHIISCKSTN-NHDQEPAGK------FDRRDVLIGLGGLYGATTLSASPFAFAA-  86

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFAT  498
                 I  P+V+KC  P+D+P  A  T  CCPP PT T++DY+ P     MR R  A  A 
Sbjct  87    ---PISAPDVTKCG-PADLPQGAAPTN-CCPP-PTATIVDYKFPPPSTTMRVRPAAHLAD  140

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
             + Y+ K+  A+  M+ L    P SF QQA +HCAYC+G Y Q GFP  E+QVHNSWLFFP
Sbjct  141   KAYVAKFNRAMELMRALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPNLELQVHNSWLFFP  200

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             FHR+YL+F+E+ILGKLI+DPTFA+PYWN+D+ +GMT+P M+ + +S LYD  RN  + PP
Sbjct  201   FHRYYLFFFERILGKLIDDPTFAMPYWNYDSPAGMTIPAMYTNPSSPLYDKLRNQGHQPP  260

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
             A++DLN++G    ++ E+ +  NL  +YR MV+N  T  LF G  Y  G  P+PG GSVE
Sbjct  261   ALIDLNFSGSGT-ITAEQQVKRNLTVMYRQMVSNSKTPRLFFGSAYRRGEDPNPGSGSVE  319

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFT  1215
              IPH PVH W GD   QPNGE+MGNFYSAGRDP+FY+HH+N+DR+W +W+ L G + D T
Sbjct  320   NIPHGPVHVWTGDPT-QPNGENMGNFYSAGRDPIFYAHHSNIDRLWSLWKGLGGRRQDIT  378

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAAS  1395
             D  +L+ASFLFYDEN Q VRV  +DC+DN  +GY Y+   +PWLKS+P+P  ++      
Sbjct  379   DPDFLDASFLFYDENGQMVRVKTRDCLDNTKLGYTYQDVEIPWLKSRPTPKVSSVLKKLK  438

Query  1396  NAPFVT-----------DVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
                              +V P  LDKV+++ V RPK  R+K EK++ EE+L+I GIE+  
Sbjct  439   KLGKAKAAAAETHRPPKEVLPAKLDKVLKIMVKRPKKKRSKKEKDELEEILIIQGIELER  498

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
             D YA+FDVY+ND D     ++  ++AG F ++PHK +     KT +RL + + LEDL AE
Sbjct  499   DVYAKFDVYINDEDDETSTEENTEFAGSFVNVPHKHKHGKKIKTQLRLSITDILEDLDAE  558

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             DD+ VLVTL P   G  + +  ++IE
Sbjct  559   DDEHVLVTLVPTNAGDSITIHGVKIE  584



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   456 bits (1172),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 267/564 (47%), Positives = 355/564 (63%), Gaps = 25/564 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             R+ CK  + N +  D         +DRRNVL+GLGGLYGV   +  P A A  V      
Sbjct  45    RIICKCTSSNQNPSDEHKHSHQTNLDRRNVLIGLGGLYGVGLGSADPFAFAKPV----AP  100

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC   +D+P  A     CCPP+ +D ++D+  P+  P+R R  A    Q YI+KY 
Sbjct  101   PDLSKCGA-ADLPPGATPIN-CCPPI-SDKIVDFTFPSSSPLRVRPAAHAVDQAYIDKYS  157

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L  S P SF QQA+IHCAYC+G Y Q GFP  E+Q+H SWLF+PFHR+YLYF
Sbjct  158   KAIELMKALPDSDPRSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFYPFHRYYLYF  217

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YEKILGKLI+DPTFALP+WNWD+  GM +P +F    S LY+  RN N+ PP ++DL++ 
Sbjct  218   YEKILGKLIDDPTFALPFWNWDSPPGMKLPALFADPKSPLYNELRNANHQPPTLLDLDWN  277

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
               D   ++ + I+ NL  +YR MV+N    +LF G  Y  GT PSPG GS+E  PH PVH
Sbjct  278   LTDTPTTEADQISSNLKIMYRQMVSNAKKQQLFFGTAYRAGTDPSPGSGSIESTPHGPVH  337

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDSWLNAS  1239
              W GD+  QPN EDMGNFYSA RDP+F+SHH+NVDRMW +W+ L    KD TD  WL+  
Sbjct  338   VWTGDNT-QPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTLGATNKDITDPDWLDTG  396

Query  1240  FLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAA----AA  1392
             FLFYDEN Q VRV  +DC+D+  +GY Y+     + +      +   +KT  A     AA
Sbjct  397   FLFYDENAQLVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPTPRRSKLAKTAKAVGVARAA  456

Query  1393  SNAPFVTDV--FPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
             ++ P V     FP+ LD  +   V RP +  R+K EKE EEE+LVI GIE   D   +FD
Sbjct  457   TSGPKVVGRGDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDTAVKFD  516

Query  1564  VYLNDSDQPD--GGKDKAQYAGGFAHLP--HKQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
             VY+ND +  D  G  D +++AG F ++P  HK +    TK+ +RLGL + LEDLGAEDD+
Sbjct  517   VYVNDLEDDDEPGKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLGAEDDE  576

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEY  1803
             +V+VTL P+ G   + +D+I+IE+
Sbjct  577   SVVVTLVPRYGTKSLKIDTIKIEF  600



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   456 bits (1172),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 267/576 (46%), Positives = 359/576 (62%), Gaps = 33/576 (6%)
 Frame = +1

Query  145   RNQTRL----RVSCKANN--PNNSTDDAAASPGSRIIDRRnvllglgglygvanla--gg  300
             RN++R     +VSC + N  PN+ +        S  +DRRNVLLG+GGLYG A       
Sbjct  39    RNRSRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATK  98

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKR  477
             P+A  A     I  P++SKC   + VP     T  CCPPV T  ++D+Q+P+ G PMR R
Sbjct  99    PLAFGA----PIQAPDISKCGTAT-VPDGVTPTN-CCPPV-TTKIIDFQLPSSGSPMRTR  151

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A   ++EY+ KY+ A+   K L    P SF QQAN+HC YC G Y Q G+   E+QVH
Sbjct  152   PAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVH  211

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
              SWLF PFHR+YLYF E+IL KLI+DPTFALPYW WDN  GM MP ++ S+ SSLYD  R
Sbjct  212   ASWLFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPTIYASSPSSLYDEKR  271

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             N  +LPP ++DL+Y G +  + D+EL  +NL  +Y+ +V+   T +LF+G  Y  G    
Sbjct  272   NAKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAID  331

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG G++E +PH  VH+W G   D+P+ EDMGNFY+AGRDP+F+ HHANVDRMW IW K +
Sbjct  332   PGAGTLEHVPHNIVHKWTG-LADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIW-KTI  388

Query  1198  GG---KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------Ysslpwl  1347
             GG   KDFTD  WL+A+F+FYDEN+Q V+V   DC+D   + Y Y+              
Sbjct  389   GGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAK  448

Query  1348  kskpspskTTGAAAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekeeeVL  1515
                 + S  +G A A+  P  T      FP  L+ V++V+V RPK SR+K EKE EEEVL
Sbjct  449   AKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVL  508

Query  1516  VIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLN  1695
             +I GIE+  + + +FDVY+ND D        +++AG F ++PHK      TKT++R  +N
Sbjct  509   LIKGIELDRENFVKFDVYINDEDYSVSRPKNSEFAGSFVNVPHKHMKEMKTKTNLRFAIN  568

Query  1696  EPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             E LEDLGAEDD++V+VT+ P+ GG  V +  I IE+
Sbjct  569   ELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEF  604



>ref|XP_007159290.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
 gb|ESW31284.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
Length=594

 Score =   455 bits (1170),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 249/511 (49%), Positives = 325/511 (64%), Gaps = 26/511 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+   C  P D+P  A+ T  CCPP  + T++D++ P   P+R R  A      Y +KY+
Sbjct  87    PDFKSCG-PPDLPRGAEST-DCCPP-KSSTIVDFKFPPRTPLRVRPGAHLVDDIYRDKYK  143

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              AL+ MK L    P SF QQANIHCAYCNG Y Q GFP  ++QVHNSWLFFP+HR+YLYF
Sbjct  144   EALSIMKGLPSEDPRSFIQQANIHCAYCNGAYHQVGFPDLDLQVHNSWLFFPYHRFYLYF  203

Query  703   YEKILGKLINDPTFALPYWNWDN-QSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             YE+ILG LI DPTFA+P+WNWD+ + GMTMP++F    S LYD  RN ++ PP ++DL+Y
Sbjct  204   YERILGSLIGDPTFAIPFWNWDHPKGGMTMPSLFTDKNSPLYDPRRNLSHQPPTLIDLDY  263

Query  880   AGKD-----RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
               KD     +  S  + I+ NL  +YR++V+ G   +LF+G  Y  G+ P PG GS+E +
Sbjct  264   NRKDDNNPNQSESVADQISSNLTIMYRNVVSGGKLPKLFLGSPYRAGSDPHPGAGSLEHV  323

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTD  1218
             PH PVH W GD   +PN EDMG FYSAG+DP+FY+HHANVDR+W IW+ + GGK  DFTD
Sbjct  324   PHIPVHSWCGDP-REPNREDMGVFYSAGKDPIFYAHHANVDRVWSIWKTIPGGKRRDFTD  382

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASN  1398
               WL +SFLFYDEN+  VRV  KD +D   +GY Y+   LPWLK KP P  +     A  
Sbjct  383   PDWLESSFLFYDENKNLVRVKVKDSLDTRNLGYVYQDIDLPWLKKKPKPRMSKAKKVALA  442

Query  1399  APFVTDV-------------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
               F                 FP++LD  V + V RPK  R+K EKE+EEEVLVIDGIE  
Sbjct  443   KSFGVTAARAAETTTSSSVRFPLSLDSKVSIVVKRPKLLRSKEEKEEEEEVLVIDGIEFG  502

Query  1540  MDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-ESSSTTKTSVRLGLNEPLEDLG  1716
              D+  +FDV++ND D        +++AG F  LPH     S   KT  R+GL + LEDL 
Sbjct  503   RDKAVKFDVFINDEDDEVIKASNSEFAGSFVSLPHTHLHKSMKVKTCFRVGLTDLLEDLE  562

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             AE+DD+++VTL P+ G G+V +  I+IE+ T
Sbjct  563   AENDDSIVVTLVPKYGKGLVTIQGIKIEFET  593



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   454 bits (1168),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 250/515 (49%), Positives = 324/515 (63%), Gaps = 27/515 (5%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQI-PTGGPMRKR  477
             P A AA     I  P+++ C  P D+PA    T  CCPP  +  ++D++  P+  P+R R
Sbjct  96    PFAFAA----PISPPDLNTCG-PPDLPAGVKPTN-CCPP--SSKIIDFKFSPSNQPLRVR  147

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A     EY+ KY+ AL  MK L    P +F QQAN+HCAYC+G Y Q GFP  ++QVH
Sbjct  148   PAAHLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQVH  207

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
             NSWLFFPFHRWYLYFYE+ILG LINDPTFALP+WNWD   GM +P+++    S LYD  R
Sbjct  208   NSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDTLR  267

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             N N+ PP +VDL++  +D  +S+ + I+ NL  +YR +V+NG T  LF+G  Y  G  P 
Sbjct  268   NANHQPPTLVDLDFNLED-PISNGK-ISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPD  325

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG GSVE +PH PVH W GD ++QPN E+MG FYSA RDP+FYSHH+N+DRMW IW K L
Sbjct  326   PGFGSVENVPHGPVHLWTGD-INQPNIENMGTFYSAARDPIFYSHHSNIDRMWSIW-KTL  383

Query  1198  GGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------Ysslp  1341
             GGK  DFTD  WL ++FLFYDEN+  VRV  KD +D   +GY Y+           +   
Sbjct  384   GGKRRDFTDSDWLESAFLFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLNSKPTPRR  443

Query  1342  wlkskpspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLV  1518
                 K + ++  G  AA  A    +V FP+ LD VV   V RP  SR+K EKE+EEEVLV
Sbjct  444   SRVQKVALAQNFGVGAAHAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLV  503

Query  1519  IDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-ESSSTTKTSVRLGLN  1695
             I+GIE   +   +FDV++ND D      D  ++AG F  +PH     +    T +RLGL 
Sbjct  504   IEGIEFERNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSHMHKNKDIITCLRLGLT  563

Query  1696  EPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             + LE+L AEDDD+V VTL P+ G G V +  I+IE
Sbjct  564   DLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIE  598



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 264/560 (47%), Positives = 353/560 (63%), Gaps = 24/560 (4%)
 Frame = +1

Query  166   VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHYP  345
             VSCKA+N  N  ++ ++S  S   DRR++LLGLG LYG  NL   P A AA     I  P
Sbjct  46    VSCKASN-GNQNNEGSSSLNS--FDRRDILLGLGTLYGATNLVSDPFALAA----PIAAP  98

Query  346   NVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKY  519
             ++S C   +   +++  + +  CCPP  T+ +LD++ P    +R R  A      Y+ K+
Sbjct  99    DLSLCENSTVTSSSSGTSISVPCCPPKTTN-ILDFKPPRFSTIRLRPAAHLVDANYLEKF  157

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK L    P SF QQAN+HCAYCNG Y Q GFP +++QVH SWLFFPFHR YLY
Sbjct  158   TKAMELMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLY  217

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILGKLI DP FA+P+WNWD+  GM +P +++   S LYD  RN N+ PP ++DL+Y
Sbjct  218   FYERILGKLIGDPNFAMPFWNWDSPPGMAIPKIYVDPNSPLYDEKRNVNHQPPNMLDLDY  277

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
             AG +  LS  + I  NL  +YR MVT   T  LF+G  Y  G  PSPG GS+E  PHT V
Sbjct  278   AGTEEELSKRDQIKSNLSVMYRQMVTY-KTASLFLGAAYRAGDDPSPGMGSIENNPHTAV  336

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLN  1233
             HRWVGD   QP  EDMGNFYSAGRDPLFY+HH++VDR+W IW+ L G K  DFT   WL+
Sbjct  337   HRWVGDK-RQPFSEDMGNFYSAGRDPLFYAHHSDVDRLWSIWRTLPGKKRTDFTGTDWLD  395

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAAAS-  1395
             +SFLFYDEN   VRV  +D ++    GYDY+     +     +  K    K+ G A A+ 
Sbjct  396   SSFLFYDENANLVRVKVRDSLNMKTFGYDYQKVNIPWLKNKPIPRKSGRGKSGGQAVAAE  455

Query  1396  --NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
               N   ++  FP+ LDK+V+V+V RPK SRTK EKE EEEVLV+  I++  D   +FDVY
Sbjct  456   TKNTTPISIAFPIALDKLVRVEVPRPKKSRTKLEKEDEEEVLVLQNIQLDRDAAVKFDVY  515

Query  1570  LNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTT-KTSVRLGLNEPLEDLGAEDDDTVLV  1743
             +ND D     + + +++AG F +LPH    +     T++ L L + LEDL  E D+++LV
Sbjct  516   INDEDDETPTEPEDSEFAGSFTNLPHNHHKTGMKLNTNLTLPLTDLLEDLNVEGDESILV  575

Query  1744  TLAPQVGGGVVDVDSIRIEY  1803
             TL P+ G G+V + +I+I+Y
Sbjct  576   TLVPKEGKGLVSIGNIKIDY  595



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 270/562 (48%), Positives = 350/562 (62%), Gaps = 29/562 (5%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRII-DRRnvllglgglygvanlaggPIASAADVDVAIH  339
             R +C  N  NN T + +    S I+  RRNVLLGLGGL G   L   P A AA     I 
Sbjct  49    RTTCSENQ-NNPTPNPSEGELSHIVGHRRNVLLGLGGLCGAVTLNNNPFAFAA----PIS  103

Query  340   YPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINK  516
              P+++ C  P D PA A+ T  CCPP  +  ++D++ P +  P+R R  A     EY+ K
Sbjct  104   PPDLNTCG-PPDTPAGANPTN-CCPP--SSKIIDFKFPPSNQPLRVRPAAHLVNDEYLAK  159

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ AL  MK L    P +F QQAN+HCAYC+G Y Q GFP  ++Q+HNSWLFFPFHRWYL
Sbjct  160   YKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSWLFFPFHRWYL  219

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKILG LINDPTFALP+WNWD   GM +P+++    S LYD  RN N+ PP +VDL+
Sbjct  220   YFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYADPKSPLYDTLRNANHQPPTLVDLD  279

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             +  +D  +S+ + I+ NL  +YR +V+NG T  LF+G  Y  G  P PG GSVE +PH  
Sbjct  280   FNLED-PISNGK-ISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPGFGSVENVPHGS  337

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWL  1230
             VH W GD ++QPN EDMG FYSA RDP+F+SHH+N+DRMW IW K LGG  KDFTD  WL
Sbjct  338   VHLWTGD-INQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIW-KTLGGKRKDFTDSDWL  395

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------YsslpwlkskpspskTTG  1380
              + FLFYDEN+  VRV  KDC+D   +GY Y+           +       K + ++  G
Sbjct  396   ESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSRVQKVALAQNFG  455

Query  1381  AAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYAR  1557
               AA  A    +V FP+ LD VV   V RP  SR++ EKE+EEEVLVI+GIE   +   +
Sbjct  456   VGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSRKEKEEEEEVLVIEGIEFERNTPVK  515

Query  1558  FDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSST-TKTSVRLGLNEPLEDLGAEDDDT  1734
             FDV++ND D      D  ++AG F  +PH  +  +    T +RLGL + LE+L AEDDD+
Sbjct  516   FDVFINDEDDKQIRPDNTEFAGSFVSVPHSHKHKNKDIITCLRLGLTDLLEELEAEDDDS  575

Query  1735  VLVTLAPQVGGGVVDVDSIRIE  1800
             V VTL P+ G G V +  I+I+
Sbjct  576   VRVTLVPRYGKGRVKIRGIKIK  597



>sp|P43311.1|PPO_VITVI RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Vitis vinifera]
 pir||S52629 catechol oxidase (EC 1.10.3.1) precursor - grape
 emb|CAA81798.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 267/576 (46%), Positives = 359/576 (62%), Gaps = 33/576 (6%)
 Frame = +1

Query  145   RNQTRL----RVSCKANN--PNNSTDDAAASPGSRIIDRRnvllglgglygvanla--gg  300
             RN++R     +VSC + N  PN+ +        S  +DRRNVLLG+GGLYG A       
Sbjct  39    RNRSRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATK  98

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKR  477
             P+A  A     I  P++SKC   + VP     T  CCPPV T  ++D+Q+P+ G PMR R
Sbjct  99    PLAFGA----PIQAPDISKCGTAT-VPDGVTPTN-CCPPV-TTKIIDFQLPSSGSPMRTR  151

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A   ++EY+ KY+ A+   K L    P SF QQAN+HC YC G Y Q G+   E+QVH
Sbjct  152   PAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVH  211

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
              SWLF PFHR+YLYF E+IL KLI+DPTFALPYW WDN  GM MP ++ S+ SSLYD  R
Sbjct  212   ASWLFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPTIYASSPSSLYDEKR  271

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             N  +LPP ++DL+Y G +  + D+EL  +NL  +Y+ +V+   T +LF+G  Y  G    
Sbjct  272   NAKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAID  331

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG G++E  PH  VH+W G   D+P+ EDMGNFY+AGRDP+F+ HHANVDRMW IW K +
Sbjct  332   PGAGTLEHAPHNIVHKWTG-LADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIW-KTI  388

Query  1198  GG---KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------Ysslpwl  1347
             GG   KDFTD  WL+A+F+FYDEN+Q V+V   DC+D   + Y Y+         +    
Sbjct  389   GGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKNTKAK  448

Query  1348  kskpspskTTGAAAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekeeeVL  1515
                 + S  +G A A+  P  T      FP  L+ V++V+V RPK SR+K EKE EEEVL
Sbjct  449   AKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVL  508

Query  1516  VIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLN  1695
             +I GIE+  + + +FDVY+ND D        +++AG F ++PHK      TKT++R  +N
Sbjct  509   LIKGIELDRENFVKFDVYINDEDYSVSRPKNSEFAGSFVNVPHKHMKEMKTKTNLRFAIN  568

Query  1696  EPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             E LEDLGAEDD++V+VT+ P+ GG  V +  I IE+
Sbjct  569   ELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEF  604



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   452 bits (1163),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/501 (47%), Positives = 318/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P  +D +  CCPP  T  + +++ P+   PMR R  A    + Y+
Sbjct  78    IAPPDITQCELVT-LPTESDPSN-CCPPTST-KIKNFEFPSASSPMRIRPAAHLVDKAYV  134

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR 
Sbjct  135   AKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRL  194

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  195   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPKSPLYDPLRDANHQPPILLD  254

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D        EEL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  255   LNYATGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  314

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q NGE+MGNFYSAGRDP+F+ HH+NVDRMW +W+K+ GG  KDF 
Sbjct  315   TPHTEIHFWTGDP-NQTNGENMGNFYSAGRDPIFFCHHSNVDRMWDLWKKIPGGKRKDFK  373

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF++EN++ VRV  KD +D   + Y ++     +             K+  
Sbjct  374   DPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRPTPKLTRQEKSRR  433

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             +A  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  434   SAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKF  493

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  494   DVLVNDEPDSPGGPDKSEFAGSFVNVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  551

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ GG  V V +++IE+
Sbjct  552   VTLVPRTGGDSVTVANVKIEF  572



>gb|EYU34166.1| hypothetical protein MIMGU_mgv1a003279mg [Erythranthe guttata]
Length=594

 Score =   452 bits (1164),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 270/563 (48%), Positives = 349/563 (62%), Gaps = 34/563 (6%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRN  R  +SC +++ N          GS++ DRRN+LLGLGG+YG ANL   P +++
Sbjct  40    HAKRNHHRRLISCSSSSSNE---------GSKV-DRRNMLLGLGGMYGAANLLSTPDSAS  89

Query  316   ADVDVAIHYPNVSKCHYPS-DVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQF  492
             A+    I  P + KC   + D  A       CCPP  T T++DY++P     + R  A  
Sbjct  90    AN---PIQAPQIDKCGNSTYDTSAGVATQINCCPPF-TGTIIDYKLPNFPKTKVRPSAHR  145

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
              + EY+ K+  A+  M+ L    P SF QQANIHCAYCNGGY Q G  T ++QVHN WLF
Sbjct  146   LSPEYLFKFNTAVDRMRRLPKDDPRSFMQQANIHCAYCNGGYDQPGQGTLDLQVHNGWLF  205

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHRWYLYFYE+ILGKLI DPTFALP+WNWDN  GMT+P  F+   S+LYDA RNP+ +
Sbjct  206   FPFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPAFIDPKSALYDAKRNPDNM  265

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PPA+VDL + G    L   ++++ NL  +Y  MV        FMGK Y  GTP +PG GS
Sbjct  266   PPAVVDLGFTGSTDPL---QVVSNNLTIMYTEMVRGNSDVYDFMGKAYREGTPVNPGPGS  322

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---  1203
              E   HT +H +VGD  +QP GEDMGNFYSAGRDPLFYSHH+NVDRMW +WQ  L     
Sbjct  323   SERGSHTAIHAFVGDYKNQPAGEDMGNFYSAGRDPLFYSHHSNVDRMWTLWQFFLPSNKI  382

Query  1204  --KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
               K  TD  +LN +FLFYDEN Q VRV  KDC+DN+ MG++YE   LPWL  +P     +
Sbjct  383   PDKKITDPDFLNTAFLFYDENAQLVRVTVKDCLDNLKMGFEYERVDLPWLDYRPPAQAAS  442

Query  1378  GA---AAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
                  A  +       VFP+ LDK+V+V +  PKT + KA     +E+LVI+ I V   +
Sbjct  443   AKVTRAGKTTVKVEDTVFPIVLDKIVRVLL--PKTKKGKA-----DELLVIENIVVDTSK  495

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDD  1728
             + +FDV++ND D      DKA YAG +A +PHK +  + T TS+RL L +  ED+   DD
Sbjct  496   FLKFDVFVNDEDDNVAEIDKASYAGTYAQIPHKTKEKTAT-TSIRLKLTDVYEDMDVTDD  554

Query  1729  DTVLVTLAPQVGGGVVDVDSIRI  1797
             DT+LVTL P+  G  V +  I+I
Sbjct  555   DTILVTLVPRHEGPGVTIGGIKI  577



>gb|EYU34157.1| hypothetical protein MIMGU_mgv1a003435mg [Erythranthe guttata]
Length=585

 Score =   452 bits (1163),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 252/500 (50%), Positives = 329/500 (66%), Gaps = 14/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYIN  513
             I  P++SKC   +D+     +   CCPPV  D + +Y++P    MR R  A  A +EYI 
Sbjct  92    ISSPDLSKCSRGTDLSTQQPLDVNCCPPV-VDGITNYKLPPVTKMRFRPAAHLAGKEYIA  150

Query  514   KYEAALTAMKNLD---PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFH  684
             KYE A+ AMK LD   P+ P  + QQAN+HCAYCN  Y+Q      ++Q+HNSW F+P+H
Sbjct  151   KYEKAVAAMKALDKTDPTDPRGYSQQANVHCAYCNLTYEQSEDSDTKLQIHNSWHFYPWH  210

Query  685   RWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAI  864
             RWYLYFYE+ILG LI+DPTF LP+WNWDN  GM MP+MF  TTS LYDA RN  +LPPA 
Sbjct  211   RWYLYFYERILGSLIDDPTFGLPFWNWDNPPGMVMPDMFAVTTSPLYDARRNLEHLPPAA  270

Query  865   VDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
              DLN+A K       +++  NL  +Y  MV N    E F G KYV GT P PG G+VE  
Sbjct  271   ADLNFASKPT-TDPSKIVTNNLTTMYGEMVRNVSKLEDFYGAKYVVGTAPDPGPGTVERG  329

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTD  1218
              HT +H WVG++   P GEDMGNFYSAGR+ LFYSHHAN+DR+W  WQ L G   K F D
Sbjct  330   SHTALHVWVGENT--PTGEDMGNFYSAGRESLFYSHHANIDRLWSTWQGLRGKKPKGFKD  387

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp-wlkskpspskTTGAAAAS  1395
               WL+A++LFYDEN+  V+V  KD +DN  MGY Y+    P          K + AA  S
Sbjct  388   KDWLDATYLFYDENKNLVQVNVKDALDNEKMGYTYQKVDNPWVNYRPKPKVKKSKAAKNS  447

Query  1396  NAPFVTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYL  1572
              AP  TD +FPV LDKVV+V V RP+ SR+K +KE EEE+LVI+GIEV   ++ RF+V++
Sbjct  448   KAPTATDTIFPVKLDKVVKVLVDRPRKSRSKKDKEDEEELLVIEGIEVDNSKFVRFEVFI  507

Query  1573  NDS-DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             ND  D+P+  +DKA++AG ++ +PHK  +S+ TK+ +RLGL E LEDL  +DDD +LV L
Sbjct  508   NDEDDKPEDLRDKAEFAGAYSQVPHK--NSTRTKSKIRLGLTELLEDLDVDDDDQILVAL  565

Query  1750  APQVGGGVVDVDSIRIEYST  1809
              P+ GG  + +  I+I Y++
Sbjct  566   VPKAGGEDITIGGIKIIYAS  585



>ref|XP_011098119.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=585

 Score =   452 bits (1162),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 317/478 (66%), Gaps = 9/478 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYIN  513
             I  P++SKC   +++     +   CCPPV +  ++DY +P    MR R  A  A ++Y  
Sbjct  97    ITSPDLSKCSTGTNLNTQQPLDVNCCPPV-SKEIMDYTLPPVRKMRFRPAAHLAGEDYYA  155

Query  514   KYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWY  693
             K+E A+  MK L P  P +F QQAN+HCAYCN  YQQ G P  ++Q+HN W FFP+HRWY
Sbjct  156   KFEKAVGLMKALPPEDPRNFMQQANVHCAYCNLTYQQTGDPNLKLQIHNCWHFFPWHRWY  215

Query  694   LYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDL  873
             LYF+E+ILGKLI+DPTF LP+WNWDN +GM MP +F    S L+DA RN ++LPPA+ DL
Sbjct  216   LYFFERILGKLIDDPTFGLPFWNWDNPNGMIMPEVFARKDSPLFDARRNKSHLPPALADL  275

Query  874   NYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHT  1053
              Y+ +    + +++I  NL  +Y  MV N    E F G KYV GT P PG GSVE   H 
Sbjct  276   AYSSRS-PTNPKKIIPNNLTVMYSEMVRNVSKLEDFYGAKYVVGTAPDPGPGSVERGSHM  334

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG--GKDFTDDSW  1227
              +H W+G+S   P GEDMGNFYS  RDP+FYSHH NVDR+W +W+ L G   KDF D  W
Sbjct  335   ALHGWIGEST--PTGEDMGNFYSTARDPIFYSHHTNVDRLWTVWRGLRGPKPKDFPDSDW  392

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             L A FLFYDEN Q VRV   D +DN  MGY Y+   LPWLKS+P        AA+S+   
Sbjct  393   LEADFLFYDENAQLVRVKVVDTLDNEKMGYVYQDVDLPWLKSRPPARVKKSKAASSSGAP  452

Query  1408  VTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSD  1584
               + VFPV LDKVV+V V+RPK SR+K +KEKEEE+LVI+GIEV   ++ +FDV++ND D
Sbjct  453   AAETVFPVKLDKVVKVLVNRPKKSRSKKDKEKEEELLVIEGIEVDNAKFVKFDVFVNDED  512

Query  1585  QPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
                   DKA+YAG ++ +PHK  +S+  KT +RLGL E LEDL  EDD+ +LV+L P+
Sbjct  513   DKPDELDKAEYAGCYSQVPHK--NSTKVKTKIRLGLTELLEDLDVEDDEKILVSLVPK  568



>ref|XP_006355239.1| PREDICTED: catechol oxidase B, chloroplastic [Solanum tuberosum]
Length=589

 Score =   452 bits (1162),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 272/565 (48%), Positives = 349/565 (62%), Gaps = 27/565 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H +RNQ+  +VSC  NN     +          +DRRNVLLGLGGLYG ANLA  P+ASA
Sbjct  38    HGRRNQS-FKVSCNVNN-----NVGEHEKNLDAVDRRNVLLGLGGLYGAANLA--PLASA  89

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             +     I  P++  C   + V    D+  +CCPPVP   D+V  Y+ P    +R R PA 
Sbjct  90    S----PIPPPDLKSCGV-AHVKEGVDVLYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAH  144

Query  490   FATQEYINKYEAALTAMKNLDPSH--PHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EY+ KY+ A + M+ LD     P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  145   AADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFS  201

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  202   WLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDDKRNQ  261

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + GK+      +++  NL  +YR MVTN      F G  Y  GT PSPG
Sbjct  262   NHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGTKPSPG  321

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              G++E IPHTPVH W GD+  Q NGE+MGNFYSAG DP+FY HHANVDRMW  W KL+GG
Sbjct  322   MGTIENIPHTPVHIWTGDTPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDEW-KLIGG  380

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D ++  WLN+ F FYDEN  P RV  +D +D+  MG+ Y     PW   KP    T 
Sbjct  381   KRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPMPTPWRNFKPIRKTTA  440

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G    ++   VT VFP+  LD+ +   ++RP +SRT  EK ++EE+L  + I     QY 
Sbjct  441   GKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKIAYDDTQYV  500

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH   +++   TSV  +L + E LED G ED
Sbjct  501   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSVIFKLAITELLEDNGLED  560

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +DT+ VTL P+VGG  V ++S+ I+
Sbjct  561   EDTIAVTLVPKVGGEGVSIESVEIK  585



>gb|AED02598.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=584

 Score =   451 bits (1161),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 244/541 (45%), Positives = 330/541 (61%), Gaps = 22/541 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanl--aggPIASAADVDVAI  336
             RV CKA N  N         G   +DRRN+L+GLG             P ASAA V    
Sbjct  44    RVRCKATNGGND----HLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFASAAPVSA--  97

Query  337   HYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YI  510
               P++++C  P+D P    I   CCPP  T T++D+++P  GP+R R+ AQ   ++  Y+
Sbjct  98    --PDLTQCG-PADKPDGTTID--CCPPT-TTTIIDFKLPDKGPLRTRLAAQDVAKDPVYL  151

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  M+ L    P SF QQA +HC+YC+GGY Q G+P  EIQVH  WLFFPFHRW
Sbjct  152   AKYKKAIALMRALPDDDPRSFTQQAMVHCSYCDGGYPQVGYPNLEIQVHFCWLFFPFHRW  211

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKI+G+LI DPTFALP+WNWD   GM +P +F  TTS LYD  RN  + PP ++D
Sbjct  212   YLYFFEKIMGELIGDPTFALPFWNWDAPVGMYLPEIFTDTTSPLYDQYRNAAHQPPKLLD  271

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             LNY G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G   SPG G++E  PH
Sbjct  272   LNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDASSPGAGNIENTPH  331

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWL  1230
               +H W GD   Q NGEDMG FYSAGRDP+F++HH+NVDRMW I++  LGG D     WL
Sbjct  332   NNIHLWTGDPT-QTNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGGTDIKKTDWL  390

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDY--EYsslpwlkskpspskTTGAAAASNAP  1404
             +A FLFYDE +  +RV  +D +D   +GY Y  +           +   +    A  ++ 
Sbjct  391   DAEFLFYDEKKNLMRVKVRDSLDTTKLGYVYGDKVEIPWLTYKPTARKSSNKRKATVSSA  450

Query  1405  FVTDVFPVTLDKVVQVKVSRPKT-SRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDS  1581
              +T  FP TL   + V+V+R  T  RT A+K+ ++EVLVI GI+ AM++  +FDVY+ND 
Sbjct  451   DLTTNFPATLTDTITVEVARTSTKKRTSAQKKAQDEVLVISGIKYAMNKAVKFDVYVNDD  510

Query  1582  DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQV  1761
                  GKDK+++AG F H+PHK   S    T++RL + + LE+L AE D +V+VTL P++
Sbjct  511   ADSLAGKDKSEFAGSFVHVPHK--GSKDITTTLRLSITKLLEELDAETDSSVVVTLVPKI  568

Query  1762  G  1764
             G
Sbjct  569   G  569



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   451 bits (1161),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 236/501 (47%), Positives = 315/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P  +D    CCPP  T  + +++ P+   PMR R  A    + Y+
Sbjct  84    IAPPDITQCELVT-LPTESD-PSNCCPPTST-KIKNFEFPSASSPMRIRPAAHLVDKAYV  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRL  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPESPLYDPLRDANHQPPTLLD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D         EL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q NGE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  
Sbjct  321   TPHTQIHYWTGDP-NQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF+DEN++ VRV  KD +D   + Y ++     +             K+  
Sbjct  380   DPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRATPKLTRQEKSRR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             AA  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  440   AAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQSIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDKSEFAGSFVNVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ GG  V V +++IE+
Sbjct  558   VTLVPRTGGDFVTVANVKIEF  578



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   452 bits (1162),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 261/573 (46%), Positives = 354/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGGLYGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGLYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC   +D+P  A+ T  CCPP P   ++D+++P    +R R PA    +
Sbjct  91    ---PIAPPDVSKCGS-ADLPPGAEAT-NCCPP-PATKIIDFKLPAPAKLRIRPPAHAVDK  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVH+SWLFFPF
Sbjct  145   AYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHDSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EKILGKLINDPTFA+P+WNWD+ +GM +P ++    + LYD  R+  + PP 
Sbjct  205   HRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKTPLYDKFRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             ++DL+Y   +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P+PG GS+EG
Sbjct  265   LIDLDYNRTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDGPNPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH  VH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW + LGGK  D  
Sbjct  325   TPHGSVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIW-RTLGGKRTDLA  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPTPRRAKVALGKI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGI  1530
                     AA AS++  V    FP++L   +   V RPK  +   + ++ EEE+LVI+GI
Sbjct  443   AKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + LE+
Sbjct  503   EFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V++  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>ref|XP_009767375.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=591

 Score =   451 bits (1161),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 269/568 (47%), Positives = 352/568 (62%), Gaps = 32/568 (6%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRNQ   + SC AN+  +  +  A       +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  39    HGKRNQN-FKFSCNANSGEHDKNLDA-------VDRRNVLLGLGGLYGAANLA--PLATA  88

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTD--TVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + +    +++ +CCPP+P+D  +V  Y+ P+   +R R  A 
Sbjct  89    A----PIPSPDLKSCS-KAHINDKEEVSYSCCPPIPSDMDSVPCYKFPSMPKLRIRPAAH  143

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EYI KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  144   AADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KELQVHFS  200

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTF LPYWNWD+  GM +P MF    SSLYDA RN 
Sbjct  201   WLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREGSSLYDARRNQ  260

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             ++    I+DL + G +   +  + +  NL  +YR M+TN     LF G+ Y  GT PSPG
Sbjct  261   SHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPG  320

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPN---GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
              G++E IPHTPVH WVG   D+ N   GEDMGNFYSAG DPLFYSHHANVDRMW  W K 
Sbjct  321   MGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW-KA  379

Query  1195  LGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpsps  1368
             LGGK  D T   WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP   
Sbjct  380   LGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRK  439

Query  1369  kTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                G    S+ P  + VFP++ LD+ +   + RP +SRT+ EK ++EE+L  + I+    
Sbjct  440   SNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDS  499

Query  1546  QYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLEDLG  1716
             +Y RFDV+LN     +  + DKA+YAG +  LPH      S  T  + +L + E LED+G
Sbjct  500   KYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELLEDIG  559

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              ED+DT+ VT+ P+ GG  + ++ + I+
Sbjct  560   LEDEDTIAVTVVPKTGGEEISIEGVEIK  587



>gb|EYU26236.1| hypothetical protein MIMGU_mgv1a027162mg [Erythranthe guttata]
Length=583

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 272/562 (48%), Positives = 352/562 (63%), Gaps = 20/562 (4%)
 Frame = +1

Query  145   RNQTRL--RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             + QTR    ++CKA N + +T+       ++ +DRRN+LLG+GG+YG A          A
Sbjct  31    KTQTRRCNNITCKATNNDKNTEP------TQKLDRRNLLLGIGGVYGGAAHLLSADNPPA  84

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFAT  498
                  I  P++SKC   +++     +   CCPP   + ++DYQ+P    MR R  A  A 
Sbjct  85    AFAAPITSPDISKCTTGTNLNTQKPLDINCCPPQSAE-IIDYQLPPVTQMRYRPAAHLAG  143

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
             +EY  K+E A+  MK L    P SF QQAN+HCAYCN  Y Q G P  ++Q+HN W FFP
Sbjct  144   KEYYAKFEKAVALMKALPADDPRSFMQQANVHCAYCNLTYPQTGDPKLKLQIHNCWHFFP  203

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             +HRWYLYFYE+ILG LI DPTF LP+WNWDN +GM MP  F    S L++  RN  +LPP
Sbjct  204   WHRWYLYFYERILGNLIGDPTFGLPFWNWDNPAGMVMPERFAVQDSPLFNPRRNQTHLPP  263

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
                DL Y+ K    + +++I  NL  +Y  MV N    E F G KYV GT P PG GSVE
Sbjct  264   TPTDLAYSAKS-PTNPKKIIPNNLTIMYGEMVRNVKKLEDFYGAKYVVGTKPDPGPGSVE  322

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG----K  1206
                HT +H WVG++    +GEDMGNFYS GRDPLFYSHH NVDR+W IW+    G    K
Sbjct  323   RGSHTAMHAWVGENT--ASGEDMGNFYSTGRDPLFYSHHTNVDRLWTIWRNQRSGPKQPK  380

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAA  1386
             DF D  WLNA +LFYDEN + VRV   D ++N  MGY Y+   LPWLK++P+   T    
Sbjct  381   DFPDSDWLNADYLFYDENARLVRVKNSDTLENEKMGYVYQEVDLPWLKNRPAARVTKSKV  440

Query  1387  AASN-APFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
             AA+  AP    VFPV LDKVV+V VSRPK SR+K EKE EEE+LVI+GIEV   ++ +FD
Sbjct  441   AATTAAPPPETVFPVKLDKVVKVLVSRPKKSRSKKEKESEEELLVIEGIEVDTAKFVKFD  500

Query  1564  VYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             V++ND D     + DKA+YAG ++ +PH+  +S+T KT +RLGL E LEDL  E DD +L
Sbjct  501   VFVNDEDDEAADELDKAEYAGSYSQVPHR--NSTTVKTRIRLGLTELLEDLDVEGDDKIL  558

Query  1741  VTLAPQVGGGVVDVDSIRIEYS  1806
             VTL P+ GG  + +  I I Y+
Sbjct  559   VTLVPKAGGEDITIGGINIIYA  580



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   451 bits (1161),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 261/573 (46%), Positives = 353/573 (62%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R +VSCKA N N+  D A +      +DRRNVLLGLGGLYGVA +   P A A  
Sbjct  39    KRSFAR-KVSCKATN-NDQNDQAQSK-----LDRRNVLLGLGGLYGVAGMGTDPFAFAK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                 I  P+VSKC   +D+P  A+ T  CCPP P   ++D+++P    +R R PA    +
Sbjct  91    ---PIAPPDVSKCGS-ADLPPGAEAT-NCCPP-PATKIIDFKLPAPAKLRIRPPAHAVDK  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +K+  A+  MK L    P SF QQA +HCAYC+G Y Q GFP  E+QVH+SWLFFPF
Sbjct  145   AYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHDSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+EKILGKLINDPTFA+P+WNWD+ +GM +P ++    + LYD  R+  + PP 
Sbjct  205   HRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPKTPLYDKFRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             ++DL+Y   +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P+PG GS+EG
Sbjct  265   LIDLDYNRTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDGPNPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH  VH W GD+  QPN EDMGNFYSAGRDP+FY+HH+NVDRMW IW K LGGK  D  
Sbjct  325   TPHGSVHLWTGDNT-QPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIW-KTLGGKRTDLA  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPTPRRAKVALGKI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGI  1530
                     A  AS++  V    FP++L   +   V RPK  +   + ++ EEE+LVI+GI
Sbjct  443   AKKLGVAHATVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDV++ND D    G DK ++AG F  +PH+ +      T +RLGL + LE+
Sbjct  503   EFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKINTILRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V++  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKYGA--VNIGGIKIEFAS  593



>gb|AHH92831.1| polyphenol oxidase [Musa acuminata AAA Group]
Length=588

 Score =   451 bits (1160),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 265/562 (47%), Positives = 361/562 (64%), Gaps = 21/562 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             +R     ++SCKA++ +  T +A        +DRR+VL+GLGGL G A   G  I S A 
Sbjct  38    RRRHAHPKISCKASDEHEMTANAK-------LDRRDVLVGLGGLCGAAAGLG--IDSKA-  87

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFAT  498
             +   I  P+++KC  P+D+P  A  T  C P  P   ++D++ P    P+R R  A    
Sbjct  88    LGNPIQAPDLTKCG-PADLPTGATPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVD  146

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
              +Y++KY+ A+  M+ L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSWLFFP
Sbjct  147   SDYLDKYKKAVELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFP  206

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             +HR+YLYF+E+ILGKLI D TFALP+WNWD   GM +P+++   +SSLYD  R+  + PP
Sbjct  207   WHRFYLYFHERILGKLIGDDTFALPFWNWDAPGGMKLPSIYADPSSSLYDKFRDAKHQPP  266

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
              +VDL+Y G D   +D E I +NL  +YR +++NG T  LF+G  Y  G  P+PG GS+E
Sbjct  267   VLVDLDYNGTDPSFTDAEQIDQNLKIMYRQVISNGKTPLLFLGSAYRAGDNPNPGAGSLE  326

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DF  1212
              IPH PVH W GD   QPN EDMGNFYSAGRDP+F++HH+NVDRMW +W+K LGGK  DF
Sbjct  327   NIPHGPVHGWTGDR-SQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKK-LGGKHQDF  384

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAA  1392
              D  WLN +FLFYDEN   VRV  KDC+    + YDY+   +PWLK++P+P        A
Sbjct  385   NDKDWLNTTFLFYDENADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTA  444

Query  1393  SNAPFVT--DVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDV  1566
             +     T    FPVTL   V   V RPK SR+  EKE+EEEVL+++GIE   D + +FDV
Sbjct  445   AKTLKATAETPFPVTLQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDV  504

Query  1567  YLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK---TSVRLGLNEPLEDLGAEDDDTV  1737
             ++N ++        +++AG F ++PHK + S   K   T + LG+ + LED+GAEDDD+V
Sbjct  505   FVNATEGEGITPGASEFAGSFVNVPHKHKHSKKEKKLMTRLCLGITDLLEDIGAEDDDSV  564

Query  1738  LVTLAPQVGGGVVDVDSIRIEY  1803
             LVT+ P+ G G V V  +RI++
Sbjct  565   LVTIVPKAGKGKVSVAGLRIDF  586



>ref|XP_009414395.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   451 bits (1159),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 258/569 (45%), Positives = 357/569 (63%), Gaps = 35/569 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             +R     ++SCKA++ +  T +A        +DRR+VL+GLGGL            +AA 
Sbjct  40    RRRHAHSKISCKASDEHEMTANAK-------LDRRDVLVGLGGL----------CGAAAG  82

Query  322   VDV-------AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKR  477
             + +        I  P+++KC  P+D+P  A  T  C P  P   ++D++ P    P+R R
Sbjct  83    LGIDGKALGNPIQAPDLTKCG-PADLPKGATPTNCCPPYFPDKKIIDFKRPPNSSPLRVR  141

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A     +Y++KY+ A+  M+ L    P +F QQAN+HCAYC+G Y Q GFP  E+QVH
Sbjct  142   PAAHLVDSDYLDKYKKAVELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVH  201

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
             NSWLFFP+HR+YLYF+E+ILGKLI D TFALP+WNWD   GM +P+++   +SSLYD  R
Sbjct  202   NSWLFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPGGMKLPSIYADPSSSLYDKFR  261

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             +  + PP +VDL+Y G D   +D E I +NL  +YR +++NG T  LF+G  Y  G  P+
Sbjct  262   DAKHQPPVLVDLDYNGTDPSFTDAEQIDQNLKIMYRQVISNGKTPLLFLGSAYRAGDNPN  321

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG GS+E IPH PVH W GD  +QPN EDMGNFYSAGRDP+F++HH+NVDRMW +W+K L
Sbjct  322   PGAGSLENIPHGPVHGWTGDR-NQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKK-L  379

Query  1198  GGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspsk  1371
             GGK  DF D  WLN +FLFYDEN   VRV  KDC+    + YDY+   +PWLK++P+P  
Sbjct  380   GGKHQDFNDKDWLNTTFLFYDENADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKA  439

Query  1372  TTGAAAASNAPFVT--DVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                   A+     T    FPVTL   V   V RPK SR+  EKE+EEEVL+++GIE   D
Sbjct  440   LKAQKTAAKTLKATAETPFPVTLQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRD  499

Query  1546  QYARFDVYLNDSDQPDGGKDKAQYAGGFAHLP---HKQESSSTTKTSVRLGLNEPLEDLG  1716
              + +FDV++N ++        +++AG F ++P      +     KT + LG+ + LED+G
Sbjct  500   YFIKFDVFVNATEGEGITPGASEFAGSFVNVPHKHKHSKKEKKLKTRLCLGITDLLEDIG  559

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             AEDDD+VLVT+ P+ G G V V  +RI++
Sbjct  560   AEDDDSVLVTIVPKAGKGKVSVAGLRIDF  588



>gb|KHN46328.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=620

 Score =   452 bits (1162),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 249/526 (47%), Positives = 313/526 (60%), Gaps = 36/526 (7%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGPMRK  474
             P+A AA     I  P++  C    DVP    I     CCPP  +   +D+++P G P+R 
Sbjct  102   PLAMAA---APILEPDLEHCCITDDVPPKGVIEAQVYCCPPRSSSPPIDFKLPKGTPLRV  158

Query  475   RVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTE-EIQ  651
             R PAQF T EY+ KY+ AL  M+ L    P SF QQA+IHCAYC+GGY+Q GFP E + +
Sbjct  159   RPPAQFVTDEYLEKYKLALKRMRELPSDDPRSFKQQADIHCAYCDGGYKQLGFPVELDFK  218

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDN-QSGMTMPNMFMSTTSSLYD  828
             VH SW+FFPFHRWYLYFYE+ILG LI+DPTFALPYWNWDN   GM +P++F    S LYD
Sbjct  219   VHFSWIFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPDGGMVLPSIFADEDSPLYD  278

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
               RNP+  P  +VDLNY     G   E  + +NL  +Y S+V+      LF GK ++ G 
Sbjct  279   PRRNPDITPTTLVDLNY-----GSGKEPSVEQNLGVMYTSVVSGAKRASLFHGKPFLAGK  333

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
              P  G G+VE  PHT VHRW GD   QPN EDMG FYSAGRDP FYSHHANVDRMW IW+
Sbjct  334   QPELGGGTVELGPHTAVHRWTGDP-RQPNKEDMGRFYSAGRDPAFYSHHANVDRMWNIWK  392

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------------  1326
              +  GK  DF +  WL  SF FYDEN+  VRV  KD +D   MGY Y+            
Sbjct  393   TIPSGKRRDFKNRDWLETSFFFYDENKTLVRVKVKDSLDTNKMGYVYQDVAIPWLEKKPK  452

Query  1327  ---YsslpwlkskpspskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAek  1494
                      +           A AA   P  +  FP+T LD  V + V RPK  R+K +K
Sbjct  453   PKRTRKAKKVAFAQQFGGIGAAMAAETGP--SSKFPLTLLDSKVTLLVKRPKQLRSKRDK  510

Query  1495  ekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQES---SST  1665
             E+EEEVLVIDGIE   D   +FDVY+ D D  D G +  ++AG F+ L H   +      
Sbjct  511   EEEEEVLVIDGIEFDGDDDVKFDVYITDEDVEDIGPESTEFAGSFSTLGHSHSNMNMDKK  570

Query  1666  TKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
              KTS+ LG+ + LEDL AE+DD+VLVTL P+     + + +I+IE+
Sbjct  571   IKTSLTLGITDLLEDLDAENDDSVLVTLVPRSENVSITIQNIKIEF  616



>emb|CAA73103.1| polyphenol oxidase [Nicotiana tabacum]
Length=592

 Score =   450 bits (1158),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 269/568 (47%), Positives = 352/568 (62%), Gaps = 32/568 (6%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRNQ   + SC AN+  +  +  A       +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  40    HGKRNQN-FKFSCNANSGEHDKNLDA-------VDRRNVLLGLGGLYGAANLA--PLATA  89

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTD--TVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + +    +++ +CCPP+P+D  +V  Y+ P+   +R R  A 
Sbjct  90    A----PIPPPDLKSCS-KAHINDKEEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAH  144

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EYI KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  145   AADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KELQVHFS  201

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTF LPYWNWD+  GM +P MF    SSLYDA RN 
Sbjct  202   WLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMGIPPMFDREGSSLYDARRNQ  261

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             ++    I+DL + G +   +  + +  NL  +YR M+TN     LF G+ Y  GT PSPG
Sbjct  262   SHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPG  321

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPN---GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
              G++E IPHTPVH WVG   D+ N   GEDMGNFYSAG DPLFYSHHANVDRMW  W K 
Sbjct  322   MGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW-KA  380

Query  1195  LGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpsps  1368
             LGGK  D T   WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP   
Sbjct  381   LGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRK  440

Query  1369  kTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                G    S+ P  + VFP++ LD+ +   + RP +SRT+ EK ++EE+L  + I+    
Sbjct  441   SNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDS  500

Query  1546  QYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLEDLG  1716
             +Y RFDV+LN     +  + DKA+YAG +  LPH      S  T  + +L + E LED+G
Sbjct  501   KYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELLEDIG  560

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              ED+DT+ VT+ P+ GG  + ++ + I+
Sbjct  561   LEDEDTIAVTVVPKTGGEEISIEGVEIK  588



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   450 bits (1157),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 235/500 (47%), Positives = 314/500 (63%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P+ +D    CCPP  T  + +++ P+   PMR R  A    + Y+
Sbjct  84    IAAPDITQCELVT-LPSESD-PSNCCPPTST-KIKNFEFPSASSPMRIRPAAHLVDKAYV  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRL  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPQSPLYDPLRDANHQPPTLLD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D        EEL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q NGE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  
Sbjct  321   TPHTEIHYWTGDP-NQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF++EN++ VRV  KD +D   + Y ++     +             K   
Sbjct  380   DPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRPTPKLTRQEKLRR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             AA  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  440   AAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKENEDEVLVIEGIEYEENQLIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDKSEFAGSFVNVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIE  1800
             VT  P+ GG  V V +++IE
Sbjct  558   VTFVPRSGGDSVTVANVKIE  577



>dbj|BAA21677.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   450 bits (1157),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 235/510 (46%), Positives = 313/510 (61%), Gaps = 24/510 (5%)
 Frame = +1

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             AI  P+VSKC  P+D+P    +   CCPP  T  ++D+++P    +R R PA    Q Y 
Sbjct  91    AIAPPDVSKCG-PADLPQGG-VPTICCPPRST-KIIDFKLPAPAKLRIRPPAHAGDQAYR  147

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
             +K+  A+  MK L    P SF QQ  +HCAYC+G Y Q GFP  E+Q+HNSWLFFP HR+
Sbjct  148   DKHYKAMELMKALPDDDPRSFKQQGAVHCAYCDGAYDQVGFPELELQIHNSWLFFPLHRY  207

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKILGKLINDPTFA P+WNWD+ +GM +P ++    S LYD  R+  + PP +VD
Sbjct  208   YLYFFEKILGKLINDPTFAGPFWNWDSPAGMPLPAIYADPKSPLYDKLRSAQHQPPTLVD  267

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG PH
Sbjct  268   LDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRAGDEPDPGGGSIEGTPH  327

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD+  QPN EDMGNFYSAGRDP+F++HH+NVDRMW IW K LGGK  D TD  
Sbjct  328   APVHLWTGDNT-QPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIW-KTLGGKRADLTDSD  385

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlkskpsp  1365
             WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L      
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALSKIAKK  445

Query  1366  skTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGIEVA  1539
                  AA AS++  V    FP+ L   +   V RPK  +   + ++ EEE+LVI+GIE  
Sbjct  446   LGVAHAAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1540  MDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGA  1719
              D   +FDVY+ND D    G DK ++AG F  +PH  +      T +RLGL + LE++ A
Sbjct  506   RDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHKHKKKMNTILRLGLTDLLEEIEA  565

Query  1720  EDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             EDDD+V+VTL P+ G   V +  I+IE+++
Sbjct  566   EDDDSVVVTLVPKFGA--VKIGGIKIEFAS  593



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   449 bits (1156),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 263/573 (46%), Positives = 346/573 (60%), Gaps = 35/573 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KR+  R  VSC A N N+  D A +      +DRRNVLLGLGGLYGVA +   P      
Sbjct  39    KRSLGR-EVSCNATN-NDQFDQAQSK-----LDRRNVLLGLGGLYGVAGMVTDPRGFGK-  90

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ  501
                +I  P+VSKC  P D+P  A +   CCPP P+  ++D+++P    +R R PA    Q
Sbjct  91    ---SIAPPDVSKCG-PGDLPQGA-VPTNCCPP-PSTKIIDFKLPAPANLRIRPPAHAVDQ  144

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y +KY  A+  MK L      SF QQ  +HCAYC+G Y Q GFP  E+Q+HNSWLFFPF
Sbjct  145   AYRDKYYKAMELMKALPDDDSRSFKQQGAVHCAYCDGAYDQVGFPELELQLHNSWLFFPF  204

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF EKILG LINDPTFALP+WNWD+ +GM +P ++    S LYD  R+  + PP 
Sbjct  205   HRYYLYFCEKILGNLINDPTFALPFWNWDSPAGMPLPAIYADPKSPLYDKLRSAKHQPPT  264

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             +VDL+Y G +  +S E  I  NL  +YR MV+N    +LF G  Y  G  P PG GS+EG
Sbjct  265   LVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRAGDEPDPGGGSIEG  324

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
              PH PVH W GD+  QPN EDMGNFYSAGRDP+F++HH+NVDRMW IW K LGGK  D T
Sbjct  325   TPHAPVHLWTGDNT-QPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIW-KTLGGKRADLT  382

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------------Ysslpwlksk  1356
             D  WL++ FLFY+EN + VRV  +DC++   +GY Y+               +   L   
Sbjct  383   DSDWLDSGFLFYNENAELVRVKVRDCLETKHLGYVYQDVDIPWLSSKPTPRRAEVALSPI  442

Query  1357  pspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekek-eeeVLVIDGI  1530
                      A AS++  V    FP+ L   +   V RPK  +   + ++ EEE+LVI+GI
Sbjct  443   AKKLGVAHPAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGI  502

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   D   +FDVY+ND D    G DK ++AG F  +PH  +      T++RLGL + LE+
Sbjct  503   EFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHKHKKKMNTTLRLGLTDLLEE  562

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             + AEDDD+V+VTL P+ G   V +  I+IE+++
Sbjct  563   IEAEDDDSVVVTLVPKFGA--VKIGGIKIEFAS  593



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   450 bits (1158),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 265/576 (46%), Positives = 357/576 (62%), Gaps = 33/576 (6%)
 Frame = +1

Query  145   RNQTRL----RVSCKANN--PNNSTDDAAASPGSRIIDRRnvllglgglygvanla--gg  300
             RN++R     +VSC + N  PN+ +        S  +DRRNVLLG+GGLYG A       
Sbjct  39    RNRSRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATK  98

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKR  477
             P+A  A     I  P++SKC   + VP     T  CCPPV T  ++D+Q+P+ G PMR R
Sbjct  99    PLAFGA----PIQAPDISKCGTAT-VPDGVTPTN-CCPPV-TTKIIDFQLPSSGSPMRTR  151

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A   ++EY+ KY+ A+   K L    P SF QQAN+HC YC G Y Q G+   E+QVH
Sbjct  152   PAAHLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVH  211

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
              SWLF PFHR+YLYF E+IL KLI+DPT AL YW WDN  GM MP ++ S+ SSLYD  R
Sbjct  212   ASWLFLPFHRYYLYFNERILAKLIDDPTIALAYWAWDNPDGMYMPTIYASSPSSLYDEKR  271

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             N  +LPP ++DL+Y G +  + D+EL  +NL  +Y+ +V+   T +LF+G  Y  G    
Sbjct  272   NAKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAID  331

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG G++E +PH  VH+W G   D+P+ EDMGNFY+AGRDP+F+ HHANVDRMW IW K +
Sbjct  332   PGAGTLEHVPHNIVHKWTG-LADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIW-KTI  388

Query  1198  GG---KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYs-------slpwl  1347
             GG   KDFTD  WL+A+F+FYDEN+Q V+V   DC+D   + Y Y+              
Sbjct  389   GGKNRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAK  448

Query  1348  kskpspskTTGAAAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekeeeVL  1515
                 + S  +G A A+  P  T      FP  L+ V++V+V RPK SR+K EKE EEEVL
Sbjct  449   AKTTTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVL  508

Query  1516  VIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLN  1695
             +I GIE+  + + +FDVY+ND D        +++AG F ++PHK      TKT++R  +N
Sbjct  509   LIKGIELDRENFVKFDVYINDEDYSVSRPKNSEFAGSFVNVPHKHMKEMKTKTNLRFAIN  568

Query  1696  EPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             E LEDLGAEDD++V+VT+ P+ GG  V +  I IE+
Sbjct  569   ELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEF  604



>ref|XP_009590067.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   449 bits (1156),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 267/568 (47%), Positives = 353/568 (62%), Gaps = 34/568 (6%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRNQ   + SC AN+  N+ +          +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  38    HGKRNQN-FKFSCNANSDKNNLE---------AVDRRNVLLGLGGLYGAANLA--PLATA  85

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTD--TVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + +    +++ +CCPP+P+D  +V  Y+  +   +R R  A 
Sbjct  86    A----PIPPPDLKSCS-KAHINDKTEVSYSCCPPIPSDMDSVPYYKFSSMPKLRIRPAAH  140

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EYI KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  141   AADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KELQVHFS  197

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTF LPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  198   WLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREGSSLYDEKRNQ  257

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             ++    I+DL + G++   +  + +  NL  +YR M+TN     LF G+ Y  GT PSPG
Sbjct  258   SHRNGTIIDLGHFGQEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPG  317

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPN---GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
              G++E IPHTPVH WVG  +D+ N   GEDMGNFYSAG DPLFYSHHANVDRMW  W K 
Sbjct  318   MGTIENIPHTPVHIWVGSRLDENNTKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW-KA  376

Query  1195  LGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpsps  1368
             LGGK  D T   WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP   
Sbjct  377   LGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRK  436

Query  1369  kTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                G    S+ P  + VFP++ LD+ +   + RP +SRT+ EK ++EE+L  + I+    
Sbjct  437   SNAGKVNLSSVPPASRVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDS  496

Query  1546  QYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLEDLG  1716
             +Y RFDV+LN     +  + DKA+YAG +  LPH      S  T  + +L + E LED+G
Sbjct  497   KYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELLEDIG  556

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              ED+DT+ VT+ P+ GG  + ++++ I+
Sbjct  557   LEDEDTIAVTVVPKKGGEEISIEAVEIK  584



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   449 bits (1155),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 235/501 (47%), Positives = 315/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P  +D    CCPP  T  + +++ P+   PMR R  A    + Y+
Sbjct  84    IAPPDITQCELVT-LPTESD-PSNCCPPTST-KIKNFEFPSASSPMRIRPAAHLVDKAYL  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRL  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPKSPLYDPLRDANHQPPTLLD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D         EL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q NGE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  
Sbjct  321   TPHTQIHYWTGDP-NQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF+DEN++ VRV  KD +D   + Y ++     +             K+  
Sbjct  380   DPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARATPKFTRQEKSRR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             +A  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  440   SAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDKSEFAGSFINVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ GG  V V +++IE+
Sbjct  558   VTLVPRTGGDSVTVANVKIEF  578



>ref|XP_008371327.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   449 bits (1155),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 248/551 (45%), Positives = 334/551 (61%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CK    +N   D     G   +DRRN+L+GLG       +   P A AA     I  
Sbjct  46    RVRCKXTKGDNDNLDQ----GLARLDRRNMLIGLGAGGLYGXVGN-PFAFAA----PISA  96

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ--EYINK  516
             P+++ C  P+  P  + I   CCPP  T T++D+++P  GP+R R  AQ      EY+ K
Sbjct  97    PDLTTC-VPASKPDGSTID--CCPPT-TTTIIDFELPDSGPLRTRPAAQDVANDPEYLAK  152

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  153   YKNAVEMMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWYL  212

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI D TFALP+WNWD  +GM +P +F  TTSSLYD  RN  + PP ++DLN
Sbjct  213   YFYEKIMGELIGDQTFALPFWNWDAPAGMYIPEIFTDTTSSLYDQYRNTAHQPPKLLDLN  272

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y   D  + D   I ENL  +Y+ MV+N     LF G+ Y  G  P PG G++E  PH  
Sbjct  273   YGXTDDDVDDATRIKENLTTMYKQMVSNATCHRLFYGEPYSAGDEPDPGAGNIETTPHNN  332

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H WVGD   QPNGEDMG FYSA RDP+FYSHH+NVDRMW I++  LGG D  +  WL+A
Sbjct  333   IHLWVGDPT-QPNGEDMGTFYSAARDPVFYSHHSNVDRMWXIYKDKLGGTDIENTDWLDA  391

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +   RV  +D +D   +GY Y+ +               T    A  ++  +
Sbjct  392   EFLFYDEKKNLXRVXXRDSLDTKKLGYVYDXNVSIPWLXSKPTXRKSTNKRKAXVSSSDL  451

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             +  FP TL  ++ V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FDVY+ND   
Sbjct  452   STTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDDAD  511

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D++++VTL P+VG 
Sbjct  512   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSITSLLEELDAETDNSLVVTLVPKVGK  569

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  570   GPITIGGFSIE  580



>ref|XP_006370117.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
 gb|ERP66686.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
Length=543

 Score =   447 bits (1151),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 234/497 (47%), Positives = 311/497 (63%), Gaps = 17/497 (3%)
 Frame = +1

Query  346   NVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYINKYE  522
             N+++C     +P  +D    CCPP  T  + +++ P+   PMR R  A    + Y+ KY 
Sbjct  50    NITQCEL-VPLPTESD-PSNCCPPTST-KIKNFEFPSASSPMRIRPAAHLVDKAYVAKYA  106

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR YLY+
Sbjct  107   KAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRLYLYY  166

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             +E+ILGKLI+ PTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++DLNYA
Sbjct  167   FERILGKLIDGPTFALPFWNWDAPAGMQMPAIFTDPESPLYDPLRDANHQPPTLLDLNYA  226

Query  883   GKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHT  1053
               D        EEL A NL  +YR MV+      LF GK Y  G  PSPG G++E  PHT
Sbjct  227   KGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIETTPHT  286

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSW  1227
              +H W GD  +Q NGE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  D  W
Sbjct  287   QIHYWTGDP-NQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIEDPDW  345

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAAA  1392
             LN+ FLF+DEN++ VRV  KD +D   + Y ++     +             K+  AA  
Sbjct  346   LNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRATPKLTRQEKSRRAAKK  405

Query  1393  SNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYL  1572
             S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +FDV +
Sbjct  406   SVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKFDVLV  465

Query  1573  NDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLA  1752
             ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++VT  
Sbjct  466   NDEPDSPGGPDKSEFAGSFVNVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLVVTFV  523

Query  1753  PQVGGGVVDVDSIRIEY  1803
             P+ GG  V V +++IE+
Sbjct  524   PRSGGDFVTVANVKIEF  540



>emb|CBZ41491.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=609

 Score =   450 bits (1157),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 251/506 (50%), Positives = 327/506 (65%), Gaps = 24/506 (5%)
 Frame = +1

Query  346   NVSKC-HYPSDVPANAD-ITG-TCCPPV-PTDTVLDYQIPTGGPMRKRVPAQFATQEYIN  513
             N+S C    S++  +AD + G  CCPPV  TD   DY +PT    R R  AQ AT +Y+ 
Sbjct  102   NISDCVTASSNLRNSADAVRGLACCPPVLSTDKPKDYVLPTNPVTRIRPAAQRATSDYVA  161

Query  514   KYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQ--FGFPTEEIQVHNSWLFFPFHR  687
             KY+ A+ AMK+L   HPHS+ QQ  IHCAYCNGGY Q   G P  ++Q+HNSWLFFPFHR
Sbjct  162   KYQQAIQAMKDLPDDHPHSWKQQGKIHCAYCNGGYSQGQTGHPELQLQIHNSWLFFPFHR  221

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMST--TSSLYDANRNPNYLPPA  861
             WYLYFYEKILGKLINDP+FA+P+WNWDN +GM +P MF      + L+D  R+  +LPP 
Sbjct  222   WYLYFYEKILGKLINDPSFAIPFWNWDNPTGMVLPGMFEDNGRNNPLFDPFRDATHLPPT  281

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ----G  1029
             I D+ YAGKD G S  + I  NL ++YR M+TN   T  F G ++V G  P   Q    G
Sbjct  282   IFDIEYAGKDTGASCIDQIGINLPSMYRQMITNASDTTSFFGGEFVAGDDPLNKQFNVAG  341

Query  1030  SVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL--LGG  1203
             S+E   HT  HRWVG+     NGEDMGNFYSAG DPLFY HHANVDRMW IW+ +   G 
Sbjct  342   SIEAGVHTAAHRWVGNP-RMANGEDMGNFYSAGYDPLFYVHHANVDRMWKIWKDVDRKGH  400

Query  1204  KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA  1383
             KD T   WLNAS++FYDENE  VRVY +DC+D   MGYDYE S +PW++S+P+       
Sbjct  401   KDPTAGDWLNASYVFYDENENLVRVYNRDCVDVRKMGYDYERSEIPWIRSRPTAHAKGAN  460

Query  1384  AAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
              AA +   V  V    FP+ L+K+V+V V RP T+RTK +KEKE E+L ++GI+   +++
Sbjct  461   VAAKSVGIVQKVEDVIFPLKLNKIVKVLVKRPATNRTKEDKEKENELLFVNGIQFDGERF  520

Query  1552  ARFDVYLNDSDQPDGGKDKA---QYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAE  1722
              +F+V++ND D  DG +  A   ++AG FA LPH        ++ V  G+ E LED+ AE
Sbjct  521   VKFNVFVNDVD--DGVETTAASSEFAGSFAQLPHNHGDKMLMRSGVAFGITELLEDIEAE  578

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              D+++LVTL P+ G   + +  I I+
Sbjct  579   GDESILVTLVPKTGCDELTISEITIK  604



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   449 bits (1155),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 262/560 (47%), Positives = 341/560 (61%), Gaps = 18/560 (3%)
 Frame = +1

Query  157   RLRVSCKANNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVD  327
             R  +SCKA NPNN+         S ++   DRRNVL+GLGGLYG   LA  P+A A    
Sbjct  50    RSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLIGLGGLYGATTLAQKPLAFA----  105

Query  328   VAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
               +  P+++KC   +++    + T  CCPPV T  +  +      P+R R  A   T EY
Sbjct  106   TPLAPPDLTKCTL-AEITTGGE-TVACCPPVSTK-IKTFTXDQSIPLRTRPAAHLVTDEY  162

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + K++ A   M+ L    P S  QQA +HCAYCNG Y Q GFP  +IQVH SWLFFPFHR
Sbjct  163   LAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYFYE+ILGKLI+DPTFALPYWNWD+  G  +P+++  TTS LYD  R+  + PP +V
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRHAGHQPPVLV  282

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG-TPPSPGQGSVEGI  1044
             DL+Y G D  + D+  I ENL  +YR MV+   T +LF G +Y  G T      G++E  
Sbjct  283   DLSYGGTDDDVDDQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGETTTGKYAGTIENN  342

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTD  1218
             PH  +H W GD  +QPN EDMGNFYSAGRDPLFY+HH NVDRMW IW K LGG  KD TD
Sbjct  343   PHNNIHLWCGDP-NQPNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIW-KTLGGKRKDPTD  400

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIA-MGYDYE-YsslpwlkskpspskTTGAAAA  1392
               WL+A FLFYDEN + V    +D +     + Y YE  S         +        A 
Sbjct  401   TDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAK  460

Query  1393  SNAPFVTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
              +A  +T  FP T D    V+V+RPK   RTK EK  EEEVL+I  IE   ++  +FDV+
Sbjct  461   VSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVF  520

Query  1570  LNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             +ND  +    KDK+++AG F H+PH Q++ + TKT+++LG+ + LEDLG EDD +VLVTL
Sbjct  521   INDDAESLSRKDKSEFAGSFVHVPHNQKTGTKTKTNLKLGITDLLEDLGVEDDSSVLVTL  580

Query  1750  APQVGGGVVDVDSIRIEYST  1809
              P+V    + V   +IEYS+
Sbjct  581   VPRVSNSPITVGGFKIEYSS  600



>ref|XP_011082856.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=558

 Score =   447 bits (1151),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 269/559 (48%), Positives = 344/559 (62%), Gaps = 50/559 (9%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KR   RL+VSC   N N+S+ +   S G   +DRRN+LLGLGGLYG +NL   P ASA
Sbjct  33    HAKRGH-RLQVSCATENQNDSSRNVETSQGK--VDRRNMLLGLGGLYGASNLVSAPGASA  89

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
                   I  P + KC   +++  N  +   CCPP+ +  ++DY++P    M+ R  A   
Sbjct  90    N----PIKPPEIDKCGTATNLNNNTQLDINCCPPL-SQNIVDYRLPPVFQMKIRPSAHRV  144

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
             + EYI KY  A+  MK L    P SF QQANIHCAYCNG Y Q G  T ++QVHNSWLFF
Sbjct  145   SPEYIFKYNMAIDRMKRLPKEDPRSFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFF  204

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHRWYLYFYE+ILGKLI DPTFALP+WNWDN  GMT+P +F+   S+LYD  RN   +P
Sbjct  205   PFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPIFVDPKSALYDEKRNQANMP  264

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             PA+VDL   G  R     +++A NL  +Y  M+        FMG+ Y  GTP +PG G+ 
Sbjct  265   PAVVDL---GMTRNPDPLQVVANNLTIMYNEMIRGNSDVYDFMGQPYREGTPVNPGPGAS  321

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ-----KLLG  1200
             E   HT VH WVGD   QP+GED+GNFYSAGRDPLFY HHANVDRMW +WQ     K + 
Sbjct  322   ERGSHTAVHVWVGDP-SQPSGEDLGNFYSAGRDPLFYCHHANVDRMWSLWQYFLPSKTVP  380

Query  1201  GKDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTG  1380
              K  TD  +LNA+FLFYDEN Q VRV  KDC+DN+ MGYD+E   LP             
Sbjct  381   DKRITDPDFLNAAFLFYDENAQLVRVTVKDCLDNLRMGYDFERIDLP-------------  427

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
                         +FP+TLDK+V+V V  PKT + KA     +E+L+++ I+V   ++ +F
Sbjct  428   ------------IFPLTLDKIVRVLV--PKTKKGKA-----DELLLLENIQVDTTKFLKF  468

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D      DKA Y G +A +PHK  + S T TS+RL L +  +D+   DDDT+L
Sbjct  469   DVFINDEDDNITELDKAAYVGTYAQVPHKTANKSAT-TSIRLKLTDLYDDMDVADDDTIL  527

Query  1741  VTLAPQVGGGVVDVDSIRI  1797
             VTL P+  G  V +  I+I
Sbjct  528   VTLVPRHQGPGVTIGGIKI  546



>ref|XP_004293563.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   448 bits (1153),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 257/551 (47%), Positives = 341/551 (62%), Gaps = 24/551 (4%)
 Frame = +1

Query  166   VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglyg--vanlaggPIASAADVDVAIH  339
             + CKA N N+   DA        +DRRN+L+GLG       A L   P A AA V     
Sbjct  50    IVCKATNNNDQNKDAVGK-----LDRRNMLIGLGAGGLYGTAGLETNPFAFAAPVPP---  101

Query  340   YPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YIN  513
              P+++ C  P+D P    I   CCPP  T T++D+++P  GPMR R+ AQ   ++  Y+ 
Sbjct  102   -PDLATCG-PADKPDGTTID--CCPP-KTTTIIDFKLPDPGPMRTRLAAQNVAKDPVYLA  156

Query  514   KYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWY  693
             KY+ A+  M+ L    P S  QQA +HC+YC+GGY   GF   EIQVH  WLF+P+HR Y
Sbjct  157   KYKKAIELMRALPDDDPRSLAQQAMVHCSYCDGGYPMAGFSDLEIQVHFCWLFYPWHRLY  216

Query  694   LYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDL  873
             LYFYEKI+ KLI+DPTFALP+WNWD  +GM +P++F  TTSSLYD  RN  + PP ++DL
Sbjct  217   LYFYEKIMCKLIDDPTFALPFWNWDAPAGMYIPSIFTDTTSSLYDQYRNAAHQPPKLLDL  276

Query  874   NYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHT  1053
             NY G D    D+  I ENL  +Y+ M++   +  LF G+ Y  G  P+PG G++E IPH 
Sbjct  277   NYGGTDDDTDDKTRIRENLTTMYQQMISKATSHRLFFGEPYSAGDEPNPGAGNIESIPHN  336

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLN  1233
              +H W GD   Q NGEDMG FYSAGRDP+FYSHHANVDRMW I+ K  GG D T   WL+
Sbjct  337   NIHLWTGDPT-QTNGEDMGAFYSAGRDPIFYSHHANVDRMWSIY-KARGGTDITKKDWLD  394

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-YsslpwlkskpspskTTGAAAASNAPFV  1410
               FLFYDEN+  VRV  +D +D   +GY Y+            +        AA ++  +
Sbjct  395   TEFLFYDENKNLVRVKVRDSLDESKLGYKYQDVEIPWLNSKPTARKSKNKRKAAVSSADL  454

Query  1411  TDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             T  FP TL + + V+V+RP  + RT AEK KEEEVLVI GIE A  +  +FDVY+ND   
Sbjct  455   TSKFPATLSETISVEVARPSAAKRTTAEKTKEEEVLVISGIEFAGSEMLKFDVYVNDDAD  514

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDKA++AG F H+PH+  ++   KT++RLG+   L DLGAE+D++V+VTL P+ G 
Sbjct  515   EVSGKDKAEFAGSFVHVPHR--ANKKIKTNLRLGITNLLTDLGAEEDNSVVVTLVPKFGK  572

Query  1768  GVVDVDSIRIE  1800
             G + +   +IE
Sbjct  573   GAI-IGGFKIE  582



>ref|XP_008224999.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   448 bits (1152),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 253/549 (46%), Positives = 338/549 (62%), Gaps = 28/549 (5%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglyg--vanlaggPIASAADVDVAI  336
             RV CKA N     DD      SR+ DRRN+L+GLG         L   P A AA V    
Sbjct  48    RVRCKATN---GGDDHLQQGLSRL-DRRNMLIGLGAGGLYGSTGLENNPFAFAAPVSA--  101

Query  337   HYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YI  510
               P  +KC  P+D P  + I   CCPP  T T++D+++P  GP+R R+ AQ   ++  Y+
Sbjct  102   --PEFTKCG-PADKPDGSTID--CCPPTAT-TIIDFKLPDKGPLRTRLAAQNVAKDPVYL  155

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  M+ L    P SF QQA +HC+YC+GGY Q  +   EIQVH  WLF+PFHRW
Sbjct  156   AKYKKAIALMRALPDDDPRSFAQQAKVHCSYCDGGYPQVEYSDLEIQVHFCWLFYPFHRW  215

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKI+G+LI DPTFALP+WNWD  +GM +P +F  TTSSLYD  RN  + PP ++D
Sbjct  216   YLYFFEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTTSSLYDQYRNAAHQPPKLLD  275

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             LNY G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G  P+PG G++E IPH
Sbjct  276   LNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPNPGAGNIESIPH  335

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWL  1230
               +H W GD+  Q NGEDMG FYSAGRDPLFY+HH+NVDRMW I++  LGG D     +L
Sbjct  336   NNIHLWTGDTT-QTNGEDMGAFYSAGRDPLFYAHHSNVDRMWSIYKSKLGGTDIEKKDYL  394

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYssl---pwlkskpspskTTGAAAASNA  1401
             +A FLFYDE +  VRV  +D +D   +GY Y+          K     S     A  S+A
Sbjct  395   DAEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDNKVEIPWLTYKPTARKSSNKRKATVSSA  454

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
                T+ FP  L   + V+V+R  T+ RT A+K+ ++EVLVI GI+ A ++  +FDVY+ND
Sbjct  455   DLTTN-FPAPLTDTISVEVARTSTTKRTSAQKKAQDEVLVISGIKYAGNETVKFDVYVND  513

Query  1579  SDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
               +   GKDK+++AG F  +PHK +   T  T++RL + + LE+L AE D +V+VTL P+
Sbjct  514   DAESLAGKDKSEFAGSFIQVPHKGKKDIT--TTLRLSITKLLEELDAETDSSVVVTLVPK  571

Query  1759  VG----GGV  1773
             VG    GGV
Sbjct  572   VGTITIGGV  580



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   447 bits (1151),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 234/501 (47%), Positives = 315/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P  +D    CCPP  T  + +++ P+   PMR R  A    + Y+
Sbjct  84    IAPPDITQCELVT-LPTESD-PSNCCPPTST-KIKNFEFPSASSPMRIRPAAHLVDKAYL  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QA++HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRL  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+W+WD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWSWDAPAGMQMPAIFTDPKSPLYDPLRDANHQPPTLLD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D         EL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q NGE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  
Sbjct  321   TPHTQIHYWTGDP-NQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF+DEN++ VRV  KD +D   + Y ++     +             K+  
Sbjct  380   DPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARATPKFTRQEKSRR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             +A  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  440   SAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDKSEFAGSFINVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ GG  V V +++IE+
Sbjct  558   VTLVPRTGGDSVTVANVKIEF  578



>ref|XP_011014565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   447 bits (1151),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 235/501 (47%), Positives = 314/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P+ ++ T  CCP   T  + +++ P+   PMR R  A    + Y+
Sbjct  84    IAPPDLTQCELVT-LPSESNPTN-CCPQTST-KIKNFEFPSASSPMRIRPAAHLVDKAYV  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QAN+HCAYC+G Y Q GFP  ++Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKNQANVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRA  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM MP +F    S LYD  R+ N+ PP ++D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPQSPLYDPLRDANHQPPTLLD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D        EEL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q  GE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  
Sbjct  321   TPHTEIHIWTGDP-NQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF++EN++ VRV  KD +D   + Y ++     +             K   
Sbjct  380   DPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRPTPKLTRQEKLRR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             AA  S        FPV LDKV+ V+VSRPK SR+  EKE E EVLVI+GIE   +Q  +F
Sbjct  440   AAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEAEVLVIEGIEYEENQLIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG DK+++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDKSEFAGSFVNVPHKHAKKS--KTNLVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ GG  V V +++IE+
Sbjct  558   VTLVPRTGGDFVTVANVKIEF  578



>ref|XP_003529305.2| PREDICTED: polyphenol oxidase A1, chloroplastic [Glycine max]
Length=626

 Score =   449 bits (1154),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 254/528 (48%), Positives = 325/528 (62%), Gaps = 38/528 (7%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGPMRK  474
             P+A AA     I  P++  C    DVP    I     CCPP  +   +D+++P G P+R 
Sbjct  108   PLAMAA---APILQPDLEHCCITDDVPPKGVIEAQVYCCPPRSSSPPIDFKLPKGTPLRV  164

Query  475   RVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTE-EIQ  651
             R PAQF T EY+ KY+ AL  M+ L    P SF QQA+IHCAYC+GGY+Q GFPTE + +
Sbjct  165   RPPAQFVTDEYLEKYKLALKRMRELPSDDPRSFKQQADIHCAYCDGGYKQLGFPTELDFK  224

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDN-QSGMTMPNMFMSTTSSLYD  828
             VH SWLFFPFHRWYLYFYE+ILG LI+DPTFALPYWNWDN   GM +P ++    S LYD
Sbjct  225   VHFSWLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPDGGMVIPLIYRDEDSPLYD  284

Query  829   ANRNPNYLPPAIVDLNY-AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG  1005
               RNP+  P  +VDLNY +GKD        + +NL  +Y S+V+      LF GK +  G
Sbjct  285   PRRNPDITPDTLVDLNYGSGKDPS------VEQNLGVMYTSVVSGAKRASLFHGKAFFAG  338

Query  1006  TPPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIW  1185
               P  G G+VE  PHT +HRW GD   QPN EDMG FYSAGRDP+FYSHHANVDRMW IW
Sbjct  339   KQPELGGGTVELGPHTALHRWTGDP-RQPNKEDMGRFYSAGRDPIFYSHHANVDRMWNIW  397

Query  1186  QKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskp  1359
             + +  GK  DF +  WL  +F FYDEN+  V V  KD +D+  MGY Y+   +PWL+ + 
Sbjct  398   KTIPTGKRRDFKNRDWLETTFFFYDENKNLVSVKVKDSLDSKKMGYVYQDVDIPWLQKRT  457

Query  1360  spskT--------------TGAA-AASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAe  1491
              P +T               GAA AA   P  +  FP+T LD  V + V RPK  R+K +
Sbjct  458   KPKRTRKAKQVAFTQQFGGIGAAIAAETGP--SSKFPLTLLDSKVTLLVKRPKQLRSKKD  515

Query  1492  kekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQES---SS  1662
             KE++EEVLVIDGIE   D   +FDVY+ D D  + G +  ++AG FA L H   +     
Sbjct  516   KEEDEEVLVIDGIEFDGDDDVKFDVYITDEDVEEIGPENTEFAGSFATLGHSHSNMNMDK  575

Query  1663  TTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
               KTS+ LG+ + LEDL AE+DD++LVTL P+     + + SI+IE+ 
Sbjct  576   KIKTSLTLGITDLLEDLDAENDDSILVTLVPRSENVTITIQSIKIEFE  623



>gb|ABE96885.1| polyphenol oxidase [Nicotiana tabacum]
Length=502

 Score =   444 bits (1142),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 237/499 (47%), Positives = 313/499 (63%), Gaps = 18/499 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTD--TVLDYQIPTGGPMRKRVPAQFATQEYINK  516
             P++  C   + +   A+++ +CCPP+P+D  +V  Y+ P+   +R R  A  A +EYI K
Sbjct  5     PDLKSCS-KAHINDKAEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAHAADEEYIAK  63

Query  517   YEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
             Y+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH SWLFFPFHRW
Sbjct  64    YQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KELQVHFSWLFFPFHRW  120

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILG LINDPTF LPYWNWD+  GM +P MF    SSLYDA RN ++    I+D
Sbjct  121   YLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREGSSLYDARRNQSHRNGTIID  180

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L + G +   +  + +  NL  +YR M+TN     LF G+ Y  GT PSPG G++E IPH
Sbjct  181   LGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPGMGTIENIPH  240

Query  1051  TPVHRWVGDSVDQPN---GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFT  1215
             TPVH WVG   D+ N   GEDMGNFYSAG DPLFYSHHANVDRMW  W K LGGK  D T
Sbjct  241   TPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW-KALGGKRRDLT  299

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAAS  1395
                WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP      G    S
Sbjct  300   HKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKVNLS  359

Query  1396  NAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYL  1572
             + P  + VFP++ LD+ +   + RP +SRT+ EK ++EE+L  + I+    +Y RFDV+L
Sbjct  360   SVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFDVFL  419

Query  1573  NDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLEDLGAEDDDTVLV  1743
             N     +  + DKA+YAG +  LPH      S  T  + +L + E LED+G ED+DT+ V
Sbjct  420   NVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELLEDIGLEDEDTIAV  479

Query  1744  TLAPQVGGGVVDVDSIRIE  1800
             T+ P+ GG  + ++ + I+
Sbjct  480   TVVPKTGGEEISIEGVEIK  498



>gb|EPS59410.1| polyphenoloxidase [Genlisea aurea]
Length=575

 Score =   446 bits (1148),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 254/571 (44%), Positives = 349/571 (61%), Gaps = 42/571 (7%)
 Frame = +1

Query  133   AHKKRNQTRLR---VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggP  303
             A  K+++ RLR   +SC A    NS++   A+P  ++ DRRN+L GLGG+  +      P
Sbjct  16    APPKQSRFRLRPRLISCSAAKSPNSSNPDPATPLPKV-DRRNILFGLGGVGLMN-----P  69

Query  304   IASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVP  483
             + + A+    I  P  +KC   +++     +   CCPPV T  ++D+++P  G +R R  
Sbjct  70    MDAGAN---PIEPPEFNKCGTATNLNTGKPLDINCCPPV-TTKIIDFKLPPVGKIRVRNS  125

Query  484   AQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
             A   + EY  KY AA+ AMK+L    P SF QQAN+HCAYCNG Y Q G    ++QVHNS
Sbjct  126   AHRVSAEYTAKYNAAIKAMKSLPDDDPRSFKQQANVHCAYCNGAYDQPGGGKIDLQVHNS  185

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYF+EKILG LI DP FALP+WNWDN  GMT+P +F+ + S++YD NRN 
Sbjct  186   WLFFPFHRWYLYFFEKILGSLIKDPDFALPFWNWDNPKGMTIPPIFLDSNSAIYDVNRNQ  245

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
              +LPPA++DL   G    L   ++++ NL  +Y  M+    +   FMGK Y  G  P+PG
Sbjct  246   AHLPPAVIDLGLTGNTDPL---QVVSNNLTIMYNEMLRGNSSVYDFMGKAYREGDGPNPG  302

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              G+ E   HT VH WVGD+   P+GEDMGNFYSAGRDPLFY HH NVDRMWV+WQ  L  
Sbjct  303   PGASERGSHTSVHVWVGDT-RTPSGEDMGNFYSAGRDPLFYVHHTNVDRMWVLWQYFLPS  361

Query  1204  -----KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpw  1344
                  K  TD  +LNA+FLFYDEN Q  RV  KDC+DN+++GY+YE        Y   P 
Sbjct  362   NKVPDKRITDPDFLNAAFLFYDENAQLTRVTVKDCLDNLSLGYEYERIDLPWIDYRPPPQ  421

Query  1345  lkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVID  1524
                       TGA  A++A     +FP+ L+ VV+V V  PKT + KA     +E+LV++
Sbjct  422   TAKAKISRIDTGAKTATSA----TLFPLKLESVVRVLV--PKTKKGKA-----DELLVLE  470

Query  1525  GIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPL  1704
              I V   ++ +FDV++ND D+     DKA Y G +A +PHK  + + T TS++L L +  
Sbjct  471   NITVDTTKFLKFDVFINDEDEKPTELDKAAYVGTYAQVPHKTNAGTAT-TSIQLKLTDVY  529

Query  1705  EDLGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             +D+  E+D+ ++VTL P+  G  V +  I+I
Sbjct  530   DDMNVEEDEDLIVTLVPRHQGPGVTIGGIKI  560



>ref|XP_004246033.1| PREDICTED: polyphenol oxidase F, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   447 bits (1149),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 241/510 (47%), Positives = 315/510 (62%), Gaps = 18/510 (4%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRK  474
             P+ASAA     I  P++  C          +++ +CCPPVP   D+V  Y+ P    +R 
Sbjct  82    PLASAA----PIPPPDLKSCGVAHIDDKGTEVSYSCCPPVPDDIDSVPYYKFPPMTKLRI  137

Query  475   RVPAQFATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEI  648
             R PA  A +EY+ KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+
Sbjct  138   RPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KEL  194

Query  649   QVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYD  828
             QVH SWLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD
Sbjct  195   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYD  254

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
               RN N+    I+DL + GKD      +++  NL  +YR MVTN      F G  Y  G+
Sbjct  255   EKRNQNHRNGTIIDLGHFGKDVETPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGS  314

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
              P PG G++E IPHTPVH W GDS  Q +GEDMGNFYSAG DPLFY HHANVDRMW  W 
Sbjct  315   DPEPGMGTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEW-  373

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskps  1362
             KL+GGK  D ++  WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP 
Sbjct  374   KLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKPI  433

Query  1363  pskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
                ++G    ++   V+ VFP+  LD+ +   ++RP +SRT  EK ++EE+L  + +   
Sbjct  434   RRSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKMAYD  493

Query  1540  MDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLED  1710
               +Y RFDV+LN     +  + DKA++AG +  LPH      +     +  L + E LED
Sbjct  494   DTKYVRFDVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNNDNHVKDVTFTLAITELLED  553

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +G ED+DT+ VTL P+VGG  V ++S+ I+
Sbjct  554   IGLEDEDTIAVTLVPKVGGEGVSIESVEIK  583



>gb|AEO00529.1| polyphenol oxidase [Nicotiana benthamiana]
Length=588

 Score =   447 bits (1149),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 268/568 (47%), Positives = 353/568 (62%), Gaps = 32/568 (6%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRNQ   + SC AN+     +  A       +DRRNVLLGLGGLYG ANLA  P+A+A
Sbjct  36    HGKRNQN-FKFSCNANSSETDKNLDA-------VDRRNVLLGLGGLYGAANLA--PLATA  85

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTD--TVLDYQIPTGGPMRKRVPAQ  489
             A     I  P++  C   + +    +++ +CCPP+P+D  +V  Y+ P+   +R R  A 
Sbjct  86    A----PIPPPDLKSCS-KAHINDQEEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAH  140

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
              A +EYI KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+QVH S
Sbjct  141   AADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KELQVHFS  197

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LINDPTF LPYWNWD+  GM +P MF    SSLYDA RN 
Sbjct  198   WLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREGSSLYDARRNQ  257

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             ++    I+DL + G +   +  + +  NL  +YR M+TN     LF G+ Y  GT PSPG
Sbjct  258   SHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPG  317

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPN---GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
              G++E IPHTPVH WVG   ++ N   GEDMGNFYSAG DPLFYSHHANVDRMW  W K 
Sbjct  318   MGTIENIPHTPVHIWVGSRPNENNVSHGEDMGNFYSAGLDPLFYSHHANVDRMWSEW-KA  376

Query  1195  LGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpsps  1368
             LGGK  D T+  WLN+ F FYDEN  P RV  +DC+ +  MG+DY     PW   KP+  
Sbjct  377   LGGKRRDLTNKDWLNSEFFFYDENRNPFRVKVRDCLHSKKMGFDYAPMPTPWRNFKPTRK  436

Query  1369  kTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
                G    S+ P  + VFP++ LD+ +   + RP +SRT+ EK ++EE+L  + I+    
Sbjct  437   SNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDS  496

Query  1546  QYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLG  1716
             +Y RFDV+LN     +  + DKA+YAG +  LPH    ++T  TSV  +L + E LED+G
Sbjct  497   KYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNATHVTSVTFQLAITELLEDIG  556

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              ED+D + VT+ P+ GG  + +  + I+
Sbjct  557   LEDEDAIAVTVVPKTGGEEISIQGVEIK  584



>ref|XP_008225000.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   446 bits (1148),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 245/542 (45%), Positives = 329/542 (61%), Gaps = 24/542 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanl--aggPIASAADVDVAI  336
             RV CKA N  N         G   +DRRN+L+GLG             P ASAA     I
Sbjct  48    RVRCKATNGGND----HLEQGLSRLDRRNMLIGLGAGGLYGATGLENNPFASAA----PI  99

Query  337   HYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YI  510
               P++++C  P+D P  + I   CCPP  T T++D+++P  GP+R R+ AQ   ++  Y+
Sbjct  100   SAPDLTQCG-PADKPDGSTID--CCPPT-TTTIIDFKLPDKGPLRTRLAAQDVAKDPVYL  155

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  M+ L    P SF QQA +HC YC+ GY Q G+P  EIQVH  WLFFPFHRW
Sbjct  156   AKYKKAIALMRALPDDDPRSFTQQAMVHCTYCDDGYPQVGYPNLEIQVHFCWLFFPFHRW  215

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKI+G+LI DPTFA+P+WNWD   GM +P +F  TTS LYD  RN  + PP ++D
Sbjct  216   YLYFFEKIMGELIGDPTFAIPFWNWDAPVGMYLPEIFTDTTSPLYDQYRNAAHQPPKLLD  275

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             LNY G D  + D   I ENL  +Y+ MV+   +  LF G+ Y  G   SPG G++E  PH
Sbjct  276   LNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDASSPGAGNIENTPH  335

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWL  1230
               +H W GD   Q NGEDMG FYSAGRDP+F++HH+NVDRMW I++  LGG D     WL
Sbjct  336   NNIHLWTGDPT-QKNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGGTDIKKTDWL  394

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYssl---pwlkskpspskTTGAAAASNA  1401
             +A FLFYDE +  +RV  +D +D   +GY Y+          K     S     A  S+A
Sbjct  395   DAEFLFYDEKKNLMRVKVRDSLDTTKLGYVYDDKVEIPWLTYKPTARKSSNKRKATVSSA  454

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKT-SRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
                T+ FP TL   + V+V+R  T  RT A+K+ ++EVLVI GI+ A ++  +FDVY+ND
Sbjct  455   DLTTN-FPATLTDTISVEVARTSTKKRTSAQKKAQDEVLVISGIKYAGNKTVKFDVYVND  513

Query  1579  SDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
               +   GKDK+++AG F H+PHK   S    T++RL + + LE+L AE D +V+VTL P+
Sbjct  514   DAESLAGKDKSEFAGSFVHVPHK--GSKDITTTLRLSITKLLEELDAETDSSVVVTLVPK  571

Query  1759  VG  1764
              G
Sbjct  572   FG  573



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   446 bits (1147),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 234/501 (47%), Positives = 315/501 (63%), Gaps = 17/501 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++++C   + +P+ ++ T  CCP   T  + +++ P+   PMR R  A    +  +
Sbjct  84    IAPPDITQCELVT-LPSESNPTN-CCPQTST-KIKNFEFPSASSPMRIRPAAHLVDKASL  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK+L    P SF  QAN+HCAYC+G Y Q GFP  E+Q+H SWLFFP+HR 
Sbjct  141   AKYAKAIALMKSLPDDDPRSFKSQANVHCAYCDGAYHQAGFPDLELQIHFSWLFFPWHRA  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY++E+ILGKLI+DPTFALP+WNWD  +GM +P +F    S LYD  R+ N+ PP + D
Sbjct  201   YLYYFERILGKLIDDPTFALPFWNWDAPAGMQIPAIFTDPKSPLYDPLRDANHQPPTLFD  260

Query  871   LNYAGKDRG---LSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             LNYA  D        EEL A NL  +YR MV+      LF GK Y  G  PSPG G++E 
Sbjct  261   LNYATGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIET  320

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFT  1215
              PHT +H W GD  +Q  GE+MGNFYSAGRDP+FY HH+NVDRMW +W+K+ GG  KD  
Sbjct  321   TPHTQIHIWTGDP-NQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIE  379

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG  1380
             D  WLN+ FLF+DEN++ VRV  KD +D   +GY ++     + +           K++ 
Sbjct  380   DPDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTRATPKLTRQEKSSR  439

Query  1381  AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             AA  S        FPV LDKV+ V+VSRPK SR+  EKE E+EVLVI+GIE   +Q  +F
Sbjct  440   AAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKF  499

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV +ND     GG D +++AG F ++PHK    S  KT++ LG+   LEDL AE DDT++
Sbjct  500   DVLVNDEPDSPGGPDMSEFAGSFVNVPHKHAKKS--KTTMVLGITGLLEDLEAEGDDTLV  557

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VT  P+ GG  V V +++IE+
Sbjct  558   VTFVPRTGGDSVTVANVKIEF  578



>emb|CCA94610.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=600

 Score =   447 bits (1149),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 252/574 (44%), Positives = 348/574 (61%), Gaps = 25/574 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNST------DDAAASPGSRIIDRRnvllglgglygvanlaggP  303
             +R++T  +VSC A + +N              P +  +DRRN+LLGLG            
Sbjct  25    RRSKTYPKVSCNATSDDNEKLLILPETQKLILPTTLNVDRRNLLLGLGAGLYSTVNFTSA  84

Query  304   IASAADVDVAIHYPNVSKCHYPSD--VPANADITGTCCPPVPTDTVLDYQIPTGGPMRKR  477
              A+ AD    I  P++S C   +    P NA  T  CCPP  + TV ++  P     R R
Sbjct  85    PAAFAD---PITTPDISTCVASTKGFQPKNAVRTNACCPPTLSKTVKEFVFPNDRATRIR  141

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A  A+ EYI KY+AA+  M++L+   PHSF  QA IHCAYCNGG+ Q   P +E+Q+H
Sbjct  142   PAAHRASPEYIAKYKAAIQKMRDLEDDDPHSFVSQAKIHCAYCNGGFTQDKHPDKELQIH  201

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMS--TTSSLYDA  831
             NSWLFFPFHRWYLYFYE+ILGKLI+DPTFA+PYWNWDN +GM++P+ F      +  +DA
Sbjct  202   NSWLFFPFHRWYLYFYERILGKLIDDPTFAIPYWNWDNPAGMSLPDFFEEGGKANPAFDA  261

Query  832   NRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTP  1011
              RN ++L PAI DL+Y G ++  +  + ++ NL A+ + M+ N G  + F G +Y  G+ 
Sbjct  262   YRNSSHLAPAIADLDYDGTEKNYTCIKQLSVNLGAMNKQMIRNAGDWKSFFGGEYRAGSD  321

Query  1012  P----SPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWV  1179
             P     P  GSVE   HT +HRWVG+S   PNGEDMGNFYSAG DP+FY HHANVDRMW 
Sbjct  322   PIGNKDPSVGSVEAGCHTAIHRWVGNS-RLPNGEDMGNFYSAGYDPVFYVHHANVDRMWK  380

Query  1180  IWQKL--LGGKDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlks  1353
             +W+ L   G  +  D+ W NAS++FYDEN++ VRVY KDC+    + YDY+++ +PW  S
Sbjct  381   VWKDLGIRGHIEPPDNDWRNASYVFYDENKELVRVYNKDCVRLEKLKYDYQFAPIPWKNS  440

Query  1354  kpspskTTGAAAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
             +P         A  +   V       FP+ LDK  +V V RP T+R+K +KE   EVL+I
Sbjct  441   RPVARTKKSNIALKSVGTVKQAQDSKFPLKLDKTTKVLVKRPATNRSKEDKENANEVLLI  500

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSVRLGLNE  1698
              G+    +++ +FDV++ND D       +++++AG FA LPH         +S R GL E
Sbjct  501   KGVVFNGEKFVKFDVFVNDKDDVTASTAEESEFAGSFAQLPHNHGDKMLMTSSARFGLTE  560

Query  1699  PLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              LED+ AEDD+++LVTL P+VG   V +  I++E
Sbjct  561   LLEDIDAEDDESILVTLVPKVGCEEVTIGEIKVE  594



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   447 bits (1150),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 261/561 (47%), Positives = 356/561 (63%), Gaps = 26/561 (5%)
 Frame = +1

Query  166   VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHYP  345
             VSCKA++ N +  D+++       DRR++LLGLGGLYG  NL   P ASAA     I  P
Sbjct  64    VSCKASDRNQNNADSSSL---NRFDRRDILLGLGGLYGATNLVSDPFASAA----PIAAP  116

Query  346   NVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKY  519
             ++S C   +   +++  + +  CCPP  T+ ++D++ P    +R R  A      Y+ K+
Sbjct  117   DLSLCENSTVTSSSSGTSISVPCCPPKATN-IIDFKPPRFSNIRLRPAAHLVDANYLEKF  175

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK L    P SF QQAN+HCAYCNG Y   GFP +++Q+H SWLFFPFHR+YLY
Sbjct  176   TKAMELMKALPDDDPRSFKQQANVHCAYCNGVYDHVGFPDQQLQIHFSWLFFPFHRFYLY  235

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILGKLI DP F +P+WNWD+  GM +P++++  TS LYD  RN ++ PP ++DL+Y
Sbjct  236   FYERILGKLIGDPNFVMPFWNWDSPPGMVIPDIYVDPTSPLYDEKRNVDHQPPKMLDLDY  295

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
             AG +  LS  + I  NL  +YR MVT   T  LF G  Y  G  PSPG GSVE  PHT V
Sbjct  296   AGTEELLSKRDQIKSNLSVMYRQMVT-YKTPSLFHGAAYRAGDNPSPGMGSVENNPHTAV  354

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLN  1233
             HRWVGD   +P  EDMGNFYSAGRDPLFY+HH NVDR+W IW+ L G K  DFTD  WL+
Sbjct  355   HRWVGDK-REPFSEDMGNFYSAGRDPLFYAHHCNVDRLWNIWKSLPGKKRTDFTDTDWLD  413

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAAA--  1392
             +SFLFYDEN   VRV  +DC+++  +GYDY+     +        +P     +G+A A  
Sbjct  414   SSFLFYDENANLVRVKVRDCLNSRTLGYDYQKVNIPWLKNKPTPRRPGRGSGSGSAMAAE  473

Query  1393  -SNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
              S    + + FP+ LDK+V+++V R K SRTK EKE EEEVLV+  I V  D   +FDVY
Sbjct  474   TSTKTVIRNAFPIVLDKLVRIEVPRTKKSRTKVEKENEEEVLVLQNIRVDRDVAVKFDVY  533

Query  1570  LNDSDQ--PDGGKDKAQYAGGFAHLPHKQESSSTT-KTSVRLGLNEPLEDLGAEDDDTVL  1740
             +ND D   P   +D +++AG F ++PH   + +    T++ L L++ LEDL  E DD ++
Sbjct  534   INDEDDETPTEPED-SEFAGSFTNIPHNHHNPAVKLDTNLTLPLSDLLEDLDIERDDNIV  592

Query  1741  VTLAPQVGGGVVDVDSIRIEY  1803
             VTL P+ G G+V + +I+I++
Sbjct  593   VTLVPKEGKGLVSIGNIKIDF  613



>ref|XP_009588337.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   446 bits (1147),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 279/577 (48%), Positives = 355/577 (62%), Gaps = 41/577 (7%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRNQ   +VSC   +  N  D  A   G+  +DRRNVLLGLGGLYG ANLA  P+ASA
Sbjct  34    HGKRNQC-FKVSCTGEHDGNQLD--AIKEGA--VDRRNVLLGLGGLYGAANLA--PLASA  86

Query  316   ADVDVAIHYPNVSKCHYPS--DVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVP  483
             A V      P+   C   +  D PA   +  +CCPP P   D+V  Y+IP    +RKR  
Sbjct  87    APVPP----PDQKSCGTATITDGPA---VPYSCCPPKPDDMDSVPYYKIPRMSKLRKRPA  139

Query  484   AQFATQEYINKYEAALTAMKNLDPSH--PHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
             AQ  T+EYI KY+ A + MK LD     P  F QQANIHCAYCN  Y       +++QVH
Sbjct  140   AQNVTEEYIAKYQLATSKMKELDKDQFDPLGFKQQANIHCAYCNDAYT---MGDQKLQVH  196

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
              SWLFFPFHRWYLYFYE+ILG LI+DPTFALPYWNWD+ SGM +P MF    SSLYDA R
Sbjct  197   ESWLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDHPSGMRLPPMFDVEGSSLYDARR  256

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             NP      I+DL + G +   ++ ++I  NL+ +YR M+TN     LF G+ Y  G+ P+
Sbjct  257   NPQVRNGTIIDLGFFGDEVKTNEIQMITNNLLLMYRQMITNAPCPLLFFGEPYRFGSKPN  316

Query  1018  PGQGSVEGIPHTPVHRWVGDSVD-------QPNGEDMGNFYSAGRDPLFYSHHANVDRMW  1176
             PGQG++E IPHTPVH W G   D       +  GEDMGNFYSAG DP+FY HHANVDRMW
Sbjct  317   PGQGTIENIPHTPVHIWTGTVRDTDLGNGVKSYGEDMGNFYSAGLDPVFYCHHANVDRMW  376

Query  1177  VIWQKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlk  1350
               W K LGGK  D TD+ WLN+ F FYDEN  P RV  +DC+D+  MGYDYE +S PW  
Sbjct  377   NEW-KALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPTSTPWRN  435

Query  1351  skpspskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDG  1527
              KP    T G    S+    + VFP++ LD+ +   + RP TSR++ EK++ EE+L   G
Sbjct  436   FKPGKKSTEGKVNLSSIKPASKVFPLSNLDRAICFSIERPATSRSQQEKDELEEILTFKG  495

Query  1528  IEVAMDQYARFDVYLNDSDQPDGGKD--KAQYAGGFAHLPHKQESSSTTK----TSVRLG  1689
             ++    +Y RFDV+LN +D+     D  K +YAG +  LPH    ++ T        +L 
Sbjct  496   VKYDDSKYIRFDVFLN-ADKTVNADDINKREYAGSYTSLPHVHGPNNATHEFKPKEFKLA  554

Query  1690  LNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             + E LED G ED+D + VT+ P+ GG VV +D++ IE
Sbjct  555   ITELLEDCGLEDEDIIAVTVVPKKGGEVVSIDNVEIE  591



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   446 bits (1146),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 270/566 (48%), Positives = 363/566 (64%), Gaps = 24/566 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNS----TDDAAASPGSRIIDRRnvllglgglygvanlaggPIA  309
             K++    R+SCKA    +     T +A  S G   +DRR++L+GLGGLYG A   G    
Sbjct  37    KKSHVHPRISCKATRNEHEKPMPTTEAIGSSGK--LDRRDMLIGLGGLYGAATGLG---V  91

Query  310   SAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPA  486
             +   + + I  P+VSKC  P+D+P+ A  T  CCPP  T  ++D+++P    P+R R  A
Sbjct  92    NRKALGLPIEAPDVSKCG-PADLPSGATPT-DCCPPS-TSKIIDFKLPPRSDPLRIRSAA  148

Query  487   QFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
                  EY+ KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSW
Sbjct  149   HLVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIELQVHNSW  208

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             +FFP+HR+YLYF+EKILGKLI D TFALP+WNWD  +GM MP+++   +SSLY+  R+  
Sbjct  209   IFFPWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMQMPSIYTDPSSSLYNKLRDAK  268

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             + PP ++DL++ G+D   + ++ I  NL  +YR ++TNG T +LFMG  Y  G  P+PG 
Sbjct  269   HQPPYLIDLDFNGQDPSFTYDQQIDYNLKIMYRQVITNGKTAQLFMGSPYRAGDQPNPGA  328

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-  1203
             GS+E +PH  VH W GD  +QPNGEDMG  YSA RD +FY+HH+NVDRMW +W K+LGG 
Sbjct  329   GSLENVPHGTVHVWTGDR-NQPNGEDMGTLYSAARDAIFYAHHSNVDRMWNVW-KMLGGK  386

Query  1204  -KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTG  1380
              KDF D  WLN+SFLFYDEN   VRV  K+C+D   + Y Y+   +PWLK++P+P  T  
Sbjct  387   HKDFEDKDWLNSSFLFYDENADLVRVKVKNCLDTQGLRYTYQDVEIPWLKTRPTPKGTAA  446

Query  1381  A--AAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             A   A S        FPVTLD  V   V RPK SR++ EKE EEEVLV++GIE   D + 
Sbjct  447   AKKGARSLRAVTEATFPVTLDSSVSATVRRPKVSRSRKEKEDEEEVLVVEGIEFDRDMFI  506

Query  1555  RFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK---TSVRLGLNEPLEDLGAED  1725
             +F VY+N  ++        ++AG F ++PHK   S   K   T++RLG+ + LEDLGAE 
Sbjct  507   KFAVYINTPEEDGVDPGSTEFAGSFVNVPHKNSHSKKEKKVRTALRLGITDLLEDLGAEA  566

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD+VLVTL P+   G V V  +R+E+
Sbjct  567   DDSVLVTLVPR--KGKVKVGGLRLEF  590



>emb|CAN62983.1| hypothetical protein VITISV_035472 [Vitis vinifera]
Length=607

 Score =   446 bits (1147),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 261/566 (46%), Positives = 348/566 (61%), Gaps = 29/566 (5%)
 Frame = +1

Query  163   RVSCKANN--PNNSTDDAAASPGSRIIDRRnvllglgglygvanla--ggPIASAADVDV  330
             +VSC + N  PN+ +        S  +DRRNVLLG+GGLYG A       P+A  A    
Sbjct  49    KVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGA----  104

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEY  507
              I  P++SKC   + VP     T  CCPPV T   + +Q+P+   PMR R  A   ++EY
Sbjct  105   PIQAPDISKCGTAT-VPDGVTXTN-CCPPV-TTKJIXFQLPSSDSPMRTRPAAHLVSKEY  161

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KY+ A+   K L    P SF QQAN+HC YC G Y Q G+   E+QVH SWLF PFHR
Sbjct  162   LAKYKKAIELQKALPDDDPRSFKQQANVHCXYCQGAYDQVGYTDLELQVHASWLFLPFHR  221

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             +YLYF E+IL KLI+DPTFALPYW WDN  GM MP ++ S+ SS YD  RN  +LPP ++
Sbjct  222   YYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPXIYASSPSSJYDEKRNAKHLPPTVI  281

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y G +  + D+EL  +NL  +Y+ +V+   T +LF G  Y  G    PG G++E +P
Sbjct  282   DLDYDGTEPTIPDDELKXDNLAIMYKQIVSGATTPKLFXGYPYRAGDAIDPGAGTLEXVP  341

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KDFTD  1218
             H  VH+W G   D+P+ EDMGNFY+AGRDP+F+ HHANVDRMW IW K +GG   KDFTD
Sbjct  342   HNIVHKWTG-LADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIW-KTIGGKNRKDFTD  398

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------YsslpwlkskpspskTT  1377
               WL+A+F+FYDEN+Q V V   DC+D   + Y Y+                  + S  +
Sbjct  399   TDWLDATFVFYDENKQLVXVKVSDCVDTSKLRYQYQDIPIPWLPKXTKAKAKTTTKSSKS  458

Query  1378  GAAAASNAPFVT----DVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD  1545
             G A A+  P  T      FP  L+ V++V+V RPK SR+K EKE EEEVL+I GIE+  +
Sbjct  459   GVAKAAELPKTTISSIXDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIKGIELDRE  518

Query  1546  QYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
              + +FDVY+ND D        +++AG F ++PHK      TKT++R  +NE LEDLGAED
Sbjct  519   NFVKFDVYINDEDYSVSRPKNSEFAGSFVNVPHKHMKEMKTKTNLRFAINELLEDLGAED  578

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             D++V+VT+ P+ GG  V +  I IE+
Sbjct  579   DESVIVTIVPRAGGDDVTIGGIEIEF  604



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   446 bits (1147),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/513 (48%), Positives = 322/513 (63%), Gaps = 30/513 (6%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGT-CCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEY  507
             I  P++S C  P D+P  A      CCPP  T  +++Y+IP+   P+R R  A     EY
Sbjct  98    ISPPDLSTCG-PPDLPLGATPNNINCCPPNST-KIINYKIPSSNQPLRVRQAAHLVNDEY  155

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KY+ AL  MK L  S P SF QQANIHCAYC+G Y Q GFP  ++QVHNSWLFFPFHR
Sbjct  156   LQKYKKALELMKALPSSDPRSFVQQANIHCAYCDGAYSQVGFPNLDLQVHNSWLFFPFHR  215

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             WYLYFYE+ILG LINDPTFALP+WN+D+ +GM +P+++  +TS LYD  R  ++ PP ++
Sbjct  216   WYLYFYERILGSLINDPTFALPFWNYDSPNGMQLPSIYADSTSPLYDKLRTASHQPPTLI  275

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DLNY   D        I+ NL  +YR MV+NG T+ LF+G  Y  G  P PG GS+E +P
Sbjct  276   DLNYDDVDVDDDANGRISSNLTTMYRQMVSNGKTSSLFLGSSYRAGDEPDPGAGSIENVP  335

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDD  1221
             H PVHRW GD+  QPN E+MG FY+A RDP+F+SHH+N+DR W IW K LGG  KDF D 
Sbjct  336   HGPVHRWSGDNT-QPNFENMGVFYAAARDPIFFSHHSNIDRFWSIW-KTLGGKRKDFKDK  393

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslpwlksk  1356
              WL + FLFYDEN+  V+V  KDC+D   +GY Y+                +    ++  
Sbjct  394   DWLESEFLFYDENKNLVKVKVKDCLDTKKLGYVYQDVDIPWLNAKPKPCRKNIQKNVEVA  453

Query  1357  pspskTTGAAAAS---NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDG  1527
                    G A AS   +  +VT   P+ LD VV   V RPK SR+K EKE+EEEVLVI+G
Sbjct  454   QGNFFGIGEARASEINSRSYVT--CPLVLDNVVSTIVKRPKKSRSKKEKEEEEEVLVIEG  511

Query  1528  IEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTS--VRLGLNEP  1701
             IE       +FDV++ND D         ++AG F ++PH        KT+  +R+GL + 
Sbjct  512   IEFDKSLGVKFDVFINDEDDKVIKPINTEFAGSFVNVPHSSHDHKKKKTNSCLRVGLTDL  571

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             LEDLGAEDDD+++VTL P+ G G+V + +I+IE
Sbjct  572   LEDLGAEDDDSIVVTLVPRYGKGIVKIRNIKIE  604



>gb|AAO16863.1| polyphenol oxidase [Ananas comosus]
Length=554

 Score =   444 bits (1141),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 237/511 (46%), Positives = 321/511 (63%), Gaps = 24/511 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++S C  P+D+PA+A  T  CCPP  + T++D+++P    P+R R  A     +Y+
Sbjct  47    ILAPDLSTCGPPADLPASARPT-VCCPPYQS-TIIDFKLPPRSAPLRVRPAAHLVDADYL  104

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  M+ L    P +F QQA +HCAYC+G Y Q GFP  EIQ+HNSWLFFP+HR+
Sbjct  105   AKYKKAVELMRALPADDPRNFVQQAKVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRF  164

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY  E+ILGKLI D TFALP+WNWD   GM  P+++   +SSLYD  R+  + PP ++D
Sbjct  165   YLYSNERILGKLIGDDTFALPFWNWDAPGGMQFPSIYTDPSSSLYDKLRDAKHQPPTLID  224

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G D   S EE I  NL  +YR ++++G T ELFMG  Y  G  P PG GSVE  PH
Sbjct  225   LDYNGTDPTFSPEEQINHNLAVMYRQVISSGKTPELFMGSAYRAGDQPDPGAGSVEQKPH  284

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD  +QPN EDMG  YSA  DP+F++HH N+DRMW +W+  LGGK  +FTD  
Sbjct  285   GPVHVWTGDR-NQPNREDMGTLYSAAWDPVFFAHHGNIDRMWYVWRN-LGGKHRNFTDPD  342

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAA  1389
             WLNASFLFYDEN Q VRV  KDC++  AM Y Y+     +               +  + 
Sbjct  343   WLNASFLFYDENAQLVRVKVKDCLEADAMRYTYQDVEIPWLKAKPTPKSALQKIKSKVST  402

Query  1390  ASNAP------FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
                 P           FPV LDK V   V+RPK  R+  EKE+EEEVLV++GIE+  D +
Sbjct  403   LKATPRGTTTTTAETTFPVVLDKPVSATVARPKARRSGKEKEEEEEVLVVEGIELEKDVF  462

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESS------STTKTSVRLGLNEPLEDL  1713
              +FDVY+N  +    G + +++AG F H+PHK + +      +   T ++LG+ + LED+
Sbjct  463   VKFDVYINSPEHEGVGPEASEFAGSFVHVPHKHKKAKKGKEMARMNTRLKLGITDLLEDI  522

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             GAEDD++VL+TL P+ G G+V V  +RI++S
Sbjct  523   GAEDDESVLITLVPRSGKGMVKVGGLRIDFS  553



>gb|AHX26182.1| polyphenol oxidase [Sorghum bicolor]
Length=553

 Score =   444 bits (1141),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 232/499 (46%), Positives = 311/499 (62%), Gaps = 21/499 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITG--TCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
             I  P++  CH P D+P   D  G   CCPP     ++D+ +P    +R R  A    +EY
Sbjct  65    IQAPDLRDCH-PPDLP---DTVGDVNCCPPGAGTAIVDFTLPPAVGLRVRPAAHLVDEEY  120

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A+  MK L    P SF QQ  +HCA C+G + Q GFP  EIQ+HN WLFFP+HR
Sbjct  121   LAKYEKAVALMKELPDDDPRSFTQQWRVHCANCDGAFDQVGFPDLEIQIHNCWLFFPWHR  180

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             +YLYF+E+ILGKLI D  FALP+WNWD   GM+MP ++ + TS LYD  R+P + PP  +
Sbjct  181   FYLYFHERILGKLIGDDKFALPFWNWDAPGGMSMPAIYANKTSPLYDERRDPAHQPPFTL  240

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y G +  +   + I +NL+ +YR M++     ELF G  Y  G  P PG GSVE IP
Sbjct  241   DLDYDGTEPTIPRHQQIDQNLMIMYRQMISGAKKKELFFGLPYHQGDQPDPGAGSVELIP  300

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDS  1224
             H  VH W GD   QPNGEDMGNFYSA RDPLF++HH N+DR+W +W  L  G  +FTD  
Sbjct  301   HNTVHFWSGDP-RQPNGEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGLRAGNTNFTDPD  359

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             WLNASFLFYDE  + VRV  +DC+D  A+GY Y+        +    ++T   A AS A 
Sbjct  360   WLNASFLFYDEEARLVRVRVRDCLDTAALGYTYQ-DVALPWLNARPTTETGSPAPASGA-  417

Query  1405  FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLND  1578
                   P TL++ V+V V+RP+TSRT+ EK+ EEEVLV++GIEVA    ++ +FDV++N+
Sbjct  418   -----LPATLNQTVRVAVTRPRTSRTRQEKDDEEEVLVVEGIEVADHFSRFVKFDVFVNE  472

Query  1579  SDQPDG-GKDKAQYAGGFAHLPH---KQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
             S    G G   AQ AG  A  PH     +   + KT+ R G+ + L+D+GA+ D T++V+
Sbjct  473   SQSGGGMGSAAAQCAGSVAMTPHLVRPDKRRGSVKTAARFGICDLLDDIGADGDKTIVVS  532

Query  1747  LAPQVGGGVVDVDSIRIEY  1803
             L P+  G +V V  +RIEY
Sbjct  533   LVPRCAGDMVTVGCVRIEY  551



>gb|AGK83468.1| polyphenol oxidase [Nicotiana tabacum]
Length=590

 Score =   444 bits (1143),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 240/513 (47%), Positives = 318/513 (62%), Gaps = 22/513 (4%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTD--TVLDYQIPTGGPMRK  474
             P+A+AA     I  P++  C   + +    +++ +CCPP+P+D  +V  Y+ P+   +R 
Sbjct  83    PLATAA----PIPPPDLKSCS-KAHINDKEEVSYSCCPPIPSDMDSVPYYKFPSMPKLRI  137

Query  475   RVPAQFATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEI  648
             R  A  A +EYI KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+
Sbjct  138   RPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KEL  194

Query  649   QVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYD  828
             QVH SWLFFPFHRWYLYFYE+ILG LINDPTF LPYWNWD+  GM +P MF    SSLYD
Sbjct  195   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREGSSLYD  254

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
             A RN ++    I+DL + G +   +  + +  NL  +YR M+TN     LF G+ Y  GT
Sbjct  255   ARRNQSHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT  314

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPN---GEDMGNFYSAGRDPLFYSHHANVDRMWV  1179
              PSPG G++E IPHTP H WVG   D+ N   GEDMGNFYSAG DPLFYSHHANVDRMW 
Sbjct  315   DPSPGMGTIENIPHTPAHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWS  374

Query  1180  IWQKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlks  1353
              W K LGGK  D T   WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   
Sbjct  375   EW-KALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNF  433

Query  1354  kpspskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGI  1530
             KP      G    S+ P  + VFP++ LD+ +   + RP +SRT+ EK ++EE+L  + I
Sbjct  434   KPIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNI  493

Query  1531  EVAMDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEP  1701
             +    +Y RFDV+LN     +  + DKA+YAG +  LPH      S  T  + +L + E 
Sbjct  494   KYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITEL  553

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             LED+G ED+DT+ VT+ P+ GG  + ++ + I+
Sbjct  554   LEDIGLEDEDTIAVTVVPKTGGEEISIEGVEIK  586



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   445 bits (1144),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 244/510 (48%), Positives = 320/510 (63%), Gaps = 31/510 (6%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITG-TCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYINK  516
             P++S C  P D+P  A      CCPP  T  +++Y+IP+   P+R R  A     EY+ K
Sbjct  102   PDLSTCG-PPDLPLGATPNNINCCPPNST-KIINYKIPSSNQPLRVRQAAHLVNDEYLQK  159

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  MK L  + P SF QQANIHCAYC+G Y Q GFP  ++QVHNSWLFFPFHRWYL
Sbjct  160   YKKAIELMKALPSNDPRSFIQQANIHCAYCDGAYSQVGFPNLDLQVHNSWLFFPFHRWYL  219

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYE+ILG LINDPTFALP+WN+D  +GM  P+++   TS LYD  RN N+ PP ++DLN
Sbjct  220   YFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTDRTSPLYDELRNANHQPPTLIDLN  279

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y G D    + E I+ NL  +YR +V+NG T+ LF+G  Y  G  P PG GS+E +PH P
Sbjct  280   YDGDDEN-DENERISTNLTIMYRQLVSNGKTSTLFLGSSYRAGDQPDPGAGSIENVPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWL  1230
             VHRW GD+  QPN E+MG FY+A RDP+F+SHH+N+DR W +W K LGG  KDF D  WL
Sbjct  339   VHRWSGDNT-QPNFENMGTFYAAARDPIFFSHHSNIDRFWSVW-KTLGGKRKDFKDKDWL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------Ysslpwlkskpsp  1365
              + FLFYDEN+  V+V  KD +D   +GY Y+                     ++     
Sbjct  397   ESEFLFYDENKNLVKVKVKDSLDTKKLGYVYQDVDTPWLNAKPKPCRKKIQKNVEVAQGI  456

Query  1366  skTTGAAAAS---NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
                 G A AS   +  +VT   P+ LD VV   V RPK SR+K EKE++EEVLVI+GIE 
Sbjct  457   FFGIGEAHASEINSRSYVT--CPLVLDNVVSTIVKRPKKSRSKKEKEEKEEVLVIEGIEF  514

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTS--VRLGLNEPLED  1710
                   +FDV++ND D         ++AG F ++PH        KT+  +R+GL + LED
Sbjct  515   DKSLGVKFDVFINDEDDKVIKPVNTEFAGSFVNVPHSSHDHKKKKTNSCLRVGLTDLLED  574

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             LGAEDDD+V+VTL P+ G G+V + +I+IE
Sbjct  575   LGAEDDDSVVVTLVPRYGKGIVKIRNIKIE  604



>ref|XP_008778193.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   444 bits (1142),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 275/565 (49%), Positives = 365/565 (65%), Gaps = 22/565 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNS---TDDAAASPGSRIIDRRnvllglgglygvanlaggPIAS  312
             K++    R+SCKA + +     T +A  S G   +DRR++L+GLGGLYG A   G    +
Sbjct  37    KKSHLDPRISCKARDEHEKPMHTSEATGSLGK--LDRRDMLIGLGGLYGAAAGLG---VN  91

Query  313   AADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQ  489
                + + I  P++SKC  P+D+P+ A I   CCPP  T  ++D+++P    P+R R  A 
Sbjct  92    RKALGLPIEAPDISKCG-PADLPSGA-IPTDCCPPF-TSKIIDFKLPPRSDPLRIRPAAH  148

Query  490   FATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWL  669
                 EY+ KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  EIQVHNSW+
Sbjct  149   LVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHNSWI  208

Query  670   FFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNY  849
             FFP+HR+YLYF+EKILGKLI D TFALP+WNWD  +GM MP+++   +SSLYD  R+  +
Sbjct  209   FFPWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMRMPSIYTDPSSSLYDKLRDAKH  268

Query  850   LPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQG  1029
              PP ++DL++ G+D   +  + I  NL  +YR ++ NG T +LFMG  Y  G  P+PG G
Sbjct  269   QPPYLIDLDFNGQDPSFTQAQQIDHNLKIMYRQVIANGKTAQLFMGSPYRAGDQPNPGAG  328

Query  1030  SVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-K  1206
             S+E +PH  VH W GD  +QPNGEDMG  YSA RDP+FY+HH+NVDRMW +W+KL G  K
Sbjct  329   SLENVPHGTVHLWTGDR-NQPNGEDMGILYSASRDPIFYAHHSNVDRMWYVWKKLGGKHK  387

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA-  1383
             DF D  WLN SFLFYDEN   VRV  KDC+D   + Y Y+   +PWL+++P+P  T  A 
Sbjct  388   DFDDKDWLNTSFLFYDENADIVRVKIKDCLDMQWLRYTYQDVEIPWLRTRPTPKGTMAAK  447

Query  1384  -AAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
               A S        FPVTLD  V   V RPK SR+  EKE EEEVLV++GIE   D + +F
Sbjct  448   KGARSLRAITEARFPVTLDSPVSATVRRPKVSRSSKEKEDEEEVLVVEGIEFDRDGFIKF  507

Query  1561  DVYLNDSDQP-DGGKDKAQYAGGFAHLPHKQESSSTTK---TSVRLGLNEPLEDLGAEDD  1728
             DV++N  ++  D G   +++AG F  +PHK + S   K   T++RLG+ E LEDLGAE D
Sbjct  508   DVHINTPEEAVDPG--SSEFAGAFVSVPHKHKHSKKEKKLITALRLGITELLEDLGAEAD  565

Query  1729  DTVLVTLAPQVGGGVVDVDSIRIEY  1803
             D+VLVTL P+ G G V V  +RIE+
Sbjct  566   DSVLVTLVPRNGIGKVKVGGLRIEF  590



>gb|AAK29782.1|AF261957_1 polyphenol oxidase [Ananas comosus]
 gb|AAO16864.1| polyphenol oxidase [Ananas comosus]
Length=604

 Score =   444 bits (1143),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 237/511 (46%), Positives = 321/511 (63%), Gaps = 24/511 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++S C  P+D+PA+A  T  CCPP  + T++D+++P    P+R R  A     +Y+
Sbjct  97    ILAPDLSTCGPPADLPASARPT-VCCPPYQS-TIIDFKLPPRSAPLRVRPAAHLVDADYL  154

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  M+ L    P +F QQA +HCAYC+G Y Q GFP  EIQ+HNSWLFFP+HR+
Sbjct  155   AKYKKAVELMRALPADDPRNFVQQAKVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRF  214

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLY  E+ILGKLI D TFALP+WNWD   GM  P+++   +SSLYD  R+  + PP ++D
Sbjct  215   YLYSNERILGKLIGDDTFALPFWNWDAPGGMQFPSIYTDPSSSLYDKLRDAKHQPPTLID  274

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G D   S EE I  NL  +YR ++++G T ELFMG  Y  G  P PG GSVE  PH
Sbjct  275   LDYNGTDPTFSPEEQINHNLAVMYRQVISSGKTPELFMGSAYRAGDQPDPGAGSVEQKPH  334

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD  +QPN EDMG  YSA  DP+F++HH N+DRMW +W+  LGGK  +FTD  
Sbjct  335   GPVHVWTGDR-NQPNREDMGTLYSAAWDPVFFAHHGNIDRMWYVWRN-LGGKHRNFTDPD  392

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAA  1389
             WLNASFLFYDEN Q VRV  KDC++  AM Y Y+     +               +  + 
Sbjct  393   WLNASFLFYDENAQLVRVKVKDCLEADAMRYTYQDVEIPWLKAKPTPKSALQKIKSKVST  452

Query  1390  ASNAP------FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
                 P           FPV LDK V   V+RPK  R+  EKE+EEEVLV++GIE+  D +
Sbjct  453   LKATPRGTTTTTAETTFPVVLDKPVSATVARPKARRSGKEKEEEEEVLVVEGIELEKDVF  512

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESS------STTKTSVRLGLNEPLEDL  1713
              +FDVY+N  +    G + +++AG F H+PHK + +      +   T ++LG+ + LED+
Sbjct  513   VKFDVYINSPEHEGVGPEASEFAGSFVHVPHKHKKAKKGKEMARMNTRLKLGITDLLEDI  572

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             GAEDD++VL+TL P+ G G+V V  +RI++S
Sbjct  573   GAEDDESVLITLVPRSGKGMVKVGGLRIDFS  603



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   444 bits (1142),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 275/569 (48%), Positives = 359/569 (63%), Gaps = 31/569 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             K ++    RV+C + N N         P   I  RRN+LLGLGGL G A L   P A AA
Sbjct  40    KSKHHHTPRVTCNSGNQNK-----GEKPDIHIEQRRNILLGLGGLCGAATLNNNPFAFAA  94

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFA  495
                  I  P+++ C  P D+P  A+ T  CCPP  + T++D++ P +  P+R R  A   
Sbjct  95    ----PISPPDLTTCG-PPDLPEGAEPTN-CCPPF-SSTIIDFKFPPSNKPLRVRPAAHLV  147

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
              + Y+ KY+ A+  MK L  + P +F QQAN+HCAYC G Y Q GFP  E+QVH+SWLFF
Sbjct  148   DKNYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFF  207

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             P+HRW+LYFYE+ILG LINDPTFALP+WNWD   GM +P+++    S LYD  RN N+ P
Sbjct  208   PYHRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDPLRNANHQP  267

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             P +VD ++   D  +S+   I+ NL  +YR +V+NG T  LF+G  Y  G  P PG GSV
Sbjct  268   PTLVDFDF-NLDNPISNGR-ISTNLTIMYRQLVSNGKTPTLFLGNPYRAGDAPDPGGGSV  325

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--D  1209
             EG+PH PVH W GD ++QPN E+MG+FYSA RDP+FYSHH+NVDRMW IW K LGGK  D
Sbjct  326   EGVPHGPVHLWTGD-INQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIW-KTLGGKRRD  383

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAA  1389
             FTD  WL +  LFYDEN+  VRV  KDC+D   +GY Y+   +PWLKSKPSP ++     
Sbjct  384   FTDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSKPSPRRSRVQKV  443

Query  1390  ASNAPFVTDV-----------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
             A    F T V           FP+ LD VV + V RPK SR+K EKE+EEEVLVI+G+E 
Sbjct  444   ALGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEEEEVLVIEGVEY  503

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQE-SSSTTKTSVRLGLNEPLEDL  1713
               +   +FDV +ND D      + ++YAG F  +PH  +  +    T +RLGL + LE+L
Sbjct  504   DSNIPVKFDVLINDEDDKQIQPEDSEYAGSFVTVPHSHKHKNKKIITCLRLGLTDLLEEL  563

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              AEDDD+V+VTL P+ G G V +  I+I+
Sbjct  564   EAEDDDSVVVTLVPRYGKGRVQIGGIKID  592



>ref|XP_011083298.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   443 bits (1140),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 336/567 (59%), Gaps = 44/567 (8%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H  R   R +VSCK       T D         +DRRN+LLGL GLYG ANL   P A A
Sbjct  36    HASRRH-RFQVSCKGVANQEPTADGK-------VDRRNMLLGLSGLYGAANLVSDPQAYA  87

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
             A ++     P    C    DV A  D+    C P+P+D ++DY++P    MR R  A   
Sbjct  88    APIEA----PEFKACGEARDV-ATGDLLDVNCCPLPSDKIIDYKLPPVNKMRIRPAAHKV  142

Query  496   TQEYINKYEAALTAMKNLD---PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
             T+EY+ K+E A+  MK LD   P+ P  F QQANIHCAYCNG + Q G+   +IQVHNSW
Sbjct  143   TKEYLAKFEEAIRRMKALDKDDPTDPRGFMQQANIHCAYCNGAHDQVGYKNLDIQVHNSW  202

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             LFFPFHRWYLYFYE+ILGKLI+DPTF LP+WNWDN  GM MP +F +T S LY+ANRN  
Sbjct  203   LFFPFHRWYLYFYERILGKLIDDPTFVLPFWNWDNPKGMQMPKIFDNTGSPLYNANRNQA  262

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
               PPAI+DL ++G      D + +  NL  +Y  M+ +  +T  FMG+ Y  G  PSPG 
Sbjct  263   NRPPAIIDLGFSGAS---DDLQKVVNNLTVMYSEMIRSVNSTIDFMGQPYRAGNSPSPGM  319

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-  1203
             GS E   H   H WVG+  ++   EDMGNFYSAGRD LFY HHANVDRMW IW+ L    
Sbjct  320   GSSERGSHVAAHVWVGNPKNKYR-EDMGNFYSAGRDTLFYCHHANVDRMWSIWRTLKTDV  378

Query  1204  -KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlksk  1356
              KD TD  +LNA+FLFYDEN+Q VRV   DC+D+  MGYD+E        Y         
Sbjct  379   PKDITDPDFLNAAFLFYDENKQLVRVKVADCLDHRRMGYDFERVDIPWLNYKPPRKAAKA  438

Query  1357  pspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
                + + GA          D+FP+ L K+ +V V  PK+++ KA     +EVLV++ IE 
Sbjct  439   KVETISQGAQKPE------DLFPLNLKKITRVLV--PKSAKGKA-----DEVLVLENIET  485

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLG  1716
                ++ +FDV++ND D      DKA+YAG FA +PHK +     K+++ L L E  ED+ 
Sbjct  486   DTTKFIKFDVFVNDEDDNAEELDKAEYAGTFAQVPHKTKDKK-GKSTISLRLTELYEDID  544

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
               DDDT++VTL P+  G  V +  I+I
Sbjct  545   VADDDTIVVTLIPRSNGDDVTIGGIKI  571



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   444 bits (1141),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 275/569 (48%), Positives = 359/569 (63%), Gaps = 31/569 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             K ++    RV+C + N N         P   I  RRN+LLGLGGL G A L   P A AA
Sbjct  40    KSKHHHTPRVTCNSGNQNK-----GEKPDIHIEQRRNILLGLGGLCGAATLNNNPFAFAA  94

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFA  495
                  I  P+++ C  P D+P  A+ T  CCPP  + T++D++ P +  P+R R  A   
Sbjct  95    ----PISPPDLTTCG-PPDLPEGAEPTN-CCPPF-SSTIIDFKFPPSNKPLRVRPAAHLV  147

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
              + Y+ KY+ A+  MK L  + P +F QQAN+HCAYC G Y Q GFP  E+QVH+SWLFF
Sbjct  148   DKNYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFF  207

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             P+HRW+LYFYE+ILG LINDPTFALP+WNWD   GM +P+++    S LYD  RN N+ P
Sbjct  208   PYHRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDPLRNANHQP  267

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             P +VD ++   D  +S+   I+ NL  +YR +V+NG T  LF+G  Y  G  P PG GSV
Sbjct  268   PTLVDFDF-NLDNPISNGR-ISTNLTIMYRQLVSNGKTPTLFLGNPYRAGDAPDPGGGSV  325

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--D  1209
             EG+PH PVH W GD ++QPN E+MG+FYSA RDP+FYSHH+NVDRMW IW K LGGK  D
Sbjct  326   EGVPHGPVHLWTGD-INQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIW-KTLGGKRRD  383

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAA  1389
             FTD  WL +  LFYDEN+  VRV  KDC+D   +GY Y+   +PWLKSKPSP ++     
Sbjct  384   FTDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSKPSPRRSRVQKV  443

Query  1390  ASNAPFVTDV-----------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
             A    F T V           FP+ LD VV + V RPK SR+K EKE+EEEVLVI+G+E 
Sbjct  444   ALGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEEEEVLVIEGVEY  503

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQE-SSSTTKTSVRLGLNEPLEDL  1713
               +   +FDV +ND D      + ++YAG F  +PH  +  +    T +RLGL + LE+L
Sbjct  504   DSNIPVKFDVLINDEDDKQIQPEDSEYAGSFVTVPHSHKHKNKKIITCLRLGLTDLLEEL  563

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
              AEDDD+V+VTL P+ G G V +  I+I+
Sbjct  564   EAEDDDSVVVTLVPRYGKGRVQIGGIKID  592



>gb|ACJ04908.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   444 bits (1141),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 326/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L +DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLPDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYCAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D  WL
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDWL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSSRISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   444 bits (1141),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 347/559 (62%), Gaps = 27/559 (5%)
 Frame = +1

Query  166   VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHYP  345
             VSCKA N N S  D++ +      DRR++L+GLGGLYG  NL+  P A AA     I  P
Sbjct  55    VSCKATN-NGSKGDSSLNR----FDRRDLLIGLGGLYGATNLSNDPFALAA----PIAAP  105

Query  346   NVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYEA  525
             +++ C   + +      T  CCPP  T  V+D++ PT   +R R  A     +Y+ K+  
Sbjct  106   DLTLCG-DATISDTTKETVYCCPP-ETTKVIDFKPPTYSKIRYRSAAHLVDPDYLAKFTK  163

Query  526   ALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYFY  705
             A+  M+ L    P SF QQANIHCAYCNG Y Q GF  ++IQVH SWLFFPFHR YLYFY
Sbjct  164   AMELMRALPDDDPRSFKQQANIHCAYCNGAYDQVGF-DQDIQVHFSWLFFPFHRLYLYFY  222

Query  706   EKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYAG  885
             E+ILGKLI DP FA+P+WNWD  +GM +P ++++  S LYD  RN N+ PP +VDL+Y G
Sbjct  223   ERILGKLIGDPDFAMPFWNWDAPAGMPIPAIYVNPNSPLYDDKRNVNHQPPKVVDLDYNG  282

Query  886   KDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVHR  1065
              D+ ++D+ ++  NL  +Y+ MV+   T  LF GK Y  G  PSPG G VE   HT +HR
Sbjct  283   TDKDITDKAMVQSNLKVMYKQMVSGSKTASLFHGKVYRAGDKPSPGGGVVELGSHTAIHR  342

Query  1066  WVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNAS  1239
             W GD   Q   EDMGNFYSAGRDPLFY+HH+NVDRMW IW+ L G K  DFTD  WL+AS
Sbjct  343   WCGDP-RQTYSEDMGNFYSAGRDPLFYAHHSNVDRMWSIWKGLPGKKRNDFTDTDWLDAS  401

Query  1240  FLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTG-----AAA  1389
             F+FYDEN   VR   +DC+D   +GYDY+     +     +  K S     G     AA 
Sbjct  402   FVFYDENANLVRARVRDCLDTRTLGYDYQGVDVPWLKTKPVPRKFSKKGGKGHGQAVAAE  461

Query  1390  ASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
               N   + + FP+ LDK+V +++ RPK SRTK EKE+EE +++   I++      +FD+Y
Sbjct  462   TKNKNVIRNAFPIVLDKIVSIEIPRPKKSRTKLEKEEEEVLVLE-SIQLDTSTPVKFDIY  520

Query  1570  LNDS-DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
             +ND  D+   G + +++AG F ++PH    S   +TS  L ++E LEDL  E DD ++VT
Sbjct  521   INDEDDEAPSGPEDSEFAGSFTNVPHNHSHSKKLETSFSLAISEVLEDLDVEGDDNIVVT  580

Query  1747  LAPQVGGGVVDVDSIRIEY  1803
             L P+ G G+V V +I+I+Y
Sbjct  581   LVPREGKGLVSVGNIKIDY  599



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   444 bits (1141),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 259/568 (46%), Positives = 347/568 (61%), Gaps = 26/568 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             K+ +    RV+C+A N +    +   +P  +  DRR+VLLGLGG+YG ANL   P A A 
Sbjct  43    KQYHHLTTRVACRATNGDQQNINNGQNPQGKF-DRRDVLLGLGGMYGAANLCNDPFALAD  101

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFA  495
              V      P ++ C   +D+PA A +   CCPP  +  + D+ +P+   P+R R  A   
Sbjct  102   PVSA----PELTLCSE-ADLPAGA-LPVNCCPPT-SKKIKDFVLPSQNTPLRVRPAAHLV  154

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
               +YI KY   +  MK+L    P SF QQAN+HCAYC+G Y Q GFP   +QVH  WLFF
Sbjct  155   DNDYIAKYNKGIELMKSLPADDPRSFTQQANVHCAYCDGAYTQVGFPDLSLQVHECWLFF  214

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHR+Y+YF+EKILGKLI DPTFALP+WNWD+  GM +P+++  + S++YD  RN N+ P
Sbjct  215   PFHRYYVYFFEKILGKLIGDPTFALPFWNWDSPPGMQLPSLYAVSNSAIYDPLRNANHQP  274

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             P I+DL+Y       +  + +  NL  +YR MV+      LF G  Y  G  P PG G++
Sbjct  275   PTIIDLDYGETSESTTTTDQVPSNLKIMYRQMVSGAKNPTLFFGSPYRAGDEPDPGAGTI  334

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KD  1209
             E  PH  +H W GD   QPN E+MGNFYSAGRDP+F++HH+NVDRMW IW K LGG  KD
Sbjct  335   ESTPHNNIHLWTGDDT-QPNIENMGNFYSAGRDPIFFAHHSNVDRMWTIW-KTLGGKRKD  392

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss----------lpwlkskp  1359
              TD  WLN+SF FYDEN  PVRV  KDC+DN  + Y Y+                   K 
Sbjct  393   ITDPDWLNSSFFFYDENADPVRVKVKDCVDNTKLRYVYQDVEIPWLKTKPTPRKSRVKKV  452

Query  1360  spskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
             + +   G    + A   + V FP+ LDKV+   V+RPK SR+K EK+ EEEVLVI+GIEV
Sbjct  453   AKAFPAGHGGVAQAAETSSVKFPIVLDKVISTVVARPKKSRSKKEKDDEEEVLVIEGIEV  512

Query  1537  AMDQYARFDVYLNDSDQ-PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDL  1713
               D   +FDV++ND D  P G     ++AG F  +P +Q+ +   KT +R+G+++ LEDL
Sbjct  513   ERDIPVKFDVFINDEDDAPTGPGINTEFAGSFVSVP-QQKQTKKKKTYLRIGISDLLEDL  571

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             GAEDDD+V+VTL P+ G G   +  I+I
Sbjct  572   GAEDDDSVVVTLVPRFGKGKAIIGGIKI  599



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   443 bits (1140),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 241/498 (48%), Positives = 327/498 (66%), Gaps = 15/498 (3%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++ KC  P+D+P+ A +   CCPP  +  ++D++ P+ G +R R  AQ   + YI+KY 
Sbjct  110   PDIDKCG-PADLPSGA-LPTNCCPPT-SQKIVDFKFPSPGKLRVRPAAQSVDKAYIDKYS  166

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQA++HCAYC+G Y + GFP  E+Q+HN WLFFPFHR+YLYF
Sbjct  167   KAIELMKALPDDDPRSFSQQADVHCAYCDGAYDEVGFPNLELQIHNCWLFFPFHRYYLYF  226

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YE+ILGKLI DPTFALP+WN+D  +GM +P ++ +  S LYD  R  ++ PP ++DL++ 
Sbjct  227   YERILGKLIGDPTFALPFWNYDAPAGMQIPALYTNPDSPLYDKFRAASHQPPTLIDLDFN  286

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S++  I  NL  +YR M++N     LF G     GT P PGQGS+E  PH PVH
Sbjct  287   GTDETISNDARIDANLKLMYRQMISNAKKQLLFFGAPLRAGTEPDPGQGSIETAPHGPVH  346

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDSWLNAS  1239
              W GD+  QPN EDMGNFYSAGRDP+F++HH+NVDRMW IW+ L    KD  D  WL+A 
Sbjct  347   LWTGDNT-QPNIEDMGNFYSAGRDPIFFAHHSNVDRMWNIWKSLGTKNKDINDPDWLDAG  405

Query  1240  FLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPFV---  1410
             FLFYDEN + VRV  +DC+DN  +GY YE   +PWLK++P+P +T  A  A  A      
Sbjct  406   FLFYDENAELVRVRVRDCLDNKKLGYTYEDVEIPWLKTRPTPRRTKAAGVAKAAETTSLG  465

Query  1411  ----TDVFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN  1575
                 +  FPV+L+  ++  V RP +  R+K EKE EEE+LVIDGIE   D   +FDV +N
Sbjct  466   KLVGSKDFPVSLETKIRTVVPRPKQKKRSKKEKEDEEEILVIDGIEFDKDVAVKFDVCVN  525

Query  1576  DSDQPDG--GKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             D D  +   G   +++AG F  +PHK + +  +K  +RLGL E LEDLGAEDD++V+VTL
Sbjct  526   DVDDDEAPSGPIYSEFAGSFVSVPHKHKENKRSKGCLRLGLTELLEDLGAEDDESVVVTL  585

Query  1750  APQVGGGVVDVDSIRIEY  1803
              P+     V + SI+IE+
Sbjct  586   VPRFSSQAVKIGSIKIEF  603



>ref|XP_009408264.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   442 bits (1137),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 232/499 (46%), Positives = 321/499 (64%), Gaps = 11/499 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPV-PTDTVLDYQIPT-GGPMRKRVPAQFATQEY  507
             I  P++SKC  P+D+P    +   CCPP  P   ++D++ P+   P+R R  A     EY
Sbjct  91    IQAPDLSKCG-PADLPTGVPVV-NCCPPYRPGAKIVDFKRPSPSSPLRVRPAAHLVDPEY  148

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KY+ A+  MK L    P +F QQA++HCAYC+G Y Q GFP  EIQVHNSWLFFP+HR
Sbjct  149   LAKYKKAIELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLEIQVHNSWLFFPWHR  208

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF E+ILGKLI D TF+LP+WNWD   GM +P+++   +S LYD  R+  + PP +V
Sbjct  209   LYLYFNERILGKLIGDDTFSLPFWNWDAPGGMMLPSIYADPSSPLYDKLRDAKHQPPVLV  268

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y G D    D + I  NL  +YR + +NG T  LF+G  Y  G  P+PG GSVE +P
Sbjct  269   DLDYNGTDPTFPDAQQIDHNLKIMYRQVFSNGKTPLLFLGSAYRAGEQPNPGAGSVENMP  328

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDS  1224
             H  VH W GD   QPN E+MG FY+A RDP+F++HHAN+DRMW +W+KL    +DF D  
Sbjct  329   HNNVHLWTGDRT-QPNFENMGTFYAAARDPIFFAHHANIDRMWYLWKKLSRKHQDFNDSD  387

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             WL ASFLFYDEN   VRV  KDC++   + Y Y+   +PW+ ++P+P       AAS++ 
Sbjct  388   WLKASFLFYDENADLVRVTVKDCLETDWLRYTYQDVKIPWVNARPTPKLAKARKAASSSL  447

Query  1405  FVTD--VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
               T    FPVTL+  V+  V RPK  R+  EKE EEE+L+++GIE   D + +FDV++N 
Sbjct  448   KATAEVQFPVTLESPVKATVKRPKVGRSGKEKEDEEEILIVEGIEFDRDYFIKFDVFVNA  507

Query  1579  SDQPDGGKDKAQYAGGFAHLPHK---QESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             ++        +++AG F ++PHK   ++  +  KT + LG+ + LED+GAEDDD+VLVT+
Sbjct  508   TEGDGITAGASEFAGSFVNVPHKHKHRKDENKLKTRLCLGITDLLEDIGAEDDDSVLVTI  567

Query  1750  APQVGGGVVDVDSIRIEYS  1806
              P+ G G V V  +RI++S
Sbjct  568   VPKAGKGKVSVGGLRIDFS  586



>gb|EPS57764.1| polyphenol oxidase, partial [Genlisea aurea]
Length=536

 Score =   440 bits (1132),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 234/498 (47%), Positives = 312/498 (63%), Gaps = 10/498 (2%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYIN  513
             +H P++SKC   +D+     +   CCPP  +D + DY   +   +R R  A  A + Y  
Sbjct  42    VHAPDLSKCSRGTDLNTKQPLDVDCCPP-QSDEIADYMPTSQAKIRVRPAAHTAGEGYFR  100

Query  514   KYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWY  693
             KYE  +  MK+L    P SF QQA +HCAYCN  + Q G    + Q+HNSWLF PFHRWY
Sbjct  101   KYERGIALMKSLPSDDPRSFIQQAKVHCAYCNLTFPQPGDDKLKYQIHNSWLFLPFHRWY  160

Query  694   LYFYEKILGKLINDPTFALPYWNW--DNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             LYFYE+ILGKL++DPTF +P+WNW  DN + + +P  + S  S LYD+ RNPN+ PPA  
Sbjct  161   LYFYERILGKLLDDPTFGIPFWNWDSDNPAAVRIPEAYTSKNSPLYDSRRNPNHFPPAPA  220

Query  868   DLNYAGKDR-GLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
             DL+Y+   R   S E++I+ N   +YR MV      + F G KYV GT P PG G+VE  
Sbjct  221   DLSYSASARKSRSPEKIISHNQTIMYREMVRRVWRLQDFYGAKYVVGTKPDPGPGTVERG  280

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKD--FTD  1218
              HT +H WVG++      EDMGNFYSA RDP+FY HHANVDR+W  WQ L G K   F D
Sbjct  281   SHTAIHAWVGENTS--TAEDMGNFYSAARDPIFYGHHANVDRLWCTWQDLRGSKKNYFND  338

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-YsslpwlkskpspskTTGAAAAS  1395
               WL+ASF+FYDEN + VRV  +D +D   +GY Y+   S    K   +  + +  AA S
Sbjct  339   SDWLDASFVFYDENARLVRVKVRDAVDIRRLGYAYQDVDSTWLKKRPLARFRKSDVAAKS  398

Query  1396  NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN  1575
             NAP    +FP+ LDKVV+V V RPK SR+  EKE+EEE+LVI+GIEV   ++ +FDV++N
Sbjct  399   NAPRPDKIFPLKLDKVVKVLVQRPKKSRSHDEKEREEELLVIEGIEVDKSKFVKFDVFVN  458

Query  1576  DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAP  1755
             D +      DKA+YAG ++ +  K+ +S+   T + LGL E LEDLGAED D +LV L P
Sbjct  459   DEEDDPDEFDKAEYAGSYSQVVQKK-NSTRVNTKITLGLTEILEDLGAEDHDDILVALVP  517

Query  1756  QVGGGVVDVDSIRIEYST  1809
             +VGG  + +  I+I Y +
Sbjct  518   KVGGEDITIGGIKIIYDS  535



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   442 bits (1138),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 248/512 (48%), Positives = 335/512 (65%), Gaps = 27/512 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGP-MRKRVPAQFATQEYI  510
             I  P+++KC   +D+P +A  T  CCPP  +  V+D+++P     MR R  A     EY+
Sbjct  106   IMAPDLTKCG-AADLPTSAKPT-NCCPPT-SSKVVDFKLPPQNEDMRVRQAAHLVDDEYV  162

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY+ A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSWLFFPFHR+
Sbjct  163   AKYQDAIARMKALPTDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQVHNSWLFFPFHRY  222

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI DPTFALP+WNWD  +GMT+P M+ + +SSLY+  R+  + PP ++D
Sbjct  223   YLYFYERILGKLIGDPTFALPFWNWDAPAGMTLPAMYTNPSSSLYNKLRDTKHQPPTLID  282

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y  KD  +++EE +  NL  +YR MV+NG T +LF+G  Y  G  P PG GS+E +PH
Sbjct  283   LDYNLKDPSITNEEQLKHNLAIMYRQMVSNGSTAQLFLGTPYRAGDEPDPGNGSLENVPH  342

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
              PVH W GD  +QPN EDMGNFYSA RDP+FY+HHANVDRMW IW K LGGK  DFTD  
Sbjct  343   GPVHLWAGDR-NQPNVEDMGNFYSAARDPIFYAHHANVDRMWTIW-KTLGGKRRDFTDPD  400

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             WL+++FLFYDEN + V+V  +DC+D   + Y Y+   +PWLK+KP+P +    A      
Sbjct  401   WLDSAFLFYDENAELVKVKVRDCLDEKKLRYTYQSVDIPWLKTKPTPVRKMKEALKEEEG  460

Query  1405  FVTDV---------------FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
                 +               FP  LD   +  V RP+ SR+K EKE EEE+LVI+ IE+ 
Sbjct  461   LKDKIKERVLKLEKKIAVSEFPKQLDTAFKTVVKRPRKSRSKKEKEDEEEILVIEKIELE  520

Query  1540  MDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPH--KQESSSTTKTSVRLGLNEPLEDL  1713
              D   +FDVY+N+ D+P    DK+++AG F ++PH   ++     KT +RL + E LEDL
Sbjct  521   RDSVVKFDVYINNEDEP--SPDKSEFAGSFVNVPHKHGKKKKKRVKTFLRLSITELLEDL  578

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
               EDDD V+VT+ P++GG +V +  I+I Y++
Sbjct  579   ETEDDDEVVVTIVPRLGGDLVIIGGIKIVYAS  610



>ref|XP_007148200.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
 gb|ESW20194.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
Length=576

 Score =   441 bits (1135),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 254/541 (47%), Positives = 337/541 (62%), Gaps = 29/541 (5%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIID-RRnvllglgglygvanlaggPIASAADVDVAIH  339
             RV+C+ N PN+ T + +      I++ RRNVLLGLGGL G   L   P A AA     + 
Sbjct  48    RVTCRGN-PNHQTPNPSEEQLPHIVENRRNVLLGLGGLCGAVTLNNNPFAFAA----PVL  102

Query  340   YPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINK  516
              P+++ C  P        I   CCPP  +  ++D++ P +  P+R R  A   T +Y+ K
Sbjct  103   PPDLTTCGPPDLAEGVKPIN--CCPP--SSKIIDFKFPPSNQPLRVRPAAHLVTDDYLAK  158

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ AL  MK L  + P SF QQAN+HCAYC+G Y Q GFP  ++QVHNSWLFFPFHRWYL
Sbjct  159   YKKALDLMKKLPSNDPRSFMQQANVHCAYCDGAYHQVGFPDLDLQVHNSWLFFPFHRWYL  218

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYE+ILG LINDPTFALP+WNWD   GM +P+++    S LYD  RN N+ PP +VDL+
Sbjct  219   YFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPKSPLYDPLRNSNHQPPTLVDLD  278

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             +  +D     +  I+ NL  +YR +V+NG T  LF+G  Y  G  P PG GSVE +PH P
Sbjct  279   FDIEDPDADGK--ISSNLTIMYRQVVSNGKTPRLFLGNAYRAGDEPDPGGGSVENVPHGP  336

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD +DQPN E+MG FYSA RDP+F+SHH+N+DRMW IW K LGGK  DF+D  WL
Sbjct  337   VHVWTGD-IDQPNIENMGTFYSAARDPIFFSHHSNIDRMWSIW-KTLGGKRRDFSDSDWL  394

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------YsslpwlkskpspskTTG  1380
              +  LFYDE++  VRV  KDC+D   +GY Y+           + +     K + ++  G
Sbjct  395   ESGLLFYDEDKNLVRVKVKDCLDTTKLGYVYQDVDVPWLNSRPTPVKSRARKVAVTQNFG  454

Query  1381  AAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYAR  1557
               AA  A    +V FP+ LD VV  +V RPK SR+K  KE+EEEVLVI+GIE   +   +
Sbjct  455   VGAARAAETSRNVKFPLVLDSVVSTRVQRPKKSRSKKAKEEEEEVLVIEGIEFDRNTPVK  514

Query  1558  FDVYLNDSDQPDGGKDKAQYAGGFAHLPH-KQESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             FDV++ND D      D  ++AG F  + H  +  + + KT +RLGL + LE+L A+DDD+
Sbjct  515   FDVFVNDEDDKVIRPDNTEFAGSFVSVAHTHKHKNKSMKTCLRLGLTDLLEELEADDDDS  574

Query  1735  V  1737
             V
Sbjct  575   V  575



>ref|XP_009771442.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=596

 Score =   442 bits (1136),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 271/572 (47%), Positives = 351/572 (61%), Gaps = 35/572 (6%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             K NQ+  +VSC   +  N  D  A   G+  +DRRNVLLGLGGLYG  NLA  P+ASAA 
Sbjct  36    KGNQS-FKVSCTGEHDGNQLD--AVKEGA--VDRRNVLLGLGGLYGATNLA--PLASAAP  88

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQFA  495
             V      P++  C  P+ +     +  +CCPP P   D+V  Y+IP    +RKR PAQ  
Sbjct  89    VPP----PDLKSCG-PATITDGPTVPYSCCPPTPDDMDSVPYYKIPRMSKLRKRPPAQDV  143

Query  496   TQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWL  669
             ++EYI KY+ A + M+ LD  P  P  F QQANIHCAYCN  Y       +++QVH SWL
Sbjct  144   SEEYIAKYQLATSKMRELDKDPFDPLGFKQQANIHCAYCNDAYT---MGDQKLQVHQSWL  200

Query  670   FFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNY  849
             FFPFHRWYLYFYE+ILG LI+DPTFALPYWNWD+ SGM +P MF    SSLYDA RNP+ 
Sbjct  201   FFPFHRWYLYFYERILGSLIDDPTFALPYWNWDHPSGMRLPAMFDVEGSSLYDARRNPHV  260

Query  850   LPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQG  1029
                 I+DL + G +   ++ ++I  NL+ +YR M+TN     LF G+ Y  G+ P+PGQG
Sbjct  261   RNGTIIDLGFFGDEVKTNEIQMITNNLILMYRQMITNAPCPLLFFGEPYRFGSKPNPGQG  320

Query  1030  SVEGIPHTPVHRWVGD--SVDQPN-----GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
             ++E IPHTPVH W G     D  N     GEDMGNFYSAG DP+FYSHHANVDRMW  W 
Sbjct  321   TIENIPHTPVHIWTGTVRCTDLGNCVPSYGEDMGNFYSAGLDPVFYSHHANVDRMWNEW-  379

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskps  1362
             K LGGK  D TD+ WLN+ F FYDEN  P RV  +DC+D+  MGYDYE  + PW   KP 
Sbjct  380   KALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPKATPWRNFKPG  439

Query  1363  pskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
                T G     +    + VFP++ LD+ +   + RP TSR++ +K++ EEVL    ++  
Sbjct  440   KKTTPGKVNLRSVKPASKVFPLSNLDRAICFSIERPATSRSQQDKDEFEEVLTFKNLKYD  499

Query  1540  MDQYARFDVYLN-DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKT----SVRLGLNEPL  1704
               +Y +FDV++N D        DK +YAG +  LPH    +S          +L + E L
Sbjct  500   DSKYIKFDVFVNADKTVNADDIDKKEYAGSYTSLPHVHGPNSGNHAVEVQEFKLAITELL  559

Query  1705  EDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             ED G ED+D + VT+ P+ GG VV ++S+ IE
Sbjct  560   EDCGLEDEDIIAVTVVPKTGGEVVSINSVLIE  591



>ref|XP_003522849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
 gb|KHN32510.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   441 bits (1133),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 242/519 (47%), Positives = 323/519 (62%), Gaps = 29/519 (6%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKR  477
             P A+AA     I  P+++ C   +++P   + T  CCPP+ T+ ++D++ P +  P+R R
Sbjct  91    PFANAA----PILGPDLTTC-VQAELPEGVEPTN-CCPPISTN-IIDFKFPPSNQPLRVR  143

Query  478   VPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVH  657
               A    ++Y+ KYE A+  MKNL    P SF QQA +HCAYC+GGY Q GFP  +++VH
Sbjct  144   SAAHLVNKDYLAKYEKAVNLMKNLPSDDPRSFAQQAKVHCAYCDGGYHQLGFPDLDLEVH  203

Query  658   NSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANR  837
              SWLFFP+HRWYLYF+E+IL  LINDPTFALP+WNWD   GM +P+M+    S LYD+ R
Sbjct  204   FSWLFFPYHRWYLYFHERILASLINDPTFALPFWNWDAPGGMQLPSMYADPKSPLYDSLR  263

Query  838   NPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             N N+ PP +V+L++  +D   + E  I+ NL  +YR +V+N  T  LF G  Y  G  P+
Sbjct  264   NANHQPPTLVNLDFTIEDP--NAEANISTNLTTMYRQLVSNAKTPTLFFGNPYRAGDQPN  321

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
             PG GSVE  PH PVH W GD ++ P  EDMGN Y+A RDP+FY HH+NVDRMW IW K L
Sbjct  322   PGGGSVESTPHGPVHAWTGD-INHPTMEDMGNLYAAARDPIFYCHHSNVDRMWSIW-KTL  379

Query  1198  GGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------Yssl  1338
             GGK  D TD  WL ++FLFYDEN+  VRV  KDC+D   +GY Y+               
Sbjct  380   GGKRRDLTDPDWLESAFLFYDENKNLVRVKTKDCLDTRKLGYVYQDVDIPWLKSKPTPLR  439

Query  1339  pwlkskpspskTTGAAAASNAPFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVL  1515
                +         G AAA  A    +V FP+ LD VV   V RPK SR+K EKE++EE+L
Sbjct  440   SRAQKVELTPLFGGVAAAHAAETSRNVKFPLVLDSVVSTVVKRPKKSRSKKEKEEKEEIL  499

Query  1516  VIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK---TSVRL  1686
             V++GIE       +FDV++ND D      D  ++AG F  +PH  E     K   T +RL
Sbjct  500   VVEGIEFESSTGVKFDVFINDEDDKLVKPDNTEFAGSFVSVPHSHEHHKNNKKIVTCLRL  559

Query  1687  GLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             GL + LE+LGAEDDD+VLVTL P+ G G V++  I+I++
Sbjct  560   GLTDLLEELGAEDDDSVLVTLVPKYGKGRVNIRGIKIDF  598



>ref|XP_007025703.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28325.1| Larreatricin hydroxylase [Theobroma cacao]
Length=605

 Score =   441 bits (1134),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 263/568 (46%), Positives = 355/568 (63%), Gaps = 34/568 (6%)
 Frame = +1

Query  166   VSCKA-NNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVDVA  333
             VSC+A NN N +   ++ S G   +   DRR++L+GLGGLYG  NLA  P A AA     
Sbjct  47    VSCRATNNGNQNPTPSSNSKGDSALNRFDRRDLLIGLGGLYGATNLANDPFALAA----P  102

Query  334   IHYPNVSKCHYPSDVPANADITGTC-----CPPVPTDTVLDYQIPTGGPMRKRVPAQFAT  498
             I  P+++ C        NA I+ T      C P  T T+ DY+ P+   +R R PA    
Sbjct  103   IAAPDLTLC-------GNAVISETTGETTYCCPPTTTTITDYKPPSFSKLRYRPPAHLVD  155

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
              +Y+ K+  A+  MK L    P SF QQA +HCAYCNG Y Q GFP +++QVH SWLFFP
Sbjct  156   ADYLAKFTKAMNLMKELPSDDPRSFMQQAYVHCAYCNGAYDQVGFPDQDLQVHFSWLFFP  215

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             FHRWYLYFYE+ILGKLI DP F +P+WNWD  +GM +P ++++  S LYD  RN N+ PP
Sbjct  216   FHRWYLYFYERILGKLIGDPDFVMPFWNWDAPAGMPIPAIYVNPQSPLYDDKRNVNHQPP  275

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
              + DL+Y G D+ ++D E IA NL  +Y+ MV+N  T  LF GK Y  G   SPG GSVE
Sbjct  276   KLADLDYNGTDKDITDAEQIAINLKLMYKQMVSNATTATLFHGKPYRAGDAGSPGGGSVE  335

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DF  1212
                HT +HRWVGD   Q   EDMGNFYSAGRDP+FY+HH NVDRMW IW+ L G K  DF
Sbjct  336   LGCHTAIHRWVGDP-RQTYNEDMGNFYSAGRDPVFYAHHGNVDRMWSIWKTLPGTKRNDF  394

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-------Ysslpwlkskpspsk  1371
             +D  WL+ASF+FYDEN   VRV  +DC+D+  +GYDY+        +     K      K
Sbjct  395   SDTDWLDASFVFYDENANLVRVKVRDCVDSKNLGYDYQPVDNPWLKTKPTARKFAKKGGK  454

Query  1372  TTGAAAASNAP---FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
               G+A A+       V + FP+ LDK V +++ RP+ SR+K EKE++EEVLV++GI++A 
Sbjct  455   ARGSAMAAEIKSKNVVRNAFPIVLDKTVSIEIPRPRKSRSKREKEEDEEVLVLEGIQLAT  514

Query  1543  DQYARFDVYLNDS-DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGA  1719
                 +FD+Y+ND  D+   G + A++AG F ++PH    +    T+  L +++ LEDL  
Sbjct  515   QAAVKFDIYINDEDDEAPSGPEDAEFAGSFTNIPHSHTHAKKLNTTFSLAISDVLEDLDV  574

Query  1720  EDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             E DD ++VTL P+ G G+V V +I+++Y
Sbjct  575   EGDDNIVVTLVPREGKGLVSVGNIKVDY  602



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   441 bits (1133),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 339/559 (61%), Gaps = 17/559 (3%)
 Frame = +1

Query  157   RLRVSCKANNPN--NSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDV  330
             R  +SCKA NPN  N  D   +S     +DRRNVL+GLGGLYG   LA  P+A A     
Sbjct  51    RSSISCKATNPNYNNEQDQQQSSNLLGKLDRRNVLIGLGGLYGATTLAPKPLAFAN----  106

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
              +  P+++KC  P+++    + T  CCPPV T  +  +      P+R R  A   T EY+
Sbjct  107   PLAPPDLTKCK-PAEITTGGE-TVECCPPVST-KIKTFTPDRSIPLRTRPAAHLVTDEYL  163

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              K++ A   M+ L    P S  QQA +HCAYCNG Y Q GFP  +IQ+H SWLFFPFHR 
Sbjct  164   AKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQIHFSWLFFPFHRM  223

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI+DPTFALPYWNWD+  G  +P+++  TTS LYD  RN ++ PP +VD
Sbjct  224   YLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRNADHQPPVLVD  283

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG-TPPSPGQGSVEGIP  1047
             L+Y G D  + D+  I ENL  +Y  MV+   T  LF G +Y  G T      G++E  P
Sbjct  284   LSYGGTDDDVDDQTRIDENLAIMYXQMVSGAKTPHLFFGHEYRAGDTTTGTYAGTIENSP  343

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDD  1221
             H  +H W GD  +Q + EDMGNFYSAGRDPLFY+HH NVDRMW +W K LGG  KD TD 
Sbjct  344   HNNIHLWCGDP-NQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWNVW-KTLGGKRKDPTDT  401

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMD-NIAMGYDYE-YsslpwlkskpspskTTGAAAAS  1395
              WL+A FLFYDEN + V    +D +     + Y YE  S         +    +   A  
Sbjct  402   DWLDAEFLFYDENAELVSCKVRDSLKPEKDLRYTYEPVSVPWLFTKPTARKPKSKTKAKV  461

Query  1396  NAPFVTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYL  1572
              A  +T  FP T D    V+V+RPK   RTK EK  EEEVL+I  IE   ++  +FDV++
Sbjct  462   GATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKIDEEEVLIIKDIEFESNEAVKFDVFI  521

Query  1573  NDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLA  1752
             ND  +    KDK+++AG F H+PH Q++ +  KT+++LG+ + LEDLG EDD +VLVTL 
Sbjct  522   NDDAESLSRKDKSEFAGSFVHVPHNQKTGTKKKTNLKLGITDLLEDLGVEDDSSVLVTLV  581

Query  1753  PQVGGGVVDVDSIRIEYST  1809
             P+V    + +   +IEYS+
Sbjct  582   PRVSNSPITIGGFKIEYSS  600



>ref|XP_010910924.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=555

 Score =   438 bits (1127),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 267/558 (48%), Positives = 359/558 (64%), Gaps = 22/558 (4%)
 Frame = +1

Query  163   RVSCKANNPNN----STDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDV  330
             R+SCKA    +    ST +A  S G   +DRR++L+GLGGLYG A   G    +   + +
Sbjct  1     RISCKATRDEHEKPMSTTEAIGSSGK--LDRRDMLIGLGGLYGAAAGLG---VNRKALGL  55

Query  331   AIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEY  507
              I  P+VSKC  P+D+P  A  T T C P  T  ++D+++P +  P+R R  A     EY
Sbjct  56    PIEAPDVSKCG-PADLPPGA--TPTDCCPSSTSKIIDFKLPPSSNPLRIRSAAHLVDSEY  112

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KY  A+  MK L    P +F QQAN+H AYC+G Y+Q GFP  E+QVHNSW+FFP+HR
Sbjct  113   LAKYAKAVELMKALPADDPRNFTQQANVHSAYCDGAYEQIGFPDLELQVHNSWIFFPWHR  172

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             +YLYF+EKILGKLI D TFALP+WNWD  +GM MP+++   +SSLY+   +  + PP +V
Sbjct  173   FYLYFHEKILGKLIGDETFALPFWNWDAPAGMQMPSIYTDPSSSLYNKLCDAKHQPPYLV  232

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL + G+D   + ++ I  NL  +YR ++TNG T +LFMG  Y  G  P+PG GS+E + 
Sbjct  233   DLGFNGQDPSFTHDQQIDYNLKTMYRQVITNGKTAQLFMGSPYRAGDQPNPGAGSLENVX  292

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDD  1221
             H  VH W GD  +QPNGE+MG  YSA RDP+FY+HH+NVDRMW +W K+LGG  KDF D 
Sbjct  293   HNTVHVWTGDR-NQPNGENMGALYSAARDPIFYAHHSNVDRMWYVW-KMLGGKHKDFEDK  350

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WLN+SFLFYDEN   VRV  KDC+D   + Y Y+   +PWLK++P+P  T  A   + +
Sbjct  351   DWLNSSFLFYDENAGLVRVKVKDCLDTQGLRYTYQDVEIPWLKTRPTPKGTAAAKKGARS  410

Query  1402  P-FVTD-VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN  1575
             P  VT+   PVTLD  V   V RPK SR++ EKE EEEVLV++GIE     + +FDVY+N
Sbjct  411   PRAVTEATLPVTLDSSVSATVRRPKVSRSRKEKEDEEEVLVVEGIEFDRGMFIKFDVYIN  470

Query  1576  DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK---TSVRLGLNEPLEDLGAEDDDTVLVT  1746
               ++        ++AG F ++PHK   S   K   T++RLG+ + LEDLGAE D +VLVT
Sbjct  471   TPEEDGVDPGSTEFAGSFVNVPHKNNHSKKEKKVRTALRLGITDLLEDLGAEADGSVLVT  530

Query  1747  LAPQVGGGVVDVDSIRIE  1800
             L P+   G V V  +R+E
Sbjct  531   LVPRKEKGNVKVGGLRLE  548



>gb|ACN38060.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   440 bits (1131),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 326/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDCL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>gb|ACF17425.1| polyphenol oxidase [Camellia sinensis]
 gb|ACS88249.1| polyphenol oxidase [Camellia sinensis]
 gb|AFU35561.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   440 bits (1131),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 326/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDCL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>gb|ABR10907.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   439 bits (1130),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 326/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDCL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISIFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>sp|Q08296.1|PPOF_SOLLC RecName: Full=Polyphenol oxidase F, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78300.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=585

 Score =   439 bits (1129),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 314/510 (62%), Gaps = 20/510 (4%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRK  474
             P+ASAA     I  P++  C          +++ +CCPPVP   D+V  Y+ P    +R 
Sbjct  82    PLASAA----PIPPPDLKSCGVAHIDDKGTEVSYSCCPPVPDDIDSVPYYKFPPMTKLRI  137

Query  475   RVPAQFATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEI  648
             R PA  A +EY+ KY+ A + M+ LD  P  P  F QQANIHCAYCNG Y+  G   +E+
Sbjct  138   RPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGG---KEL  194

Query  649   QVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYD  828
             QVH SWLFFPFHRWYLYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD
Sbjct  195   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYD  254

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
               RN N+    I+DL + GKD      +++  NL  +YR MVTN      F G     G+
Sbjct  255   EKRNQNHRNGTIIDLGHFGKDVRTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAPL--GS  312

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
              P PG G++E IPHTPVH W GDS  Q +GEDMGNFYSAG DPLFY HHANVDRMW  W 
Sbjct  313   DPEPGMGTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEW-  371

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskps  1362
             KL+GGK  D ++  WLN+ F FYDEN  P RV  +DC+D+  MG+DY     PW   KP 
Sbjct  372   KLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYPPMPTPWRNFKPI  431

Query  1363  pskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
                ++G    ++   V+ VFP+  LD+ +   ++RP +SRT  EK +++E+L  + +   
Sbjct  432   RRSSSGKVNTASIAPVSKVFPLAKLDRAISFSLTRPASSRTTQEKNEQQEILTFNKMAYD  491

Query  1540  MDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLED  1710
               +Y RFDV+LN     +  + DKA++AG +  LPH      +     +  L + E LED
Sbjct  492   DTKYVRFDVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNNDNHVKDVTFTLAITELLED  551

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             +G ED+DT+ VTL P+VGG  V ++S+ I+
Sbjct  552   IGLEDEDTIAVTLVPKVGGEGVSIESVEIK  581



>gb|EYU26238.1| hypothetical protein MIMGU_mgv1a025156mg [Erythranthe guttata]
Length=587

 Score =   439 bits (1128),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 261/569 (46%), Positives = 333/569 (59%), Gaps = 42/569 (7%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRN  RL++SC  +     +   A +P   + DRRNVLLG GGL G ANL     ASA
Sbjct  36    HAKRNN-RLQISCSDSQKQKDSSQNADTPQGNV-DRRNVLLGFGGLCGAANLISTHTASA  93

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
               V      P + KC   +++     +   CCPP+  + ++D++ P    MR R  A   
Sbjct  94    NPVQA----PQIDKCGVATNLNTGKQLDINCCPPMGKN-IIDFKPPPLVQMRTRPSAHRV  148

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
             + EY+ KY  A+  MK L    P SF QQANIHCAYCNG Y Q G  T ++QVHNSWLFF
Sbjct  149   SAEYMFKYNTAIDRMKRLPKDDPRSFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFF  208

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHRWYLYFYE+ILGKLI DPTFALP+WNWDN  GMT+P MF+   +++YDA RNP  +P
Sbjct  209   PFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPMFVDPKAAIYDAKRNPANMP  268

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             PA+VDL   G    L   ++++ NL  +Y  MV        FMGK Y  GT  +PG G+ 
Sbjct  269   PAVVDLGLTGNKDPL---QVVSNNLTVMYSEMVRANSDIYDFMGKPYREGTLVNPGPGAS  325

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG----  1203
             E   H  +H +VGD   +P+GED+GNFYSAGRDPLFY HHANVDRMW +WQ  L      
Sbjct  326   ERGSHVAIHVFVGDP-REPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWQYFLPNNKLI  384

Query  1204  -KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss----------lpwlk  1350
              K  TD  +LNASFLFYDEN Q VRV  KDC+DN  +GYD+E                  
Sbjct  385   DKKITDPDYLNASFLFYDENAQLVRVTVKDCLDNTKLGYDFERVDLPWLDYRPPPQTAQA  444

Query  1351  skpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGI  1530
                    TT  A A        VFP+ LD + +V +   KT + KA     +E+LVI+ I
Sbjct  445   KVMRTVSTTRKADA--------VFPLKLDGIARVLIQ--KTKKGKA-----DELLVIEDI  489

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
              V   ++ +FDV++ND D   G  DKA YAG +A +PHK    + T T++RL L E  +D
Sbjct  490   TVDTSKFLKFDVFVNDEDDNVGELDKAAYAGTYAQVPHKTNEKTAT-TTIRLKLTELYDD  548

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             +   +DDTVLVTL P+  G  V +  I+I
Sbjct  549   MDVTEDDTVLVTLVPRHEGEGVTIGGIKI  577



>gb|ADP89908.1| polyphenol oxidase [Nelumbo nucifera]
Length=500

 Score =   435 bits (1119),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 302/450 (67%), Gaps = 18/450 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P++SKC   +++PA A  T  CCPP  ++ ++D+++P+   PMR R  A    +EYI
Sbjct  48    IMPPDLSKCG-AANLPAGAKPT-NCCPPASSE-IVDFKLPSSSEPMRVRPAAHMVDEEYI  104

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+QVHNSWLFFPFHR+
Sbjct  105   AKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLFFPFHRY  164

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE++LGKLI+DPTFALPYWNWD  +GM MP M+ +  S LYD  R+  + PP ++D
Sbjct  165   YLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYANPNSPLYDKLRDAKHQPPTMID  224

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             LNY  +D  ++ E+L+  NL  +YR +V+NG T +LF+G  Y  G  P PG GS+E +PH
Sbjct  225   LNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFGSLENVPH  284

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG-GKDFTDDSW  1227
              PVH W GD   QPN E+MGNFYSA RDP+FY+HH+NVDRMW IW+KL G  KDF D  W
Sbjct  285   GPVHLWAGDRT-QPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGGRRKDFKDPDW  343

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAA------  1389
             LNA FL YDEN+Q VRV  +DC+D   + Y Y+   +PW+K++P+P K   AA       
Sbjct  344   LNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQKLKITD  403

Query  1390  ---ASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
                    P V++ FP  LD   +V V RP+ SR+K EKE EEE+LVID +E+  D   +F
Sbjct  404   RGLKKKKPTVSE-FPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVELERDTVVKF  462

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ  1650
             DV++ND D P    DK+++AG F ++PHK 
Sbjct  463   DVHINDEDGP--SPDKSEFAGSFVNVPHKH  490



>ref|XP_008345876.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 243/551 (44%), Positives = 328/551 (60%), Gaps = 21/551 (4%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RV CK    +N   D     G   +DRRN+L+GLG       +   P A AA        
Sbjct  46    RVRCKXTKGDNDNLDQ----GLARLDRRNMLIGLGAGGLYGXVGN-PFAFAAPXSA----  96

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQ--EYINK  516
             P+++ C  P+  P  + I   CCPP  T T++D+++P  GP+R R  AQ      EY+ K
Sbjct  97    PDLTTCX-PAXKPDGSTID--CCPPT-TTTIIDFELPDSGPLRTRPAAQDVANDPEYLAK  152

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YC+GGY Q G+   EIQVH  WLFFPFHRWYL
Sbjct  153   YKXAVEXMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHXCWLFFPFHRWYL  212

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI D TFALP+WNWD  +GM +P +F  T SSLYD  RN  + PP ++DLN
Sbjct  213   YFYEKIMGELIGDXTFALPFWNWDAPAGMYIPEIFXDTXSSLYDQYRNXAHQPPKLLDLN  272

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             Y   D  + D   I ENL  +Y+ MV+N      F G+ Y  G  P PG G++E  PH  
Sbjct  273   YGXTDDDVDDATRIKENLTTMYKQMVSNATXHRXFYGEPYSAGDEPXPGAGNIETTPHNN  332

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q NGEDMG FYSA RDP FYSHH+NVDRMW I++  LGG D  +  WL+A
Sbjct  333   IHLWXGDPT-QXNGEDMGTFYSAARDPXFYSHHSNVDRMWXIYKDKLGGTDIENTDWLDA  391

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--wlkskpspskTTGAAAASNAPFV  1410
              FLFYDE +   RV  +D +D   +GY Y+ +               T    A  ++  +
Sbjct  392   EFLFYDEKKNLXRVXVRDSLDTKKLGYVYDENVSIPWLXSKPTXRKSTNKRKAXVSSSDL  451

Query  1411  TDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQ  1587
             +  FP TL  ++ V+V+RP  T RT A+K+ ++EVLVI GIE A ++  +FDVY+ND   
Sbjct  452   STTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDDAD  511

Query  1588  PDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGG  1767
                GKDK+++AG F H+PHK + +   KT++RL +   LE+L AE D++++VTL P+VG 
Sbjct  512   SLAGKDKSEFAGSFVHVPHKHKKN--IKTNLRLSITSLLEELDAETDNSLVVTLVPKVGK  569

Query  1768  GVVDVDSIRIE  1800
             G + +    IE
Sbjct  570   GPITIGGFSIE  580



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   439 bits (1128),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 233/511 (46%), Positives = 305/511 (60%), Gaps = 28/511 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGT-CCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKY  519
             P++SKC  PSD+P+        CCPP  T  + D++ P+  P+R R  A     E++ KY
Sbjct  98    PDLSKCVPPSDLPSGTTPPNINCCPPYST-KITDFKFPSNQPLRVRQAAHLVDNEFLEKY  156

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
             + A   MK L  + P +F QQANIHCAYC+G Y Q GFP  ++QVH SWLFFPFHRWYLY
Sbjct  157   KKATELMKALPSNDPRNFTQQANIHCAYCDGAYSQIGFPDLKLQVHGSWLFFPFHRWYLY  216

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILG LINDPTFALP+WN+D   GM +P ++    S LYD  RN ++ PP ++DLN+
Sbjct  217   FYERILGSLINDPTFALPFWNYDAPDGMQLPTIYADKASPLYDELRNASHQPPTLIDLNF  276

Query  880   AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPV  1059
                   +   ELI  NL  +YR + +NG T+ LF+G  Y  G     G GS+E +PH PV
Sbjct  277   CDIGSDIDRNELIKTNLSIMYRQVYSNGKTSRLFLGNPYRAGDAEPQGAGSIENVPHAPV  336

Query  1060  HRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLN  1233
             H W GD+  Q N EDMG FYSA RDP+FYSHH+NVDR+W IW K LGGK  DFTD  WL 
Sbjct  337   HTWTGDNT-QTNIEDMGIFYSAARDPIFYSHHSNVDRLWYIW-KTLGGKKHDFTDKDWLE  394

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------YsslpwlkskpspskTTG  1380
             + FLFYDEN+  VRV  KD +D   +GY Y+                 ++         G
Sbjct  395   SGFLFYDENKNLVRVNVKDSLDIDKLGYAYQDVPIPWEKAKPVPRRTKVQKLVEVEVNDG  454

Query  1381  AAAASNAPFVTD--------VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
                 S   F+           FP+ L+  V   V RPK  R+K EKE+EEEVLVI+GIE 
Sbjct  455   NLRKSPTIFLVRQQSPRKYVTFPLVLNNKVSAIVKRPKKLRSKKEKEEEEEVLVIEGIEF  514

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK--TSVRLGLNEPLED  1710
              M+   +FDVY+ND D   G  +  ++AG F ++PH        K  TS+RLG+ + LED
Sbjct  515   YMNIAIKFDVYINDEDDKVGAGN-TEFAGSFVNIPHSAHGHKNKKIITSLRLGITDLLED  573

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             L  E DD ++VTL P+ G G V ++++ I +
Sbjct  574   LHVEGDDNIVVTLVPKCGSGQVKINNVEIVF  604



>ref|XP_008779317.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   438 bits (1126),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 276/566 (49%), Positives = 366/566 (65%), Gaps = 24/566 (4%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNS---TDDAAASPGSRIIDRRnvllglgglygvanlaggPIAS  312
             K++    R+SCKA + +     T +A  S G   +DRR++L+GLGGLYG A   G    +
Sbjct  37    KKSHLHPRISCKARDEHEKPMHTSEATGSSGK--LDRRDMLIGLGGLYGAAAGLG---VN  91

Query  313   AADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQ  489
                + + I  P++SKC  P+D+P+ A I   CCPP  T  ++D+++P    P+R R  A 
Sbjct  92    RKALGLPIEAPDISKCG-PADLPSGA-IPTDCCPPF-TSKIIDFKLPPRSDPLRIRPAAH  148

Query  490   FATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWL  669
                 EY+ KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  EIQVH+SW+
Sbjct  149   LVDSEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHDSWI  208

Query  670   FFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNY  849
             FFP+HR+YLYF+EKILGKLI D TFALP+WNWD  +GM MP+++   +SSLYD  R+  +
Sbjct  209   FFPWHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMGMPSIYTDPSSSLYDKLRDAKH  268

Query  850   LPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQG  1029
              PP +VDL++ G+D   +  + I  NL  +YR ++ NG T +LFMG  Y  G  P+PG G
Sbjct  269   QPPYLVDLDFNGQDPSFTQAQQIDHNLKIMYRQVIANGKTAQLFMGSPYRAGDQPNPGGG  328

Query  1030  SVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG-K  1206
             S E +PH  VH W GD  +QPNGEDMG  YSA RDP+FY++H+NVDRMW +W+KL G  K
Sbjct  329   SFENVPHGTVHEWTGDR-NQPNGEDMGVLYSASRDPIFYAYHSNVDRMWYVWKKLGGKHK  387

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA-  1383
             DF D  WLN SFLFYDEN   VRV  KDC+D   + Y Y+   +PWL+++P+P  T  A 
Sbjct  388   DFDDKDWLNTSFLFYDENADIVRVKIKDCLDTQWLRYTYQDVEIPWLRTRPTPKGTMAAK  447

Query  1384  -AAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
              +A S        FPVTLD  V   V RPK SR+  EKE EEEVLV++GIE   D + +F
Sbjct  448   KSARSLRAITEATFPVTLDSPVSATVRRPKVSRSSKEKEDEEEVLVVEGIEFDRDVFIKF  507

Query  1561  DVYLNDSDQPDGGKD--KAQYAGGFAHLPHKQESSSTTK---TSVRLGLNEPLEDLGAED  1725
             DVY+N    P+ G D   +++AG F ++PHK + S   K   T++RLG+ E LEDLGAE 
Sbjct  508   DVYIN---TPEDGVDPGSSEFAGAFVNVPHKHKHSKKEKKLMTALRLGITELLEDLGAEA  564

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD+VLVTL P+ G G V V  +RIE+
Sbjct  565   DDSVLVTLVPRKGKGKVKVGGLRIEF  590



>gb|ABR24120.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   438 bits (1127),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 326/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A +++I K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKHIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDCL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>gb|ABR57236.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   438 bits (1127),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 325/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDCL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P         K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPPISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGCFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   438 bits (1126),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 254/509 (50%), Positives = 330/509 (65%), Gaps = 27/509 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGT-CCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINK  516
             P++S C  P D+P  A      CCPP  T+ ++D++IP T  P+R R  A     +Y+ K
Sbjct  96    PDLSTCG-PPDLPLGATPNNINCCPPNSTN-IIDFKIPSTNQPLRIRQAAHLVDNKYLRK  153

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTE-EIQVHNSWLFFPFHRWY  693
             Y  A+  MK+L    P SF QQANIHCAYC+G Y Q GFP++ ++QVHNSWLFFPFHRWY
Sbjct  154   YNKAVELMKSLPSDDPRSFIQQANIHCAYCDGAYSQVGFPSDLDLQVHNSWLFFPFHRWY  213

Query  694   LYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDL  873
             LYFYE+ILG LINDPTFALP+WN+D  +GM  P ++  T SSLYD  RN ++ PP +++L
Sbjct  214   LYFYERILGSLINDPTFALPFWNYDAPNGMQFPTIYTDTKSSLYDKLRNTDHQPPTLINL  273

Query  874   NYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHT  1053
             N+ G D    +E  ++ NL  +YR +V+NG T++LF+G  Y  G  P PG GSVE +PH 
Sbjct  274   NFDGDDDDDVNER-VSTNLTIMYRQVVSNGKTSKLFLGNSYRAGDEPDPGAGSVENVPHG  332

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KDFTDDS  1224
              VH W GD   QPN EDMG FYSA RDP+F+SHH+N+DR+W IW K LGG   KDFTD  
Sbjct  333   TVHGWSGDKT-QPNREDMGVFYSAARDPIFFSHHSNIDRLWSIW-KTLGGKNRKDFTDSD  390

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT---------  1377
             WL + FLFYDEN+  V V  KDC+D   +GY Y+   +PWLKSKP+P   T         
Sbjct  391   WLESGFLFYDENKNLVNVKVKDCLDTKNLGYVYQDVDIPWLKSKPTPRGKTQKKVEVAQG  450

Query  1378  -----GAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
                  G A A  +      FP+ LD VV   V RPK SR+K EKE+EEEVLVI+GIE   
Sbjct  451   LHFGIGEAHAFESSRKYVKFPLVLDNVVSTIVKRPKKSRSKKEKEEEEEVLVIEGIEFER  510

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK--TSVRLGLNEPLEDLG  1716
             +   +FDV++ND D         ++AG F ++PH  E+    K  + +RLGL + LEDLG
Sbjct  511   NLAVKFDVFINDEDDKVIRPVDTEFAGSFVNVPHFNENKGKKKIISCLRLGLTDLLEDLG  570

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             AEDDD+V+VTL P+ G G+V + SI+I +
Sbjct  571   AEDDDSVVVTLVPRNGKGLVKIRSIKIVF  599



>ref|XP_009334704.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   437 bits (1125),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 264/560 (47%), Positives = 342/560 (61%), Gaps = 18/560 (3%)
 Frame = +1

Query  157   RLRVSCKANNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVD  327
             R  +SCKA NPNN+         S ++   DRRNVLLGLGGLYG   LA  P+A AA   
Sbjct  50    RSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAA---  106

Query  328   VAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
               +  P+++KC   +++    + T  CCPPV T  +  +      P+R R  A   T EY
Sbjct  107   -PLAPPDLTKCTL-AEITTGGE-TVACCPPVSTK-IKAFTPDRSIPLRTRPAAHLVTDEY  162

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + K++ A   M+ L    P S  QQAN+HCAYCNG Y Q GFP  +IQVH SWLFFPFHR
Sbjct  163   LAKFKKAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYFYE+ILGKLI+DPTFALPYWNWD+     +P+++  TTS LYD  RN  + PP +V
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPVCFPIPDIYTDTTSPLYDQYRNAGHQPPVLV  282

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG-TPPSPGQGSVEGI  1044
             DL+Y G D  + ++  I ENL  +YR MV+   T +LF G +Y  G T      G++E  
Sbjct  283   DLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTIENN  342

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTD  1218
             PH  +H W GD  DQPN EDMGNFYS+GRDPLFY+HH NVDRMW IW K LGG  KD TD
Sbjct  343   PHNNIHLWCGDP-DQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIW-KTLGGKRKDPTD  400

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIA-MGYDYE-YsslpwlkskpspskTTGAAAA  1392
               WL+A FLFYDEN + V    +D +     + Y YE  S         +        A 
Sbjct  401   TDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAK  460

Query  1393  SNAPFVTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
              +A  +T  FP T D    V+V+RPK   RTK EK  EEEVL+I  IE   ++  +FDV+
Sbjct  461   VSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVF  520

Query  1570  LNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             +ND  +    KDK+++AG F H+PHKQ++ + TKT+++LG+ + LEDLG E+D  VLVTL
Sbjct  521   INDDAESLSRKDKSEFAGSFVHVPHKQKTGTKTKTNLKLGITDLLEDLGVEEDSCVLVTL  580

Query  1750  APQVGGGVVDVDSIRIEYST  1809
              P+V    + V   +IEYS+
Sbjct  581   VPRVSNSPITVGGFKIEYSS  600



>gb|ABF19601.1| polyphenol oxidase [Camellia ptilophylla]
Length=595

 Score =   437 bits (1124),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 324/503 (64%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P +SKC   +++PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  98    PYLSKCGA-ANLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  154

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  155   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  214

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  215   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  274

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  275   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  334

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
              H W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D  WL
Sbjct  335   AHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDPDWL  392

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  393   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFLRKIKNKAGI  452

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIEV  D   +F
Sbjct  453   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEVERDVSVKF  512

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +T +RLG+ E LEDL AEDD++VL
Sbjct  513   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTGLRLGITELLEDLEAEDDESVL  572

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  573   VTLVPRYGSDAVTIGGVKIEFDS  595



>gb|ACR82078.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   437 bits (1123),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 325/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P P  GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPVAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDPDLL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEGEKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>ref|XP_008663490.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Zea mays]
 gb|AFW59173.1| putative polyphenol oxidase family protein [Zea mays]
Length=546

 Score =   434 bits (1117),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 228/497 (46%), Positives = 305/497 (61%), Gaps = 23/497 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGP-MRKRVPAQFATQEYI  510
             I  P++  CH P D+P  A+    C    P+  ++D+   T  P +R R  A     EY+
Sbjct  64    IQAPDLRNCH-PPDLPDTAEDVNCC----PSPGIVDF---TPSPRLRVRPAAHLVDAEYV  115

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KYE A+  MK L    P SF QQ  +HCAYC+G + Q GFP  EIQ+HN WLFF +HR+
Sbjct  116   AKYEKAVALMKQLPDDDPRSFAQQWRVHCAYCDGAFDQVGFPDLEIQIHNCWLFFQWHRF  175

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKL+ D  FALP+WNWD   GM++P ++   +S LYD  R+P + PP  +D
Sbjct  176   YLYFHERILGKLVGDDKFALPFWNWDAPGGMSLPAIYADKSSPLYDERRDPAHQPPFTLD  235

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G +  +   + I +NL+ +YR M++     ELF G  Y  G  P PG G+VE IPH
Sbjct  236   LDYDGTEPTIPRAQQIDQNLMIMYRQMISGAKKKELFFGMPYRQGDQPDPGAGTVESIPH  295

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTDDSW  1227
              PVH W GD   QPNGEDMGNFYSA RDPLF++HH N+DRMW +W  L  G  DFTD SW
Sbjct  296   NPVHFWSGDP-RQPNGEDMGNFYSAARDPLFFAHHGNIDRMWSVWNGLRPGNSDFTDPSW  354

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             L+ASFLFYDE  + VRV  +DC+D  A+GY Y+        + P  +      A S AP 
Sbjct  355   LDASFLFYDEEARLVRVRVRDCLDTAALGYAYQ------DVALPWLNAKPAKEAGSPAP-  407

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLNDS  1581
                  P TL++ V+V V+RPKTSRT+ EK+ +EEVLV+ GIE+A    ++ +FDV++NDS
Sbjct  408   TAGALPATLNQTVRVAVTRPKTSRTRKEKDAKEEVLVVQGIEIADHSSRFVKFDVFVNDS  467

Query  1582  DQPDGGKDKAQYAGGFAHLPHK---QESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLA  1752
                 G    AQ AG  A  PH     +   T KT  R G+ + L+D+GA+ D T++V+L 
Sbjct  468   QSGGGMPAAAQCAGSVALTPHAVRPGKGKGTVKTVARFGICDLLDDIGADGDKTIIVSLV  527

Query  1753  PQVGGGVVDVDSIRIEY  1803
             P+  G +V V  + IEY
Sbjct  528   PRCAGDMVTVGGVGIEY  544



>ref|XP_009334541.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   436 bits (1122),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 263/560 (47%), Positives = 341/560 (61%), Gaps = 18/560 (3%)
 Frame = +1

Query  157   RLRVSCKANNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVD  327
             R  +SCKA NPNN+         S ++   DRRNVLLGLGGLYG   LA  P+A AA   
Sbjct  50    RSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAA---  106

Query  328   VAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
               +  P+++KC   +++    + T  CCPPV T  +  +      P+R R  A   T EY
Sbjct  107   -PLAPPDLTKCTL-AEITTGGE-TVACCPPVST-KIKAFTPDRSIPLRTRPAAHLVTDEY  162

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + K++ A   M+ L    P S  QQA +HCAYCN  Y Q GFP  +IQVH SWLFFPFHR
Sbjct  163   LAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNDAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYFYE+ILGKLI+DPTFALPYWNWD+  G  +P+++  TTS LYD  RN  + PP +V
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRNAGHQPPVLV  282

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG-TPPSPGQGSVEGI  1044
             DL+Y G D  + ++  I ENL  +YR MV+   T +LF G +Y  G T      G++E  
Sbjct  283   DLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTIENN  342

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTD  1218
             PH  +H W GD  DQPN EDMGNFYS+GRDPLFY+HH NVDRMW IW K LGG  KD TD
Sbjct  343   PHNNIHLWCGDP-DQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIW-KTLGGKRKDPTD  400

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIA-MGYDYE-YsslpwlkskpspskTTGAAAA  1392
               WL+A FLFYDEN + V    +D +     + Y YE  S         +        A 
Sbjct  401   TDWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAK  460

Query  1393  SNAPFVTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
              +A  +T  FP T D    V+V+RPK   RTK EK  EEEVL+I  IE   ++  +FDV+
Sbjct  461   VSATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVF  520

Query  1570  LNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             +ND  +    KDK+++AG F H+PHKQ++ + TKT+++LG+ + LEDLG E+D  VLVTL
Sbjct  521   INDDAESLSRKDKSEFAGSFVHVPHKQKTGTKTKTNLKLGITDLLEDLGVEEDSCVLVTL  580

Query  1750  APQVGGGVVDVDSIRIEYST  1809
              P+V    + V   +IEYS+
Sbjct  581   VPRVSNSPITVGGFKIEYSS  600



>gb|ABF19602.1| polyphenol oxidase [Camellia sinensis var. assamica]
Length=599

 Score =   436 bits (1121),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 237/503 (47%), Positives = 325/503 (65%), Gaps = 19/503 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P P  GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPVAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D   L
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDPDLL  396

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAA  1392
             N+ F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  
Sbjct  397   NSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRKIKNKAGI  456

Query  1393  SNAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             + A    D    VFP  LD+VV+V V RP  SR++ EKE+EEEV+V++GIE+  D   +F
Sbjct  457   AMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEGEKEEEEEVVVVEGIEMERDVSVKF  516

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++VL
Sbjct  517   DVFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESVL  576

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+ G   V +  ++IE+ +
Sbjct  577   VTLVPRYGSDAVTIGGVKIEFDS  599



>dbj|BAM15849.1| hypothetical protein [Portulaca oleracea]
Length=614

 Score =   436 bits (1122),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 257/583 (44%), Positives = 352/583 (60%), Gaps = 38/583 (7%)
 Frame = +1

Query  139   KKRNQTRLRVSCKA-----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggP  303
             +K +    ++SC A      NP ++T D  A+     +DRRN+L+GLGGLYG A   GG 
Sbjct  40    RKSHLPTRKISCSAAKNDDQNPRSNTHDGNAN---NKLDRRNMLIGLGGLYGAATNLGGA  96

Query  304   IASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVP  483
              AS A     I  P++SKC  P+D+P+NA     CCPPV T+ ++DY       +R R P
Sbjct  97    PASFA---APIATPDLSKCE-PADLPSNAIDRSNCCPPVATN-IIDYTPSASSTLRVRPP  151

Query  484   AQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
             A      Y+ K+  A+ AMK L  + P SF QQA +HCAYC+GGY Q GFP  ++QVH S
Sbjct  152   AHAVDATYLAKFNKAIAAMKALPSTDPRSFIQQARVHCAYCDGGYNQVGFPNLDLQVHGS  211

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLF PFHR+YLYF+E+ILG LINDPTFA+P+WNWD+  GM MP+++ +T+S LYD  R+ 
Sbjct  212   WLFLPFHRYYLYFFERILGSLINDPTFAIPFWNWDHPDGMKMPSIYTNTSSPLYDRRRDA  271

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
              + PP ++DLNY G D   SD  LI  NL  +Y+ +V N  T  LF+G+ Y  G     G
Sbjct  272   AHQPPTVIDLNYDGSDDSTSDNALINANLTVMYQQIVRNASTPRLFLGQPYRAGDASPGG  331

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG-  1200
              GS+E +PH PVH W GD  +QPN EDMG FY+A +DP+FY+HHANVDRMW +W+     
Sbjct  332   SGSLENVPHGPVHVWTGDR-NQPNNEDMGTFYTAAKDPIFYAHHANVDRMWSVWKSRRSN  390

Query  1201  --GKDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskT  1374
                 +FTD  WLNASF+FYDEN+Q VRV  KDC+D   +GY Y+   LPWL S+P+   +
Sbjct  391   PTAPEFTDTDWLNASFIFYDENKQAVRVRVKDCLDTKKLGYTYQNVDLPWLNSRPTSRAS  450

Query  1375  TGAAAASNAPFVTD--------------VFPVTLDKVVQVKVSRPKTSRTKAekekeeeV  1512
                  +S  P   +               FP  LD  + + V R        +++K EE 
Sbjct  451   RVTTLSSTIPKTANAAKPPSKPSSSSNVTFPKRLDSAITIDVKR-PKKSRSKKEKKGEEE  509

Query  1513  LVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKA--QYAGGFAHLPHKQ----ESSSTTKT  1674
             +++  IE+  D +  FDV++ND D     K++A  ++ G F ++PH Q    E     KT
Sbjct  510   VLVVEIEIQRDVHVNFDVFVNDEDDVPSKKNRAFVEHVGSFVNVPHHQHRNNEHGKKMKT  569

Query  1675  SVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
               R+GLNE +EDLGA+DD+ + VTL P+ GG  V +  ++IE+
Sbjct  570   FFRVGLNEAIEDLGADDDEGITVTLVPRTGGDAVVIKGLKIEF  612



>ref|XP_008236801.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=567

 Score =   434 bits (1116),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 217/489 (44%), Positives = 304/489 (62%), Gaps = 10/489 (2%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE--YINK  516
             P+++KC  PS+ P  + I   CCPP  T ++LD+++P  GP+R R+ AQ   ++  ++ K
Sbjct  81    PDLTKCG-PSEKPDGSTIE--CCPPT-TTSILDFKLPDPGPLRTRLAAQDLAKDPIHLAK  136

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y+ A+  M+ L    P S  QQA +HC+YCN GY Q G+P  ++QVH+ WLFFPFHRWYL
Sbjct  137   YKKAIELMRALPHDDPRSLAQQAEVHCSYCNNGYPQVGYPNLKMQVHSCWLFFPFHRWYL  196

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYEKI+G+LI DPTFALP+WNWD  +GM +P +F   TSSLYD  RN  + PP ++DLN
Sbjct  197   YFYEKIMGELIGDPTFALPFWNWDAPAGMCIPEIFTDPTSSLYDQYRNAKHQPPKLLDLN  256

Query  877   YAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
             ++G D  + D   I ENL  +Y+ MV+   +  LF G  Y  G    PG+G++E IPH  
Sbjct  257   FSGTDDEVDDATRIKENLTTMYQQMVSKAKSHRLFYGTPYSAGDHLIPGEGNLELIPHDN  316

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFTDDSWLNA  1236
             +H W GD   Q + EDMG FYSAGRDPLFY+HH+NVDRMW I++  LGG D     WL+ 
Sbjct  317   IHFWTGDP-KQAHREDMGTFYSAGRDPLFYAHHSNVDRMWSIYKSKLGGTDIEKTDWLDT  375

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPFVTD  1416
              FLFYD+ +  VRV  +D +D   +GY Y+        +    ++ +         F   
Sbjct  376   EFLFYDQKKNLVRVKVRDSLDTTKLGYVYDDKVEIPWLTSKPTARKSSNKRKPTVSFADL  435

Query  1417  VFPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPD  1593
                 +L   + V+V RP +T RT AEK  ++EVLVI GIE A ++  +FDVY+ND  +  
Sbjct  436   TTKFSLTDTISVEVKRPSRTKRTMAEKAAQDEVLVIKGIEFAGNETVKFDVYVNDDAESL  495

Query  1594  GGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGV  1773
              GKDK+++ G F  LPHK++     K ++ L + + LE+L AE D +V+VTL P+VG G 
Sbjct  496   AGKDKSEFVGSFIDLPHKEKKD--IKKNLMLSITQLLEELDAETDSSVVVTLVPKVGKGT  553

Query  1774  VDVDSIRIE  1800
             + +    IE
Sbjct  554   ITIGGFSIE  562



>ref|XP_010100566.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82809.1| Polyphenol oxidase [Morus notabilis]
Length=586

 Score =   434 bits (1117),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 243/510 (48%), Positives = 325/510 (64%), Gaps = 33/510 (6%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADIT-GT-----CCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
             I  P+++KC        NA+++ GT     CCPP   + ++D++ P    +R R  A   
Sbjct  88    IAAPDLTKC-------GNAELSDGTVLPVDCCPPTALE-IIDFKPPPFTKLRVRPVAHKV  139

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
              +EYI KY  AL+ MK L  + P SF QQA++HCAYCN  Y Q G+P  E+QVHNSWLF+
Sbjct  140   DKEYIAKYNKALSLMKALPDTDPRSFSQQADVHCAYCNSAYDQTGYPGVELQVHNSWLFY  199

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMS-TTSSLYDANRNPNYL  852
             PFHRWYLYFYE+ILGKLI DPTFA+P+WNWD+  GM MP+MF S T+S+LYD NR+P++ 
Sbjct  200   PFHRWYLYFYERILGKLIGDPTFAIPFWNWDHPDGMKMPSMFTSDTSSALYDVNRSPSHQ  259

Query  853   PPAIVDLNYA-GKDRGLSD---EELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSP  1020
             PP ++DL+Y+  +D G      ++ + ENL  +Y+ MV+   T  LF G  Y  G PP  
Sbjct  260   PPYVIDLDYSPSQDAGKPAKPYKQQVDENLTTMYKQMVSGANTQSLFFGGDYRAGEPPEN  319

Query  1021  GQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLG  1200
               GSVE  PH P+H   G+  ++ NGEDMGNFYSAGRDPLFY HH NVDRMW +W++L G
Sbjct  320   SPGSVESRPHIPLHIICGNENNK-NGEDMGNFYSAGRDPLFYCHHGNVDRMWSLWKQLPG  378

Query  1201  GK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----Ysslpwlkskp  1359
              K  D TD  WLNA+FLFYDEN + VRV    C+D   +GY YE     +        K 
Sbjct  379   KKKNDITDPDWLNATFLFYDENAKLVRVKVAGCLDTKKLGYVYEQVDLPWLKKKPKSKKV  438

Query  1360  spskTTGAAAASNAPFVT--DVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIE  1533
             +      A AA +   +T    FP+ L K + VKV RPK  R+KAEKE+EEE+LVI+GI+
Sbjct  439   AKLAVGAAIAAESTKGLTPLSAFPIALKKAITVKVPRPKKGRSKAEKEEEEEILVIEGID  498

Query  1534  VAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDL  1713
                    +FDVY+ND D+   G +K+++AG F  +PH  ++   T T ++LG+ E LED+
Sbjct  499   YDKSTAVKFDVYVNDEDE--AGPEKSEFAGSFVTVPHNTKNKEKTYTKLKLGITELLEDV  556

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             GA+DD+ VLVTL P+ G   V V  ++I Y
Sbjct  557   GADDDEDVLVTLVPKSGN--VTVGGVKIVY  584



>gb|AGU01537.1| polyphenol oxidase [Malus domestica]
Length=616

 Score =   436 bits (1120),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 319/511 (62%), Gaps = 30/511 (6%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++KC   +D P+ A +   CCPP  +  ++D++ P+   +R R  A    + YI KY 
Sbjct  110   PDLAKCGA-ADFPSGA-VPTNCCPPT-SQKIVDFKFPSPTKLRVRPAAHTVDKAYIEKYS  166

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQA++HCAYC+G Y Q GFP  E+Q+H SWLFFPFHR+YLYF
Sbjct  167   KAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQSWLFFPFHRYYLYF  226

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             +E+IL KLI+DPTFALP+WNWD  +GM +P +F +  S LYD  R  ++ PP ++DL++ 
Sbjct  227   HERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRADSHQPPTLIDLDFN  286

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S +  I  NL  +YR MV+N     LF G  Y  GT P PG GS+E  PH PVH
Sbjct  287   GTDETMSKDAQIDANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGAGSIETTPHGPVH  346

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDSWLNAS  1239
              W GD+  QPN EDMGNFYSA RDP+F+SHH+N+DRMW IW+ +    KD  D  WL+  
Sbjct  347   TWTGDNT-QPNFEDMGNFYSAARDPIFFSHHSNIDRMWNIWKSIGTKNKDINDTDWLDTG  405

Query  1240  FLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA------------  1383
             FLFYD+N + VRV  +D +DN  +GY YE   +PWLKS+P+P +T  A            
Sbjct  406   FLFYDKNAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPTPRRTKLARKAKAAGVAKAA  465

Query  1384  -------AAASNAPFVTDVFPVTLD-KVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
                      +S        FP+ L+ K+  V        R+K EKE EEE+LVI GIE+ 
Sbjct  466   GVAKAAETTSSGKVVAGKDFPINLETKISTVVSRPKPKKRSKKEKEDEEEILVIQGIELD  525

Query  1540  MDQYARFDVYLNDSDQPDG---GKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
              D   +FDVY+ND D  D    G DK+++AG F  +PHKQ+  S  K+ +RLGL + LED
Sbjct  526   KDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS--KSCLRLGLTDLLED  583

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             LGAEDD++V+VTL P+ G   V + SI+IE+
Sbjct  584   LGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  614



>ref|XP_006370128.1| hypothetical protein POPTR_0001s39950g [Populus trichocarpa]
 gb|AEH41424.1| polyphenol oxidase [Populus trichocarpa]
 gb|ERP66697.1| hypothetical protein POPTR_0001s39950g [Populus trichocarpa]
Length=573

 Score =   434 bits (1116),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 228/495 (46%), Positives = 312/495 (63%), Gaps = 16/495 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P+++ C   ++   + +    CCPP+ T  ++D+++P+   P+R R PA      YI
Sbjct  85    IQPPDIADCSVINE--PDPENPTNCCPPL-TRKIIDFKLPSQNEPLRIRRPAHLVDDNYI  141

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P +F QQAN+HCAYC+GGY Q G P    QVH SWLFFP+HR+
Sbjct  142   AKYNRAIALMKQLPEDDPRNFTQQANVHCAYCDGGYHQVGMPDLNYQVHFSWLFFPWHRY  201

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLINDPTFALP+WNWD+  GM +P  F    S++YD  R+ ++ PP I+D
Sbjct  202   YLYFYERILGKLINDPTFALPFWNWDSPQGMQIPAFFADPKSAVYDPLRDKSHQPPKIID  261

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L++ G D  L D   +A NL  +YR +VT    T LFMG+ Y  G  P PG GS+E +PH
Sbjct  262   LDFPGVDFPLPDPVQVASNLNVMYRQVVTAKYPT-LFMGRPYRAGDEPEPGAGSLEDVPH  320

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
             T VH W GD+ DQPN E+MG FY+A RDP+F++HH N+DR+W +W+KL GGK  +FTD  
Sbjct  321   TTVHIWTGDA-DQPNRENMGVFYAAARDPIFFAHHGNIDRLWEVWKKLPGGKRENFTDPD  379

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             WL+A+FLFYDEN   VRV  +DC+D   + Y ++           +  K          P
Sbjct  380   WLDAAFLFYDENANLVRVKIRDCLDTTKLRYGFQ---DVASPWINARPKRKPNKPKPTVP  436

Query  1405  FVT--DVFPV-TLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN  1575
               T     P+  L+K V V V RP   R+K +K++ EEVLVI+GIE  +D Y +F+V +N
Sbjct  437   VDTADPTKPIGLLNKTVSVVVQRPNKKRSKKDKDEAEEVLVIEGIEYRIDLYIKFNVLIN  496

Query  1576  DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAP  1755
             D     G  D A++AG F ++PH +  + T KTS+RLG++E LEDL AEDD++V+VTL P
Sbjct  497   DVPDTPGKADDAEFAGTFVNVPHNR--NKTVKTSLRLGISELLEDLEAEDDESVVVTLVP  554

Query  1756  QVGGGVVDVDSIRIE  1800
                 G   + ++RIE
Sbjct  555   VTNIGEATIGTLRIE  569



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   434 bits (1115),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 239/511 (47%), Positives = 309/511 (60%), Gaps = 33/511 (6%)
 Frame = +1

Query  343   PNVSKC-----HYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
             P+++ C       P D+  N D   +CCPP  +D ++D++ PT   +R R  AQ    +Y
Sbjct  100   PDLTSCVVPPIELPDDI-KNIDPPISCCPPFSSD-IIDFKFPTFNKLRVRPAAQLVNDDY  157

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
               KY  AL  M+ L    P SF QQANIHCAYC GGY Q G+  E +QVHNSWLF PFHR
Sbjct  158   FAKYNKALELMRALPDDDPRSFYQQANIHCAYCVGGYTQKGYDVE-LQVHNSWLFLPFHR  216

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             WYLYFYE+ILG LINDPTFA+P+WNWD   GM +P++F +  SSLYD  RNP + PP IV
Sbjct  217   WYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSSLYDPRRNPTHQPPTIV  276

Query  868   DLNYAGKD----RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             DLNY   +       S EE I  NL  +++ M++N  T   F+G  Y  G  P  G GS+
Sbjct  277   DLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTPRQFLGSPYRGGDTPFKGAGSL  336

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDF  1212
             E IPHTP+H W GD   QP+GEDMG+F++AGRDPLFY+HHANVDRMW +W+ L    KDF
Sbjct  337   ENIPHTPIHIWTGDP-RQPHGEDMGHFWAAGRDPLFYAHHANVDRMWSVWKTLGKKRKDF  395

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskpsps  1368
             TD  WL + FLFYDEN+  V+V  KD  ++  +GY Y+        Y S P  + K    
Sbjct  396   TDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIKYKSKPSRRVKSKDK  455

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
               + A   S    + D FP+ LD VV + V RPK SR   EKE EEE+LVIDGIE     
Sbjct  456   NKSSAQRPSRK--LVDKFPIVLDSVVSIIVKRPKKSRNSKEKEDEEEILVIDGIEYDNKT  513

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK-------TSVRLGLNEPLE  1707
               +FDV +ND D  + G +  ++AG +  + H  +     K       T +RLGL + LE
Sbjct  514   EVKFDVIVNDEDDKEIGGENTEFAGSYVSVLHVHDHGKNKKKKNNNIVTCLRLGLTDLLE  573

Query  1708  DLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             DL A+DDD+++VTL P+ G   V +  I+IE
Sbjct  574   DLKADDDDSIVVTLIPRYGN--VKISGIKIE  602



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   433 bits (1114),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 238/510 (47%), Positives = 311/510 (61%), Gaps = 31/510 (6%)
 Frame = +1

Query  343   PNVSKCHYPS-DVPANADITG---TCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             P+++ C  P  ++P +  I     +CCPP  +D ++D++ PT   +R R  AQ    +Y 
Sbjct  100   PDLTSCVVPPIELPDDMKIINPPLSCCPPFSSD-IIDFKFPTFKKLRVRPAAQLVNDDYF  158

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  AL  M+ L    P SF QQANIHCAYC GGY Q G+   E+QVHNSWLF PFHRW
Sbjct  159   AKYNKALELMRALPNDDPRSFYQQANIHCAYCVGGYTQKGY-DAELQVHNSWLFLPFHRW  217

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILG LINDPTFA+P+WNWD   GM +P++F +  SSLYD  RNP++ PP IVD
Sbjct  218   YLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSSLYDPRRNPSHQPPTIVD  277

Query  871   LNYAGKD----RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
             LNY   +       S EE I  NL  +++ M++N  T   F+G  Y  G  P  G GS+E
Sbjct  278   LNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTNRQFLGSPYRGGDTPFKGAGSLE  337

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFT  1215
              IPHTP+H W GD   QP+GEDMG+FY+AGRDPLFY+HHANVDRMW +W+ L    KDFT
Sbjct  338   NIPHTPIHIWTGDP-RQPHGEDMGHFYAAGRDPLFYAHHANVDRMWSVWKTLGKKRKDFT  396

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskpspsk  1371
             D  WL + FLFYDEN+  V+V  KD  ++  +GY Y+        Y S P  + K     
Sbjct  397   DPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIKYKSKPSRRVKSKDKN  456

Query  1372  TTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQY  1551
              + A   S    + D FP+ LD +V + V RPK SR   EKE EEE+LVIDGIE      
Sbjct  457   KSSAQRPSKK--LVDKFPIVLDSIVSIIVKRPKKSRNSKEKEDEEEILVIDGIEYDNKTE  514

Query  1552  ARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK-------TSVRLGLNEPLED  1710
              +FDV +ND D    G +  ++AG +  + H  +     K       T +RLGL + LED
Sbjct  515   VKFDVIVNDEDDKVIGGENTEFAGTYVSVLHVHDHGKNKKKKNNNIVTCLRLGLTDLLED  574

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             L A+DDD+++VTL P+   G+V +  I+IE
Sbjct  575   LKADDDDSIVVTLIPRY--GLVKISGIKIE  602



>sp|Q6UIL3.1|LAHY_LARTR RecName: Full=(+)-larreatricin hydroxylase, chloroplastic; AltName: 
Full=Polyphenol oxidase; Flags: Precursor [Larrea tridentata]
 gb|AAQ67412.1| (+)-larreatricin hydroxylase [Larrea tridentata]
Length=584

 Score =   432 bits (1112),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 259/571 (45%), Positives = 348/571 (61%), Gaps = 27/571 (5%)
 Frame = +1

Query  136   HKKRNQTRLR-VSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIAS  312
             H K ++  LR VSCKA+N N    +      S  IDRRN+L+GLGGLYG +N+     ++
Sbjct  20    HTKPSRVSLRRVSCKASNDNKDKPNDQEKTFS--IDRRNMLIGLGGLYGASNVFP---SN  74

Query  313   AADVDVAIHYPNV-SKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPA  486
              + +   I  P +   CH P D+    ++   CCPP   D + D+Q+P+    +R R  A
Sbjct  75    QSTLAAPIQPPVLPDSCHPPEDLAEGVNVL--CCPPDVKDPI-DFQMPSNPSRLRIRPAA  131

Query  487   QFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
               A   YI KY+ AL AMK L  + P SF QQANIHCAYCNG Y Q GFP   IQVH+SW
Sbjct  132   HLADPTYIEKYKKALAAMKALPQNDPRSFYQQANIHCAYCNGAYDQVGFPDVNIQVHHSW  191

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             LF PFHRWYLYFYE+ILG LI+DPTFA+P+WNWD   GM MP+MF+   S LYDA RNP 
Sbjct  192   LFLPFHRWYLYFYERILGSLIDDPTFAIPFWNWDAPKGMHMPHMFIDPNSPLYDAKRNPA  251

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT-PPSPG  1023
             + P  IVDL+++  +    +   I  NL  +Y+ +V       LF G+    G+ P   G
Sbjct  252   HFPDTIVDLDFSSGEAPSHNPRQIGNNLSIMYKQVV-RAKKARLFHGRPLQAGSFPDESG  310

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              GS+EG PH  +H W GD   Q N E+MGNFYSAGRDPLFY+HHANVDRMW IW+  LG 
Sbjct  311   DGSLEGTPHGNIHLWSGDP-RQSNFENMGNFYSAGRDPLFYAHHANVDRMWYIWKNSLGR  369

Query  1204  KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----Ysslpwlkskpsps  1368
             KD+    WLNA FL +DEN QPVRVY +D +D   +GY Y+     + +      K +P 
Sbjct  370   KDYKKKDWLNAGFLLFDENAQPVRVYVRDALDERKLGYAYQEVDIPWINSKPKPRKANPW  429

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
                  + A+    + + FP+TLD  V  +V RPK SR+K+EKE EEEVLVI+ I+     
Sbjct  430   PNRLRSKATTTTKLINKFPLTLDSTVSFEVKRPKKSRSKSEKEDEEEVLVIEKIKHEPQF  489

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPH------KQESSSTTKTSVRLGLNEPLED  1710
               +FDVY+ND D+     D+ ++AG F ++PH      K++   TT  S+  G++E L++
Sbjct  490   PLKFDVYINDEDEDPSAADQTEFAGSFVNVPHFHRHGDKKDKRQTTNLSI--GISEVLDE  547

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             L  + DD+++VTL P+VG G + +   +IE+
Sbjct  548   LDVDGDDSIVVTLVPRVGSGQITIGGAKIEF  578



>gb|ACJ04909.1| polyphenol oxidase [synthetic construct]
Length=600

 Score =   433 bits (1113),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 234/504 (46%), Positives = 317/504 (63%), Gaps = 20/504 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A ++YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADEKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               AL  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V+ G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWL  1230
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W K LGGK  DF D  WL
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVW-KTLGGKRNDFKDSDWL  396

Query  1231  NASFLFYDENEQPVRVYAK----------DCMDNIAMGYDYEYsslpwlkskpspskTTG  1380
             N+ F FYDEN Q V V  K              N+ + +     S              G
Sbjct  397   NSEFTFYDENAQLVTVKVKREFGSSKNSATSTQNVEIPWLNARPSPRISNFFRKIKNRAG  456

Query  1381  AAAASNA-PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYAR  1557
              A A+        VFP  LD+VV+V V RP  SR++ EKE+EE V+V++GIE+  D   +
Sbjct  457   IAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEGVVVVEGIEMERDVSVK  516

Query  1558  FDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTV  1737
             FDV++ND D+   G +K ++AG F ++P K +     +TS+RLG+ E LEDL AEDD++V
Sbjct  517   FDVFINDDDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTSLRLGITELLEDLEAEDDESV  576

Query  1738  LVTLAPQVGGGVVDVDSIRIEYST  1809
             LVTL P+ G   V +  ++IE+ +
Sbjct  577   LVTLVPRYGSDAVTIGGVKIEFDS  600



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   433 bits (1113),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 251/574 (44%), Positives = 332/574 (58%), Gaps = 32/574 (6%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPN-NSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             K R     +++C +N+ N NS  +    P  R   R  ++   G            +A  
Sbjct  39    KNRKPKHHKIACTSNDTNQNSPKEQEQKPSPR---RNVLIGLGGLYGATTLTNNNSLAFG  95

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
             A V +    P+++KC  P   P+ A +   CCPP   D ++D++ P+   +R R  AQ  
Sbjct  96    APVPI----PDLTKCVIP---PSGAPVPINCCPPFSKD-IIDFKYPSFEKLRVRPAAQLV  147

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
               +Y  KY  AL  M+ L    P SF QQA IHCAYC GGY+Q G+P  E+ VHNSWLF 
Sbjct  148   DDDYFAKYNKALELMRALPDDDPRSFSQQAKIHCAYCVGGYKQLGYPEIELSVHNSWLFL  207

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
              FHRWY+YFYE+ILG LINDPTFA+P+WN+D   GM +P++F +  SSLYD  R+  + P
Sbjct  208   AFHRWYIYFYERILGSLINDPTFAIPFWNFDAPDGMQIPSIFTNPNSSLYDLKRDSRHQP  267

Query  856   PAIVDLNY------AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS  1017
             P I+DLNY       G +   S E+ I +NL  +++ M+TN  T  LF G  Y  G  P 
Sbjct  268   PRIIDLNYNKDTEDPGPNYPPSAEQQIKDNLTLMHKQMITNSKTCILFHGSPYRAGQAPG  327

Query  1018  PGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL  1197
              G G++E  PH  VH W GD+  QP  EDMGNFYS+GRDPLFY+ HANVDR+W IW K L
Sbjct  328   KGHGALEMSPHNNVHIWSGDA-KQPYREDMGNFYSSGRDPLFYALHANVDRLWSIW-KTL  385

Query  1198  GG--KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss---lpwlkskps  1362
             GG  KD TDD WL + FLFYDEN+  V+V  KD +D   +GYDY+      +       S
Sbjct  386   GGKRKDPTDDDWLESEFLFYDENKNLVKVKVKDGLDGKKLGYDYQKVDIPWINSKPKPAS  445

Query  1363  pskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAM  1542
                 +     +   FV D FP+ LD VV   V RPK SR+  EKE EEE+LVIDGIE   
Sbjct  446   RRVQSKGKLLTPRKFV-DKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEILVIDGIEFDS  504

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHL--PHKQESSSTTK----TSVRLGLNEPL  1704
             +   +FDV +ND D    G    ++AG F +L   H  E+S+  K    T +RLGL + L
Sbjct  505   NIEVKFDVIVNDEDDKVIGVGNTEFAGTFVNLLHGHNHENSTNKKKNIVTCMRLGLTDLL  564

Query  1705  EDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
             EDL A+DDD++LVT  P+ GG  V +  I+IE++
Sbjct  565   EDLKADDDDSILVTFIPRYGGDSVKISGIKIEFA  598



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   431 bits (1107),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 239/506 (47%), Positives = 318/506 (63%), Gaps = 26/506 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++KC   +D P+ A +   CCPP  +  ++D++ P+   +R R  A    + YI KY 
Sbjct  42    PDLAKCG-AADFPSGA-VPINCCPPT-SQKIVDFKFPSPTKLRVRPAAHTVDKAYIEKYS  98

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQA++HCAYC+G Y Q GFP  E+Q+H  WLFFPFHR+Y YF
Sbjct  99    KAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQCWLFFPFHRYYXYF  158

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
              E+IL KLI+DPTFALP+WNWD  +GM +P +F +  S LYD  R  ++ PP ++DL++ 
Sbjct  159   XERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRAASHQPPTLIDLDFN  218

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S++  I  NL  +YR MV+N     LF G  Y  GT P PG GS+E  PH PVH
Sbjct  219   GTDETMSNDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGGGSIETTPHGPVH  278

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNA  1236
              W GD+  QPN EDMGNFYSAGRDP+F+SHH+N+DRMW IW K +G K  D  D  WL+ 
Sbjct  279   LWTGDNT-QPNFEDMGNFYSAGRDPIFFSHHSNIDRMWNIW-KSIGTKNXDINDKDWLDT  336

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskT-------------T  1377
              FLFYDEN + VRV  +D +DN  +GY YE   +PWLKS+P+P +T              
Sbjct  337   GFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPTPRRTKLARKAKAAGVAKA  396

Query  1378  GAAAASNAPFVTDVFPVTLD-KVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
                 +S        FP+ L+ K+  V        R+K EKE EEE+LVI GIE+  D   
Sbjct  397   XETTSSGKVVAGKDFPINLETKISTVVSRPKPKKRSKKEKEDEEEILVIQGIELDKDVAV  456

Query  1555  RFDVYLNDSDQPDG---GKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             +FDVY+ND D  D    G DK+++AG F  +PHKQ+  S  K+ +RLGL + LEDLGAED
Sbjct  457   KFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS--KSCLRLGLTDLLEDLGAED  514

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             D++V+VTL P+ G   V + SI+IE+
Sbjct  515   DESVVVTLVPRYGAQAVKIGSIKIEF  540



>gb|ADY18412.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=584

 Score =   432 bits (1110),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 259/564 (46%), Positives = 341/564 (60%), Gaps = 27/564 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H+ R+Q+  +VSC ANN      +  A      IDRRNVLLGLGGLYG ANL     A  
Sbjct  33    HRSRSQS-FKVSCNANNVGEHDKNLDA------IDRRNVLLGLGGLYGAANL-----APL  80

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             A     I  P+   C   + +  N ++  +CCPP P   D+V  Y+ P    +R R PA 
Sbjct  81    AASAAPIPSPDPKSCS-KAHIKPNKEVPYSCCPPPPQDIDSVPYYKFPPMTKLRIRPPAH  139

Query  490   FATQEYINKYEAALTAMKNLD--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
                +EYI KY+ A + M+ LD  P  P  F QQANIHC+YC G Y+  G   + +QVH+S
Sbjct  140   AVDEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCSYCCGAYKVGG---KVLQVHSS  196

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRW+LYFYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  197   WLFFPFHRWFLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDHEGSSLYDEKRNQ  256

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I++L ++ K+   ++ + +  NL  +YR MVTN     LF G  Y  GT P PG
Sbjct  257   NHRNGKIINLGFSCKETQTTELQTMTNNLTLMYRQMVTNAPCPLLFFGNPYPLGTDPKPG  316

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              G++E IPH  VH W GD   QPNGE MG FYSAG DP+FYSHHANVDRMW  W K +GG
Sbjct  317   MGTIENIPHNAVHNWTGDQPRQPNGEHMGTFYSAGLDPVFYSHHANVDRMWNEW-KAIGG  375

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D  D  WLN+ F FYDEN  P +V  +DC+D+  MG+DY     PW   KP    T+
Sbjct  376   KRRDLADKDWLNSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKTTS  435

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G A   + P  + VFP+  LD+ +   ++R  +SRT+AEK ++EE+L  + ++    Q  
Sbjct  436   GKANIGSIPPASKVFPIAKLDRAISFSINRSASSRTQAEKNEQEEILTFNKVQYDDSQCV  495

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DK ++AG +  LPH    ++T  TSV  +L + E LED+G ED
Sbjct  496   RFDVFLNVDKTVNADELDKPEFAGSYTSLPHVHGDNNTHVTSVTFKLVITELLEDIGLED  555

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRI  1797
             +DT+ VTL P+ GG  + +++  I
Sbjct  556   EDTIAVTLVPKEGGEGISIENAEI  579



>ref|XP_004972211.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Setaria italica]
Length=594

 Score =   432 bits (1111),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 236/513 (46%), Positives = 313/513 (61%), Gaps = 27/513 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP--TGGPMRKRVPAQFATQEY  507
             +  P++S C  P+D+P  A++  TCCPP      +D+  P     P+R+R  A   T +Y
Sbjct  82    VATPDISTCG-PADLPPGANVV-TCCPPPSAALPVDFTPPDAASSPLRRRPAAHSVTADY  139

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + +  A + AMK L    P SF  QA++HCAYC+G Y   GFP  E+QVHNSWLFFPFHR
Sbjct  140   VARLNAGIAAMKALPAGDPRSFAAQASVHCAYCDGSYSPNGFPRVELQVHNSWLFFPFHR  199

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILG LI DP+FA+P+WNWD   GM MP M+   +S L+D  R+  + PP ++
Sbjct  200   CYLYFFERILGSLIGDPSFAIPFWNWDAPDGMRMPAMYADQSSQLFDPRRDGRHAPPKLI  259

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y G +R  +D + I  NL  +YR MV+   T  LF G  Y  G  P+ G G VE IP
Sbjct  260   DLDYNGSERRFTDNQQIDRNLRVMYRQMVSLSPTPSLFFGGAYRAGDDPNQGPGPVENIP  319

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK----DFT  1215
             H PVH W GD   QP+ EDMGNFYSAG DPLFY+HHAN+DRMW +W+ L   +    D  
Sbjct  320   HGPVHIWCGDP-SQPSREDMGNFYSAGSDPLFYAHHANIDRMWTVWKGLDDVRRRRTDLA  378

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------Ysslpwlkskpsp  1365
             D  WL+ASFLFYDE  + VR+  +D +D  A+GY Y+           +      ++ + 
Sbjct  379   DPDWLDASFLFYDETPKLVRIRVRDVLDTGALGYQYQDVPMPWRAARPTVTAAAATRRAD  438

Query  1366  skTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAM  1542
             S  T AA A++A      FPVTLD+ + V V RP  + R++AEK  EEEVLV+DGIEV  
Sbjct  439   SLLTPAAQAASAAKKARKFPVTLDEAMSVTVKRPVAARRSEAEKASEEEVLVVDGIEVDR  498

Query  1543  DQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ-------ESSSTTKTSVRLGLNEP  1701
             D  A+FDV++N  D    G    + AG F ++PH+        +     KT++RL LNE 
Sbjct  499   DVAAKFDVFVNAEDHGAVGSGGRELAGSFVNVPHRHAHGHGRGKKGGGIKTTLRLALNEQ  558

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             LEDL AEDD++V VTL P+ G G V V S+RIE
Sbjct  559   LEDLEAEDDESVEVTLVPRQGRGKVKVGSVRIE  591



>gb|AFH00996.1| polyphenol oxidase II [Pyrus x bretschneideri]
 gb|AFH00997.1| polyphenol oxidase II [Pyrus x bretschneideri]
Length=600

 Score =   432 bits (1111),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 262/563 (47%), Positives = 338/563 (60%), Gaps = 24/563 (4%)
 Frame = +1

Query  157   RLRVSCKANNPNNSTDDAAASPGSRII---DRRnvllglgglygvanlaggPIASAADVD  327
             R  +SCKA NPNN+         S ++   DRRNVLLGLGGLYG   LA  P+A AA   
Sbjct  50    RSSISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLAQKPLAFAA---  106

Query  328   VAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
               +  P+++KC   +++    + T  CCPPV T  +  +      P+R R  A   T EY
Sbjct  107   -PLAPPDLTKCTL-AEITTGGE-TVACCPPVSTK-IKAFTPDRSIPLRTRPAAHLVTDEY  162

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + K++ A   M+ L    P S  QQAN+HCAYCNG Y Q GFP  +IQVH SWLFFPFHR
Sbjct  163   LAKFKNAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYFYE+ILGKLI+DPTFALPYWNWD+  G  +P+++  TTS LYD  RN  + PP +V
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTTSPLYDQYRNAGHQPPVLV  282

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG-TPPSPGQGSVEGI  1044
             DL+Y G D  + ++  I ENL  +YR MV+   T +LF G +Y  G T      G++E  
Sbjct  283   DLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGTYAGTIENN  342

Query  1045  PHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGKDFT--D  1218
             PH  +H W GD  DQPN EDMGNFYS+GRDPLFY+HH NVDRMW IW K LGGK      
Sbjct  343   PHNNIHLWCGDP-DQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIW-KTLGGKRKVPYR  400

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASN  1398
               WL+A FLFYDEN + V    +   D+I    D  Y+  P          T        
Sbjct  401   HRWLDAEFLFYDENAELVSCKVR---DSIHPAKDLRYTYEPVSVPCLFSKPTARKPRNKT  457

Query  1399  APFVTDV-----FPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARF  1560
                V+D      FP T D    V+V+RPK   RTK EK  EEEVL+I  IE   ++  +F
Sbjct  458   KARVSDTQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKF  517

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVL  1740
             DV++ND  +    KDK+++AG F H+PHKQ++ + TKT+++LG+ + LEDLG E+D  VL
Sbjct  518   DVFINDDAESLSRKDKSEFAGSFVHVPHKQKTGTKTKTNLKLGITDLLEDLGVEEDSCVL  577

Query  1741  VTLAPQVGGGVVDVDSIRIEYST  1809
             VTL P+V    + V   +IEYS+
Sbjct  578   VTLVPRVSNSPITVGGFKIEYSS  600



>gb|ABR57235.1| polyphenol oxidase [Camellia sinensis]
Length=598

 Score =   432 bits (1110),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 232/502 (46%), Positives = 321/502 (64%), Gaps = 18/502 (4%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYINKY  519
             P++SKC   +D+PA+A  T  CCPP  T+ ++++++P     +R R  A  A Q+YI K+
Sbjct  102   PDLSKCGA-ADLPADAKPTN-CCPP-KTNKIIEFKLPPPSNILRVRPAAHLADQKYIAKF  158

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A+  MK+L    P SF QQ+NIHCAYC G Y Q GFP+ E+QVHNSWLFFPFHR+YLY
Sbjct  159   SKAVQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFYLY  218

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             F+EKILG L++DP FA+P+WNWD+ +GM +P M+    S LY+  R+  + PP ++DL+Y
Sbjct  219   FFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADINSPLYNRLRDAKHQPPTLIDLDY  278

Query  880   AGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
                D + + +E+    NL  +YR +V  G T  LF+G  Y  G  P PG GS+E IPH P
Sbjct  279   NLTDPKNVDEEKQKLRNLTIMYRQVVAGGKTPRLFLGSSYRAGDDPDPGAGSLENIPHGP  338

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDSWLN  1233
             VH W GD   QPN EDMGNFYSAGRDP+FY HHANVDR+W +W+ L G + DF D  WLN
Sbjct  339   VHIWCGDRT-QPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLEGKRNDFKDPDWLN  397

Query  1234  ASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTGAAAAS  1395
             + F FYDEN Q V V  K+ +D+  +GY Y+       ++ P  +      K    A  +
Sbjct  398   SEFTFYDENAQVVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRKIKNKAGRA  457

Query  1396  NAPFVTD----VFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFD  1563
              A    D    VFP  LD+VV+V V RP T   +  +E+EEEV+V++GIEV  D   +FD
Sbjct  458   MATETLDSAAIVFPRKLDEVVKVVVKRP-TKSRREREEEEEEVVVVEGIEVERDVSVKFD  516

Query  1564  VYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLV  1743
             V++ND D+   G +K ++AG F ++P K +     +T +RLG+ E LEDL AE+D++VLV
Sbjct  517   VFINDEDEAASGPEKTEFAGSFVNVPRKHKHDKKIRTGLRLGITELLEDLEAENDESVLV  576

Query  1744  TLAPQVGGGVVDVDSIRIEYST  1809
             TL P+ G   V +  ++IE+ +
Sbjct  577   TLVPRYGSDAVTIGGVKIEFDS  598



>ref|XP_011098121.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=585

 Score =   431 bits (1108),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 256/550 (47%), Positives = 326/550 (59%), Gaps = 28/550 (5%)
 Frame = +1

Query  133   AHKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIAS  312
             +H KR+  RLRVSC              +P  ++  R  +L   GGLY  ANL   P AS
Sbjct  29    SHAKRSN-RLRVSCADAQKKKEASRDVETPIGKVDRRNMLLGLGGGLYSAANLIPTPGAS  87

Query  313   AADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQF  492
             A      I  P + KC   +++     +   CCPP  ++ + DYQ+P    M+ R  A  
Sbjct  88    AN----PIKAPELDKCGVATNLNTGEKLDMNCCPPT-SENIADYQLPPVVQMKVRPSAHR  142

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
              + EYI KY  A+  MK L    P +F QQANIHCAYCNG Y Q G  T ++QVHNSWLF
Sbjct  143   VSPEYIFKYNMAIDRMKRLPKDDPRNFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLF  202

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHRWYLYFYE+I+GKLI DPTFALP+WNWDN  GMT+P MF+   S+LYD+ RN + L
Sbjct  203   FPFHRWYLYFYERIMGKLIGDPTFALPFWNWDNPKGMTIPPMFLDPKSALYDSKRNQDNL  262

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
               A++DL   G    L   ++++ NL  ++  MV    +   FMGK Y  G   +PG GS
Sbjct  263   -KAVLDLGMTGNKDPL---QVVSNNLTIMHTEMVRGNASVYDFMGKPYREGDKVNPGPGS  318

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---  1203
              E   HT VH +VGD   +P+GED+GNFYSAGRDPLFY HHANVDRMW +W+  L     
Sbjct  319   AERGSHTAVHVFVGDP-REPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWKYFLPSNKV  377

Query  1204  --KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
               +  TD  +LN SFLFYDEN Q VRV  KDC+DN+ MGYD+E            P +T 
Sbjct  378   PERTITDPDFLNTSFLFYDENAQLVRVTVKDCVDNLRMGYDFE-RIDLPWLDYRPPPQTA  436

Query  1378  GAAAA---SNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
             GA       +A     VFP+ LDK+V+V V  PKT +  A     +EVLVI+ I V   +
Sbjct  437   GAKVKRTRKSAENAETVFPLKLDKIVRVLV--PKTRKGVA-----DEVLVIEDITVDTTK  489

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDD  1728
             + +FDV++ND D      DKA YAG +A +PHK  + + T TS+RL L E  ED+   DD
Sbjct  490   FLKFDVFVNDEDDNVEELDKAAYAGTYAQVPHKTNNKTAT-TSIRLKLKELYEDMDVADD  548

Query  1729  DTVLVTLAPQ  1758
             DTVLVTL P+
Sbjct  549   DTVLVTLVPR  558



>ref|XP_002446944.1| hypothetical protein SORBIDRAFT_06g025570 [Sorghum bicolor]
 gb|EES11272.1| hypothetical protein SORBIDRAFT_06g025570 [Sorghum bicolor]
Length=566

 Score =   430 bits (1106),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 230/498 (46%), Positives = 313/498 (63%), Gaps = 19/498 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPAN-ADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             I  PN+S CH P D+P   +DI   CCPP     ++D+  P     R R  A    +EY+
Sbjct  78    IPAPNLSNCH-PPDLPDTVSDIN--CCPPGAGTAIVDFTPPPTVGRRVRPAAHLVDEEYV  134

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KYE A+  MK L    P SF QQ  +HCAYC+G + Q GFP  EIQ+HN WLFFP+HR 
Sbjct  135   AKYEKAVALMKELPDDDPRSFTQQWRVHCAYCDGAFDQVGFPDLEIQIHNCWLFFPWHRL  194

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKLI D  FALP+WNWD   GM++P ++ + +S LYD  R+P + PP  VD
Sbjct  195   YLYFHERILGKLIGDDKFALPFWNWDAPGGMSLPAIYANKSSPLYDERRDPAHQPPFTVD  254

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   ++ +   + I +NL+ +YR M++     ELF G  Y  G  P PG G+VE +PH
Sbjct  255   LDYDRIEQNIPRAQQIDQNLMIMYRQMISGAKKKELFFGLPYHQGDQPDPGAGTVESVPH  314

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDSW  1227
              PVH W GD   QPN EDMGNFYSA RDPLF++HH N+DR+W +W  L  G  +FTD  W
Sbjct  315   GPVHFWSGDP-SQPNNEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGLRAGNTNFTDPDW  373

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             LNASFLFYDE  + VRV  +DC+D  A+GY Y+  +LPWL ++P+    +   AA     
Sbjct  374   LNASFLFYDEEARLVRVRVRDCLDTAALGYSYQDVALPWLNARPTTETGSPVPAAG----  429

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLNDS  1581
                  P TL++ V+V V+RP+TSRT+ EK+ EEEVLV++GIEVA    ++ +FDV++N+ 
Sbjct  430   ---ALPATLNQTVRVAVTRPRTSRTRQEKDAEEEVLVVEGIEVADHFSRFVKFDVFVNEC  486

Query  1582  D-QPDGGKDKAQYAGGFAHLPH---KQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
                   G   AQ AG  A  PH     +   + KT+ R G+ + L+++GA+ D T++V+L
Sbjct  487   QGGGGMGAAVAQCAGSVAMTPHLVRPGKGRGSVKTAARFGICDLLDNIGADGDKTIVVSL  546

Query  1750  APQVGGGVVDVDSIRIEY  1803
              P+  G +V V  +RIEY
Sbjct  547   VPRCAGDMVTVGGVRIEY  564



>gb|AHX26181.1| polyphenol oxidase [Sorghum bicolor]
Length=554

 Score =   430 bits (1105),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 230/498 (46%), Positives = 313/498 (63%), Gaps = 19/498 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPAN-ADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             I  PN+S CH P D+P   +DI   CCPP     ++D+  P     R R  A    +EY+
Sbjct  66    IPAPNLSNCH-PPDLPDTVSDIN--CCPPGAGTAIVDFTPPPTVGRRVRPAAHLVDEEYV  122

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KYE A+  MK L    P SF QQ  +HCAYC+G + Q GFP  EIQ+HN WLFFP+HR 
Sbjct  123   AKYEKAVALMKELPDDDPRSFTQQWRVHCAYCDGAFDQVGFPDLEIQIHNCWLFFPWHRL  182

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKLI D  FALP+WNWD   GM++P ++ + +S LYD  R+P + PP  VD
Sbjct  183   YLYFHERILGKLIGDDKFALPFWNWDAPGGMSLPAIYANKSSPLYDERRDPAHQPPFTVD  242

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   ++ +   + I +NL+ +YR M++     ELF G  Y  G  P PG G+VE +PH
Sbjct  243   LDYDRIEQNIPRAQQIDQNLMIMYRQMISGAKKKELFFGLPYHQGDQPDPGAGTVESVPH  302

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDSW  1227
              PVH W GD   QPN EDMGNFYSA RDPLF++HH N+DR+W +W  L  G  +FTD  W
Sbjct  303   GPVHFWSGDP-SQPNNEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGLRAGNTNFTDPDW  361

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             LNASFLFYDE  + VRV  +DC+D  A+GY Y+  +LPWL ++P+    +   AA     
Sbjct  362   LNASFLFYDEEARLVRVRVRDCLDTAALGYSYQDVALPWLNARPTTETGSPVPAAG----  417

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLNDS  1581
                  P TL++ V+V V+RP+TSRT+ EK+ EEEVLV++GIEVA    ++ +FDV++N+ 
Sbjct  418   ---ALPATLNQTVRVAVTRPRTSRTRQEKDAEEEVLVVEGIEVADHFSRFVKFDVFVNEC  474

Query  1582  D-QPDGGKDKAQYAGGFAHLPH---KQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
                   G   AQ AG  A  PH     +   + KT+ R G+ + L+++GA+ D T++V+L
Sbjct  475   QGGGGMGAAVAQCAGSVAMTPHLVRPGKGRGSVKTAARFGICDLLDNIGADGDKTIVVSL  534

Query  1750  APQVGGGVVDVDSIRIEY  1803
              P+  G +V V  +RIEY
Sbjct  535   VPRCAGDMVTVGGVRIEY  552



>gb|ACB12082.1| polyphenol oxidase [Triticum monococcum subsp. aegilopoides]
Length=577

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 221/504 (44%), Positives = 312/504 (62%), Gaps = 26/504 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++  C  P ++P N      CCP  P   + D+++P    P+R R  A      Y+
Sbjct  84    IQAPDLRNCQTP-ELP-NTPPDTNCCP-TPGTGITDFELPPASSPLRVRPAAHLVDAGYL  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              +YE A+  MK L    P SF QQ ++HCAYC+  Y Q GFP  E+Q+HN WLFFP+HR+
Sbjct  141   ARYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPWHRF  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKLI D TFALP+WNWD  +GMT+P ++ + +S LYD  R+P + PP +VD
Sbjct  201   YLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLVD  260

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+ +G D  +  ++ I ENL  +YR M++N   T LF+G+ Y  G  P PG GS+E +PH
Sbjct  261   LDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSLENVPH  320

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTDDSW  1227
               VH W GD   QPN  DMGNF+SA RDP+F++HH N+DR+W +W+ L     DFTD  W
Sbjct  321   GTVHVWTGDP-RQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVWRGLRPSNTDFTDPDW  379

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             L+A+FLFYDE  +PVRV  +DC+D  A+ Y Y+      +      ++   A+  + AP 
Sbjct  380   LDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQ-----DVGLPWLNARPAKASGGTPAPA  434

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLNDS  1581
              T   P TLD  ++V V+RP+ SR++ EK+ EEEVLV++GIE+A   +++ +FDV +N  
Sbjct  435   TTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIEIADHFNKFIKFDVLVN--  492

Query  1582  DQPDGGKD------KAQYAGGFAHLPHKQESSSTTKTSV----RLGLNEPLEDLGAEDDD  1731
              +P+GG D          AG FAH PH      T K SV    R G+ + ++D+GA+ D 
Sbjct  493   -EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTVARFGVCDLMDDIGADGDQ  551

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEY  1803
             TV+V+L P+ GG +V V  + I Y
Sbjct  552   TVVVSLVPRCGGELVTVGGVSISY  575



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   430 bits (1105),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 327/556 (59%), Gaps = 33/556 (6%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RVSCKA      TDD    P  R +      L              PI            
Sbjct  29    RVSCKA------TDDTQNPPTRRDVLIGLGGLYSATNLADRTAFAKPITP----------  72

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYINKY  519
             P+++KC    D+P N +    CC P+P   ++D++ P+   P+R R  A    ++Y+ KY
Sbjct  73    PDLTKCEL-VDLP-NPENPSNCCTPLPK-KIIDFRPPSPFSPLRTRRAAHLVDEDYVAKY  129

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A++ MK+L  + P +F QQAN+HCAYCNG Y+Q GFP  EI VH+ W FFP+HR+YLY
Sbjct  130   AEAISLMKSLPENDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFFFPWHRYYLY  189

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILGKLINDPTFALP+WNWD+ SGM MP +F    S LYD  R+ N+ PP ++DL+Y
Sbjct  190   FYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPILLDLDY  249

Query  880   -AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
              AG     +  +L + NL  +Y+ MV+      LF GK Y  G   SPG G++E  PH  
Sbjct  250   GAGDPNPTNANQLYSSNLTVMYKQMVSGAAKPTLFFGKSYRAGEDTSPGAGTIETTPHNN  309

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWL  1230
             +HRW GD   Q N EDMGNFYSA RDP+F+ HH+NVDRMW IW+ + GG  +D +D  WL
Sbjct  310   IHRWTGDPT-QENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIPGGTRRDISDPDWL  368

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPFV  1410
             N+ FLFY+EN + VR    DC+DN  + Y Y+ +            +  G  AA     +
Sbjct  369   NSEFLFYNENAELVRCKVSDCLDNTGLRYTYQ-NVEIPWLESKPIPRRLGKKAAETKTAL  427

Query  1411  TDV--FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSD  1584
             T +  FP+ LDK +   VSRPK SR++ EKE+E+EVLVI+GIE    ++ +FDV++ND  
Sbjct  428   TPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGKFVKFDVFINDDV  487

Query  1585  QPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ--  1758
             +     +  ++AG F ++ HK    S  KT + LG+ E LEDL ++ DD+++V L P+  
Sbjct  488   EMPSKPENTEFAGSFVNVSHKHAKKS--KTRLILGITELLEDLESDGDDSIVVALVPRSN  545

Query  1759  -VGGGVVDVDSIRIEY  1803
              V   VV +  ++IE+
Sbjct  546   SVSDPVV-ISGVKIEF  560



>gb|ABK62804.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 243/564 (43%), Positives = 339/564 (60%), Gaps = 36/564 (6%)
 Frame = +1

Query  145   RNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADV  324
             R   RL +SC+A              G R +DRR VLLGLGG             + A  
Sbjct  37    RQPRRLSISCEAT-------------GGRRVDRREVLLGLGGAAAAGLATDQGRGAIA--  81

Query  325   DVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQ  501
                I  P++S C  P+ +P N      CCP  P   + D+++P    P+R R  A     
Sbjct  82    -APIQAPDLSNCQTPA-LP-NTPPDTNCCP-TPGTGITDFELPPASSPLRVRPAAHLVDA  137

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
             EY+ KYE A+  MK L    P SF QQ ++HCAYC+  Y Q GFP  E+Q+HN WLFFP+
Sbjct  138   EYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPW  197

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+E+ILGKLI D TFALP+WNWD  +GM +P ++ + +S LYD  R+P + PP 
Sbjct  198   HRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMKLPVIYANRSSPLYDERRDPAHQPPV  257

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             +VDL+Y+G D  +  ++ I ENL  +YR M++N   T LF+G+ Y  G  P PG GSVE 
Sbjct  258   LVDLDYSGTDANIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSVEN  317

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTD  1218
             +PH PVH W GD   QPNGEDMGNFYSA RDP+F++HH N+DR+W +W+ L     DFTD
Sbjct  318   VPHGPVHNWTGDP-RQPNGEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRPSNTDFTD  376

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASN  1398
               WL+A FLFYDE  +PVRV  +DC+D  A+ Y Y+      +      ++   A+  + 
Sbjct  377   PDWLDAGFLFYDEEARPVRVRVRDCLDPAALRYTYQ-----DVGLPWLNARPAKASGGTP  431

Query  1399  APFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYL  1572
             AP  T   P TLD+ ++V V+RP+ SR++ EK++EEEVLV++GIE+A   +++ +FDV +
Sbjct  432   APATTGTLPATLDRTIRVTVTRPRVSRSRREKDEEEEVLVVEGIEIADHFNKFVKFDVLV  491

Query  1573  NDSDQPDGGKDKAQ---YAGGFAHLPH----KQESSSTTKTSVRLGLNEPLEDLGAEDDD  1731
             N+ +   GG         AG FAH PH    ++      KT  R G+ + ++D+GA+ D 
Sbjct  492   NEPEGGVGGTPATATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGADGDQ  551

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEY  1803
             TV+V+L P+ GG +V +  + I Y
Sbjct  552   TVVVSLVPRCGGDLVTIGGVSISY  575



>gb|ABX09994.1| chloroplast polyphenol oxidase [Taraxacum officinale]
Length=599

 Score =   430 bits (1106),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 253/506 (50%), Positives = 340/506 (67%), Gaps = 21/506 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQFATQEYI  510
             I  P++++C  P+D+PA   +T  CCPP  T  + D+++P     +R R  A    ++YI
Sbjct  97    IMAPDLTQCG-PADIPAGGIVT-DCCPPF-TTKIQDFKLPPPSNTLRIRPAAHLVDKDYI  153

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
             +K+  A+  MK L    P SF QQA +HCAYC+G Y+Q G+P  ++QVHNSWLFFPFHR 
Sbjct  154   DKFNKAIGLMKALPDDDPRSFKQQAVVHCAYCDGAYEQVGYPGLDLQVHNSWLFFPFHRC  213

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+EKI GKLINDPTFA+P+WNWD   GMT+P+++ ++ S LYD  R+  + PP++VD
Sbjct  214   YLYFFEKICGKLINDPTFAIPFWNWDAADGMTIPDIYTNSKSPLYDTLRDAKHQPPSVVD  273

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y G D  LS  E  + NL  +YR MV++  T  LFMG  Y  G  P+PG G++E IPH
Sbjct  274   LDYNGVDENLSPSEQTSTNLTIMYRQMVSSAKTASLFMGSPYRAGDEPNPGGGTLENIPH  333

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDS  1224
              PVH W GD  +QPNGE+MGNFYSAG+DP+FY+HHANVDRMW IW K LGG  KDFTD  
Sbjct  334   GPVHIWTGDR-NQPNGENMGNFYSAGKDPIFYAHHANVDRMWSIW-KTLGGRRKDFTDSD  391

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------YsslpwlkskpspskTTG--  1380
             WL++SF FYDEN + VRV  +DC+D+  +GY YE        + P  K   S  K  G  
Sbjct  392   WLDSSFSFYDENAEFVRVKVRDCLDSKKLGYAYEDVKIPWLKTKPRSKYGKSRRKAVGHK  451

Query  1381  ---AAAASNAPFVTDVFPVTLDKV-VQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
                A A    PF  DVFP +LDKV ++V V RPK SR+K +K++EEEVLV++GIEV  ++
Sbjct  452   HAVARADELIPFAKDVFPASLDKVMIKVLVPRPKKSRSKKQKDEEEEVLVVEGIEVKRNE  511

Query  1549  YARFDVYLNDSD-QPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             + +FDV+++D D +     DK ++AG F ++PH  +      T +RLG++E L+DLGA+D
Sbjct  512   FVKFDVFVDDDDDEVRATADKTEFAGSFVNVPHVHKHEKNVTTRLRLGISELLDDLGADD  571

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             DD VLVTL P+  GG V +  I+IEY
Sbjct  572   DDNVLVTLVPKTEGGEVSIGMIKIEY  597



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   429 bits (1102),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 326/556 (59%), Gaps = 33/556 (6%)
 Frame = +1

Query  163   RVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADVDVAIHY  342
             RVSCKA      TDD    P  R +      L              PI            
Sbjct  29    RVSCKA------TDDTQNPPTRRDVLIGLGGLYSATNLADRTAFAKPITP----------  72

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYINKY  519
             P+++KC    D+P N +    CC P+P   ++D++ P+   P+R R  A    ++Y+ KY
Sbjct  73    PDLTKCEL-VDLP-NPENPSNCCTPLPK-KIIDFRPPSPFSPLRTRRAAHLVDEDYVAKY  129

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
               A++ MK+L    P +F QQAN+HCAYCNG Y+Q GFP  EI VH+ W FFP+HR+YLY
Sbjct  130   AEAISLMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFFFPWHRYYLY  189

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILGKLINDPTFALP+WNWD+ SGM MP +F    S LYD  R+ N+ PP ++DL+Y
Sbjct  190   FYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPILLDLDY  249

Query  880   -AGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTP  1056
              AG     +  +L + NL  +Y+ MV+      LF GK Y  G   SPG G++E  PH  
Sbjct  250   GAGYPNPTNANQLYSSNLTVMYKQMVSGAAKPTLFFGKSYRAGEDTSPGAGTIETTPHNN  309

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWL  1230
             +HRW GD   Q N EDMGNFYSA RDP+F+ HH+NVDRMW IW+ + GG  +D +D  WL
Sbjct  310   IHRWTGDPT-QENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIPGGTRRDISDPDWL  368

Query  1231  NASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPFV  1410
             N+ FLFY+EN + VR    DC+DN  + Y Y+ +            +  G  AA     +
Sbjct  369   NSEFLFYNENAELVRCKVSDCLDNTGLRYTYQ-NVEIPWLESKPIPRRLGKKAAETKTAL  427

Query  1411  TDV--FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSD  1584
             T +  FP+ LDK +   VSRPK SR++ EKE+E+EVLVI+GIE    ++ +FDV++ND  
Sbjct  428   TPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGKFVKFDVFINDDV  487

Query  1585  QPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ--  1758
             +     +  ++AG F ++ HK    S  KT + LG+ E LEDL ++ DD+++V L P+  
Sbjct  488   EMPSKPENTEFAGSFVNVSHKHAKKS--KTRLILGITELLEDLESDGDDSIVVALVPRSN  545

Query  1759  -VGGGVVDVDSIRIEY  1803
              V   VV +  ++IE+
Sbjct  546   SVSDPVV-ISGVKIEF  560



>gb|ACB12081.1| polyphenol oxidase [Triticum urartu]
Length=577

 Score =   429 bits (1103),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 241/567 (43%), Positives = 333/567 (59%), Gaps = 42/567 (7%)
 Frame = +1

Query  145   RNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADV  324
             R   RL VSC+A              G R +DRR VLLGLGG             + A  
Sbjct  37    RQPRRLPVSCEAT-------------GGRRVDRREVLLGLGGAAAAGLATDKGRGAIA--  81

Query  325   DVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQ  501
                I  P++  C  P ++P N      CCP  P   + D+ +P    P+R R  A     
Sbjct  82    -APIQAPDLRNCQTP-ELP-NTPPDTNCCP-TPGTGITDFVLPPASSPLRVRPAAHLVDA  137

Query  502   EYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPF  681
              Y+ KYE A+  MK L    P SF QQ ++HCAYC+  Y Q GFP  E+Q+HN WLFFP+
Sbjct  138   GYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPW  197

Query  682   HRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPA  861
             HR+YLYF+E+ILGKLI D TFALP+WNWD  +GMT+P ++   +S LYD  R+P + PP 
Sbjct  198   HRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRSSPLYDERRDPAHQPPV  257

Query  862   IVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
             +VDL+ +G D  +  ++ I ENL  +YR M++N   T LF+G+ Y  G  P PG GS+E 
Sbjct  258   LVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSLEN  317

Query  1042  IPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTD  1218
             +PH  VH W GD   QPN  DMGNF+SA RDP+F++HH N+DR+W +W+ L     DFTD
Sbjct  318   VPHGTVHVWTGDP-RQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVWRGLRPSNTDFTD  376

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASN  1398
               WL+A+FLFYDE  +PVRV  +DC+D  A+ Y Y+      +      ++   A+  + 
Sbjct  377   PDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQ-----DVGLPWLNARPAKASGGTP  431

Query  1399  APFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYL  1572
             AP  T   P TLD  ++V V+RP+ SR++ EK+ EEEVLV++GI++A   +++ +FDV +
Sbjct  432   APATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIKIADHFNKFIKFDVLV  491

Query  1573  NDSDQPDGGKD------KAQYAGGFAHLPHKQESSSTTKTSV----RLGLNEPLEDLGAE  1722
             N   +P+GG D          AG FAH PH      T K SV    R G+ + ++D+GA+
Sbjct  492   N---EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTVARFGVCDLMDDIGAD  548

Query  1723  DDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
              D TV+V+L P+ GG +V V  + I Y
Sbjct  549   GDQTVVVSLVPRCGGELVTVGGVSISY  575



>gb|EYU34165.1| hypothetical protein MIMGU_mgv1a003246mg [Erythranthe guttata]
Length=597

 Score =   430 bits (1105),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 259/568 (46%), Positives = 347/568 (61%), Gaps = 26/568 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H K       VSC ++ P N  D+    P ++++DRRN+L+G+GGLYG   LA  P A+A
Sbjct  38    HAKLTNRLHHVSC-SSTPQNQNDETK-KPTAKVVDRRNMLVGMGGLYGATTLASTPSAAA  95

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
                   I  P ++KC   +++     +   CCPP+ +D ++DY++P    M+ R  A   
Sbjct  96    N----PIQAPELNKCGTATNLNNGEKLDINCCPPI-SDRIIDYKLPPVFQMKIRPSAHRV  150

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
             + EY+ K+  A+  MK L    P +F QQANIHCAYCNG Y Q G  T ++Q+HNSWLFF
Sbjct  151   SPEYMFKFNTAIDRMKRLPKDDPRNFMQQANIHCAYCNGAYDQPGQGTLDLQIHNSWLFF  210

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHRWYLYFYE+ILGKLI DPTFALP+WNWDN  GMTMP MF+   SSLYD  RN  +LP
Sbjct  211   PFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTMPPMFVDPKSSLYDKKRNQEHLP  270

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPS-PGQGS  1032
             PA+VDL        L   +++A NL  +Y  M+        FMG+ Y  G   S    GS
Sbjct  271   PAVVDLGLTNSTDTL---QVVANNLTIMYSEMIRGNSDANDFMGQAYREGDESSAKAAGS  327

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---  1203
              E   HT VH WVGD  DQP+GEDMGNFYSAGRDPLFYSHHANVDRMW +WQ  L     
Sbjct  328   SERGSHTSVHAWVGDFKDQPSGEDMGNFYSAGRDPLFYSHHANVDRMWTLWQYFLPSNKV  387

Query  1204  --KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYss---lpwlkskpsps  1368
               K  TD  +LN +FLFYDEN Q VRV  KDC+DN+ MGYD+E      L +   + S  
Sbjct  388   PDKRITDTDFLNTAFLFYDENAQLVRVTVKDCLDNLRMGYDFERIDLPWLDYRPPRQSAR  447

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
                  A+++ AP    +FP+TLD VV+ +V   KT + KA++      LV++ I+V   +
Sbjct  448   AKINRASSTAAPKAAALFPLTLDGVVRFQVD--KTKKGKADES-----LVLEDIKVDTTK  500

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDD  1728
               +FDV++ND D   G  DKA Y G +A +PHK  +++++ +S++L L E  +D+  +DD
Sbjct  501   LLKFDVFVNDEDDNPGELDKAAYLGTYAQVPHKSANNNSSTSSIKLKLTELYDDMDIDDD  560

Query  1729  DTVLVTLAPQVGGGVVDVDSIRIEYSTR  1812
             DT++VTL P+  G V+ +   R+    R
Sbjct  561   DTIVVTLVPRHQGPVLPLVVSRLSRIHR  588



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   430 bits (1106),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 259/570 (45%), Positives = 348/570 (61%), Gaps = 27/570 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNS--TDDAAASPGSRIIDRRnvllglggl-ygvanlaggPIA  309
             +K      +VSCK    + +  T  ++ S  ++IIDRRN+LLGLGG+      + G P A
Sbjct  43    RKYGNHSFQVSCKGTEDDQTINTSKSSDSSNNKIIDRRNMLLGLGGIYGAATLVGGHPFA  102

Query  310   SAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPA  486
              AA V      P+VSKC  P+D+P  A     CCPP  T  ++D+Q+P     +R R  A
Sbjct  103   FAAPVP----GPDVSKCG-PADLPPGAAPV-NCCPPT-TANIIDFQLPPPSTTLRTRPAA  155

Query  487   QFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSW  666
               A   YI K+  A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+QVH SW
Sbjct  156   HSADSAYIEKFNRAIQLMKQLPDDDPRSFRQQANVHCAYCDGAYDQLGFPNSELQVHFSW  215

Query  667   LFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPN  846
             LF PFHR YLYF+EKILG LINDPTF +P+WNWD+  GM +P M+ + +SSL+D  R+  
Sbjct  216   LFLPFHRCYLYFFEKILGSLINDPTFVIPFWNWDHPDGMRLPAMYANRSSSLFDPLRDRR  275

Query  847   YLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ  1026
             + PP +VDL++ G D  +S+ +  ++NL  +YR MV+ G T   F+G  Y  G  P  G 
Sbjct  276   HQPPVMVDLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPATFLGDPYRAGGEPG-GA  334

Query  1027  GSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK  1206
             GS+E IPH PVH W GD   QPN E+MG+FYSA RDP+FY+HH+N+DR+W +W K LGG+
Sbjct  335   GSLENIPHGPVHVWTGDRT-QPNFENMGDFYSAARDPIFYAHHSNIDRLWSVW-KTLGGR  392

Query  1207  --DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------Ysslpwlks  1353
               DFTD  +LNASFLFYDE  Q VR+  +DC+D   +GY Y+                 +
Sbjct  393   RQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVANPWINSRPRARVSSA  452

Query  1354  kpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIE  1533
               S  +   A AA N P   DVFP  LD V++V V RP   R K EK+ +EE LV++GIE
Sbjct  453   LSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPIKKRNKKEKDAKEEFLVVEGIE  512

Query  1534  VAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLE  1707
             +  D + +FDV +ND D+     + A++AG F ++PH    +S    KT ++L + E LE
Sbjct  513   LETDVFVKFDVLINDEDETVISPNNAEFAGSFVNVPHHSHGKSDKKRKTKLKLAITELLE  572

Query  1708  DLGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             DL AEDDD V+VT  P+ G G V +  ++I
Sbjct  573   DLDAEDDDHVVVTFVPKNGSGAVKIGGVKI  602



>ref|XP_009616674.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=595

 Score =   429 bits (1104),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 270/574 (47%), Positives = 347/574 (60%), Gaps = 42/574 (7%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAAD  321
             KRNQ+  +VSC   +  N     A   G  ++DRRNVLLGLGGLYG ANL   P+ASAA 
Sbjct  36    KRNQS-FKVSCTGEHDGNLD---AIKEG--VVDRRNVLLGLGGLYGAANLV--PLASAAP  87

Query  322   VDVAIHYPNVSKCHYPS--DVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
             V      PN++ C   +  D PA   +  +CCPP P   D+V  Y+IP    +RKR  AQ
Sbjct  88    VPP----PNLNSCGTATITDGPA---VPYSCCPPKPDDMDSVPYYKIPRMSKLRKRPAAQ  140

Query  490   FATQEYINKYEAALTAMKNLDPSH--PHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
               T+EYI KY+ A + MK LD     P  F QQANIHCAYCN  Y       +++QVH S
Sbjct  141   NVTEEYIAKYQLATSKMKELDKDQLDPLGFKQQANIHCAYCNDAYT---MGDKKLQVHES  197

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFHRWYLYFYE+ILG LI+DPTFALPYWNWDN SGM +P MF    SSLYDA RNP
Sbjct  198   WLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPSGMRLPYMFDVEGSSLYDARRNP  257

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             +     I+DL + G +   ++ ++I  NL+ +YR M+TN     LF G+ Y  G+ P PG
Sbjct  258   HVRNGTIIDLGFFGDEVKTNELQMITNNLILMYRQMITNAPCPLLFFGEPYRFGSNPEPG  317

Query  1024  QGSVEGIPHTPVHRWVGD--SVDQPN-----GEDMGNFYSAGRDPLFYSHHANVDRMWVI  1182
              G++E IPH PVH W G     D  N     GEDMGNFYS   DP+F+ HHANVDR+W  
Sbjct  318   MGTIENIPHNPVHIWTGTVRGTDLGNGAKSYGEDMGNFYSTALDPVFFCHHANVDRLWNE  377

Query  1183  WQKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlksk  1356
             W K LGGK  D  D+ WLN+ F FYDEN  P RV  +DC+D+  MGYDYE ++ PW   K
Sbjct  378   W-KALGGKRRDLRDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPTATPWRNFK  436

Query  1357  pspskTTGAAAASNAPFVTDVFP-VTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIE  1533
             P    T G    S+    + VFP + LD+ +   + RP TSR++ EK++ EE+L   G++
Sbjct  437   PGKKSTAGKVNLSSVKPASKVFPLLNLDRAICFSIERPATSRSQQEKDEFEEILTFKGVK  496

Query  1534  VAMDQYARFDVYLNDSDQPDGGKD--KAQYAGGFAHLPHKQESSSTTK----TSVRLGLN  1695
                 +Y RFDV+LN +D+     D  K +YAG +  LPH    ++ T        +L + 
Sbjct  497   YDDSKYIRFDVFLN-ADKTVNADDINKREYAGSYTSLPHVHGPNNATHEFKPKEFKLAIT  555

Query  1696  EPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             E LED G ED+D + VT+ P+ GG VV + S+ I
Sbjct  556   ELLEDCGLEDEDIIAVTVVPKKGGEVVSIHSVEI  589



>gb|ACB12083.1| polyphenol oxidase [Triticum monococcum]
Length=577

 Score =   429 bits (1103),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 221/504 (44%), Positives = 312/504 (62%), Gaps = 26/504 (5%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYI  510
             I  P++  C  P ++P N      CCP  P   + D+++P    P+R R  A      Y+
Sbjct  84    IQAPDLRNCQTP-ELP-NTPPDTNCCP-TPGTGITDFELPPASSPLRVRPAAHLVDAGYL  140

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              +YE A+  MK L    P SF QQ ++HCAYC+  Y Q GFP  E+Q+HN WLFFP+HR+
Sbjct  141   ARYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPWHRF  200

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKLI D TFALP+WNWD  +GMT+P ++ + +S LYD  R+P + PP +VD
Sbjct  201   YLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPPVLVD  260

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+ +G D  +  ++ I ENL  +YR M++N   T LF+G+ Y  G  P PG GS+E +PH
Sbjct  261   LDSSGFDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSLENVPH  320

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTDDSW  1227
               VH W GD   QPN  DMGNF+SA RDP+F++HH N+DR+W +W+ L     DFTD  W
Sbjct  321   GTVHVWTGDP-RQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVWRGLRPSNTDFTDPDW  379

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             L+A+FLFYDE  +PVRV  +DC+D  A+ Y Y+      +      ++   A+  + AP 
Sbjct  380   LDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQ-----DVGLPWLNARPAKASGGTPAPA  434

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLNDS  1581
              T   P TLD  ++V V+RP+ SR++ EK+ EEEVLV++GIE+A   +++ +FDV +N  
Sbjct  435   TTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIEIADHFNKFIKFDVLVN--  492

Query  1582  DQPDGGKD------KAQYAGGFAHLPHKQESSSTTKTSV----RLGLNEPLEDLGAEDDD  1731
              +P+GG D          AG FAH PH      T K SV    R G+ + ++D+GA+ D 
Sbjct  493   -EPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTVARFGVCDLMDDIGADGDQ  551

Query  1732  TVLVTLAPQVGGGVVDVDSIRIEY  1803
             TV+V+L P+ GG +V V  + I Y
Sbjct  552   TVVVSLVPRCGGELVTVGGVSISY  575



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   430 bits (1105),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 238/506 (47%), Positives = 315/506 (62%), Gaps = 26/506 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++KC   +D P+ A +   CCPP  +  ++D++ P+   +R R  A    + YI KY 
Sbjct  110   PDLAKCG-GADFPSGA-VPXNCCPPT-SQKIVDFKFPSPTKLRVRPAAHTVDKAYIEKYS  166

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQA+ HCAYC+G Y Q GFP  E+Q+H  WLFFPFHR+Y YF
Sbjct  167   KAIELMKALPDDDPRSFTQQADJHCAYCDGAYDQVGFPNLELQIHQXWLFFPFHRYYXYF  226

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
              E+IL KLI+DPTFALP+WNWD  +GM +P +F +  S LYD  R  ++ PP ++DL++ 
Sbjct  227   XERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRAASHQPPTLIDLDFN  286

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S +  I  NL  +YR MV+N     LF G  Y  GT P PG GS+E  PH PVH
Sbjct  287   GTDETMSKDAQIDANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGAGSIETTPHGPVH  346

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNA  1236
              W GD+  QPN EDMGNFYSA RDP+F+SHH+N+DRMW IW K +G K  D  D  WL+ 
Sbjct  347   TWTGDNT-QPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIW-KSIGTKNXDINDKDWLDT  404

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskT-------------T  1377
              FLFYDEN + VRV  +D +DN  +GY YE   +PWLKS+P+P +T              
Sbjct  405   GFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPTPRRTKLARKAKAAGVAKA  464

Query  1378  GAAAASNAPFVTDVFPVTLD-KVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
                 +S        FP+ L+ K+  V        R+K EKE EEE+LVI GIE+  D   
Sbjct  465   AETTSSGKVVAGKDFPINLETKISTVVSRPKPKKRSKKEKEDEEEILVIQGIELDKDVAV  524

Query  1555  RFDVYLNDSDQPDG---GKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             +FDVY+ND D  D    G DK+++AG F  +PHKQ+  S  K+ +RLGL + LEDLGAED
Sbjct  525   KFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS--KSCLRLGLTDLLEDLGAED  582

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             D++V+VTL P+ G   V + SI+IE+
Sbjct  583   DESVVVTLVPRYGAQAVKIGSIKIEF  608



>ref|XP_008349220.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=610

 Score =   430 bits (1105),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 264/582 (45%), Positives = 348/582 (60%), Gaps = 40/582 (7%)
 Frame = +1

Query  145   RNQTRLRVSCKA--------NNPNNSTDDA-AASPGSRIIDRRnvllglggl-ygvanla  294
             R+     VSCKA         NP+ S++D    +P    +DRR VL+GLG L  GVA L 
Sbjct  38    RHSNLQAVSCKATNNSSDQNKNPSTSSNDHDHENPSPVNLDRRXVLIGLGSLYGGVAGLG  97

Query  295   ggPIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRK  474
               P A A  V      P+++KC   +D P+ A +   CCPP  +  ++D++ P+   +R 
Sbjct  98    SDPFAVAKPVSP----PDLAKCG-AADFPSGA-VPTNCCPPT-SQKIVDFKFPSPTKLRV  150

Query  475   RVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQV  654
             R  A    + YI KY  A+  MK L    P SF QQA++HCAYCNG Y Q GFP  E+Q+
Sbjct  151   RPAAHAVDKAYIEKYSKAIELMKALPDDDPRSFTQQADVHCAYCNGAYDQVGFPNLELQI  210

Query  655   HNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDAN  834
             H SWLFFPFHR+YLYF+E+IL KLI+DPTFALP+WNWD  +GM +P ++ +  S LYD  
Sbjct  211   HQSWLFFPFHRYYLYFHERILAKLIDDPTFALPFWNWDAPAGMQLPALYANPDSPLYDEL  270

Query  835   RNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP  1014
             R  ++ PP ++DL++ G D  +S +  I  NL  +YR MV+N     LF G  Y  GT P
Sbjct  271   RAASHQPPTLIDLDFNGTDETMSKDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGTEP  330

Query  1015  SPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
              PG G +E  PH PVH W GD+  QPN EDMGNFYS  RDP+F+ HH N DRMW IW K 
Sbjct  331   DPGXGXIEXTPHGPVHXWTGDNT-QPNXEDMGNFYSXARDPIFFXHHXNXDRMWNIW-KS  388

Query  1195  LGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpsps  1368
             +G K  D  D  WL+  FLFYDEN + VRV  +D +DN  +GY YE   +PWL S+P+P 
Sbjct  389   IGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPTPR  448

Query  1369  kT-------------TGAAAASNAPFVTDVFPVTLD-KVVQVKVSRPKTSRTKAekekee  1506
             +T                  +S        FP+ L+ K+  V        R+K EKE EE
Sbjct  449   RTKLARKAKAAGVAKAAETTSSGKVVAGKDFPINLETKIXTVVSRPKPKKRSKKEKEDEE  508

Query  1507  eVLVIDGIEVAMDQYARFDVYLNDSDQPDG---GKDKAQYAGGFAHLPHKQESSSTTKTS  1677
             E+LVI GIE+  D   +FDVY+ND D  D    G DK+++AG F  +PHKQ+  S  K+ 
Sbjct  509   EILVIXGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS--KSC  566

Query  1678  VRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             +RLGL + LEDLGAEDD++V+VTL P+ G   V + SI+IE+
Sbjct  567   LRLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEF  608



>gb|AES87890.2| polyphenoloxidase [Medicago truncatula]
Length=606

 Score =   429 bits (1104),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 236/513 (46%), Positives = 308/513 (60%), Gaps = 33/513 (6%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINKY  519
             P++SKC          DI   CCPP  T  ++DY+ P    P+R R  A     EY+ KY
Sbjct  97    PDLSKCRSSHISSGAIDID--CCPPKST-KIIDYKFPPLTQPLRVRQAAHLVNDEYLQKY  153

Query  520   EAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLY  699
             + A+  MK L  + P SF QQAN+HCAYC+G Y Q GFP  ++QVH SWLFFPFHRWYLY
Sbjct  154   KKAIELMKALPSNDPRSFMQQANVHCAYCDGAYSQVGFPNLDLQVHGSWLFFPFHRWYLY  213

Query  700   FYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNY  879
             FYE+ILG LINDPTFALP+WN+D  +GM  P+++   TS LYD  RN  + PP ++D NY
Sbjct  214   FYERILGSLINDPTFALPFWNYDAPNGMRFPSIYTDPTSPLYDKLRNAKHQPPTLIDFNY  273

Query  880   AGKDRGLSDEE--LIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHT  1053
                D    D E  +I  NL  +YR +V+ G  + LF+G  Y  G  P    GSVE +PH 
Sbjct  274   GHCDDIDEDGENNIIHTNLTIMYRQVVSRGKNSRLFLGYPYRAGGVPKCA-GSVEIVPHN  332

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSW  1227
              VH W GD+  QPN E+MG FYSA RDP+F+SHH+N+DR+W IW K LGG  KDF D  W
Sbjct  333   TVHNWSGDT-RQPNHENMGTFYSAARDPVFFSHHSNIDRLWSIW-KTLGGKRKDFYDKDW  390

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------------Ysslpwlkskpsp  1365
             L + FLFYDEN+  V+V  KDC+D   +GY Y+                    ++     
Sbjct  391   LESEFLFYDENKNLVKVNVKDCLDTQKLGYVYQDVFIPWLNAKPTPCKKIQKKVEVAQGN  450

Query  1366  skTTGAAAASN-----APFVTDV-FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDG  1527
             S  TG A  S           DV FP+ LD +V   V RPK SR+K EKE+EEEVLVI+G
Sbjct  451   SFGTGKARLSEINENLTNSRNDVKFPLVLDNIVSTIVRRPKKSRSKTEKEEEEEVLVIEG  510

Query  1528  IEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTS--VRLGLNEP  1701
             IE       +FDV++ND D  +      ++AG F ++PH        KT+  +R+GL + 
Sbjct  511   IEFDKSLGVKFDVFINDEDAKEIKPVNTEFAGSFVNVPHSSHDHKKKKTNSCLRVGLTDL  570

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             L+DLGAEDDD+++VTL P+   G+V + +I+IE
Sbjct  571   LKDLGAEDDDSIVVTLVPRYRKGLVKITNIKIE  603



>dbj|BAM15848.1| hypothetical protein [Portulaca oleracea]
Length=600

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 254/586 (43%), Positives = 355/586 (61%), Gaps = 45/586 (8%)
 Frame = +1

Query  145   RNQTRL---RVSCKAN-----NPNNSTDDAAASPGSRIIDRRnvllglggl-ygvanlag  297
             R QTR    ++SCKA      NP    +D   +  ++ +DRRN+L+GLGGL      L  
Sbjct  29    RCQTRHASPKISCKATKNDDENPRKIHEDKTIA--NKKLDRRNMLIGLGGLYGAATALGS  86

Query  298   gPIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRK  474
              P   AA     I  PN+++C  P+D+P +A     CCPPV    ++D+ +P T   ++ 
Sbjct  87    DPTTLAA----PITAPNIAQCG-PADLPQDAQGDHNCCPPV-AQNIIDFTLPPTPATLKV  140

Query  475   RVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQV  654
             R  A     EY+ K+  A++ MK L  + P SF QQA +HCAYC+GGY Q GFP  ++QV
Sbjct  141   RPAAHSVDNEYLQKFNRAISLMKALPDTDPRSFSQQAKVHCAYCDGGYNQVGFPNLDLQV  200

Query  655   HNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDAN  834
             H SWLF PFHR YLYF+E+ILG LINDPTFA+P+WNWDN +GM MP ++    S LYD+ 
Sbjct  201   HGSWLFLPFHRCYLYFFERILGNLINDPTFAMPFWNWDNPAGMQMPAIYADRNSPLYDSE  260

Query  835   RNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPP  1014
             R+  + PP +VDLN+ G+D  +S ++L   NL  +YR MV+N  T  LF+G+ Y  G  P
Sbjct  261   RDGPHQPPTLVDLNFDGEDTDMSTDDLTTANLTVMYRQMVSNAKTARLFLGQPYKAGGSP  320

Query  1015  SPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL  1194
               G GS+E +PH PVH W GD  +QPN EDMGNFYSA RDP+FY+HH+N+DRMW IW+ L
Sbjct  321   R-GGGSLENVPHGPVHIWTGDR-NQPNTEDMGNFYSAARDPIFYAHHSNIDRMWSIWKTL  378

Query  1195  LGGK-DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE---------------  1326
                + +FTD  WL+ASF+FYDEN Q V++  +DC+D   +GY Y+               
Sbjct  379   GANRVEFTDSDWLDASFVFYDENAQAVKIRVRDCLDTKKLGYTYQDVDLPWLNSQPTPKR  438

Query  1327  YsslpwlkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekee  1506
                            TT   + S +P     FP  LD  +++ + RPK SR+K EK+ +E
Sbjct  439   SRIATLFSKLKPAKATTHPPSTSTSPV---KFPKPLDSTLKIDIQRPKKSRSKKEKKLQE  495

Query  1507  eVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKD--KAQYAGGFAHLP---HKQESSSTTK  1671
             EVLV++    + D + +FDVY+ND D     K   K +YAG FA++P     ++     K
Sbjct  496   EVLVVEVELQS-DVFVKFDVYVNDEDDVPLKKTIVKTEYAGSFANVPHKHKHKKEHRKMK  554

Query  1672  TSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             T++RLGL + +EDLGA+DDD V+VTL P+ G  V  +  ++IE+++
Sbjct  555   TTLRLGLTDLIEDLGADDDDGVMVTLVPRSGKEVTIIKDVKIEFAS  600



>gb|ABM68052.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   428 bits (1101),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 235/511 (46%), Positives = 306/511 (60%), Gaps = 30/511 (6%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++KC  P   P  + ++ +CCPP   D ++D++ P+   +R R  AQ    +Y  KY+
Sbjct  101   PDLTKCVIP---PEKSPVSSSCCPPFSAD-IIDFKFPSFEKLRVRPAAQLVNDDYFRKYD  156

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              AL  M+ L    P SF QQANIHCAYC GGY Q G+P  E+ VH SWLF  FHRWY+YF
Sbjct  157   EALKLMRALPDDDPRSFFQQANIHCAYCVGGYTQKGYPGLELSVHKSWLFLAFHRWYIYF  216

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YE+ILG LINDPTFA+P+WNWD   GM +P++F +  SSLYD  R+P + PP I+DLNY+
Sbjct  217   YERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSSLYDPKRDPKHQPPTIIDLNYS  276

Query  883   GKDRGLSD-----------EELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQG  1029
                   +D           E+ I +NL  +Y+ M+TN  T   F G  Y  G  P PG G
Sbjct  277   KSKEDPTDPNYDPNFPPSAEQQIKDNLTLMYKQMITNSKTCIQFHGSPYRAGQAPDPGAG  336

Query  1030  SVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-  1206
              +E  PH  +H W GD  +Q N EDMG+FYS+GRDPLFY+ HANVDR+W IW K LGGK 
Sbjct  337   QLEINPHNHIHVWCGDP-NQKNREDMGHFYSSGRDPLFYALHANVDRLWSIW-KTLGGKR  394

Query  1207  -DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----Ysslpwlkskpsps  1368
              D TDD WL   FLFYDEN+  V+V  KD +D   +GY Y+     + +     S    S
Sbjct  395   KDPTDDDWLETEFLFYDENKNLVKVKVKDGLDGEKLGYVYQDRDLPWKNCKPEPSSRVKS  454

Query  1369  kTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQ  1548
             K        +  FV D FP+ LD VV   V RPK SR+  EKE EEE+LVIDGIE   + 
Sbjct  455   KGKLLTQRPSRKFV-DKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEILVIDGIEFDSNI  513

Query  1549  YARFDVYLNDSDQPDGGKDKAQYAGGFAHLPH-----KQESSSTTKTSVRLGLNEPLEDL  1713
               +FDV +ND D    G    ++AG F  L H       +    T T +RLGL + LEDL
Sbjct  514   EVKFDVIVNDEDDKVIGVGNTEFAGTFVSLLHGHNHENNKKKKNTVTCLRLGLTDLLEDL  573

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRIEYS  1806
              A+DDD+++VTL P+ GG  V +  I+IE++
Sbjct  574   KADDDDSIVVTLIPRYGGDGVKISGIKIEFA  604



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 258/561 (46%), Positives = 355/561 (63%), Gaps = 19/561 (3%)
 Frame = +1

Query  142   KRNQTRLRVSCKANNPNNS--TDDAAASPGSRIIDRRnvllglggl-ygvanlaggPIAS  312
             K +  R +VSCK    + +  T  ++ S  ++IIDRRN+LLGLGG+      + G P A 
Sbjct  44    KCSNYRFQVSCKGTEDDQTINTSKSSDSSNNKIIDRRNMLLGLGGIYGAATLVGGHPFAF  103

Query  313   AADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVPAQ  489
             AA V      P+VSKC  P+D+P  A     CCPP  T  ++D+Q+P     +R R  A 
Sbjct  104   AAPVP----GPDVSKCG-PADLPPGAAPV-NCCPPT-TANIIDFQLPPPSTTLRTRPAAH  156

Query  490   FATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWL  669
              A   YI K+  A+  MK L  + P SF QQAN+HCAYC+G Y+Q GFP+ E+QVH+SWL
Sbjct  157   SADSAYIEKFNRAIQLMKQLPDNDPRSFKQQANVHCAYCDGAYEQLGFPSSELQVHSSWL  216

Query  670   FFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNY  849
             FFPFHR YLYF+EKILG LINDPTFA+P+WNWD+  GM +P M+ + +SSL+D  R+  +
Sbjct  217   FFPFHRCYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMYANRSSSLFDPLRDQKH  276

Query  850   LPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQG  1029
              PP IVDL++ G D  +S+ +  ++NL  +YR MV+ G T   F+G  Y  G  P  G G
Sbjct  277   QPPVIVDLDFNGADPNISNAQQTSQNLTIMYRQMVSLGSTPAAFLGDPYRAGGEPG-GAG  335

Query  1030  SVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-  1206
             S+E IPH  VH W GD   QPN E+MG FY+AGRDP+FY+HH+N+DR+W +W K LGG+ 
Sbjct  336   SLENIPHGTVHVWTGDRT-QPNFENMGVFYAAGRDPIFYAHHSNIDRLWSVW-KTLGGRR  393

Query  1207  -DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA  1383
              DFTD  +LN+SFLFYDE  Q VR+  +DC+D   +GY Y+    PW+ S+P    ++  
Sbjct  394   QDFTDPDFLNSSFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVVNPWINSRPRARVSSAL  453

Query  1384  AAASNAPFVTDVFPVTLDKVVQVKVSRPKT-SRTKAekekeeeVLVIDGIEVAMDQYARF  1560
             ++        D FP  LD V++V V RP    R K EK+ +EE LV++GIE+  D + +F
Sbjct  454   SSVRRLAEAKDYFPTKLDHVIRVMVKRPNNKKRNKEEKDAKEEFLVVEGIELETDVFVKF  513

Query  1561  DVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLEDLGAEDDDT  1734
             DV +ND D+     + A++AG F ++PH    +S    KT ++L + E LEDL AEDDD 
Sbjct  514   DVLINDEDETVISPNNAEFAGSFVNVPHLSHGKSDEKRKTKLKLAITELLEDLDAEDDDH  573

Query  1735  VLVTLAPQVGGGVVDVDSIRI  1797
             V+VT  P+ G G V +  ++I
Sbjct  574   VVVTFVPKNGSGAVKIGGVKI  594



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   426 bits (1094),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 236/506 (47%), Positives = 314/506 (62%), Gaps = 26/506 (5%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++KC   +D P+ A +   CCPP  +  ++D++ P+   +R R  A    + YI KY 
Sbjct  42    PDLAKCG-AADFPSGA-VPXNCCPPT-SQKIVDFKFPSPTKLRVRPAAHTVDKAYIEKYS  98

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A+  MK L    P SF QQA++HCAYC+G Y Q GFP  E+Q+H  WLFFPFHR+Y YF
Sbjct  99    KAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQCWLFFPFHRYYXYF  158

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
              E+IL KLI+DPTFALP+WNWD  +GM +P +F +  S LYD  R  ++ PP ++DL++ 
Sbjct  159   XERILAKLIDDPTFALPFWNWDAPAGMQLPALFANPDSPLYDELRAASHQPPTLIDLDFN  218

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVH  1062
             G D  +S +  I  NL  +YR MV+N     LF G  Y   T P PG GS+E  PH PVH
Sbjct  219   GTDETMSXDAQIXANLKIMYRQMVSNSKKPLLFFGSPYRAXTEPDPGXGSIETTPHGPVH  278

Query  1063  RWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNA  1236
              W GD+  QPN EDMGNFYSA RDP+F+SHH+N+DRMW IW K +G K  D  D  WL+ 
Sbjct  279   XWTGDNT-QPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIW-KSIGTKNXDINDKDWLDT  336

Query  1237  SFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskT-------------T  1377
              FLFYDEN + VRV  +D +DN  +GY YE   +PWL S+P+P +T              
Sbjct  337   GFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPTPRRTKLARKAKAAGVAKA  396

Query  1378  GAAAASNAPFVTDVFPVTLD-KVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
                 +S        FP+ L+ K+  V        R+K EKE EEE+LVI GIE+  D   
Sbjct  397   XETTSSGKVVAGKDFPINLETKIXTVVSRPKPKKRSKKEKEDEEEILVIXGIELDKDVAV  456

Query  1555  RFDVYLNDSDQPDG---GKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAED  1725
             +FDVY+ND D  D    G DK+++AG F  +PHKQ+  S  K+ +RLGL + LEDLGAED
Sbjct  457   KFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS--KSCLRLGLTDLLEDLGAED  514

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             D++V+VTL P+ G   V + SI+IE+
Sbjct  515   DESVVVTLVPRYGAQAVKIGSIKIEF  540



>ref|XP_004232833.2| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum lycopersicum]
Length=626

 Score =   427 bits (1099),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 254/585 (43%), Positives = 355/585 (61%), Gaps = 42/585 (7%)
 Frame = +1

Query  139   KKRNQTR-LRVSCKANNPNNSTDDAAASPGSR------IIDRRnvllglgglygvanlag  297
             +K N  R  +VSCK  + NN   ++      +      +IDRRNVLLGLGGLYG + L G
Sbjct  48    RKHNVHRNFQVSCKTIDDNNHEHNSPVDISKKNDSSNNMIDRRNVLLGLGGLYGASTLVG  107

Query  298   -gPIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMR  471
               P   AA V+     P+V+KC   +D+P  A++   CCPP+ + +++D+Q+P+   P+R
Sbjct  108   GLPFVLAAPVN----GPDVTKCG-AADLPPGAELVN-CCPPM-SGSIIDFQLPSSSTPLR  160

Query  472   KRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQ  651
              R  A      YI K+  A+  MK L    P SF QQANIHCAYC+G Y Q GFP  E+Q
Sbjct  161   TRPAAHSVDSAYIEKFNRAIQLMKQLPDDDPRSFKQQANIHCAYCDGAYDQLGFPNSELQ  220

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDA  831
             VH+SW+F PFHR YLYF+E+ILG LINDPTFA+P+WNWD+  GM MP ++ + TSSLYD 
Sbjct  221   VHSSWIFLPFHRCYLYFFERILGSLINDPTFAMPFWNWDHPDGMRMPGLYTNPTSSLYDR  280

Query  832   NRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTP  1011
              R+  + PP +VDL++ G D  +S  +  ++NL  +YR MV+ G T E F+G  Y  G  
Sbjct  281   LRDRRHQPPTMVDLDFNGTDPNISTAQQTSQNLTNMYRQMVSLGRTPETFLGDPYRAGGV  340

Query  1012  PSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQK  1191
             P  G GS+E + H  VH W GD   Q N E+MG+FYSA RDP+FY+HH+N+DR+W +W K
Sbjct  341   PG-GAGSLENMAHGAVHVWTGDRT-QANFENMGDFYSAARDPIFYAHHSNIDRLWTVW-K  397

Query  1192  LLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslp--------  1341
              LGG+  DFTD  +LN SFLFYDE  Q VR+  +D +D+  +GY Y+             
Sbjct  398   TLGGRRQDFTDPDFLNTSFLFYDEKAQMVRIRVRDVLDSSKLGYVYQNVRNQWINSRPTP  457

Query  1342  -wlkskpspskTTGAAAAS-------NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAeke  1497
                ++  S  +   A AA        N P   ++FP  LD V++V V RP   +   +++
Sbjct  458   RVSRALSSVRRLVEARAADDNNNNIMNFPRPKEIFPTKLDHVIKVMVKRPNKKKRNKKEK  517

Query  1498  keee-VLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPH----KQESSS  1662
              E E +L+++G+EV  D + +FDV +ND D+     D A++AG F ++PH    K E +S
Sbjct  518   NEREEILIVEGLEVESDVFVKFDVLINDEDETLISPDNAEFAGSFVNVPHHSHGKGEKNS  577

Query  1663  TTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
               KT ++L + E LEDL AE+DD VLVT  P+ G G V +  ++I
Sbjct  578   KRKTKLKLAITELLEDLDAENDDNVLVTFVPKNGSGAVKIGGVKI  622



>gb|AHX26180.1| polyphenol oxidase [Sorghum bicolor]
Length=554

 Score =   425 bits (1093),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 227/498 (46%), Positives = 308/498 (62%), Gaps = 19/498 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPAN-ADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYI  510
             I  PN+  CH P D+P   +DI   CCPP     ++D+  P    +R R  A    +EY+
Sbjct  66    IPAPNLRNCH-PPDLPDTVSDIN--CCPPGAGTAIVDFTPPPTVGLRVRPAAHLVDEEYL  122

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KYE A+  MK L    P SF QQ  +HCAYC+G + Q GFP  EIQ+HN WLFFP+HR 
Sbjct  123   AKYEKAVALMKELPDDDPRSFTQQWRVHCAYCDGAFDQVGFPDLEIQIHNCWLFFPWHRL  182

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYF+E+ILGKLI D  FALP+WNWD   GM++P ++ + +S LYD  R+P + PP  VD
Sbjct  183   YLYFHERILGKLIGDDKFALPFWNWDAPGGMSLPAIYANKSSPLYDERRDPAHQPPFTVD  242

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L+Y   ++ +   + I +NL+ +YR M++     ELF G  Y  G  P PG GSVE +PH
Sbjct  243   LDYDRIEQNIPRAQQIDQNLMIMYRQMISGAKKKELFFGLPYHQGDQPDPGAGSVESVPH  302

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDSW  1227
              PVH W GD   QPNGEDMGNFYSA RDPLF++HH N+DR+W +W  L  G  +FTD  W
Sbjct  303   GPVHFWSGDP-SQPNGEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGLRAGNTNFTDPDW  361

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             LNASFLFYDE  + VRV  +DC+D  A+GY Y+   +        P+  TG+ A +    
Sbjct  362   LNASFLFYDEEARLVRVRVRDCLDTAALGYTYQ--DVALPWLNAKPTTETGSPAPAAGAL  419

Query  1408  VTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLNDS  1581
                    TL++ V+V V+RP+TSRT+ EK+ EEEVLV++GIEVA    ++ +FDV++N+ 
Sbjct  420   PA-----TLNRTVRVAVTRPRTSRTRQEKDAEEEVLVVEGIEVADHFSRFVKFDVFVNEC  474

Query  1582  D-QPDGGKDKAQYAGGFAHLPH---KQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
                   G   AQ AG  A  PH     +   + KT+ R G+ + L+ +GA+ D T++V+L
Sbjct  475   QGGGGMGAAVAQCAGSVAMTPHLVRPGKGRGSVKTAARFGICDLLDSIGADGDKTIVVSL  534

Query  1750  APQVGGGVVDVDSIRIEY  1803
              P+  G +V V  +RIEY
Sbjct  535   VPRCAGDMVTVGGVRIEY  552



>ref|XP_003541548.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=608

 Score =   427 bits (1097),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 237/500 (47%), Positives = 295/500 (59%), Gaps = 36/500 (7%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGPMRK  474
             P+A AA     I  P++  C    DVP    I     CCPP  +   +D+++P G P+R 
Sbjct  102   PLAMAA---APILEPDLEHCCITDDVPPKGVIEAQVYCCPPKSSSPPIDFKLPKGTPLRV  158

Query  475   RVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTE-EIQ  651
             R PAQF T EY+ KY+ AL  M+ L    P SF QQA+IHCAYC+GGY+Q GFP E + +
Sbjct  159   RPPAQFVTDEYLEKYKLALKRMRELPSDDPRSFKQQADIHCAYCDGGYKQLGFPVELDFK  218

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDN-QSGMTMPNMFMSTTSSLYD  828
             VH SW+FFPFHRWYLYFYE+ILG LI+DPTFALPYWNWDN   GM +P++F    S LYD
Sbjct  219   VHFSWIFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPDGGMVLPSIFADEDSPLYD  278

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
               RNP+  P  +VDLNY     G   E  + +NL  +Y S+V+      LF GK ++ G 
Sbjct  279   PRRNPDITPTTLVDLNY-----GSGKEPSVEQNLGVMYTSVVSGAKRASLFHGKPFLAGK  333

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
              P  G G+VE  PHT VHRW GD   QPN EDMG FYSAGRDP FYSHHANVDRMW IW+
Sbjct  334   QPELGGGTVELGPHTAVHRWTGDP-RQPNKEDMGRFYSAGRDPAFYSHHANVDRMWNIWK  392

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE------------  1326
              +  GK  DF +  WL  SF FYDEN+  VRV  KD +D   MGY Y+            
Sbjct  393   TIPSGKRRDFKNRDWLETSFFFYDENKTLVRVKVKDSLDTNKMGYVYQDVAIPWLEKKPK  452

Query  1327  ---YsslpwlkskpspskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAek  1494
                      +           A AA   P  +  FP+T LD  V + V RPK  R+K +K
Sbjct  453   PKRTRKAKKVAFAQQFGGIGAAMAAETGP--SSKFPLTLLDSKVTLLVKRPKQLRSKRDK  510

Query  1495  ekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQES---SST  1665
             E+EEEVLVIDGIE   D   +FDVY+ D D  D G +  ++AG F+ L H   +      
Sbjct  511   EEEEEVLVIDGIEFDGDDDVKFDVYITDEDVEDIGPESTEFAGSFSTLGHSHSNMNMDKK  570

Query  1666  TKTSVRLGLNEPLEDLGAED  1725
              KTS+ LG+ + LEDL A++
Sbjct  571   IKTSLTLGITDLLEDLDADN  590



>gb|ACJ70698.1| polyphenol oxidase [Cynara cardunculus var. scolymus]
Length=569

 Score =   426 bits (1094),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 270/582 (46%), Positives = 349/582 (60%), Gaps = 51/582 (9%)
 Frame = +1

Query  142   KRNQTRLRVSCKA-----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPI  306
             K +  R +VSC A     N+P  +     +   +  +DRRN+LLGLGGLYG AN    P 
Sbjct  3     KASSHRFKVSCNAASGDTNHPETTPKLITSLDMTHNVDRRNLLLGLGGLYGAANFTSLPS  62

Query  307   ASAADV----DVAIHYPNVSKCHYPSDVPANADITG-TCCPPVPTDTVLDYQIPTGGPMR  471
             A A  +    ++A      S    P+DV     + G  CCPP  +     Y +P     R
Sbjct  63    AFATPIAAPDNIADCVTASSNLQNPTDV-----VRGLACCPPALSSKPEIYTLPVNPVTR  117

Query  472   KRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGY--QQFGFPTEE  645
              R  AQ AT EYI KY+AA+  M+ L   HPHSF QQA IHCAYCNG Y  +Q G P  +
Sbjct  118   IRPAAQRATPEYIEKYKAAIQEMRKLPDDHPHSFKQQAMIHCAYCNGAYNQEQSGHPELQ  177

Query  646   IQVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSL-  822
             +Q+HNSWLF+PFHRWYLYFYE+ILGKLINDPTFA+P+WNWD+ +GM +P MF     +L 
Sbjct  178   LQIHNSWLFYPFHRWYLYFYERILGKLINDPTFAIPHWNWDHPTGMMLPAMFEDADPALK  237

Query  823   ----YDANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGK  990
                 +D  R+  +LPPAI+D  YAG + G      I+ NL ++YR M+TN   T  F G 
Sbjct  238   QNPIFDPYRDVTHLPPAILDAEYAGANTGADCVNQISSNLASMYRQMITNATDTTSFSGG  297

Query  991   KYVTGTPPSPG----QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHA  1158
             ++V+G  P        GS+E   HT +HRWVG+     N EDMGNFYSAG DP+FY HHA
Sbjct  298   EFVSGDDPLQAGTLIAGSIERGIHTAMHRWVGNP-RMANNEDMGNFYSAGYDPVFYVHHA  356

Query  1159  NVDRMWVIWQKLLGGKDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYssl  1338
             NVDRMW IW               NAS++FYDENE+ VRV+ KD +D   MGYDYE SS+
Sbjct  357   NVDRMWKIWN--------------NASYVFYDENEKLVRVFNKDSIDIGRMGYDYERSSV  402

Query  1339  pwlkskpspskTTGAAAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekee  1506
             PWL+S+P        AAA +   V  V    FPV LD+VV+V V RP T+RTK +KEK  
Sbjct  403   PWLQSRPVAHAKRSKAAAQSVGTVKKVEDVEFPVKLDQVVKVLVKRPATNRTKEDKEKAH  462

Query  1507  eVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKA---QYAGGFAHLPHKQESSSTTKTS  1677
             E+L+++GI+   +++ +FDV++ND D  DG +  A   ++AG FA LPH   S     TS
Sbjct  463   EILLLNGIKFDGEKFVKFDVFVNDVD--DGIETTAAESEFAGSFAQLPHGSHSEKMLMTS  520

Query  1678  -VRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
               R G+ E LED+ AEDD+ VLV L P++G     V  I+IE
Sbjct  521   GARFGITELLEDIEAEDDEYVLVNLVPKIGCDDAIVSEIKIE  562



>ref|XP_010100568.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82811.1| Polyphenol oxidase [Morus notabilis]
Length=591

 Score =   426 bits (1096),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 257/523 (49%), Positives = 321/523 (61%), Gaps = 29/523 (6%)
 Frame = +1

Query  301   PIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRK  474
             P+ASAA     I  P++SKCH P DVP    +   CCPPV    ++DY  P   P  +R 
Sbjct  78    PLASAA----PIQAPDLSKCHLPDDVPPTVHVE--CCPPV-APKIIDYTPPAHIPSKLRV  130

Query  475   RVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQV  654
             R+PA    +EYI+KY  A+  M+ L    P SF QQA +HCAYCNG Y Q GFP   IQV
Sbjct  131   RLPAHTLDKEYIDKYNIAMERMRALPDDDPRSFTQQAMVHCAYCNGAYDQIGFPDINIQV  190

Query  655   HNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDAN  834
             HN WLF PFHRW LYFYE+ILG LINDPTFALP+WNWD+  GM MP++F   TSSLYD N
Sbjct  191   HNCWLFLPFHRWQLYFYERILGSLINDPTFALPFWNWDHPEGMRMPDIFADPTSSLYDEN  250

Query  835   RNPNYLPPAIVDLNYA--GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGT  1008
             RNPN+ PP +VDL+Y     D  + D++ I  NL  +YR +VT   T ELF G  Y  G 
Sbjct  251   RNPNHQPPVVVDLDYTKGADDPTIDDKQQIIHNLSIMYRQVVT-PKTAELFFGLPYRAGD  309

Query  1009  PPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQ  1188
              P+PG G++E +PH  +H W G+  +  N ED+G+FYS+GRDPLFYS HANVDR+W IW+
Sbjct  310   QPNPGMGALERMPHNNLHIWGGNPNNP-NNEDLGHFYSSGRDPLFYSLHANVDRIWNIWK  368

Query  1189  KLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskps  1362
              L G K  DF+D  WL  SF+FYDE +Q VRV  KD +D   +GY YE   LPWL  KP 
Sbjct  369   TLPGDKRTDFSDSDWLETSFVFYDEKKQLVRVKVKDAVDTRLLGYTYEKRPLPWLNCKPE  428

Query  1363  pskTTGAAAASN--APFVTDV----------FPVTLDKVVQVKVSRPKTSRTKAekekee  1506
               K      ASN   P    V          FP+ LD  +   V RPK  R+K EK+  E
Sbjct  429   SRKAKVTTTASNILVPSARAVEKKVTTPLTAFPLMLDNPISTVVPRPKKRRSKKEKDDAE  488

Query  1507  eVLVIDGIEVAMDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPH-KQESSSTTKTSV  1680
             EVL+I G+E        F VY+ND DQ +  + D +++AG F  +P  K++S   TKT V
Sbjct  489   EVLIIKGVEFEETLSVSFAVYVNDEDQTETIRPDNSEFAGSFTSVPSGKKDSHEKTKTDV  548

Query  1681  RLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
                + E LEDL AEDDDTV+VTL P+   G V +D I+IE  +
Sbjct  549   LFAITELLEDLDAEDDDTVVVTLVPRNEVGKVKIDGIKIELRS  591



>gb|AAC28935.1| polyphenol oxidase precursor [Prunus armeniaca]
Length=597

 Score =   426 bits (1096),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 239/496 (48%), Positives = 321/496 (65%), Gaps = 12/496 (2%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++ C  P+++      T  CCPPV T  +  ++     P+R    A   T EY+ K++
Sbjct  107   PDLTTCK-PAEITPGGSETVPCCPPV-TTKIKTFKPDLSIPLRTSPAAHQVTDEYLAKFK  164

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A  AM+ L    P S  QQA +HCAYCNG Y Q GF   +IQVH SWLFFPFHR YLYF
Sbjct  165   KAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFTDNDIQVHFSWLFFPFHRMYLYF  224

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YE+ILGKLI+DPTFALPYWNWD+  G  +P+++  T+S LYD  RN ++ PP +VDL+Y 
Sbjct  225   YERILGKLIDDPTFALPYWNWDSPVGFPIPDIYTDTSSPLYDQYRNADHQPPVLVDLSYG  284

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQ--GSVEGIPHTP  1056
             GKD  + ++  I ENL  +YR MV+   T +LF G  Y  G   + G+  G++E +PH  
Sbjct  285   GKDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHAYRAGN-LNTGKYPGTIENMPHNN  343

Query  1057  VHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSWL  1230
             +H WVGD   Q + EDMGNFYSAGRDPLFY+HHANVDRMW IW K LGG  KD TD  WL
Sbjct  344   IHIWVGDP-SQTHQEDMGNFYSAGRDPLFYAHHANVDRMWNIW-KTLGGKRKDITDTDWL  401

Query  1231  NASFLFYDENEQPVRVYAKDCMD-NIAMGYDYEYsslpwlkskpspskTTGAAAASNAPF  1407
             +A FLFYDEN + VRV  +D ++    + Y+YE  SLPWL +KP+  KT     A  A  
Sbjct  402   DAEFLFYDENAELVRVKVRDSLEPEKQLRYNYEPVSLPWLFTKPTARKTKNKTKAKVAAT  461

Query  1408  -VTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDS  1581
              +T  FP TL +V  V+V+RPK   R+K EK  EEE+L+I  IE    +  +FDV++ND 
Sbjct  462   QLTSKFPATLVEVTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDD  521

Query  1582  DQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQV  1761
              +    +DK+++AG F H+P  + + + TKT+++LG+ + LEDLGAEDD +VLVTL P+V
Sbjct  522   AESLSRRDKSEFAGSFVHVPQGKTTKAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRV  581

Query  1762  GGGVVDVDSIRIEYST  1809
                 + +   +IEYS+
Sbjct  582   SNSPITIGGFKIEYSS  597



>gb|ADY18411.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=586

 Score =   426 bits (1094),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 263/564 (47%), Positives = 343/564 (61%), Gaps = 28/564 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H+ R+Q+  +VSC ANN      +  A      +DRRNVLLGLGGLYG ANLA     +A
Sbjct  36    HRSRSQS-FKVSCNANNVGEHDKNLDA------VDRRNVLLGLGGLYGAANLAPLAANAA  88

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQ  489
                   +   + SK H   D     ++T +C PP+P   D+V  Y+ P    +R R PA 
Sbjct  89    PIPPPDLK--SCSKAHINPD----KEVTYSCRPPIPQDIDSVPYYKFPPMTKLRIRPPAH  142

Query  490   FATQEYINKYEAALTAMKNL--DPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
                +EYI KY+ A + M+ L  DP  P  F QQANIHCAYCNG Y+      +E+QVH S
Sbjct  143   AVDEEYIAKYQLATSRMRELGKDPFDPLGFKQQANIHCAYCNGAYK---VGEKELQVHFS  199

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLFFPFH  ++ FYE+ILG LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN 
Sbjct  200   WLFFPFHMVFV-FYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREGSSLYDEKRNQ  258

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
             N+    I+DL + G +   ++ + +  NL  +YR MVTN     LF G  Y  GT PSPG
Sbjct  259   NHRNGKIIDLGFFGTETQTTELQTMTNNLTYMYRQMVTNAPCPLLFFGNPYPLGTDPSPG  318

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              G++E IPH PVH W GDS  QPNGEDMGNFYSAG DP+FY HHANVDRMW  W K +GG
Sbjct  319   MGTIENIPHNPVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEW-KAIGG  377

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             K  D  D  WLN+   FYDEN  P +V  +DC+D+  MG+DY     PW   KP    T+
Sbjct  378   KRRDLADKDWLNSESFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKTTS  437

Query  1378  GAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYA  1554
             G A   + P  + VFP+  LD+ +   ++RP +SRT+AEK ++EE+L  + ++    QY 
Sbjct  438   GKANIGSIPPASKVFPIAKLDRAISFSINRPASSRTQAEKNEQEEILTFNKVKYDDSQYV  497

Query  1555  RFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQESSSTTKTSV--RLGLNEPLEDLGAED  1725
             RFDV+LN     +  + DKA++AG +  LPH    ++T  TSV   L + E LED+G ED
Sbjct  498   RFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGDNNTHVTSVTFNLAITELLEDIGLED  557

Query  1726  DDTVLVTLAPQVGGGVVDVDSIRI  1797
             +DT+ +TL P+ GG  + +D+  I
Sbjct  558   EDTIALTLVPKQGGEGISIDNAEI  581



>gb|AGK88243.1| polyphenol oxidase [Cynara cardunculus var. scolymus]
Length=587

 Score =   425 bits (1093),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 270/582 (46%), Positives = 349/582 (60%), Gaps = 51/582 (9%)
 Frame = +1

Query  142   KRNQTRLRVSCKA-----NNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPI  306
             K +  R +VSC A     N+P  +     +   +  +DRRN+LLGLGGLYG AN    P 
Sbjct  21    KASSHRFKVSCNAASGDTNHPETTPKLITSLDMTHNVDRRNLLLGLGGLYGAANFTSLPS  80

Query  307   ASAADV----DVAIHYPNVSKCHYPSDVPANADITG-TCCPPVPTDTVLDYQIPTGGPMR  471
             A A  +    ++A      S    P+DV     + G  CCPP  +     Y +P     R
Sbjct  81    AFATPIAAPDNIADCVTASSNLQNPTDV-----VRGLACCPPALSSKPEIYTLPVNPVTR  135

Query  472   KRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGY--QQFGFPTEE  645
              R  AQ AT EYI KY+AA+  M+ L   HPHSF QQA IHCAYCNG Y  +Q G P  +
Sbjct  136   IRPAAQRATPEYIEKYKAAIQEMRKLPDDHPHSFKQQAMIHCAYCNGAYNQEQSGHPELQ  195

Query  646   IQVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSL-  822
             +Q+HNSWLF+PFHRWYLYFYE+ILGKLINDPTFA+P+WNWD+ +GM +P MF     +L 
Sbjct  196   LQIHNSWLFYPFHRWYLYFYERILGKLINDPTFAIPHWNWDHPTGMMLPAMFEDADPALK  255

Query  823   ----YDANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGK  990
                 +D  R+  +LPPAI+D  YAG + G      I+ NL ++YR M+TN   T  F G 
Sbjct  256   QNPIFDPYRDVTHLPPAILDAEYAGANTGADCVNQISSNLASMYRQMITNATDTTSFSGG  315

Query  991   KYVTGTPPSPG----QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHA  1158
             ++V+G  P        GS+E   HT +HRWVG+     N EDMGNFYSAG DP+FY HHA
Sbjct  316   EFVSGDDPLQAGTLIAGSIERGIHTAMHRWVGNP-RMANNEDMGNFYSAGYDPVFYVHHA  374

Query  1159  NVDRMWVIWQKLLGGKDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYssl  1338
             NVDRMW IW               NAS++FYDENE+ VRV+ KD +D   MGYDYE SS+
Sbjct  375   NVDRMWKIWN--------------NASYVFYDENEKLVRVFNKDSIDIGRMGYDYERSSV  420

Query  1339  pwlkskpspskTTGAAAASNAPFVTDV----FPVTLDKVVQVKVSRPKTSRTKAekekee  1506
             PWL+S+P        AAA +   V  V    FPV LD+VV+V V RP T+RTK +KEK  
Sbjct  421   PWLQSRPVAHAKRSKAAAQSVGTVKKVEDVEFPVKLDQVVKVLVKRPATNRTKEDKEKAH  480

Query  1507  eVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKA---QYAGGFAHLPHKQESSSTTKTS  1677
             E+L+++GI+   +++ +FDV++ND D  DG +  A   ++AG FA LPH   S     TS
Sbjct  481   EILLLNGIKFDGEKFVKFDVFVNDVD--DGIETTAAESEFAGSFAQLPHGSHSEKMLMTS  538

Query  1678  -VRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
               R G+ E LED+ AEDD+ VLV L P++G     V  I+IE
Sbjct  539   GARFGITELLEDIEAEDDEYVLVNLVPKIGCDDAIVSEIKIE  580



>ref|XP_010686565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 226/517 (44%), Positives = 313/517 (61%), Gaps = 37/517 (7%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITG--TCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQEYI  510
             P+ ++C     VP+  D      CCPP P+  V D+++P   P  +R R  A     +Y+
Sbjct  92    PDATQC-----VPSKIDDGSPLQCCPPKPSQFV-DFKLPKVNPKQLRLRPAAHLVDDKYL  145

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  AL  MK L  S P SF QQA++HCAYCNGGY Q G P  E QVH SWLFFPFHR 
Sbjct  146   AKYSKALALMKALPDSDPRSFKQQADVHCAYCNGGYHQVGLPNLEFQVHGSWLFFPFHRA  205

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLI+DPTF++PYWNWD+  GM MP+MF    S  +DA R+ N+LPP +++
Sbjct  206   YLYFYERILGKLIDDPTFSIPYWNWDHPDGMYMPSMFNDKNSPFFDAIRDQNHLPPTLMN  265

Query  871   LNYAGKD--RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
             L+Y G D    L++E+ I +NL  +Y+ MV+N     LF+G  Y  G P +PG G++E  
Sbjct  266   LSYDGPDTVSNLTNEQQIEQNLTIMYKQMVSNAKKPTLFLGASYRAGDPVNPGPGTLEIQ  325

Query  1045  PHTPVHRWVGD-SVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTD  1218
             PH  VH W G+   + P  EDMGNFYSA RDP+FY+HH NVDR W IW+ +    KDF D
Sbjct  326   PHGTVHNWTGNPPPNTPFWEDMGNFYSAARDPIFYAHHGNVDRTWSIWKDISRKHKDFKD  385

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----------------Ysslpwl  1347
               +LN+ F FYDEN +PV+++ KD +D   +GYDY+                        
Sbjct  386   KDFLNSYFYFYDENAKPVKIFVKDVLDTKKLGYDYQPMDLPWLKSRPTPKRNRRPKKLVK  445

Query  1348  kskpspskTTGAAAASNAPFV-TDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVID  1524
             K   +      A A +N P V T VFP  LD +++  ++RP+ SRT+ EK+ EEEVLVID
Sbjct  446   KVFSTVKNAVAAEADTNNPVVPTLVFPRKLDHIIRTNLARPRKSRTQEEKDDEEEVLVID  505

Query  1525  GIEVAMDQYARFDVYLNDSDQPDGGKDKAQ--YAGGFAHLPHKQ--ESSSTTKTSVRLGL  1692
              +E   D Y++FDVY+ND D+    +++ Q  YAG F ++PH+   +      T+++ GL
Sbjct  506   -VESRSDVYSKFDVYVNDEDESPTLENRTQTEYAGSFVNVPHRHSGKDGHLKMTTIKFGL  564

Query  1693  NEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             +E ++DL A DD+ + +   P+ G   V +  +RIE+
Sbjct  565   SELIDDLDANDDEGLDIIFVPRTGTDSVTIKDVRIEF  601



>ref|XP_002446945.1| hypothetical protein SORBIDRAFT_06g025580 [Sorghum bicolor]
 gb|EES11273.1| hypothetical protein SORBIDRAFT_06g025580 [Sorghum bicolor]
 gb|AHX26183.1| polyphenol oxidase [Sorghum bicolor]
Length=553

 Score =   423 bits (1088),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 224/499 (45%), Positives = 305/499 (61%), Gaps = 21/499 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITG--TCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEY  507
             I  P++  CH P D+P   D  G   CCPP     ++D+ +P    +R R  A    +EY
Sbjct  65    IQAPDLRDCH-PPDLP---DTVGDVNCCPPGAGTAIVDFTLPPAVGLRVRPAAHLVDEEY  120

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A+  MK L    P SF QQ  +HCA C+G + Q GFP  EIQ+HN WLFFP+HR
Sbjct  121   LAKYEKAVALMKELPDDDPRSFAQQWRVHCANCDGAFDQVGFPDLEIQIHNCWLFFPWHR  180

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             +YLYF+E+ILGKLI D  FALP+WNWD   GM+MP ++ + TS LYD  R+P + PP  +
Sbjct  181   FYLYFHERILGKLIGDDKFALPFWNWDAPGGMSMPAIYANKTSPLYDERRDPAHQPPFTL  240

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y G +  +   + I +NL+ +YR M++     ELF G  Y  G  P PG GSVE IP
Sbjct  241   DLDYDGTEPTIPRHQQIDQNLMIMYRQMISGAKKKELFFGLPYHQGDQPDPGAGSVELIP  300

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDS  1224
             H  VH W GD   QPNGEDMGNFYSA RDPLF++HH N+DR+W +W  L  G  +FTD  
Sbjct  301   HNTVHFWSGDP-RQPNGEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGLRAGNTNFTDPD  359

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             WLNASFLFYDE  + VRV  +DC+D  A+GY Y+   +        P+  TG+ A +   
Sbjct  360   WLNASFLFYDEEARLVRVRVRDCLDTAALGYTYQ--DVALPWLNAKPTTETGSPAPAAGA  417

Query  1405  FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVYLND  1578
                     TL++ V+V V+RP+TSRT+ EK+ EEEVLV++GIEVA    ++ +FD+++N+
Sbjct  418   LPA-----TLNRTVRVAVTRPRTSRTRQEKDAEEEVLVVEGIEVADHFSRFVKFDLFVNE  472

Query  1579  SDQPDGGKDKAQY----AGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
             S    G    A           HL    +   + KT+ R G+ + L+D+GA+ D T++V+
Sbjct  473   SQSGGGMGAAAAQFAGSVAMTPHLVRPDKRRGSVKTAARFGICDLLDDIGADGDKTIVVS  532

Query  1747  LAPQVGGGVVDVDSIRIEY  1803
             L P+  G +V V  +RIEY
Sbjct  533   LVPRCAGDMVTVGCVRIEY  551



>ref|XP_007214660.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
 gb|AFI08585.1| polyphenol oxidase II [Prunus persica]
 gb|EMJ15859.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
Length=596

 Score =   425 bits (1092),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 237/497 (48%), Positives = 320/497 (64%), Gaps = 15/497 (3%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P+++KC   +++    + T  CCPPV T  +  ++     P+R R  AQ  T EY+ K++
Sbjct  107   PDLTKCQL-AEITTGGE-TVPCCPPV-TTKIKTFKPDLSIPLRTRPAAQQVTDEYLAKFK  163

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A  AM+ L    P S  QQA +HCAYCNG Y Q GFP  ++QVH SWLFFPFHR YLYF
Sbjct  164   KAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFPDNDLQVHFSWLFFPFHRMYLYF  223

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YE+ILGKLI+DPTFALPYWNWD+ +G  +P+++  T+S LYD  RN ++ PP +VDL Y 
Sbjct  224   YERILGKLIDDPTFALPYWNWDSPAGFPIPDIYTDTSSPLYDQYRNSDHQPPVLVDLGYG  283

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG---TPPSPGQGSVEGIPHT  1053
               +  + D+  I ENL  +YR MV+   T +LF G  Y  G   T   P  G++E +PH 
Sbjct  284   KTNDDVDDQTRIDENLAIMYRQMVSGAKTPDLFFGHAYRAGDLNTKKYP--GTIENMPHN  341

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSW  1227
              +H WVGD  +Q + EDMGNFYSAGRDPLFY+HH NVDRMW IW K LGGK  D TD  W
Sbjct  342   NIHLWVGDP-NQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWTIW-KTLGGKRQDITDTDW  399

Query  1228  LNASFLFYDENEQPVRVYAKDCMDNIA-MGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             L+A FLFYDEN + V    +D +D    + Y+YE +SLPWL +KP+  KT     A  A 
Sbjct  400   LDAEFLFYDENAELVNCKVRDSLDTAKQLRYNYEPASLPWLFTKPTARKTKNKTKAKVAA  459

Query  1405  F-VTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
               +T  FP T D    V+V+RPK   R+K EK  EEE+L+I  IE   ++  +FDV++ND
Sbjct  460   TQLTSKFPATFDSKTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGNEAVKFDVFIND  519

Query  1579  SDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
               +    +DK+++AG F H+P  + + + TKT+++LG+ + LEDLGAEDD +VLVTL P+
Sbjct  520   DAESLSRRDKSEFAGSFVHVPQGKTTKAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPR  579

Query  1759  VGGGVVDVDSIRIEYST  1809
             V    + +   +IEYS+
Sbjct  580   VSNSPITIGGFKIEYSS  596



>gb|AFO55219.1| chloroplast polyphenol oxidase III [Eriobotrya japonica]
Length=614

 Score =   425 bits (1092),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 255/573 (45%), Positives = 336/573 (59%), Gaps = 31/573 (5%)
 Frame = +1

Query  157   RLRVSCKANNPN----------------NSTDDAAASPGSRIIDRRnvllglgglygvan  288
             R  +SCKA NPN                N  D   +S     +DRRNVL+GLGGLYG   
Sbjct  51    RSSISCKATNPNYNNEQDQQQSTNPNYNNEQDQQQSSNLLGKLDRRNVLIGLGGLYGATT  110

Query  289   laggPIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPM  468
             L   P+A A      +  P+++KC   +++    + T  CCPPV T  +  +      P+
Sbjct  111   LVPKPLAFAN----PLAPPDLTKCTL-AEITTGGE-TVECCPPVSTK-IKTFTPDLSIPL  163

Query  469   RKRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEI  648
             R R  A   T EY+ K++ A   M+ L    P S  QQA +HCAYCNG Y Q GFP  +I
Sbjct  164   RTRPAAHLVTDEYLAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQIGFPDIDI  223

Query  649   QVHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYD  828
             QVH SWLFFPF   YLYFYE+ILGKLI+DPTFALPYWNWD+  G  +P+++  TTS LYD
Sbjct  224   QVHFSWLFFPFPPMYLYFYERILGKLIDDPTFALPYWNWDSLDGFPIPDIYTDTTSPLYD  283

Query  829   ANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG-  1005
               RN ++ PP +VDL+Y G D  + ++  I ENL  +YR MV+   T +LF G +Y  G 
Sbjct  284   QYRNADHQPPVLVDLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGD  343

Query  1006  TPPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIW  1185
             T      G++E  PH  +H W GD  +Q N EDMGNFYSAGRDPLFY+HH NVDRMW IW
Sbjct  344   TTTGTYAGTIENTPHNNIHLWCGDP-NQTNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIW  402

Query  1186  QKLLGG--KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIA-MGYDYE-Ysslpwlks  1353
              K LGG  KD TD  WL+A FLFYDEN + V    +D +     + Y YE  S       
Sbjct  403   -KTLGGKRKDPTDTDWLDAEFLFYDENAELVSCKVRDSLKPAKDLRYTYEPVSVPWLFTK  461

Query  1354  kpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGI  1530
               +    +   A   A  +T  FP T D    V+V+RPK   RTK EK  EEEVL+I  I
Sbjct  462   PTARKPKSKTKAKVAATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKIDEEEVLIIKDI  521

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLED  1710
             E   ++  +  V++ND  +    KDK+++AG F H+PH Q++ +  KT+++LG+ + LED
Sbjct  522   EFESNEAVKLIVFINDDAESLSRKDKSEFAGSFVHVPHNQKTGTKKKTNLKLGITDLLED  581

Query  1711  LGAEDDDTVLVTLAPQVGGGVVDVDSIRIEYST  1809
             LGAED+ +VLVTL P+V    + +   +IEYS+
Sbjct  582   LGAEDESSVLVTLVPRVSNSPITIGGFKIEYSS  614



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   424 bits (1089),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 247/575 (43%), Positives = 337/575 (59%), Gaps = 36/575 (6%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H    + RL V CKA       DD    PG+    R  ++   G   G+++L   P A A
Sbjct  27    HSSARRVRL-VLCKAT----GNDDQQPPPGNLDRRRNVLIGLGGLYGGLSSLPTDPFAFA  81

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFA  495
                   I  P++++C  P+D+P+ A +   CCPP     ++D+++P    +R R  AQ  
Sbjct  82    N----PISPPDLTQCG-PADLPSGA-LPTNCCPPT-YPKIIDFKLPPPSRLRVRPAAQTV  134

Query  496   TQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
              Q YI+KY  A+  MK L    P +F QQAN+HCAYC+G Y Q GFP  E+Q+HN WLFF
Sbjct  135   DQSYIDKYSKAIALMKALPDDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQIHNCWLFF  194

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHR+YLYFYE+IL KLI+DPTFALP+WNWD  +GM +P ++ ++ SSLYD  R   + P
Sbjct  195   PFHRYYLYFYERILAKLIDDPTFALPFWNWDAPAGMQLPALYANSDSSLYDELRAAAHQP  254

Query  856   PAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSV  1035
             P +VDL++ G D  ++ E  +  N          N     LF G  Y  GT   PG GSV
Sbjct  255   PTLVDLDFNGTDEKVNREARVNTN----RGQRGANARNPLLFFGWPYRAGTEADPGAGSV  310

Query  1036  EGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDF  1212
             E IPH PVH W GD+  QPN EDMGNFYSA RDP+F++HH+NVDRMW IW+ L    KD 
Sbjct  311   EAIPHGPVHLWTGDNT-QPNFEDMGNFYSAARDPIFFAHHSNVDRMWSIWKNLGTKNKDL  369

Query  1213  TDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTT  1377
             +D  WL++ FLFY+EN + VRV  +DC+D+  +GY YE     +        +    +  
Sbjct  370   SDKDWLDSGFLFYNENAELVRVKVRDCLDSRKLGYVYEDVEIPWLKSRPTPRRTKQQRKA  429

Query  1378  GAAAASNAPFVTDV--------FPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGI  1530
              A   + A   T +        FP+ L+  +   VSRP+   R K EKE EEE+LVI+GI
Sbjct  430   KAVGVAKAAGTTSLGKLVKSSEFPIQLESKISTVVSRPRQKKRNKKEKEDEEEILVIEGI  489

Query  1531  EVAMDQYARFDVYLNDSDQPD---GGKDKAQYAGGFAHLPHK-QESSSTTKTSVRLGLNE  1698
             E   +   +FDVY+ND    D    G DK+++AG F  +PH  +E  + +K  +RLGL +
Sbjct  490   EYEKNAVVKFDVYMNDVGDDDDVLSGPDKSEFAGSFVSVPHTHKEKRNKSKGCLRLGLTD  549

Query  1699  PLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
              LEDL AEDD++++VTL P+ G   V + SIRIE+
Sbjct  550   LLEDLEAEDDESIVVTLVPRFGAQTVTIGSIRIEF  584



>gb|ACN78382.1| polyphenol oxidase [Solanum quitoense]
Length=472

 Score =   419 bits (1078),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 300/474 (63%), Gaps = 16/474 (3%)
 Frame = +1

Query  376   VPANADITGTCCPPVP--TDTVLDYQIPTGGPMRKRVPAQFATQEYINKYEAALTAMKNL  549
             +  + ++T +CCPP+P   D+V  Y+ P+   +R R PA    +EYI KY+ A + M+ L
Sbjct  4     IKPDTEVTYSCCPPIPEDIDSVPYYKFPSMTKLRIRPPAHAVDEEYIAKYQLATSRMRGL  63

Query  550   D--PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYFYEKILGK  723
             D  P  P  F QQANIHCAYCNG Y+  G   +E+QVH SWLFFPFHRWYLYFYE+ILG 
Sbjct  64    DKDPFDPLGFKQQANIHCAYCNGAYKVGG---KELQVHFSWLFFPFHRWYLYFYERILGS  120

Query  724   LINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYAGKDRGLS  903
             LINDPTFALPYWNWD+  GM +P MF    SSLYD  RN N+    I+DL + GK+   +
Sbjct  121   LINDPTFALPYWNWDHPKGMRIPPMFDVEGSSLYDEKRNQNHRNGKIIDLGFFGKETQTT  180

Query  904   DEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVHRWVGDSV  1083
               + +  NL  +YR M+TN     LF G  Y  GT PSPG G++E IPH  VH WVGD  
Sbjct  181   QLQTMTNNLTLMYRQMITNAPCPSLFFGNPYPLGTDPSPGMGTIENIPHNAVHVWVGDP-  239

Query  1084  DQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNASFLFYDE  1257
              QPNGEDMGNFYS+G +P F+ HH+NVDRMW  W K +GGK  D  D  WLN  FLFYDE
Sbjct  240   RQPNGEDMGNFYSSGLEPAFFCHHSNVDRMWNEW-KAIGGKRRDLADKDWLNTEFLFYDE  298

Query  1258  NEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT-GAAAASNAPFVTDVFPV-T  1431
             N +  RV  +DC+D+  MG+DY     PW   KPS  KTT G    S+ P V+ VFP+  
Sbjct  299   NRKLFRVRVRDCLDSKKMGFDYAPMPTPWRNFKPSIRKTTAGKLNTSSIPPVSKVFPIPK  358

Query  1432  LDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDGGK-DK  1608
             LD+ +   ++RP +SRT+AEK ++EE+L    I+     Y RFDV+LN     +  + D+
Sbjct  359   LDRPISFSINRPASSRTQAEKNEQEEMLTFHKIQHNDRLYVRFDVFLNVDKTVNALELDQ  418

Query  1609  AQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVG  1764
              ++AG +  LPH    +    T  ++ L + E LED   ED++T++VTL P+VG
Sbjct  419   PEFAGSYTSLPHVHGDDKPHATSATLSLAITELLEDNNLEDEETIVVTLVPKVG  472



>gb|AAK53414.1|AF368291_1 polyphenol oxidase [Populus tremuloides]
Length=563

 Score =   422 bits (1086),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 219/498 (44%), Positives = 310/498 (62%), Gaps = 15/498 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTG-GPMRKRVPAQFATQEYI  510
             I  P+++ C    D+P N +    CC P+P   ++D++ P+   P+R R  A    ++Y+
Sbjct  70    ITSPDLTNCKL-VDLP-NPENPTDCCSPLPR-KIIDFRPPSPFSPLRTRRAAHLVDEDYV  126

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A++ MK+L    P +F QQAN+HCAYC+  Y+Q GFP  E+ VH  WLFFP+HR+
Sbjct  127   AKYAEAISLMKSLPEDDPRNFYQQANVHCAYCDDAYEQVGFPKLELDVHFCWLFFPWHRY  186

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLINDPTFALP+WNWD+ SGM MP +F    S LYD  R+ N+ PP ++D
Sbjct  187   YLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPKSPLYDQFRDQNHQPPVLLD  246

Query  871   LNYAGKDRGLSD-EELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             L+YA  D   ++  ++ + N   +Y+ MV+      LF GK Y  G    PG G++E  P
Sbjct  247   LDYAAGDPNPTNANQVYSSNRRVMYKQMVSGAAKPTLFFGKPYRAGDDARPGAGTIESSP  306

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDD  1221
             H  +HRW GD   Q N EDMGNFYSA RDP+F+ HH+NVDRMW IW+ + GG  +D TD 
Sbjct  307   HNNIHRWTGDPT-QENTEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIPGGLRRDITDP  365

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WLN+ FLFY+EN + VR   +DC+DN  + Y Y+ +            +  G  AA   
Sbjct  366   DWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQ-NVEIPWLKSKPIPRRLGKKAAETK  424

Query  1402  PFVTDV--FPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN  1575
               +T +  FP+ LDK +   VSRPK SR++ EKE+E+EVLVI+GIE   D++ RFDV++N
Sbjct  425   TALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDNDKFVRFDVFIN  484

Query  1576  DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAP  1755
             D  +     +  ++AG F ++ HK+   S  KT + LG+ E LEDL  + DD+++V L P
Sbjct  485   DDLEIPSKPENTEFAGSFVNVSHKRAKKS--KTRLILGITELLEDLETDGDDSIVVALVP  542

Query  1756  QVGG--GVVDVDSIRIEY  1803
             +  G    V +  ++IE+
Sbjct  543   RSNGVSDPVVISGVKIEF  560



>ref|XP_010686675.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=597

 Score =   424 bits (1089),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 233/513 (45%), Positives = 315/513 (61%), Gaps = 32/513 (6%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQEYINK  516
             P+V++C  PS +    D T  CCPP P+  V D+++P   P  +R R PA    Q+YI K
Sbjct  89    PDVNQC-VPSTI---GDSTLNCCPPKPSQFV-DFKLPEVNPKQLRLRRPAHLVDQKYIAK  143

Query  517   YEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYL  696
             Y  AL  MK L  S P SF  QAN+HCAYCNGGY Q G P  + QVH SWLFFPFHR YL
Sbjct  144   YSEALAKMKALPDSDPRSFKNQANVHCAYCNGGYHQVGLPDIQFQVHGSWLFFPFHRAYL  203

Query  697   YFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLN  876
             YFYE+ILGKLI DPTF++PYWNWD+  GM MP+MF    S  YDA R+ N+ PPA+++L+
Sbjct  204   YFYERILGKLIKDPTFSIPYWNWDHPDGMYMPSMFDVEESPFYDAIRDQNHRPPALMNLS  263

Query  877   YAGKD--RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             Y G D    L++EE IA+NL  +Y+ MV+      LF+G+ Y  G PP    G++E  PH
Sbjct  264   YDGPDTVSNLTNEEQIAQNLAIMYKQMVSGAKKPALFLGQPYRAGDPPVDNSGTLEVQPH  323

Query  1051  TPVHRWVGD-SVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL-LGGKDFTDDS  1224
               +H W G+   + PN EDMGNFYSAGRDP+FYSHHANVDR W IW+ L    KDFTD  
Sbjct  324   GNIHVWTGNPPPNTPNWEDMGNFYSAGRDPIFYSHHANVDRTWSIWKSLSTTNKDFTDKD  383

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------------Ysslpwlksk  1356
             +LN+ F FYDEN QPV+++ +D +D   MGYDY+                 +  P  K  
Sbjct  384   FLNSYFYFYDENAQPVKIHVRDVLDTKKMGYDYQPQDLPWLNSKPTPKRNRTPKPLKKVF  443

Query  1357  pspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEV  1536
              +      A  A++    T VFP  L  +++  + RP+ SRT+ EK+ EEE+LVI+    
Sbjct  444   STVKNAVAAEPATDPVVPTVVFPKPLKNIIRTNLPRPRKSRTQKEKDDEEEILVIEVESR  503

Query  1537  AMDQYARFDVYLNDSDQPDGGKDKAQ--YAGGFAHLPHKQ--ESSSTTKTSVRLGLNEPL  1704
               D Y +FDVY+ND D+    +++ Q  YAG F ++PH+   +     KT+V+LG++E +
Sbjct  504   G-DVYCKFDVYVNDEDESPTLENRTQTEYAGSFVNVPHRHVGKDGHLKKTTVKLGISELI  562

Query  1705  EDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             +DL A DD+ + +   P+ G   V +  +RIE+
Sbjct  563   DDLDANDDEGLDIIFVPRTGTDSVIIKDVRIEF  595



>gb|AAA85122.1| polyphenol oxidase [Solanum tuberosum]
Length=599

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 264/577 (46%), Positives = 349/577 (60%), Gaps = 40/577 (7%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRN+T  +VSCK +N    + D   +  +  +DRRNVLLGLGGLYGVAN    P+A++
Sbjct  37    HGKRNKT-FKVSCKVSN----SGDQNQNIETNSVDRRNVLLGLGGLYGVANAI--PLAAS  89

Query  316   ADVDVAIHYPNVSKCHYP--SDVPANADITGTCCPP-VPT--DTVLDYQIPTGGPMRKRV  480
             A     I  P++  C     SD P    +  TCCPP +PT  DT+  Y+ P+   +R R 
Sbjct  90    A---TPIPSPDLKTCGRATISDGPL---VPYTCCPPPMPTNFDTIPYYKFPSMTKLRIRP  143

Query  481   PAQFATQEYINKYEAALTAMKNLD---PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQ  651
             PA    +EYI KY  A++ MK+LD   P +P  F QQANIHCAYCNG Y   G   +E+Q
Sbjct  144   PAHAVDEEYIAKYNLAISRMKDLDKTDPLNPLGFKQQANIHCAYCNGAYIIGG---KELQ  200

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDA  831
             VHNSWLFFPFHRWYLYFYE+ILGKLI+DPTFALPYWNWD+  GM +P MF    +S+YD 
Sbjct  201   VHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMFDREGTSIYDE  260

Query  832   NRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTP  1011
              RN       ++DL   G     +  +L++ NL  +YR MVTN     LF G  YV G  
Sbjct  261   RRNQQVRNGTVMDLGSFGDKVQTTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPYVLGNN  320

Query  1012  PSPGQGSVEGIPHTPVHRWVGD-------SVDQPNGEDMGNFYSAGRDPLFYSHHANVDR  1170
                  G++E IPH PVH W G        + D   GEDMGNFYSAG DP+FY HH NVDR
Sbjct  321   VE-APGTIENIPHIPVHIWAGTVRGSTFPNGDTSYGEDMGNFYSAGLDPVFYCHHGNVDR  379

Query  1171  MWVIWQKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpw  1344
             MW  W K +GGK  D ++  WLN+ F FYDEN++P RV  +DC+D   MGYDY     PW
Sbjct  380   MWNEW-KAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMPTPW  438

Query  1345  lkskpspskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
                KP    + G    +  P V  VFP+T +DK +   ++RP +SRT+ EK ++EE+L  
Sbjct  439   RNFKPKTKASVGKVNTTTLPPVNKVFPLTKMDKAISFSINRPASSRTQQEKNEQEEMLTF  498

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ---ESSSTTKTSVRLG  1689
             D I+     Y RFDV+LN  +  +  + DKA++AG +  LPH     E+  T   + +L 
Sbjct  499   DNIKYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGENDHTATVTFQLA  558

Query  1690  LNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             + E LED+G ED++T+ VTL P+ GG  + ++++ I+
Sbjct  559   ITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEIK  595



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 263/572 (46%), Positives = 358/572 (63%), Gaps = 29/572 (5%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNS---TDDAAASPGSRIIDRRnvllglgglygvanlag-gPI  306
             +K      +VSCK +  + +   T   + S  ++IIDRRN+LLGLGGLYG A + G    
Sbjct  44    RKYGNRSFQVSCKGSEDDQTIYNTSKNSDSSNNKIIDRRNILLGLGGLYGAATIVGGHSF  103

Query  307   ASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPT-GGPMRKRVP  483
             A AA V+     P+VSKC  P+D+P  A     CCPP  T  ++D+Q+P     +R R  
Sbjct  104   AFAAPVN----GPDVSKCG-PADLPPGAAPVN-CCPPT-TANIIDFQLPPPSTTLRTRPA  156

Query  484   AQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNS  663
             A  A   YI K+  A+  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+QVH S
Sbjct  157   AHAADSAYIEKFNRAIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQVHFS  216

Query  664   WLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNP  843
             WLF PFHR YLYF+EKILG LINDPTFA+P+WNWD+  GM +P M+ + +SSL+D  R+ 
Sbjct  217   WLFLPFHRCYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMYTNRSSSLFDPLRDR  276

Query  844   NYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPG  1023
              + PP +VDL++ G D  +S+ +  ++NL  +YR MV+ G T   F+G  Y  G  P  G
Sbjct  277   RHQPPVMVDLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPTTFLGDPYRAGGEPG-G  335

Query  1024  QGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              GS+E IPH PVH W GD   QPN E+MG+FYSA RDP+FY+HH+N+DR+W +W K LGG
Sbjct  336   AGSLENIPHGPVHVWTGDRT-QPNFENMGDFYSAARDPIFYAHHSNIDRLWSVW-KTLGG  393

Query  1204  K--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTT  1377
             +  DFTD  +LNASFLFYDE  Q VR+  +DC+D   +GY Y+  + PW+ S+P    ++
Sbjct  394   RRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYAYQNVANPWINSRPRARVSS  453

Query  1378  G---------AAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAeke-keeeVLVIDG  1527
                       A AA N P   DVFP  LD V++V V RP   +   +++  +EE+LV++G
Sbjct  454   ALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPNKKKRNKKEKDAKEEILVVEG  513

Query  1528  IEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQ--ESSSTTKTSVRLGLNEP  1701
             IE+  D + +FDV +ND D+     + A++AG F ++PH    +S    KT ++L + E 
Sbjct  514   IELETDVFVKFDVLINDEDETVISPNNAEFAGSFVNVPHHSHGKSGKKRKTKLKLAITEL  573

Query  1702  LEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
             LEDL AEDDD VLVT  P+ G G V +  ++I
Sbjct  574   LEDLDAEDDDHVLVTFVPKNGSGAVKIGGVKI  605



>gb|ADG85002.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   422 bits (1085),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/508 (44%), Positives = 317/508 (62%), Gaps = 26/508 (5%)
 Frame = +1

Query  322   VDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFAT  498
             +   I  P++  C  P+ +P N      CCP  P  ++ D+++P    P+R R  A    
Sbjct  80    IAAPIQAPDLRNCQTPA-LP-NTPPDTNCCP-TPGTSITDFELPPASSPLRVRPAAHLVD  136

Query  499   QEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFP  678
              EY+ KYE A+  MK L    P SF QQ ++HCAYC+  + Q GFP  E+Q+HN WLFFP
Sbjct  137   AEYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAFDQVGFPDLELQIHNCWLFFP  196

Query  679   FHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPP  858
             +HR+Y+YF+E+ILGKLI D TFALP+WNWD  +GMT+P ++ + +S LYD  R+P + PP
Sbjct  197   WHRFYVYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYANRSSPLYDERRDPAHQPP  256

Query  859   AIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVE  1038
              +VDL+ +G D  +  ++ I ENL  +YR M++N   T LF+G+ Y  G  P PG GSVE
Sbjct  257   VLVDLDSSGTDANIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSVE  316

Query  1039  GIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFT  1215
              +PH  VH W GD   QPNGEDMGNFYSA RDP+F++HH N+DR+W +W+ L     DFT
Sbjct  317   NVPHGTVHGWTGDP-RQPNGEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRPSNADFT  375

Query  1216  DDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAAS  1395
             D  WL+A+FLFYDE  +PVRV  +DC+D  A+ Y Y+      +      ++   A+  +
Sbjct  376   DPDWLDAAFLFYDEEARPVRVRVRDCLDTAALRYTYQ-----DVGLPWLNARPAKASGGT  430

Query  1396  NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA--MDQYARFDVY  1569
              AP  T   P TLD+ ++V V+RP+ SR++ EKE EEEV+V++GIE+A   +++ +FDV 
Sbjct  431   PAPATTSTLPATLDRTIRVTVTRPRVSRSRREKEDEEEVVVVEGIEIADHFNKFIKFDVL  490

Query  1570  LNDSDQPDGG------KDKAQYAGGFAHLPH----KQESSSTTKTSVRLGLNEPLEDLGA  1719
             +N   +P+GG            AG FAH PH    ++      KT  R G+ + ++D+GA
Sbjct  491   VN---EPEGGVGSTPATATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGA  547

Query  1720  EDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
             + D TV+V+L P+ GG +V V  + I Y
Sbjct  548   DGDQTVVVSLVPRCGGELVTVGGVSISY  575



>ref|XP_008225003.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=597

 Score =   422 bits (1086),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 237/497 (48%), Positives = 316/497 (64%), Gaps = 14/497 (3%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++S C  P+++      T  CCPPV T  +  ++     P+R R  A   T EY+ K++
Sbjct  107   PDLSTCK-PAEITPGGSETVPCCPPV-TTKIKTFKPDLSIPLRTRPAAHQVTDEYLAKFK  164

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A  AM+ L    P S  QQA +HCAYCNG Y Q GF   +IQVH SWLFFPFHR YLYF
Sbjct  165   KAQAAMRALPDDDPRSMVQQAKVHCAYCNGAYPQVGFTDNDIQVHYSWLFFPFHRMYLYF  224

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YE+ILGKLI+DPTFALPYWNWD+  G  +P+++  T+S LYD  RN ++ PP +VDL+Y 
Sbjct  225   YERILGKLIDDPTFALPYWNWDSPVGFPIPDIYTDTSSPLYDQYRNADHQPPVLVDLSYG  284

Query  883   GKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTG---TPPSPGQGSVEGIPHT  1053
             G D  + ++  I ENL  +YR MV+   T +LF G  Y  G   T   P  G++E +PH 
Sbjct  285   GTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHAYRAGDLNTQKYP--GTIENMPHN  342

Query  1054  PVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--KDFTDDSW  1227
              +H WVGD   Q + EDMGNFYSAGRDPLFY+HH NVDRMW IW K LGG  KD TD  W
Sbjct  343   DIHIWVGDPT-QTHHEDMGNFYSAGRDPLFYAHHCNVDRMWNIW-KTLGGKRKDITDTDW  400

Query  1228  LNASFLFYDENEQPVRVYAKDCMD-NIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             L+A FLFYDEN + V    +D ++    + Y+YE + LPWL +KP+  KT     A  A 
Sbjct  401   LDAEFLFYDENAELVNCKVRDSLEPEKQLRYNYEPAPLPWLFTKPTARKTKNKTKAKVAA  460

Query  1405  F-VTDVFPVTLDKVVQVKVSRPK-TSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLND  1578
               +T  FP TLD    V+V+RPK   R+K EK  EEE+L+I  IE    +  +FDV++ND
Sbjct  461   TQLTSKFPATLDSKTTVEVARPKPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFIND  520

Query  1579  SDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
               +    +DK+++AG F H+P  + + + TKT+++LG+ + LEDLGAEDD +VLVTL P+
Sbjct  521   DAESLSRRDKSEFAGSFVHVPQGKTTKAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPR  580

Query  1759  VGGGVVDVDSIRIEYST  1809
             V    + +   +IEYS+
Sbjct  581   VSNSPITIGGFKIEYSS  597



>ref|XP_011013403.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=573

 Score =   421 bits (1082),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 230/497 (46%), Positives = 316/497 (64%), Gaps = 20/497 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEYI  510
             I  P+++ C   ++   + +    CCPP+ T  ++D+++P+   P+R R PA    + YI
Sbjct  85    IQPPDIADCSIINE--PDPENPTNCCPPL-TRKIIDFKLPSQNEPLRIRRPAHLVDENYI  141

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  A+  MK L    P +F QQAN+HCAYC+GGY Q G P    QVH SWLFFP+HR+
Sbjct  142   AKYNRAIALMKQLPEDDPRNFTQQANVHCAYCDGGYHQVGMPDLNYQVHFSWLFFPWHRY  201

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYE+ILGKLINDPTFALP+WNWD+  GM +P  F    S++YD  R+ ++ PP I+D
Sbjct  202   YLYFYERILGKLINDPTFALPFWNWDSPQGMQIPAFFADPKSAVYDPLRDKSHQPPKIID  261

Query  871   LNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPH  1050
             L++ G D  L D   +A NL  +YR MVT    T LFMG+ Y  G  P PG GS+E +PH
Sbjct  262   LDFPGVDFPLPDPVQVASNLNVMYRQMVTAKYPT-LFMGRPYRAGDEPEPGAGSLEDVPH  320

Query  1051  TPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDS  1224
             T VH W GD+ DQPN E+MG FY+A RDP+F++HH N+DR+W +W+KL GG+  +FTD  
Sbjct  321   TTVHIWTGDA-DQPNRENMGVFYAAARDPIFFAHHGNIDRLWEVWKKLPGGRRENFTDPD  379

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAAA  1389
             WL+A+FLFYDEN   VRV  +DC+D   + Y ++     + +    +    P  T     
Sbjct  380   WLDAAFLFYDENANLVRVKIRDCLDTRKLRYGFQDVANPWINARPKRKPNKPKPTVPVDT  439

Query  1390  ASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVY  1569
             A     +       L+K V + V RP   R+K EKE+EEEVLVI+GIE  +DQY +F+V 
Sbjct  440   ADPTKPIG-----LLNKTVNIVVQRPNKRRSKKEKEEEEEVLVIEGIEYRIDQYVKFNVL  494

Query  1570  LNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTL  1749
             +ND     G  D A++AG F ++PH +  + T KTS+RLG++E LEDL AEDD++V+VTL
Sbjct  495   INDVPDTPGKADDAEFAGTFVNVPHNR--NKTVKTSLRLGISELLEDLEAEDDESVVVTL  552

Query  1750  APQVGGGVVDVDSIRIE  1800
              P    G   + ++RIE
Sbjct  553   VPVTTIGEATIGTLRIE  569



>ref|XP_006347083.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum tuberosum]
Length=616

 Score =   422 bits (1086),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 252/584 (43%), Positives = 354/584 (61%), Gaps = 41/584 (7%)
 Frame = +1

Query  139   KKRNQTR-LRVSCK-----ANNPNNSTDDAAASPGS--RIIDRRnvllglgglygvanla  294
             +K N  R  +VSCK     ++  NNS  D +    S   +IDRRNVLLGLGGLYG + L 
Sbjct  39    RKHNVHRNFQVSCKTIDDNSHEHNNSPIDISKKNDSLNNMIDRRNVLLGLGGLYGASTLV  98

Query  295   g-gPIASAADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMR  471
             G  P A AA V+     P+V+KC      P  A +   CCPP+ +  ++D+Q+P+   +R
Sbjct  99    GGLPFALAAPVN----GPDVTKCGAADLPPGAAPVN--CCPPM-SGNIIDFQLPSSTALR  151

Query  472   KRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQ  651
              R  A      YI K+   +  MK L    P SF QQAN+HCAYC+G Y Q GFP  E+Q
Sbjct  152   TRPAAHSVDSAYIEKFNRGIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQ  211

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDA  831
             VH+SW+F PFHR YLYF+E+ILG LINDPTFA+P+WNWD+  GM MP ++ ++TSSLYD 
Sbjct  212   VHSSWIFLPFHRCYLYFFERILGSLINDPTFAMPFWNWDHPDGMRMPGLYTNSTSSLYDR  271

Query  832   NRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTP  1011
              R+  + PP +VDL++ G D  +S+ +  ++NL  +YR MV+ G T E F+G  Y  G  
Sbjct  272   LRDRRHQPPTMVDLDFNGTDPNISNAQQTSQNLTNMYRQMVSLGRTPETFLGDPYRAGGV  331

Query  1012  PSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQK  1191
             P  G GS+E + H  VH W GD   Q N E+MG+FYSA RDP+FY+HH+N+DR+W +W K
Sbjct  332   PG-GAGSLENMAHGAVHVWTGDRT-QANFENMGDFYSAARDPIFYAHHSNIDRLWTVW-K  388

Query  1192  LLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYssl---------  1338
              LGG+  DFTD  +LN SFLFYDE  Q VR+  +D +D+  +GY Y+  +          
Sbjct  389   TLGGRRQDFTDPDFLNTSFLFYDEKAQMVRIRVRDVLDSSKLGYVYQNVTNPWINSRPTP  448

Query  1339  pwlkskpspskTTGAAAAS------NAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekek  1500
                ++  S  +   A AA       N P   ++FP  LD V++V V RP   +   +++ 
Sbjct  449   RVSRALSSVRRLVEAKAADDNSNVMNFPRPKEIFPTKLDHVIKVMVKRPNKKKRNKKEKN  508

Query  1501  eee-VLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPH----KQESSST  1665
             E+E +L+++G+EV  D + +FDV +ND D+     D A++ G F ++PH    K E +S 
Sbjct  509   EKEEILIVEGLEVESDVFVKFDVLINDEDETLVSPDNAEFVGSFVNVPHHSHGKGEKNSK  568

Query  1666  TKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
              KT ++L + E LEDL AE+D+ VLVT  P+ G G V +  ++I
Sbjct  569   RKTKLKLAITELLEDLDAENDENVLVTFVPKNGSGAVKIGGVKI  612



>ref|XP_011082866.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=580

 Score =   421 bits (1082),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 264/568 (46%), Positives = 338/568 (60%), Gaps = 51/568 (9%)
 Frame = +1

Query  145   RNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAADV  324
             R   R +VSC      N + D         +DRRN+LLGLGGLYG ANL     A AA  
Sbjct  39    RRSHRFQVSCNGGINQNPSADGT-------VDRRNLLLGLGGLYGAANLVSDSQAYAA--  89

Query  325   DVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQE  504
                I  P    C    DV  N  +   CCPPV TD ++DY++P     R R  A   ++E
Sbjct  90    --PIEPPEFKNCGVARDVQTNDILDVNCCPPV-TDKIIDYKLPPVTNWRIRPAAHRVSKE  146

Query  505   YINKYEAALTAMKNLD---PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFF  675
             Y+ K+E A+  MK LD   P+ P  F QQANIHCAYCNG + Q GF   ++QVHNSWLFF
Sbjct  147   YLAKFEEAIRRMKALDKDDPTDPRGFMQQANIHCAYCNGAHDQVGFKDLDLQVHNSWLFF  206

Query  676   PFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLP  855
             PFHRWYLYFYE+ILGKLI+DPTF LP+WNWDN  GM MP +F  T S LY+ NR+  + P
Sbjct  207   PFHRWYLYFYERILGKLIDDPTFCLPFWNWDNPKGMQMPRIFDKTGSPLYNVNRDKTHRP  266

Query  856   PAIVDLNYAGKDRGLSDE-ELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
             PA++DL+ +     +SD+ +++  NL  +Y  M+ +  +T  FMGK Y  G  PSPG GS
Sbjct  267   PALIDLSLS----NISDDLQVVVNNLTVMYSEMIRSVNSTLDFMGKPYRKGDNPSPGMGS  322

Query  1033  VEGIPHTPVHRWVGDSVDQPNG---EDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG  1203
              E   H   H WVGD    PN    EDMGNFYSAGRD LFYSHHANVDRMW IW+ L   
Sbjct  323   SERGSHVAAHVWVGD----PNNRYREDMGNFYSAGRDILFYSHHANVDRMWSIWRTLKTD  378

Query  1204  --KDFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlks  1353
               KD TD  +LNA+FLFYDEN+Q VRV   DC+D+  MGYD+E        Y        
Sbjct  379   VPKDITDPDYLNAAFLFYDENKQLVRVRVADCIDHKKMGYDFEKVDIPWLNYRPPKKAAK  438

Query  1354  kpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIE  1533
                 + ++GA  A        +FP+ L K+ +V V  PK+++ KA     +EVLV++ IE
Sbjct  439   TKIQNISSGAQKAEG------LFPLNLKKITRVLV--PKSAKGKA-----DEVLVLENIE  485

Query  1534  VAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDL  1713
                 QY +FDV++ND D      DKA+YAG FA +PHK +S     +++ L L E  ED+
Sbjct  486   TDATQYIKFDVFVNDEDDNAKELDKAEYAGTFAQVPHKTKSKKDI-SNINLRLTELYEDI  544

Query  1714  GAEDDDTVLVTLAPQVGGGVVDVDSIRI  1797
               +DDDT++VTL P+  G  V +  I+I
Sbjct  545   DIDDDDTIVVTLVPRSNGDDVTIGGIKI  572



>gb|AEY79826.1| polyphenol oxidase [Triticum aestivum]
Length=562

 Score =   420 bits (1079),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 314/500 (63%), Gaps = 22/500 (4%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP--TGGPMRKRVPAQFATQEY  507
             I  P++  C+ P D+P  A  T  CCP   T  ++D+ +P  +  P+R R  A  A  E+
Sbjct  75    IQAPDLGNCN-PPDLPDTAPDT-NCCPTSGTG-IIDFVLPPASTAPLRVRPAAHLADAEH  131

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A+  MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQVHN WLFFP+HR
Sbjct  132   LAKYERAVALMKQLPADDPRSFEQQWRVHCAYCDGAYDQVGFPDLEIQVHNCWLFFPWHR  191

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
             +YLYF+E+ILGKLI D TF LP+WNWD  +GMT+P ++ + +S LY+  R+P + PP  V
Sbjct  192   FYLYFHERILGKLIGDDTFGLPFWNWDAPAGMTLPAIYANRSSPLYNERRDPAHQPPFPV  251

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y   D  +  +E I +NL  +YR MV++   T LFMG+ Y  G  P PG GS+E +P
Sbjct  252   DLDYNEIDVIIPTDEQIDQNLNIMYRQMVSSAKKTRLFMGQPYRAGDQPDPGAGSLENLP  311

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTDDS  1224
             H  VH W GD   QPN EDMGNFYSA RDP+F++HH N+DR+W +W+ L  G  DFTD  
Sbjct  312   HNTVHIWTGDPA-QPNSEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRPGNADFTDAD  370

Query  1225  WLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAP  1404
             WL+ +FLFYDE  +PVRV  +DC+D  AMGY Y+   LPWLK+KP        A A  A 
Sbjct  371   WLDTAFLFYDEEARPVRVRVRDCLDPAAMGYAYQDVGLPWLKAKPGKRSRRTPAPAEGA-  429

Query  1405  FVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMD-QYARFDVYLNDS  1581
                   P TL + V+V V+RP+ SR+  EKE+ EEVL+I+GI+VA   ++ +FDV +N  
Sbjct  430   -----LPATLRETVRVTVTRPQVSRSDKEKEEAEEVLIIEGIQVANHFKFVKFDVLVN--  482

Query  1582  DQPDGGKDKAQ--YAGGFAHLPH---KQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
               P+ G D A    AG  A  PH     +   + KT  R G+ + ++++GA+ D TV+V+
Sbjct  483   -APESGGDAASGYCAGSVAMTPHMVRTNKKKGSMKTVARFGVCDLMDNIGADGDKTVVVS  541

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             L P+ GG +V V  + I Y+
Sbjct  542   LVPRCGGELVTVGGVSIGYA  561



>ref|XP_009603530.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   421 bits (1081),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 257/563 (46%), Positives = 341/563 (61%), Gaps = 28/563 (5%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             HKK N  + +VSC  NN  N++ +         ++RRN+LLGLGG+YG A+L   P  + 
Sbjct  32    HKKPN-NKFKVSCNQNNEANNSQEK--------VERRNLLLGLGGIYGAAHLL--PYDAL  80

Query  316   ADVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDT-VLDYQIPTGGPMRKRVPAQF  492
             A     I  P +++C   + +     +  TCCPP+P    V  Y +P     R R  AQ 
Sbjct  81    AS---PIPSPTITQCGT-AFIDPKIPVCYTCCPPIPDKKDVPCYDLPLVSGFRVRPAAQT  136

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
                EYI KY  A + MK L    P SF QQANIHCAYCNG Y+  G   +E+QVH SWLF
Sbjct  137   VDDEYIAKYNEAYSRMKALPTDDPRSFMQQANIHCAYCNGAYKVGG---KELQVHFSWLF  193

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHRWYLYF+E+IL  LI DPTFALPYWNWD+  GM +P+MF    +S+Y+  RN  + 
Sbjct  194   FPFHRWYLYFHERILASLIGDPTFALPYWNWDHPKGMHLPDMFDVEGTSIYNERRNQKHR  253

Query  853   PPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGS  1032
                I+DL YAG+D   +D + +  NL  +YR M+TN     LF GK Y  G+ PSPG G+
Sbjct  254   NGFIMDLGYAGEDVVANDLQKMVNNLAIMYRQMITNAPCPLLFFGKPYRLGSKPSPGMGT  313

Query  1033  VEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG--K  1206
             +E +PH  +HRWVGD   QPN EDMGNFYS+G+DP F+S HANVDRMW IW K LGG  K
Sbjct  314   IENVPHNSIHRWVGDP-RQPNQEDMGNFYSSGKDPAFFSLHANVDRMWTIW-KTLGGKRK  371

Query  1207  DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAA  1386
             D +D  +L+  F FYDE  +P RV  +DC+D   +GY ++    PW   KP   K T   
Sbjct  372   DISDPDYLDTEFFFYDEKAKPFRVRVQDCLDEKKLGYTFQPMDTPWKNFKPLLRKNTKNV  431

Query  1387  AA--SNAPFVTDVFPV-TLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYAR  1557
                 ++ P  + VFP+  LDK+V   V+RPK  RTK EKE EEE+L    +E+ + ++ R
Sbjct  432   KIDPNSVPPASQVFPIKKLDKIVTFSVARPKKLRTKKEKEDEEELLTFKNVELDVRKFVR  491

Query  1558  FDVYLN-DSDQPDGGKDKAQYAGGFAHLPHKQESSSTTK-TSVRLGLNEPLEDLGAEDDD  1731
             FDV+LN D+D      D+ ++ G FA+LPH  +     K     L +NE LEDL  E DD
Sbjct  492   FDVFLNEDNDVIANEIDRTEFVGSFANLPHIHDDPKKEKFPEFSLAINELLEDLKLEGDD  551

Query  1732  TVLVTLAPQVGGGVVDVDSIRIE  1800
              V+VTL P++GG  V ++++ I+
Sbjct  552   LVVVTLVPKIGGDNVSIEAVEIQ  574



>ref|XP_004246032.1| PREDICTED: polyphenol oxidase B, chloroplastic [Solanum lycopersicum]
 sp|Q08304.1|PPOB_SOLLC RecName: Full=Polyphenol oxidase B, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78296.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=596

 Score =   421 bits (1081),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 263/577 (46%), Positives = 346/577 (60%), Gaps = 42/577 (7%)
 Frame = +1

Query  136   HKKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASA  315
             H KRN+T  +VSCK  N N + D+  +      +DRRNVLLGLGGLYGVAN    P+A++
Sbjct  36    HGKRNKT-FKVSCKVINNNGNQDETNS------VDRRNVLLGLGGLYGVANAI--PLAAS  86

Query  316   ADVDVAIHYPNVSKCHYP--SDVPANADITGTCCPP-VPT--DTVLDYQIPTGGPMRKRV  480
             A     I  P++  C     SD P    +  +CCPP +PT  DT+  Y+ P+   +R R 
Sbjct  87    A---TPIPSPDLKTCGRATISDGPL---VPYSCCPPPMPTNFDTIPYYKFPSMTKLRIRT  140

Query  481   PAQFATQEYINKYEAALTAMKNLD---PSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQ  651
             PA    +EYI KY  A++ M++LD   P +P  F QQANIHCAYCNG Y   G   +E+Q
Sbjct  141   PAHAVDEEYIAKYNLAISRMRDLDKTEPLNPLGFKQQANIHCAYCNGAYIIGG---KELQ  197

Query  652   VHNSWLFFPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDA  831
             VHNSWLFFPFHRWYLYFYE+ILGKLI+DPTFALPYWNWD+  GM +P MF    SSLYD 
Sbjct  198   VHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMFDREGSSLYDE  257

Query  832   NRNPNYLPPAIVDLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTP  1011
              RN       ++DL   G     +  +L++ NL  +YR MVTN     LF G  YV G  
Sbjct  258   RRNQQVRNGTVLDLGSFGDKVETTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPYVLGNN  317

Query  1012  PSPGQGSVEGIPHTPVHRWVGD-------SVDQPNGEDMGNFYSAGRDPLFYSHHANVDR  1170
                  G++E IPH PVH W G        + D   GEDMGNFYSAG DP+FY HH NVDR
Sbjct  318   VE-APGTIETIPHIPVHIWAGTVRGSKFPNGDVSYGEDMGNFYSAGLDPVFYCHHGNVDR  376

Query  1171  MWVIWQKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpw  1344
             MW  W K +GGK  D ++  WLN+ F FYDE++ P RV  +DC+D   MGYDY     PW
Sbjct  377   MWNEW-KAIGGKRRDISEKDWLNSEFFFYDEHKNPYRVKVRDCLDTKKMGYDYAPMPTPW  435

Query  1345  lkskpspskTTGAAAASNAPFVTDVFPVT-LDKVVQVKVSRPKTSRTKAekekeeeVLVI  1521
                KP    + G    S  P   +VFP+  +DK +   ++RP +SRT+ EK ++EE+L  
Sbjct  436   RNFKPKSKASVGKVNTSTLPPANEVFPLAKMDKTISFAINRPASSRTQQEKNEQEEMLTF  495

Query  1522  DGIEVAMDQYARFDVYLNDSDQPDGGK-DKAQYAGGFAHLPHKQ---ESSSTTKTSVRLG  1689
             + I      Y RFDV+LN  +  +  + DKA++AG +  LPH     E+    K + +L 
Sbjct  496   NNIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGENDHIAKVNFQLA  555

Query  1690  LNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             + E LED+G ED+DT+ VTL P+ GG  + ++++ I+
Sbjct  556   ITELLEDIGLEDEDTIAVTLVPKKGGEGISIENVEIK  592



>gb|ABG23057.1| polyphenol oxidase [Oryza sativa Indica Group]
Length=576

 Score =   420 bits (1079),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 233/500 (47%), Positives = 306/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  84    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  142

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  143   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  202

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P M+ +  S LYD  RN  +LPP  +
Sbjct  203   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAMYANRWSPLYDPRRNQAHLPPFPL  262

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL  +YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  263   DLDYSGTDTNIPKDQLIDQNLKMMYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  322

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  323   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  381

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  382   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  435

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  436   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  495

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  496   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  555

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  556   IVPRCGCDSVTVAGVSIGYA  575



>ref|XP_002458623.1| hypothetical protein SORBIDRAFT_03g036870 [Sorghum bicolor]
 gb|EES03743.1| hypothetical protein SORBIDRAFT_03g036870 [Sorghum bicolor]
Length=598

 Score =   420 bits (1080),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 247/567 (44%), Positives = 323/567 (57%), Gaps = 41/567 (7%)
 Frame = +1

Query  139   KKRNQTRLRVSCKANNPNNSTDDAAASPGSRIIDRRnvllglgglygvanlaggPIASAA  318
             + R  T  RVSC +     S  DA         DRR+VLLGLG L   A         A 
Sbjct  29    RPRRVTVQRVSCASPRGERSEHDAPKH------DRRDVLLGLGALSASATATLVTARRAG  82

Query  319   DVDVAIHYPNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIP--TGGPMRKRVPAQF  492
                VA   P++S C  P+D+P +A++  TCCPP      +D+ +P  T  P+R R  A  
Sbjct  83    ADPVAT--PDISSCG-PADLPPSANVL-TCCPPPSNALPVDFTLPDATSLPLRTRPAAHS  138

Query  493   ATQEYINKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLF  672
              T +Y+ K+ A + AMK L    P SF  QA +HCAYC+G Y   GFP  E+QVHNSWLF
Sbjct  139   VTADYVAKFNAGIAAMKALPADDPRSFAAQATVHCAYCDGSYSPEGFPDVELQVHNSWLF  198

Query  673   FPFHRWYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYL  852
             FPFHR YLYF+E+ILG LI DP+FA+P+WNWD   GM MP M+   +S L+D  RN  + 
Sbjct  199   FPFHRCYLYFFERILGSLIGDPSFAIPFWNWDAPDGMRMPAMYADPSSQLFDPRRNSRHA  258

Query  853   PPAIVDLNYAGKD-RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQG  1029
             PP +++L+Y G++ R  +D++ +  NL  +YR MV+   T  LF G  Y  G  P+ G G
Sbjct  259   PPKLINLDYNGREPRFFTDKQQVDHNLRVMYRQMVSLSPTPSLFFGSAYRAGDEPNQGPG  318

Query  1030  SVEGIPHTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-  1206
              VE IPH PVH W GD  +QP+GEDMGNFYSAG DPLFY+HHAN+DRMW +W+ L   + 
Sbjct  319   PVENIPHGPVHIWCGDP-NQPHGEDMGNFYSAGFDPLFYAHHANIDRMWSVWKGLDARRH  377

Query  1207  -DFTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGA  1383
              D TD  WLNASFL YDE  + VR+  +D +D   + Y Y+      L    +    T A
Sbjct  378   TDLTDPDWLNASFLLYDETSKLVRIRVRDVLDTDRLRYRYQ---DVPLPWTAARPTVTAA  434

Query  1384  AAASNAPFVTDV--------------FPVTLDKVVQVKVSRP-KTSRTKAekekeeeVLV  1518
             A  +++                    FP+TLD+   V V RP    R+KAEK  + EVLV
Sbjct  435   ARRADSLLAPAAQAATAAAAAKKAGEFPITLDEATSVTVKRPVAVQRSKAEKASKVEVLV  494

Query  1519  IDGIEVAMDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLP-------HKQESSSTTKTS  1677
             IDGIEV  D  A+FDV++N  D    G    + AG F ++P          +     KT 
Sbjct  495   IDGIEVDRDVAAKFDVFVNTEDHAAVGSGGRELAGSFVNVPHGHGHRHGHGKKGRGIKTK  554

Query  1678  VRLGLNEPLEDLGAEDDDTVLVTLAPQ  1758
             +RL LNE LEDL AE D++V+VTL P+
Sbjct  555   LRLALNEQLEDLKAEGDESVVVTLVPR  581



>gb|ABG23062.1| polyphenol oxidase [Oryza sativa Indica Group]
 gb|ABG23064.1| polyphenol oxidase [Oryza rufipogon]
 gb|ABG23069.1| polyphenol oxidase [Oryza rufipogon]
 gb|ABG23071.1| polyphenol oxidase [Oryza rufipogon]
 gb|ABG23079.1| polyphenol oxidase [Oryza rufipogon]
 gb|ABG23089.1| polyphenol oxidase [Oryza rufipogon]
Length=576

 Score =   419 bits (1078),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 233/500 (47%), Positives = 306/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  84    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  142

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  143   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  202

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P M+ +  S LYD  RN  +LPP  +
Sbjct  203   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAMYANRWSPLYDPRRNQAHLPPFPL  262

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL  +YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  263   DLDYSGTDTNIPKDQLIDQNLNIMYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  322

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  323   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  381

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  382   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  435

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  436   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  495

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  496   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  555

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  556   IVPRCGCDSVTVAGVSIGYA  575



>gb|ABG23075.1| polyphenol oxidase [Oryza rufipogon]
 gb|ABG23076.1| polyphenol oxidase [Oryza rufipogon]
Length=576

 Score =   419 bits (1078),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 234/500 (47%), Positives = 305/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  84    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  142

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  143   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  202

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P M+ +  S LYD  RN  +LPP  V
Sbjct  203   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAMYANRWSPLYDPRRNQAHLPPFPV  262

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL   YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  263   DLDYSGTDTNIPKDQLIDQNLNIRYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  322

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  323   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  381

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  382   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  435

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  436   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  495

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  496   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  555

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  556   IVPRCGCDSVTVAGVSIGYA  575



>ref|XP_003567197.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Brachypodium 
distachyon]
Length=592

 Score =   420 bits (1079),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 226/503 (45%), Positives = 303/503 (60%), Gaps = 17/503 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPS-DVPANADITGTCCPPVPTDTVLDYQIPTGG-PMRKRVPAQFATQEY  507
             +  P++S C  P   +P NA++  TCCPP      +D+  P    P+R R  A     +Y
Sbjct  90    VATPDISSCGKPDLGLPPNANLL-TCCPPPSNALPVDFSPPDASTPLRTRPAAHSVGADY  148

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + K   A+ AMK L    P SF  QA+IHCAYCNG Y   GFP  ++QVHNSWLF PFHR
Sbjct  149   VAKLNRAMAAMKALPAEDPRSFAAQASIHCAYCNGSYGVEGFPGSDLQVHNSWLFLPFHR  208

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILG LI DP+FA+P+WNWD   GM MP M++   S L+D  R+  + PP ++
Sbjct  209   CYLYFFERILGSLIGDPSFAMPFWNWDAPGGMRMPAMYVDPKSPLFDPRRDARHAPPELI  268

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             +L+Y G++   +D + +  NL  +YR MV+   T  LF G  Y  G  P  G G +E IP
Sbjct  269   NLDYNGREPTFTDRQQVDHNLRVMYRQMVSLSPTPSLFFGGAYRAGDEPDQGPGPMENIP  328

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKL--LGGKDFTDD  1221
             H PVH W GD  +QP GEDMGNFYSAGRDPLFY+HH N+DRMW +W+ L     +D TD 
Sbjct  329   HGPVHIWCGDP-NQPAGEDMGNFYSAGRDPLFYAHHGNIDRMWSVWKGLDPRRHRDLTDP  387

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE-----YsslpwlkskpspskTTGAA  1386
              WL++SFLFYDE  + VR+  +D +D   + Y ++     +++     +  + S  T  A
Sbjct  388   DWLDSSFLFYDETPKLVRIRVRDVLDTDRLRYRFQDVPMPWTTARPTVTPRARSFGTPTA  447

Query  1387  AASNAPFVTDVFPVTLDKVVQVKVSRPKTS-RTKAekekeeeVLVIDGIEVAMDQYARFD  1563
              A++A   T  FP+ LD    V V RP +S R+K EK  +EEVLVI GIEV MD  A+FD
Sbjct  448   VAASAKKATK-FPIMLDSATSVTVRRPVSSKRSKLEKSAKEEVLVIGGIEVDMDIAAKFD  506

Query  1564  VYLNDSDQPDG-GKDKAQYAGGFAHLPHKQE---SSSTTKTSVRLGLNEPLEDLGAEDDD  1731
             V++N  D     G    + AG F  +PH+          KT +RL LNE LEDL AE D+
Sbjct  507   VFVNAGDDHAAVGSGGRELAGSFVSVPHRHRHDKKEKKIKTKLRLALNEQLEDLDAEGDE  566

Query  1732  TVLVTLAPQVGGGVVDVDSIRIE  1800
             +V+VTL P+ G G V + S++IE
Sbjct  567   SVVVTLVPRQGKGKVKIGSVKIE  589



>gb|ABG23073.1| polyphenol oxidase [Oryza rufipogon]
Length=576

 Score =   419 bits (1077),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 233/500 (47%), Positives = 306/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  84    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  142

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  143   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  202

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P ++ +  S LYD  RN  +LPP  +
Sbjct  203   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAIYANRWSPLYDPRRNQAHLPPFPL  262

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL  VYR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  263   DLDYSGTDTNIPKDQLIDQNLNKVYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  322

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  323   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  381

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  382   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  435

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  436   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  495

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  496   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  555

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  556   IVPRCGCDSVTVAGVSIGYA  575



>gb|ACS15319.1| polyphenol oxidase [Oryza sativa]
Length=557

 Score =   419 bits (1076),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 233/500 (47%), Positives = 306/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  65    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  123

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  124   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  183

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P M+ +  S LYD  RN  +LPP  +
Sbjct  184   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAMYANRWSPLYDPRRNQAHLPPFPL  243

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL  +YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  244   DLDYSGTDTNIPKDQLIDQNLNIMYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  303

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  304   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  362

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  363   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  416

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  417   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  476

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  477   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  536

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  537   IVPRCGCDSVTVAGVSIGYA  556



>ref|XP_010100567.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82810.1| Polyphenol oxidase [Morus notabilis]
Length=604

 Score =   420 bits (1079),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 319/508 (63%), Gaps = 35/508 (7%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYE  522
             P++SKC  PS +PA   +   CCPP  +D ++DY+ P   P+R R  A     EYI KY 
Sbjct  107   PDLSKCSTPSGLPAG--VVTECCPPY-SDEIIDYK-PPRTPLRVRPAAHLVDSEYIAKYN  162

Query  523   AALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYF  702
              A   M+ L  S P +F QQAN+HCAYCNG Y Q  +P   +QVHN W FFPFHRWYLYF
Sbjct  163   EATKRMRKLPDSDPRNFMQQANVHCAYCNGAYDQVNYPEIVLQVHNGWHFFPFHRWYLYF  222

Query  703   YEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYA  882
             YEKILGKLI+DPTFALP+WNWD+ +GM MP  F + +S+LYD  R+  + PP++VDLN+ 
Sbjct  223   YEKILGKLIDDPTFALPFWNWDHPNGMQMPAFFTNKSSALYDEKRSIKHQPPSLVDLNF-  281

Query  883   GKDRGLSDE-------ELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEG  1041
                 GLS +       E + ENL  +Y+SMV+      LF G+ Y  GT   PG G+VE 
Sbjct  282   ----GLSKDTTPKTYNEQVQENLTIMYQSMVSGAKLQSLFFGEPYRQGTDKEPGAGTVER  337

Query  1042  IPHTPVHRWVGDSVD-QPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGG---KD  1209
              PHT +H W G   D + NGE++GNFYSAGRDP+FYSHHANVDRMW +W K +GG   KD
Sbjct  338   TPHTAIHIWGGSEKDREKNGENLGNFYSAGRDPMFYSHHANVDRMWSLW-KTIGGRKRKD  396

Query  1210  FTDDSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE--------Ysslpwlkskpsp  1365
              +D  +LNA FLFYDEN + VRV  +DC+D   +GY Y+            P        
Sbjct  397   ISDPDYLNAEFLFYDENARLVRVKVRDCLDTKKLGYIYDDVELPWLYKKPKPRKSKLVKL  456

Query  1366  skTTGAAAASNAPFVT-DVFPVTL-DKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA  1539
              K  G A A++A  V    FP+TL D +V   V R    R+K EKE+EEEVL+I+GIE  
Sbjct  457   LKNLGVARAADAKRVALSDFPITLTDNIVTTVVPRAIKGRSKEEKEEEEEVLIIEGIEFD  516

Query  1540  MDQYARFDVYLNDSDQPDGGKDKAQYAGGFAHLPHK-QESSSTTKTSVRLGLNEPLEDLG  1716
              +   +FDVY+ND D P  G DK+++AG F ++PHK +  +   K S++LG+++ L+D+G
Sbjct  517   KELAVKFDVYVNDEDVP--GPDKSEFAGSFGNVPHKLKPGAERGKVSLKLGISDLLDDVG  574

Query  1717  AEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             A+DD+ ++V L P+     V +  I+IE
Sbjct  575   ADDDENIIVALVPK-NNYPVTIGGIKIE  601



>dbj|BAA08234.1| polyphenol oxidase [Phytolacca americana]
Length=586

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 225/474 (47%), Positives = 306/474 (65%), Gaps = 14/474 (3%)
 Frame = +1

Query  388   ADITGTCCPPVPTDTVLDYQIP-TGGPMRKRVPAQFATQEYINKYEAALTAMKNLDPSHP  564
             +D+   CCPP   + ++D+Q+P     +R R PA     +Y+ K+  A++ MK L  + P
Sbjct  112   SDVGLNCCPPTARN-IVDFQLPPQPTTLRVRPPAHLVDDQYLQKFSRAISLMKALPANDP  170

Query  565   HSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYFYEKILGKLINDPTF  744
              +F QQAN+HCAYC+GGY Q GFP  E+QVH SWLFFPFHR+YLYF+E+ILGKLINDP+F
Sbjct  171   RNFSQQANVHCAYCDGGYTQTGFPNLELQVHFSWLFFPFHRFYLYFFERILGKLINDPSF  230

Query  745   ALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYAGKD--RGLSDEELI  918
             A+P+WNWD  +GM +P ++ S  S LYD  R+  + PP ++DLNY G+D    L+ ++LI
Sbjct  231   AIPFWNWDTPAGMQIPGIYTSPNSPLYDPRRDRAHQPPRVIDLNYDGQDDPNDLTGQDLI  290

Query  919   AENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVHRWVGDSVDQPNG  1098
             + NL  +YR MV+N  TT LF+G+ +  G  PSPG GS+E +PH PVH W GD  +QPNG
Sbjct  291   SANLTLMYRQMVSNSTTTRLFLGQPFRVGNRPSPGAGSIENVPHGPVHVWTGDP-NQPNG  349

Query  1099  EDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK-DFTDDSWLNASFLFYDENEQPVR  1275
             EDMG FYSA R P+FY+HHA VDRMW IW  L   + DFTD  WLNAS + Y  N Q VR
Sbjct  350   EDMGTFYSAARVPIFYAHHAIVDRMWAIWNALGNDRQDFTDSDWLNASCIVYGGNGQAVR  409

Query  1276  VYAKDCMDNIAMGYDYE---YsslpwlkskpspskTTGAAAASNAPFVTDVFPVTLDKVV  1446
             V ++D +D   +GY Y+       P   +       T +    +    T  FP  LD V+
Sbjct  410   VPSRDSLDKARLGYTYQGVDLPEWPSSPTPQRSKLNTTSRIPMSPTLSTVKFPRALDSVI  469

Query  1447  QVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDGGKDKA--QYA  1620
             +  V R K SR + EKE EEE+LVI+ IE+  D Y +FDV++ND D+    K +   ++A
Sbjct  470   RTDVKRSKKSRGRREKEVEEEILVIE-IELEKDIYVKFDVHVNDEDEVPFKKTRVLTEFA  528

Query  1621  GGFAHLPHK--QESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVV  1776
             G F ++PHK  +E     KT++RLGL   +E+LGA+DD+TV +TL P+ G  VV
Sbjct  529   GSFVNVPHKHHKEGQHGMKTALRLGLTALIEELGADDDETVTITLVPRAGNDVV  582



>ref|XP_010686566.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=601

 Score =   419 bits (1078),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 231/515 (45%), Positives = 312/515 (61%), Gaps = 35/515 (7%)
 Frame = +1

Query  343   PNVSKCHYPSDVPANADITGT--CCPPVPTDTVLDYQIPTGGP--MRKRVPAQFATQEYI  510
             P+ ++C      P+  D   T  CCPP P+  V D+++P   P  +R R  A    ++Y+
Sbjct  92    PDATQC-----APSTIDDGSTLLCCPPKPSQFV-DFKLPKVNPKQLRLRPAAHLVDEQYL  145

Query  511   NKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRW  690
              KY  AL  MK L  S P SF QQA++HCAYCNGGY Q G P  E QVH SWLFFPFHR 
Sbjct  146   AKYSKALALMKALPDSDPRSFKQQADVHCAYCNGGYHQVGLPNLEFQVHGSWLFFPFHRA  205

Query  691   YLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVD  870
             YLYFYEKILGKLI+DPTF +PYWNWD+  GM MP+MF +  S  +DA R+ N+LPP +++
Sbjct  206   YLYFYEKILGKLIDDPTFTIPYWNWDHPDGMYMPSMFNNQNSPFFDAIRDQNHLPPTLMN  265

Query  871   LNYAGKD--RGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGI  1044
             L+Y G D    L++EE I +NL  +Y+ MV N    ELF+G  Y  G PP    G++E  
Sbjct  266   LSYDGPDTVSNLTNEEQINQNLAVMYKQMVANAKKPELFLGAPYRAGDPPGQSPGTLEVQ  325

Query  1045  PHTPVHRWVGD-SVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL-GGKDFTD  1218
             PH  +H W G+   + P  EDMGNFYSAGRDP+FYSHHANVDR W IW+ L    KDF D
Sbjct  326   PHGTIHNWTGNPPPNTPFWEDMGNFYSAGRDPIFYSHHANVDRTWSIWKSLSPKNKDFKD  385

Query  1219  DSWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYE----------------Ysslpwlk  1350
               +LN+ F FYDEN QPV++Y +D +D   MGYDY+                 S  P  K
Sbjct  386   KDFLNSYFYFYDENAQPVKIYVRDVLDTKKMGYDYQPQDLPWLKSKPTPKRNRSPKPLKK  445

Query  1351  skpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGI  1530
                +      A  A++    T VFP  L  +++  + RP+ SRT+ EK+ EEE+LVI+  
Sbjct  446   VFSTVKNAVAAEPATDPVVPTVVFPKPLKNIIRTNLPRPRKSRTQNEKDDEEEILVIEVE  505

Query  1531  EVAMDQYARFDVYLNDSDQPDGGKDKAQ--YAGGFAHLPHKQ--ESSSTTKTSVRLGLNE  1698
               A D Y++FDVY+ND D+    +++ Q  YAG F ++PH+   +     KT+V+ GL+E
Sbjct  506   SRA-DVYSKFDVYVNDEDESPTLENRTQTEYAGSFVNVPHRHGGKDGHLKKTTVKFGLSE  564

Query  1699  PLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIEY  1803
              ++DL A DD+ + +   P+ G   V +  +RIE+
Sbjct  565   LIDDLDANDDEGIDIIFVPRTGTDSVIIKDVRIEF  599



>gb|ACS15330.1| polyphenol oxidase [Oryza sativa]
Length=562

 Score =   418 bits (1074),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 306/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  70    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  128

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  129   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  188

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P ++ +  S LYD  RN  +LPP  +
Sbjct  189   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAIYANRWSPLYDPRRNQAHLPPFPL  248

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL  +YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  249   DLDYSGTDTNIPKDQLIDQNLNIMYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  308

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  309   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  367

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  368   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  421

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  422   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  481

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  482   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  541

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  542   IVPRCGCDSVTVAGVSIGYA  561



>gb|AHN09736.1| aurone synthase [Coreopsis grandiflora]
Length=602

 Score =   419 bits (1077),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 227/485 (47%), Positives = 298/485 (61%), Gaps = 19/485 (4%)
 Frame = +1

Query  397   TGTCCPPVPTDTVLDYQIPTGGPMRKRVPAQFATQEYINKYEAALTAMKNLDPSHPHSFP  576
             T  CCPP     + D+Q P    +R R PA   T++ ++ Y  A+ AM+ L    P SF 
Sbjct  113   TRKCCPPSLGKKIKDFQFPNDKKVRMRWPAHKGTKKQVDDYRRAIAAMRALPDDDPRSFV  172

Query  577   QQANIHCAYCNGGYQQF--GFPTEEIQVHNSWLFFPFHRWYLYFYEKILGKLINDPTFAL  750
              QA IHCAYCNGGY Q   GFP  +IQ+HNSWLFFPFHRWYLYFYE+ILG LI++P FAL
Sbjct  173   SQAKIHCAYCNGGYTQVDSGFPDIDIQIHNSWLFFPFHRWYLYFYERILGSLIDEPNFAL  232

Query  751   PYWNWDNQSGMTMPNMFMSTTSS-LYDANRNPNYLPPAIVDLNYAGKDRGLSDEELIAEN  927
             PYW WD   GM + N+F+   S+ LYD  R+ N++   IVDL+Y GKD+ + D++ +A N
Sbjct  233   PYWKWDEPKGMPISNIFLGDASNPLYDQYRDANHIEDRIVDLDYDGKDKDIPDQQQVACN  292

Query  928   LVAVYRSMVTNGGTTELFMGKKYVTGTPP----SPGQGSVEGIPHTPVHRWVGDSVDQPN  1095
             L  VYR +V NG     F G KYV G  P     P  GSVE   HT VHRWVGD   QPN
Sbjct  293   LSTVYRDLVRNGVDPTSFFGGKYVAGDSPVANGDPSVGSVEAGSHTAVHRWVGDPT-QPN  351

Query  1096  GEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDDSWLNASFLFYDENEQP  1269
              EDMGNFYSAG DP+FY HHANVDRMW +W++L   G  D TD  WLNAS++FYDEN+  
Sbjct  352   NEDMGNFYSAGYDPVFYIHHANVDRMWKLWKELRLPGHVDITDPDWLNASYVFYDENKDL  411

Query  1270  VRVYAKDCMDNIAMGYDY-EYsslpwlkskpspskTTGAAAASNAPFVTDV----FPVTL  1434
             VRVY KDC++   + Y++ E S   +      P +   +A  +    V  V    FPV L
Sbjct  412   VRVYNKDCVNLDKLKYNFIENSKEVFPWRNSRPPQRRKSAQVATTGDVKTVEQTKFPVRL  471

Query  1435  DKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVAMDQYARFDVYLNDSDQPDG---GKD  1605
             +++ +V+V RP  +RT+ EK++  EVL+I  I+    ++ +FDV++ND  + DG      
Sbjct  472   NQIFKVRVKRPAVNRTEEEKDQANEVLLIKKIKYDSGKFVKFDVFVNDKLK-DGVFTTPC  530

Query  1606  KAQYAGGFAHLPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVD  1785
               +YAGGFA +PH  + S    ++ R GLNE LED   E ++   VTL P+ G   + V 
Sbjct  531   DPEYAGGFAQIPHNDKRSMVMTSTARFGLNELLEDTNTEGEEYATVTLVPRTGCEDLTVG  590

Query  1786  SIRIE  1800
              I+IE
Sbjct  591   EIKIE  595



>gb|ADY18410.1| chloroplast polyphenol oxidase precursor, partial [Solanum melongena]
Length=584

 Score =   418 bits (1075),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 223/475 (47%), Positives = 288/475 (61%), Gaps = 13/475 (3%)
 Frame = +1

Query  403   TCCPPVP--TDTVLDYQIPTGGPMRKRVPAQFATQEYINKYEAALTAMKNLD--PSHPHS  570
             +CCPP+P   D+V  Y+ P+   +R R PA    +EYI KY+ A + M+ LD  P  P  
Sbjct  110   SCCPPIPDDIDSVPYYKFPSMTKLRIRPPAHAVDEEYIAKYQLATSQMRELDKDPFGPIG  169

Query  571   FPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHRWYLYFYEKILGKLINDPTFAL  750
             F QQANIHCAYCNG Y+  G   +E+QVH SWLFFPFHRWYLYFYE+ILG LINDPTFAL
Sbjct  170   FKQQANIHCAYCNGAYKAGG---KELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFAL  226

Query  751   PYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIVDLNYAGKDRGLSDEELIAENL  930
             PYWNWD+  GM +P MF    SSLYDA RN ++    I+DL + G++   ++ + +  NL
Sbjct  227   PYWNWDHPKGMRLPPMFDVEGSSLYDAKRNQSHRNGKIIDLGFFGQETETTELQTMTNNL  286

Query  931   VAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIPHTPVHRWVGDSVDQPNGEDMG  1110
               +YR MVTN     LF G  Y  GT P PG G++E IPHTPVH W GDS  QPNGEDMG
Sbjct  287   TLMYRQMVTNAPCPLLFFGNPYPLGTDPKPGMGTIENIPHTPVHIWTGDSPRQPNGEDMG  346

Query  1111  NFYSAGRDPLFYSHHANVDRMWVIWQKLLGGK--DFTDDSWLNASFLFYDENEQPVRVYA  1284
             NFYSAG DP+FY HHANVDRMW  W K +GGK  D  D  WLN+ F FYDEN  P +V  
Sbjct  347   NFYSAGLDPVFYCHHANVDRMWNEW-KAIGGKRRDLADKDWLNSEFFFYDENRNPFKVKV  405

Query  1285  KDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNAPFVTDVFPVTLDKVVQVKVSR  1464
             +DC+D+  MG+DY     PW   KP    T+G A   + P  + VFP    +       R
Sbjct  406   RDCLDSKKMGFDYAPMPTPWRNFKPVRRTTSGKANTRSIPPASKVFPTCETRQSDFIFHR  465

Query  1465  PKT--SRTKAekekeeeVLVIDGIEVAMDQYARFDVYLN-DSDQPDGGKDKAQYAGGFAH  1635
               +    +KAEK ++E    I  I+    QY RFDV+LN D        D+ ++AG +  
Sbjct  466   QTSFVKDSKAEKNEQEGDTNIRQIQYDDSQYVRFDVFLNVDKTVKALELDQPEFAGSYTS  525

Query  1636  LPHKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVTLAPQVGGGVVDVDSIRIE  1800
             LPH          + +L + E LED   ED++++++TL P+ GG  + + +  I+
Sbjct  526   LPHVHGDKDRAPVTFKLAITELLEDNNLEDEESIVITLIPKAGGDGISIQNAVID  580



>gb|ABG23042.1| polyphenol oxidase [Oryza sativa Indica Group]
 gb|ABG23058.1| polyphenol oxidase [Oryza sativa Indica Group]
 gb|ABG23074.1| polyphenol oxidase [Oryza rufipogon]
Length=576

 Score =   418 bits (1075),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 233/500 (47%), Positives = 305/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  84    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  142

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  143   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  202

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P M+ +  S LYD  RN  +LPP  +
Sbjct  203   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAMYANRWSPLYDPRRNQAHLPPFPL  262

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL   YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  263   DLDYSGTDTNIPKDQLIDQNLNIRYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  322

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  323   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  381

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  382   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  435

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  436   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  495

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  496   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  555

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  556   IVPRCGCDSVTVAGVSIGYA  575



>gb|ABG23092.1| polyphenol oxidase [Oryza rufipogon]
Length=576

 Score =   418 bits (1074),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 306/500 (61%), Gaps = 17/500 (3%)
 Frame = +1

Query  334   IHYPNVSKCHYPSDVPANADITGTCCPPVPTDTV-LDYQIP-TGGPMRKRVPAQFATQEY  507
             I  P++  CH P DVPA A     CCP     TV +D+  P    P+R R  A  A + Y
Sbjct  84    IQAPDLGDCHQPVDVPATAPAI-NCCPTYSAGTVAVDFAPPPASSPLRVRPAAHLADRAY  142

Query  508   INKYEAALTAMKNLDPSHPHSFPQQANIHCAYCNGGYQQFGFPTEEIQVHNSWLFFPFHR  687
             + KYE A++ MK L    P SF QQ  +HCAYC+G Y Q GFP  EIQ+H+ WLFFP+HR
Sbjct  143   LAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYDQVGFPGLEIQIHSCWLFFPWHR  202

Query  688   WYLYFYEKILGKLINDPTFALPYWNWDNQSGMTMPNMFMSTTSSLYDANRNPNYLPPAIV  867
              YLYF+E+ILGKLI D TFALP+WNWD   GM+ P ++ +  S LYD  RN  +LPP  +
Sbjct  203   MYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAIYANRWSPLYDPRRNQAHLPPFPL  262

Query  868   DLNYAGKDRGLSDEELIAENLVAVYRSMVTNGGTTELFMGKKYVTGTPPSPGQGSVEGIP  1047
             DL+Y+G D  +  ++LI +NL  +YR M++     ELFMG+ Y  G  P PG G+VE +P
Sbjct  263   DLDYSGTDTNIPKDQLIDQNLNMMYRQMISGARKAELFMGQPYRAGDQPEPGAGTVESVP  322

Query  1048  HTPVHRWVGDSVDQPNGEDMGNFYSAGRDPLFYSHHANVDRMWVIWQKLL--GGKDFTDD  1221
             H PVHRW GD   QPNGEDMG FYSA RDP+F++HH NVDRMW I + LL  G  DFTD 
Sbjct  323   HNPVHRWTGDP-RQPNGEDMGIFYSAARDPVFFAHHGNVDRMWHIRRGLLFPGDTDFTDP  381

Query  1222  SWLNASFLFYDENEQPVRVYAKDCMDNIAMGYDYEYsslpwlkskpspskTTGAAAASNA  1401
              WL+ASF FYDE  + VRV  +D +D  A+ + Y+           +   +TG  AAS  
Sbjct  382   DWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQ----DVGLPWLNAKPSTG--AASTP  435

Query  1402  PFVTDVFPVTLDKVVQVKVSRPKTSRTKAekekeeeVLVIDGIEVA-MDQYARFDVYLND  1578
                   FP TLDK V+V V+RP+ SR++ EKE+EEEVLVI+GIE+     Y +FDV++N 
Sbjct  436   APAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVLVIEGIEIPDHSTYVKFDVFVNA  495

Query  1579  SDQPDGGKDKAQYAGGFAHLP----HKQESSSTTKTSVRLGLNEPLEDLGAEDDDTVLVT  1746
              +  DG    A    G   L     H++   S  KT  R G+ + L+D+GA+ D T++V+
Sbjct  496   PESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGADGDKTIVVS  555

Query  1747  LAPQVGGGVVDVDSIRIEYS  1806
             + P+ G   V V  + I Y+
Sbjct  556   IVPRCGCDSVTVAGVSIGYA  575



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6210644380388