BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78047_g1_i1 len=1645 path=[1:0-1644]

Length=1645
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                   480   2e-162   Ipomoea nil [qian niu]
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              404   2e-132   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              401   3e-131   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              395   8e-129   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           394   1e-128   
emb|CDO96758.1|  unnamed protein product                                393   3e-128   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           391   1e-127   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             390   5e-127   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           389   1e-126   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              389   2e-126   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           387   1e-125   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           386   2e-125   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     385   3e-125   Vitis vinifera
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     385   3e-125   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           384   9e-125   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           386   1e-124   
emb|CDO96757.1|  unnamed protein product                                379   2e-123   
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              380   4e-123   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         379   1e-122   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                379   2e-122   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          377   8e-122   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           377   2e-121   
emb|CBI30665.3|  unnamed protein product                                374   3e-121   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    375   3e-121   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           375   4e-121   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                374   1e-120   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           374   1e-120   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           372   2e-120   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           372   2e-120   
gb|KHN18919.1|  Phospholipase A1-IIgamma                                372   3e-120   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             372   7e-120   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           372   9e-120   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    370   2e-119   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   370   3e-119   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           368   1e-118   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              368   1e-118   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    368   2e-118   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           366   1e-117   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              366   2e-117   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                364   3e-117   
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           362   4e-116   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             361   6e-116   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                362   9e-116   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            360   2e-115   
ref|XP_002305750.2|  lipase class 3 family protein                      358   5e-115   Populus trichocarpa [western balsam poplar]
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                360   5e-115   
ref|XP_003593747.1|  Lipase                                             359   5e-115   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           358   7e-115   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           357   1e-114   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    357   3e-114   
ref|XP_002316835.2|  lipase class 3 family protein                      357   3e-114   Populus trichocarpa [western balsam poplar]
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           356   4e-114   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           356   8e-114   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    355   1e-113   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           355   2e-113   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                355   2e-113   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           353   4e-113   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             353   5e-113   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    353   5e-113   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   353   2e-112   Ricinus communis
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           352   4e-112   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   351   4e-112   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                353   6e-112   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           350   1e-111   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              349   4e-111   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           349   4e-111   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           348   4e-111   
emb|CDP11819.1|  unnamed protein product                                348   4e-111   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    348   9e-111   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              347   2e-110   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           347   3e-110   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           347   4e-110   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           346   4e-110   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   346   4e-110   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   346   5e-110   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       347   7e-110   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           345   1e-109   
gb|AFK47098.1|  unknown                                                 343   3e-109   
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           342   1e-108   
ref|XP_002525127.1|  triacylglycerol lipase, putative                   342   1e-108   Ricinus communis
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           342   2e-108   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              341   3e-108   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                343   3e-108   
gb|ABQ95989.1|  phospholipase A1                                        341   4e-108   Capsicum annuum
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           341   5e-108   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           340   1e-107   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    342   1e-107   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           339   5e-107   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           339   7e-107   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           338   7e-107   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           337   9e-107   
ref|XP_003608120.1|  Lipase                                             337   1e-106   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           337   2e-106   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          337   2e-106   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   336   3e-106   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    337   3e-106   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           337   3e-106   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             337   4e-106   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           336   1e-105   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    335   3e-105   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      333   5e-105   
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    332   5e-105   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           331   2e-104   
emb|CDY01554.1|  BnaC07g35440D                                          332   2e-104   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   332   2e-104   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    332   3e-104   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             332   3e-104   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           330   4e-104   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           330   6e-104   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           329   1e-103   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    330   1e-103   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                327   3e-103   
emb|CBI21954.3|  unnamed protein product                                328   3e-103   
ref|XP_003608122.1|  Lipase                                             328   3e-103   
ref|XP_002525129.1|  triacylglycerol lipase, putative                   328   4e-103   Ricinus communis
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           328   5e-103   
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    327   6e-103   
ref|XP_002867985.1|  lipase class 3 family protein                      328   1e-102   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                327   2e-102   
emb|CDY10187.1|  BnaC05g04300D                                          326   4e-102   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                327   5e-102   
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           325   5e-102   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                326   5e-102   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              325   6e-102   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           323   2e-101   
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             324   2e-101   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           324   3e-101   
ref|NP_193590.1|  phospholipase A1-IIgamma                              322   1e-100   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57813.1|  BnaA10g28020D                                          327   1e-100   
emb|CDM83551.1|  unnamed protein product                                321   2e-100   
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   320   3e-100   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           321   4e-100   
gb|EMT15519.1|  Lipase                                                  319   1e-99    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           320   1e-99    
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             319   1e-99    Oryza sativa Indica Group [Indian rice]
emb|CDM85400.1|  unnamed protein product                                319   1e-99    
dbj|BAJ96485.1|  predicted protein                                      318   1e-99    
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          318   2e-99    Sorghum bicolor [broomcorn]
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              319   2e-99    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             319   2e-99    
gb|ABR18391.1|  unknown                                                 319   2e-99    Picea sitchensis
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                319   3e-99    
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             318   4e-99    
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           317   9e-99    
ref|NP_172115.1|  phospholipase A1-IIalpha                              317   1e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDX86530.1|  BnaC08g01730D                                          317   1e-98    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              317   1e-98    
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           315   4e-98    
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             315   4e-98    Oryza sativa Japonica Group [Japonica rice]
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              316   4e-98    
gb|AAM61647.1|  lipase-like protein                                     315   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    314   7e-98    
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    314   8e-98    
ref|NP_001152663.1|  triacylglycerol lipase precursor                   315   8e-98    Zea mays [maize]
gb|ABK23399.1|  unknown                                                 315   9e-98    Picea sitchensis
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              314   2e-97    
ref|XP_002522552.1|  triacylglycerol lipase, putative                   313   3e-97    Ricinus communis
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          314   4e-97    Sorghum bicolor [broomcorn]
gb|EPS70940.1|  hypothetical protein M569_03817                         311   1e-96    
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg             310   1e-96    
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    311   2e-96    
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like           311   2e-96    
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           310   3e-96    
gb|EEE64775.1|  hypothetical protein OsJ_19631                          308   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           310   1e-95    
gb|EMS63185.1|  Phospholipase A1-II 1                                   320   2e-95    
ref|NP_001149813.1|  triacylglycerol lipase                             308   3e-95    Zea mays [maize]
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             308   3e-95    
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    306   3e-95    
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    307   4e-95    
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       306   1e-94    
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              306   1e-94    
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like           305   2e-94    
ref|NP_001151242.1|  triacylglycerol lipase                             306   2e-94    Zea mays [maize]
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    321   2e-94    
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like           305   2e-94    
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g             305   3e-94    
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              305   4e-94    
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             305   5e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           304   7e-94    
emb|CDY23963.1|  BnaC03g17280D                                          305   7e-94    
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like           304   8e-94    
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          305   1e-93    Sorghum bicolor [broomcorn]
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             302   3e-93    Oryza sativa Indica Group [Indian rice]
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                302   3e-93    
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             302   4e-93    
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             303   4e-93    
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like              302   6e-93    
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            302   7e-93    
ref|NP_001043730.2|  Os01g0651200                                       301   8e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              301   1e-92    
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            301   2e-92    
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 301   2e-92    
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g             301   2e-92    
gb|EMT21704.1|  Putative lipase                                         301   2e-92    
emb|CDX84801.1|  BnaA03g14290D                                          300   2e-92    
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          300   3e-92    Sorghum bicolor [broomcorn]
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          300   3e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            300   4e-92    
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like           298   5e-92    
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           299   6e-92    
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           300   8e-92    
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       315   1e-91    
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              297   3e-91    
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     297   8e-91    Zea mays [maize]
gb|ABK24664.1|  unknown                                                 297   1e-90    Picea sitchensis
gb|KDP46905.1|  hypothetical protein JCGZ_24114                         296   1e-90    
dbj|BAJ95995.1|  predicted protein                                      296   1e-90    
gb|ABK96341.1|  unknown                                                 294   3e-90    Populus trichocarpa x Populus deltoides
gb|EMT05578.1|  hypothetical protein F775_13080                         295   5e-90    
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              295   1e-89    
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             293   2e-89    Populus trichocarpa [western balsam poplar]
gb|EAY75192.1|  hypothetical protein OsI_03084                          293   3e-89    Oryza sativa Indica Group [Indian rice]
emb|CDX76515.1|  BnaA08g08850D                                          291   4e-89    
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    292   5e-89    
gb|EMT15520.1|  Feruloyl esterase A                                     299   5e-89    
gb|EMS52156.1|  Phospholipase A1-II 2                                   291   5e-89    
dbj|BAD68802.1|  lipase-like protein                                    291   9e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg             290   9e-89    
gb|KDP21072.1|  hypothetical protein JCGZ_21543                         291   1e-88    
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein          290   3e-88    
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like           288   6e-88    
gb|EAY99121.1|  hypothetical protein OsI_21080                          288   7e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein          288   9e-88    
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              288   2e-87    
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              288   2e-87    
gb|KDP46901.1|  hypothetical protein JCGZ_24110                         287   3e-87    
gb|KDP46903.1|  hypothetical protein JCGZ_24112                         287   3e-87    
emb|CDX99456.1|  BnaC01g10960D                                          287   3e-87    
dbj|BAJ85084.1|  predicted protein                                      288   4e-87    
gb|EMS51987.1|  Phospholipase A1-II 3                                   287   5e-87    
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           285   1e-86    
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         284   2e-86    
gb|EMT04701.1|  Lipase                                                  283   3e-86    
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              285   3e-86    
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          285   3e-86    Sorghum bicolor [broomcorn]
ref|XP_002892328.1|  predicted protein                                  282   3e-86    
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                  281   2e-85    
ref|NP_001043734.1|  Os01g0651800                                       282   4e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              283   4e-85    
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    282   4e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              281   8e-85    
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              280   2e-84    
ref|XP_007025428.1|  Alpha/beta-Hydrolases superfamily protein          278   3e-84    
gb|EMT11182.1|  hypothetical protein F775_27795                         280   9e-84    
gb|KDP21071.1|  hypothetical protein JCGZ_21542                         276   4e-83    
ref|NP_001056387.1|  Os05g0574100                                       276   4e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein          275   5e-83    
emb|CDY24728.1|  BnaC04g13330D                                          276   7e-83    
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              276   1e-82    
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            275   1e-82    
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              275   2e-82    
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              276   2e-82    
gb|EMS48809.1|  Phospholipase A1-II 6                                   276   3e-82    
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    273   4e-82    
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     271   5e-82    
ref|XP_003608142.1|  Lipase                                             271   6e-82    
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660          274   1e-81    Sorghum bicolor [broomcorn]
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2      269   3e-81    
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   273   4e-81    
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230          269   6e-81    Sorghum bicolor [broomcorn]
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          269   3e-80    Sorghum bicolor [broomcorn]
gb|EAY75191.1|  hypothetical protein OsI_03083                          267   3e-80    Oryza sativa Indica Group [Indian rice]
emb|CDY34061.1|  BnaC03g62710D                                          266   3e-79    
gb|EMS63050.1|  Phospholipase A1-II 5                                   269   4e-79    
gb|EMT30117.1|  Mono- and diacylglycerol lipase                         265   7e-79    
gb|EMS63790.1|  Phospholipase A1-II 7                                   268   1e-78    
gb|KDO38625.1|  hypothetical protein CISIN_1g0208022mg                  261   1e-78    
emb|CDY53993.1|  BnaA03g58180D                                          260   1e-77    
emb|CDM83808.1|  unnamed protein product                                264   1e-77    
gb|EMS68153.1|  Phospholipase A1-II 7                                   261   2e-77    
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              261   6e-77    
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like           259   1e-76    
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              260   2e-76    
ref|NP_001168256.1|  hypothetical protein                               258   3e-76    Zea mays [maize]
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             258   5e-76    
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              256   5e-76    
dbj|BAJ88202.1|  predicted protein                                      259   6e-76    
dbj|BAJ85876.1|  predicted protein                                      259   6e-76    
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                257   7e-76    
ref|XP_002522553.1|  triacylglycerol lipase, putative                   258   1e-75    
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             258   2e-75    
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   2e-75    
ref|XP_001781080.1|  predicted protein                                  255   3e-75    
ref|NP_001044041.1|  Os01g0710700                                       257   3e-75    
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like              257   4e-75    
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           256   5e-75    
emb|CDP15943.1|  unnamed protein product                                254   1e-74    
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    255   2e-74    
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   255   3e-74    
dbj|BAJ90094.1|  predicted protein                                      251   3e-74    
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    252   5e-74    
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              251   5e-74    
emb|CDO98286.1|  unnamed protein product                                253   6e-74    
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           253   9e-74    
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                     248   2e-73    
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010        250   3e-73    
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             251   3e-73    
gb|EEE55280.1|  hypothetical protein OsJ_03214                          256   4e-73    
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           251   4e-73    
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           250   4e-73    
emb|CBI21996.3|  unnamed protein product                                252   6e-73    
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     249   8e-73    
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         252   8e-73    
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    253   2e-72    
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    248   2e-72    
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    251   2e-72    
ref|NP_181797.1|  phospholipase A1-IIdelta                              248   3e-72    
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             248   3e-72    
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   249   3e-72    
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           252   3e-72    
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    251   3e-72    
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    251   3e-72    
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    250   4e-72    
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           247   5e-72    
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             250   5e-72    
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           247   6e-72    
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                246   1e-71    
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           246   1e-71    
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             246   1e-71    
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     247   1e-71    
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250          246   1e-71    
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             248   2e-71    
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    249   2e-71    
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   247   2e-71    
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    245   2e-71    
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           245   5e-71    
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                244   5e-71    
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                246   5e-71    
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    244   7e-71    
ref|XP_002891639.1|  lipase class 3 family protein                      248   7e-71    
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    247   8e-71    
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           244   9e-71    
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    247   1e-70    
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   244   1e-70    
gb|EPS65211.1|  hypothetical protein M569_09564                         244   1e-70    
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          247   1e-70    
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like           243   2e-70    
ref|XP_002303465.1|  lipase family protein                              243   2e-70    
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                244   2e-70    
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060          246   2e-70    
ref|XP_009415331.1|  PREDICTED: phospholipase A1-II 5-like              242   3e-70    
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260          242   4e-70    
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    244   6e-70    
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    244   8e-70    
gb|EPS65213.1|  hypothetical protein M569_09566                         241   9e-70    
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              244   9e-70    
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                241   1e-69    
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    244   1e-69    
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    244   1e-69    
emb|CDY50817.1|  BnaC04g52540D                                          240   2e-69    
ref|XP_003607601.1|  Feruloyl esterase A                                241   2e-69    
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              241   2e-69    
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     242   2e-69    
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   2e-69    
emb|CDM86669.1|  unnamed protein product                                244   2e-69    
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                244   3e-69    
gb|ACJ85535.1|  unknown                                                 241   3e-69    
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    243   3e-69    
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    243   3e-69    
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    243   3e-69    
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    243   3e-69    
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           242   3e-69    
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    243   4e-69    
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                242   6e-69    
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    242   6e-69    
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                     238   8e-69    
ref|XP_004243279.1|  PREDICTED: phospholipase A1-IIdelta                240   1e-68    
gb|EEE64776.1|  hypothetical protein OsJ_19632                          234   1e-68    
ref|XP_006348881.1|  PREDICTED: phospholipase A1-IIdelta-like           241   1e-68    
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   1e-68    
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         241   1e-68    
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              239   1e-68    
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           239   2e-68    
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   2e-68    
emb|CAN74039.1|  hypothetical protein VITISV_012945                     241   2e-68    
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          241   2e-68    
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    242   2e-68    
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    239   2e-68    
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           240   2e-68    
dbj|BAJ85518.1|  predicted protein                                      241   3e-68    
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             240   3e-68    
gb|EEC79153.1|  hypothetical protein OsI_19824                          242   3e-68    
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             239   4e-68    
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          241   4e-68    
gb|ABR17156.1|  unknown                                                 239   4e-68    
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    240   4e-68    
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    239   5e-68    
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                237   5e-68    
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         237   5e-68    
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    239   6e-68    
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                237   6e-68    
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       239   8e-68    
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    239   8e-68    
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             239   1e-67    
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             238   1e-67    
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    240   1e-67    
ref|NP_564590.1|  DAD1-like lipase 2                                    239   1e-67    
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                237   1e-67    
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             236   1e-67    
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          236   1e-67    
ref|XP_009593784.1|  PREDICTED: phospholipase A1-IIdelta                238   2e-67    
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    238   2e-67    
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           234   2e-67    
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    238   2e-67    
ref|XP_006304825.1|  hypothetical protein CARUB_v10012471mg             238   2e-67    
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    238   2e-67    
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          238   3e-67    
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     237   4e-67    
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         237   4e-67    
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             235   5e-67    
ref|XP_010460828.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    237   5e-67    
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    237   5e-67    
gb|KCW74059.1|  hypothetical protein EUGRSUZ_E02687                     233   6e-67    
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    236   7e-67    
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             235   8e-67    
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    236   8e-67    
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    236   8e-67    
gb|EPS66180.1|  hypothetical protein M569_08597                         233   1e-66    
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    235   2e-66    
ref|NP_174326.1|  DAD1-like acylhydrolase                               236   2e-66    
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    235   2e-66    
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             236   2e-66    
gb|ABR16123.1|  unknown                                                 236   2e-66    
ref|XP_010499568.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    235   3e-66    
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    235   3e-66    
emb|CDY49813.1|  BnaC06g04560D                                          235   3e-66    
ref|XP_002893614.1|  lipase class 3 family protein                      235   3e-66    
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          234   4e-66    
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    234   4e-66    
emb|CDY10774.1|  BnaA05g11620D                                          230   4e-66    
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    234   4e-66    
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    235   5e-66    
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    234   5e-66    
ref|XP_010478423.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    234   5e-66    
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642             231   6e-66    
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    234   6e-66    
gb|AAD01804.1|  lipase                                                  232   6e-66    
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    234   7e-66    
emb|CDY22842.1|  BnaA06g02350D                                          234   7e-66    
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg             234   7e-66    
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                    234   8e-66    
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    234   8e-66    
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   231   8e-66    
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    234   1e-65    
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    233   1e-65    
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    233   1e-65    
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    233   1e-65    
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             233   1e-65    
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    233   1e-65    
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           230   1e-65    
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    233   2e-65    
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             233   2e-65    
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg             233   2e-65    
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           230   2e-65    
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    233   2e-65    
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             230   2e-65    
gb|EAZ12914.1|  hypothetical protein OsJ_02837                          228   2e-65    
emb|CDY02287.1|  BnaA09g26150D                                          233   2e-65    
ref|XP_002982537.1|  hypothetical protein SELMODRAFT_445229             230   2e-65    
ref|XP_009629724.1|  PREDICTED: phospholipase A1-IIdelta-like           230   3e-65    
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                230   3e-65    
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    232   3e-65    
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    233   3e-65    
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          232   3e-65    
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    232   4e-65    
emb|CDY47985.1|  BnaA04g24630D                                          228   4e-65    
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    232   4e-65    
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          229   5e-65    
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    231   5e-65    
emb|CDY14851.1|  BnaC04g48480D                                          228   5e-65    
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     231   6e-65    
emb|CDY09593.1|  BnaC05g23260D                                          231   7e-65    
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    229   7e-65    
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    231   1e-64    
ref|XP_002981063.1|  hypothetical protein SELMODRAFT_113737             228   1e-64    
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    231   2e-64    
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    230   2e-64    
ref|XP_002531054.1|  triacylglycerol lipase, putative                   230   2e-64    
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    230   2e-64    
ref|XP_003607369.1|  Lipase                                             231   2e-64    
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          231   2e-64    
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    231   2e-64    
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    227   2e-64    
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    230   2e-64    
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             231   2e-64    
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         230   2e-64    
ref|XP_010525104.1|  PREDICTED: phospholipase A1-IIdelta                227   2e-64    
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    230   2e-64    
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    229   2e-64    
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    229   2e-64    
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    229   3e-64    
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    229   4e-64    
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    229   4e-64    
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    229   4e-64    
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg             229   5e-64    
dbj|BAJ99811.1|  predicted protein                                      229   6e-64    
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    231   6e-64    
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    228   7e-64    
emb|CDX77597.1|  BnaA07g07350D                                          226   8e-64    



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/403 (60%), Positives = 300/403 (74%), Gaps = 5/403 (1%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  IAKRW+VL+GSDNWEGLL+PLDSDLRRYLIHYG+M+    DSFI+E  SK  GL RY
Sbjct  1     MSGIAKRWKVLSGSDNWEGLLEPLDSDLRRYLIHYGTMVSPATDSFINEAASKNVGLPRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A+++LL   GL K NPFKY +TKYFY PST      G Y+V++ RADAV+KESNW GYVA
Sbjct  61    ARRNLLANCGLVKGNPFKYEVTKYFYAPSTIPLPDEG-YNVRATRADAVLKESNWNGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDIL+VWRGT  +SEW E+     VK  + F Q++  LVH+GWY+MYT
Sbjct  120   VATDEGKVALGRRDILIVWRGTIRKSEWNENLTFWFVKAPLFFGQNSDPLVHKGWYDMYT  179

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + NQDS LN  SARDQ+R EV RL++LYK+E++SITVTGHSLGSS+ATLNAVDLAANP N
Sbjct  180   TINQDSQLNEKSARDQIREEVARLVELYKDEDISITVTGHSLGSSMATLNAVDLAANPIN  239

Query  849   NT-DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
             N  ++L+TAFL+ASPKVG+E FK   S+ +NLRALR+ +  D+V  VP    + G    +
Sbjct  240   NNKNILVTAFLYASPKVGDENFKNVISNQQNLRALRISDVNDIVTAVPPFGWKEGDNTAI  299

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQ  493
             + Y DVGV   I++ KS Y+K D  N L  H LM+Y+H IDG+QG +G F+ Q  FD+ +
Sbjct  300   L-YGDVGVGLVIDSKKSHYLKPDFPN-LSTHDLMLYMHAIDGYQGSQGGFERQEDFDLAK  357

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             VNKYG  LK E  P+P  W+  K+KGMVQQDDG +ILDDHE D
Sbjct  358   VNKYGDYLKAE-YPIPIGWFNIKDKGMVQQDDGNYILDDHEVD  399



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   404 bits (1037),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/402 (53%), Positives = 265/402 (66%), Gaps = 16/402 (4%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M +IA+RWR L+G+++WEGLL+PLD DLRRYLIHYG M  A  D+F +   SKYAG  RY
Sbjct  27    MGNIAERWRFLSGNNSWEGLLNPLDDDLRRYLIHYGEMAQATRDAFNTNKLSKYAGSCRY  86

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +KK+LL   G+E  NPF Y +TKY Y  S+          ++S+  +A  KESNW G+VA
Sbjct  87    SKKNLLSRAGIEMPNPFNYEVTKYIYATSSVQVPE--ALFIKSLSREAWSKESNWVGFVA  144

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDI++ WRG+    EW  DF    V    IF Q +   VH GWY +YT
Sbjct  145   VATDEGKMALGRRDIVIAWRGSVQTMEWFNDFDFIQVSAPEIFGQKSIPKVHHGWYSVYT  204

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S++  S  N  SARDQV  EV RL++ YKNEE++ITVTGHS+G+++ATLNAVD+  N FN
Sbjct  205   SSDSRSPFNKASARDQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDIVFNEFN  264

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                  +TAFLFASP+VG+E FKK FS L NLRALRV N  D+VP             PL+
Sbjct  265   K-GFPVTAFLFASPRVGDENFKKTFSKLVNLRALRVRNAPDIVPN-----------YPLL  312

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y DVGVQ DI+ +KS Y+K    +   WH +  YLHG+ G QG KG FK +   DI  V
Sbjct  313   GYSDVGVQLDIDTTKSTYLKSPG-DESSWHNMDCYLHGVAGTQGSKGGFKLEVQHDISVV  371

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NKY   LK ++  VP  WWVEKNKGMVQQ DG+WIL DHE D
Sbjct  372   NKYLDALK-DEYGVPASWWVEKNKGMVQQQDGSWILMDHEDD  412



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   401 bits (1031),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 213/403 (53%), Positives = 269/403 (67%), Gaps = 17/403 (4%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M +IA+RWR L+G+++WEGLLDPLD+DLRRY+IHYG M  A  D+F +   SKYAG  RY
Sbjct  38    MGNIAERWRFLSGNNSWEGLLDPLDNDLRRYIIHYGGMAQATRDAFNTNKISKYAGSCRY  97

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +KK+LL + G+E +NPFKY +TKY Y  S+          ++S+  +A  KESNW G+VA
Sbjct  98    SKKNLLSQVGIEMSNPFKYEVTKYIYATSSVQVPE--ALIIKSLSREAWSKESNWVGFVA  155

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             VATD+GK  LGRRDI++ WRG+    EW  DF  I +  P I   Q +   VH GWY +Y
Sbjct  156   VATDEGKVALGRRDIVISWRGSVQTMEWFNDFDFIQVSAPEIFGHQKSIPKVHHGWYSVY  215

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  +  SAR+QV  EV RL++ YKNEE++ITVTGHS+G+++ATLNAVD+  N F
Sbjct  216   TSNDSRSPFSKASARNQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDMVFNGF  275

Query  852   NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
             N     +TAFLFASP+VG+E  KK FS L+NLR LRV N  D+VP             PL
Sbjct  276   NK-GFPVTAFLFASPRVGDENLKKTFSKLENLRTLRVRNAPDIVPN-----------YPL  323

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQ  493
             + Y DVGVQ DI+ +KS Y+K    +   WH +  YLHG+ G QG KG FK Q   DI  
Sbjct  324   LGYSDVGVQLDIDTTKSAYLKSPG-DESSWHNMDCYLHGVAGTQGSKGGFKLQVQHDISV  382

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             VNKY G LK ++  VP  WWVEKNKGMVQQ DG+WIL DHE D
Sbjct  383   VNKYLGALK-DEYGVPASWWVEKNKGMVQQQDGSWILMDHEDD  424



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   395 bits (1015),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 211/402 (52%), Positives = 258/402 (64%), Gaps = 16/402 (4%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M +I +RWR+L+G+ NWEGLLDPLD+DLRRYLI YG M  A  D+F +   SKYAG  RY
Sbjct  42    MGNITERWRILSGNSNWEGLLDPLDNDLRRYLIRYGEMTQAARDAFNTNKISKYAGTCRY  101

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +KK+    TG+E +NPFKY +TKY Y  S           ++S+  +A  KESNW G+VA
Sbjct  102   SKKNFFSRTGIEISNPFKYEVTKYIYATSAVQVPE--ALFIKSLSREAWSKESNWAGFVA  159

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATDKGK  LGRRDI++VWRG+    EW  DF    V    IF + +   VH GWY +YT
Sbjct  160   VATDKGKIALGRRDIVIVWRGSVQTLEWFNDFDFIQVSATKIFGEKSDPKVHHGWYSIYT  219

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N  SARDQV  EV RL++ YK EEVSITVTGHS+G+S+ATLNA D+  N  N
Sbjct  220   SDDSRSLFNKESARDQVLGEVKRLMEQYKTEEVSITVTGHSMGASMATLNAGDIVFNGIN  279

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                  +TAFLFASP+VG+E FK+ FS L+NLRALR+ N  DLVP             PL 
Sbjct  280   K-GFPVTAFLFASPRVGDENFKRTFSKLENLRALRIRNAPDLVPS-----------YPLF  327

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y DVGV+  I+  KS Y+K    +   +H    YLHGI G QG KG FK +   DI  +
Sbjct  328   GYSDVGVELAIDTRKSGYLKSPG-DQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLI  386

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NKY   LK ++  VPT WWVEKN GMVQQ +GTWIL DHE D
Sbjct  387   NKYLDALK-DEYGVPTSWWVEKNNGMVQQQNGTWILVDHEDD  427



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 209/400 (52%), Positives = 268/400 (67%), Gaps = 17/400 (4%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             ++IA+RWRVL+G++NWEGLLDPLD+DLRRYLIHYG M+ A+ D+F ++ TSKYAG SRY+
Sbjct  6     KNIAERWRVLSGNNNWEGLLDPLDNDLRRYLIHYGEMVQAIRDAFNNDETSKYAGCSRYS  65

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             KK+L  + G+E +NPFKY +TKY Y  S+        + ++S+  +A  KESNW G+VAV
Sbjct  66    KKNLFSKVGIEISNPFKYEVTKYVYATSSIQVPE--AFIIKSLSGEAWSKESNWIGFVAV  123

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+G+  LGRRDI++ WR T    EW  DF    V    IF +++   VH GWY MYTS
Sbjct  124   ATDEGEVALGRRDIVIAWRSTVVPMEWFNDFEFIRVSAPTIFGENSDPKVHHGWYSMYTS  183

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              +  S  N  SARDQV  EV RL++ YK EEVSITVTGHS+G+S+ATLNAVD+  N  N 
Sbjct  184   NDPRSLFNKASARDQVLGEVERLMEQYKTEEVSITVTGHSMGASIATLNAVDMVFNGINK  243

Query  846   TDVLITAFLFASPKVGNEGFKKAFSHLKN-LRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                 +TAFLFASP+VG+E F K FS L+N LRALRV N  D++P  PF           I
Sbjct  244   G-FPVTAFLFASPRVGDENFNKTFSELENQLRALRVRNIPDIIPHYPF-----------I  291

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y DVGV+  ++  KS+Y+K    +   WH L  YLHG+ G QG K  FK +   DI  V
Sbjct  292   GYSDVGVELIMDTRKSDYLKSGG-DYWTWHNLECYLHGVAGTQGSKEGFKLEVERDISLV  350

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             NK+   LK ++  VP  WWV +NKGMVQQ +G+WIL DHE
Sbjct  351   NKHMDTLK-DEYGVPVSWWVVENKGMVQQQNGSWILMDHE  389



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 268/409 (66%), Gaps = 22/409 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M+SIAKRW+VL+G+ +W+GLLDPLD DLRRY+IHYG M  A YDSF +E  S+YAG   Y
Sbjct  1     MDSIAKRWKVLSGNYDWDGLLDPLDYDLRRYIIHYGEMAQATYDSFNAEKASRYAGSCLY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AKK L  + GL+  NPFKY +TKY Y  S+        + V+S   +A  KESNW GYVA
Sbjct  61    AKKDLFAKVGLQNGNPFKYRVTKYLYATSSI--QLPDAFIVKSFSREAWSKESNWMGYVA  118

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             VATD+GK  LGRRDI++ WRGT    EW+ D   + +  P+I    D+   VH+GWY +Y
Sbjct  119   VATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVSVSAPKIFTENDDDPKVHQGWYSIY  178

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             T+ +  S  N  SARDQV  E+ RL++ +K EE+SITVTGHSLG+++ATLNAVD+ AN F
Sbjct  179   TTDDSRSPFNKISARDQVLDEIRRLVEEFKGEEISITVTGHSLGAAVATLNAVDIVANGF  238

Query  852   NNT------DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N +         +TAF++ASP+VG++GF+K FS  +NL+ LR+ N+ D+VP         
Sbjct  239   NKSVQNPGKACPVTAFVYASPRVGDQGFEKVFSQQQNLKVLRIRNSLDVVPN--------  290

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 PL+ Y DVG Q  I+ +KS+Y+K    N+  WH L  Y+HGI G QG +G FK   
Sbjct  291   ---YPLLGYADVGEQLGIDTTKSKYLKSPG-NLSSWHSLECYMHGIAGTQGLQGGFKLVA  346

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               D+  VNK+   LK E C VP  WW  +NKGMVQQ DG+W L+DHE D
Sbjct  347   NRDVALVNKHMDALKDEHC-VPVSWWCIQNKGMVQQSDGSWKLEDHEDD  394



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 208/412 (50%), Positives = 264/412 (64%), Gaps = 21/412 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SI KRWR+LNG +NW+ LLDPLD DLRR +IHYG M  A YD+FI+E  SK+AG SRY
Sbjct  2     MGSIDKRWRLLNGQENWKNLLDPLDIDLRRNIIHYGEMAQATYDTFITEKASKFAGSSRY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A+     + GL K NPFKY +TK+ Y  S         + ++S+  +A  +ESNW GYVA
Sbjct  62    ARADFFSKVGLVKTNPFKYQVTKFLYATSRIEVPE--AFIIKSLSREAWSRESNWMGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK VLGRRDI+V WRGT    EW++DF   +V    I    N   VH+GW  +YT
Sbjct  120   VATDEGKAVLGRRDIVVAWRGTVEDLEWVDDFSFNLVSASEILGGTNDPKVHQGWLSIYT  179

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N  SARDQV +EV RL++L+K+EE+SIT+TGHSLG++L TLNA D+ A+  N
Sbjct  180   SDDPRSPFNKASARDQVLSEVRRLVELFKDEEISITITGHSLGAALGTLNAADIVAHGLN  239

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                   +   L+TA LFASP+VG++ F++ FS L+NLR LRV N  D+VP          
Sbjct  240   KPRNHPHRACLVTAILFASPRVGDDNFQEVFSGLENLRLLRVRNALDVVPN---------  290

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PL+ Y DVG +  I+  KS+++K    N  +WH L  YLHG+ G QG KG FK +  
Sbjct  291   --YPLLGYSDVGEELAIDFRKSKFIKASA-NPSLWHNLECYLHGVAGTQGAKGGFKLEVG  347

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
              DI  VNK    LK E   VP  WW EKNKGMVQ+DDGTW L DHE D+  F
Sbjct  348   RDIALVNKTTDALKDEHL-VPVSWWCEKNKGMVQRDDGTWKLMDHEEDYPEF  398



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   390 bits (1003),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 209/408 (51%), Positives = 262/408 (64%), Gaps = 22/408 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G +NWEGLLDPLD DLRRY+IHYG M  A YD+F +E  SKYAG S YAK
Sbjct  22    SIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEMAQAAYDTFNTEKASKYAGDSIYAK  81

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K    + GL+K NP+KY +TK+FY  S         + +  +  +A  KESNW GYVAVA
Sbjct  82    KDFFSKVGLDKGNPYKYNVTKFFYATSQIHVPE--AFIIVPLSREAWSKESNWMGYVAVA  139

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD--NGSLVHRGWYEMYT  1030
             TD+GK VLGRRDI++ WRG+    EW+ D     V    IF  D  +   VH+GWY +YT
Sbjct  140   TDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYT  199

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +Q S  N  SARDQV  E+ RL+D YKNEE+SITVTGHSLG++LATLNAVD+AAN FN
Sbjct  200   SDDQRSPFNKTSARDQVIREIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFN  259

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                   N    +TA + ASP+VG+  FKK  S  ++LR LR+ N  D+VP          
Sbjct  260   KPGGQPNKACPVTAIILASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPK---------  310

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PLI Y+DVG +  I+ +KS+Y+K+   N   WH L +YLHG+ G QG KG F+ +  
Sbjct  311   --YPLIGYEDVGKELTIDTTKSKYLKNGTANFSGWHNLEVYLHGVAGTQGRKGGFQLEVN  368

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              DI  VNK    LK ++  VP  W + KNKGMVQQ DG+W L DHE D
Sbjct  369   RDISLVNKTMDNLK-DQYLVPVSWRILKNKGMVQQADGSWKLMDHEKD  415



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   389 bits (1000),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 208/409 (51%), Positives = 263/409 (64%), Gaps = 22/409 (5%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +SIAK+WR L+G +NWEGLLDPLD DLRRY+IHYG +  A YD+F +E  SKYAG S YA
Sbjct  21    DSIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSIYA  80

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             KK    + GL+K NP+KY +TK+FY  S         + +  +  +A  KESNW GYVAV
Sbjct  81    KKDFFSKVGLDKGNPYKYNVTKFFYATSQIHVPE--AFIIVPLSREAWSKESNWMGYVAV  138

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD--NGSLVHRGWYEMY  1033
             ATD+GK VLGRRDI++ WRG+    EW+ D     V    IF  D  +   VH+GWY +Y
Sbjct  139   ATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIY  198

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +Q S  N  SARDQV  E+ RL+D YKNEE+SITVTGHSLG++LATLNAVD+AAN F
Sbjct  199   TSDDQRSPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGF  258

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      N    +TA +FASP+VG+  FKK  S  ++LR LR+ N  D+VP         
Sbjct  259   NKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPK--------  310

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 PLI Y+DVG +  I+ + S+Y+K+   N   WH L +YLHG+ G QG KG F+ + 
Sbjct  311   ---YPLIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRKGGFQLEV  367

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    LK ++  VP  W + KNKGMVQQ DG+W L DHE D
Sbjct  368   NRDISLVNKTMDSLK-DQYLVPVSWRILKNKGMVQQADGSWKLMDHEKD  415



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 209/398 (53%), Positives = 261/398 (66%), Gaps = 16/398 (4%)
 Frame = -2

Query  1557  AKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKS  1378
             A+RWR+L+G++NWEGLLDPLD+DLRRYLI YG M  A  D+F +   SKYAG  RY+KK+
Sbjct  48    AERWRLLSGNNNWEGLLDPLDNDLRRYLIRYGEMAQAARDAFNTNKMSKYAGSCRYSKKN  107

Query  1377  LLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATD  1198
             L   TG+E +NPFKY +TKY Y  S+          ++S+  +A  KESNW G+VAVATD
Sbjct  108   LFSRTGIEISNPFKYEVTKYIYATSSVQVPD--ALFIKSLSREAWSKESNWVGFVAVATD  165

Query  1197  KGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTNQ  1018
             KGK  LGRRDI++VWRG+    EW  DF    V    IF + +   VH GWY +YTS + 
Sbjct  166   KGKIALGRRDIVIVWRGSVQTMEWFNDFDFIQVSSPKIFGEKSDPKVHHGWYSIYTSDDS  225

Query  1017  DSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTDV  838
              S  N  SARDQV  EV RLL+ YK +EV+ITVTGHS+G+++ATLNA D+  N  N    
Sbjct  226   RSPFNKGSARDQVLGEVQRLLEQYKKDEVTITVTGHSMGAAMATLNAGDIVFNGINK-GF  284

Query  837   LITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKD  658
              +TAFLFASP+VG+E FKK FS L+NLRALR+ N+ D+VP             PL  Y D
Sbjct  285   PVTAFLFASPRVGDENFKKTFSKLENLRALRIRNDPDIVPN-----------YPLFGYSD  333

Query  657   VGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQVNKYG  478
             VGV+  I+  KS Y+K    +   +H    YLHGI G QG KG FK +   DI  +NKY 
Sbjct  334   VGVELVIDTRKSGYLKSPG-DQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYL  392

Query  477   GMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               LK ++  VPT WWVEKNKGMVQQ +G+WIL DHE D
Sbjct  393   DALK-DEYGVPTSWWVEKNKGMVQQQNGSWILVDHEDD  429



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/421 (49%), Positives = 266/421 (63%), Gaps = 23/421 (5%)
 Frame = -2

Query  1599  HSEkknnnkKMESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEP  1420
             +SE  +      SI KRW+ L+G +NWEGLLDPLD DLR+Y+IHYG M  A YD+F +E 
Sbjct  28    NSENMDTIISKHSIVKRWKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTER  87

Query  1419  TSKYAGLSRYAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVM  1240
              SK+AG SRYA+KS     GLEKAN F+Y +TK+ Y  S         + V+S+  +A  
Sbjct  88    ASKFAGSSRYARKSFFSRVGLEKANAFRYNVTKFLYATSQIQVPE--AFIVKSLSREAWS  145

Query  1239  KESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL  1060
             KESNW GYVAVATD+GK +LGRRDI++ WRGT    EW+ D    MV    I  ++  + 
Sbjct  146   KESNWIGYVAVATDEGKALLGRRDIVIAWRGTVRSLEWVNDLHFSMVSASNILGEEADAK  205

Query  1059  VHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLN  880
             VH+GWY +YTS +  S  N  SAR+QV AEV RL++ YK+EE+SIT+TGHSLG+++ATL+
Sbjct  206   VHQGWYSIYTSDDSHSPFNKTSARNQVLAEVSRLVEQYKDEEISITITGHSLGAAIATLS  265

Query  879   AVDLAANPFNN---------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGD  727
             AVD+ AN  N          +   +TAF+FA P+VG+  FKK FS   NLR LRV N  D
Sbjct  266   AVDIVANGINKPKDQTANKLSSCPVTAFVFACPRVGDSNFKKLFSSYNNLRVLRVSNALD  325

Query  726   LVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDG  547
             +VP  PF          L+ Y +VG +  I++ KS Y+K    +VL WH L  YLHG+ G
Sbjct  326   IVPNYPF----------LVGYSEVGEELGIDSRKSSYLKSPG-SVLSWHNLEGYLHGVAG  374

Query  546   FQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEA  367
              QG KG FK +   DI  VNK    LK E+  VP  W  EK+KGMVQ +DG+W L DHE 
Sbjct  375   TQGSKGGFKLEVKRDIALVNKSHDALK-EEYLVPVSWRCEKDKGMVQMEDGSWQLMDHEE  433

Query  366   D  364
             +
Sbjct  434   E  434



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/409 (49%), Positives = 260/409 (64%), Gaps = 21/409 (5%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             + I +RWR+L+G +NWEGLLDPLD DLRR +IHYG M  A YD+F +E  S++AG SRYA
Sbjct  15    DEIPRRWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYA  74

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             K+    + GL+  NPFKY++TK+ Y  S         + ++ +  +A  KESNW GYVAV
Sbjct  75    KRDFFSKVGLDNGNPFKYSVTKFLYATSEIHVPD--AFLIKPLSREAWRKESNWIGYVAV  132

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+GK  LGRRD++V WRGT+   EW++DF   +V    +  + N   V +GWY +Y S
Sbjct  133   ATDEGKAALGRRDVVVAWRGTKQTLEWVDDFEFILVSASKVLGKANDPKVQKGWYSIYNS  192

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
             ++  S  N  SAR QV  E+ RL+DLYKNEE+SITVTGHSLG+++ATLNAVD+ AN FN 
Sbjct  193   SDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDIVANAFNK  252

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                       +TAF FASP+VG+  F+K FS L +LR LRV N  D+VP           
Sbjct  253   PIGHQTNGCPVTAFAFASPRVGDSNFRKLFSELADLRVLRVRNALDIVPN----------  302

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               PL+ Y DVG +  +++ KS+Y+K    NV  WHGL +YLH   G QG  G F+     
Sbjct  303   -YPLLGYSDVGEELAVDSRKSKYLKSPG-NVSSWHGLEVYLHCAAGTQGTNGGFELMVDR  360

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
             D+  +NK    LKVE   VP  WW  KNKGMVQQ DG+W L DHEAD +
Sbjct  361   DVALINKSLDALKVEYL-VPASWWCPKNKGMVQQADGSWKLMDHEADDL  408



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   385 bits (990),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 206/407 (51%), Positives = 263/407 (65%), Gaps = 17/407 (4%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M+SIAK+WR L+G +NWEGLLDPLD DLRRY+IHYG M  A YD+F SE  S++AG SRY
Sbjct  16    MDSIAKKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRY  75

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AKK    + G++  NPFKY +TKY Y  S        G+ ++S+  +A  KESNW GYVA
Sbjct  76    AKKDFFSKVGIDIGNPFKYYVTKYLYATSEIQVPD--GFILKSLSREAWSKESNWMGYVA  133

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMY  1033
             VATD+GK VLGRRDI++ WRGT    EW+ DF   +V    I  +  G   VH+GWY +Y
Sbjct  134   VATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIY  193

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  +  SARDQV  EV RL++ +KNEE+SI++TGHSLG+++ATLNAVD+ AN  
Sbjct  194   TSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGL  253

Query  852   NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
             N     +TA +FASP+VG+  F K FS LKNLR LRV N  D++P             PL
Sbjct  254   NQ-GCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPN-----------YPL  301

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQ  493
             + Y DVG +  ++  KS+Y+K    N+  WH L  +LHG+ G QG +G F+ +   DI  
Sbjct  302   LGYSDVGEELGVDTRKSKYLKSPG-NLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIAL  360

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             VNK    L  E   VP  W  EKNKGMVQQ DG+W L DHE D +VF
Sbjct  361   VNKSIDALNDEYL-VPVSWRCEKNKGMVQQVDGSWKLMDHEEDDLVF  406



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   385 bits (990),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 261/407 (64%), Gaps = 21/407 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             S+AK+WR+L+G D+WE LLDPL+ DLRRY++HYG M  A YD+FI+E  SK+AG  RYA+
Sbjct  20    SVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRYAR  79

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             +    + GLE  NP+KY++TK+ Y  S         + V+S+  +A  KESNW GYVAVA
Sbjct  80    RDFFSKVGLELGNPYKYSVTKFLYATSQV--QVPDAFIVKSLSREAWSKESNWIGYVAVA  137

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK VLGRRDI++ WRGT    EW+ DF   +V    I  +     VH+GWY +YTS 
Sbjct  138   TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQGWYSIYTSD  197

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N  SARDQV  EV RL++LYKNEE+SITVTGHSLG+++ATLNAVD+ AN  N  
Sbjct  198   DSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDIVANGLNQP  257

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FASPKVG+  F +AFS  ++LRALR+ N  D+VP  P L       
Sbjct  258   KDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIVPSYPIL-------  310

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
                  Y +VGV+  IN  KS+Y+K    +   WH L  YLHG+ G QG KG FK +   D
Sbjct  311   ----DYTEVGVELGINTRKSQYLKSPG-STSSWHNLECYLHGVAGTQGSKGGFKLEINRD  365

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             +  VNK    LK E   VP  W  EKNKGMVQQ+DG+W L DHE D+
Sbjct  366   VSLVNKRLDGLKDEYL-VPVSWRCEKNKGMVQQEDGSWKLMDHEEDN  411



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   384 bits (987),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 201/409 (49%), Positives = 260/409 (64%), Gaps = 21/409 (5%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             + I ++WR+L+G +NWEGLLDPLD DLRR +IHYG M  A YD+F +E  S++AG SRYA
Sbjct  15    DEIPRKWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYA  74

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             K+    + GL+K NPFKY++TK+ Y  S         + ++ +  +A  KESNW GYVAV
Sbjct  75    KRDFFSKVGLDKGNPFKYSVTKFLYATSEIHVPD--AFLIKPLSREAWRKESNWIGYVAV  132

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+GK  LGRRDI+V WRGT+   EWI+DF   +V    +  + N   VH+GWY +Y S
Sbjct  133   ATDEGKTALGRRDIVVAWRGTKQTLEWIDDFEFNLVSASKVLGEANDPKVHQGWYSIYNS  192

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
             ++  S  N  SAR QV  E+ RL+DLYKNEE+SITVTGHSLG+++ATLNAVD+ AN FN 
Sbjct  193   SDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDITANAFNK  252

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                       +TA  FASP+VG+  F+K FS L +LRALRV N  D+VP           
Sbjct  253   PIGHQTNGCPVTAITFASPRVGDSNFRKVFSELADLRALRVRNALDIVPN----------  302

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               PLI Y DVG +  +++ KS+Y+K    NV  WHGL +YLH + G QG    F+     
Sbjct  303   -YPLIGYSDVGEELAVDSRKSKYLKSPG-NVSSWHGLEVYLHCVAGTQGTNDGFELMVDH  360

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
             D   +NK    LK E   VP  WW  KNKGMVQQ DG+W L D+EAD +
Sbjct  361   DATLINKALDALKDEYL-VPASWWCPKNKGMVQQADGSWKLMDYEADDL  408



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   386 bits (991),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 261/407 (64%), Gaps = 21/407 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             S+AK+WR+L+G D+WE LLDPL+ DLRRY++HYG M  A YD+FI+E  SK+AG  RYA+
Sbjct  60    SVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRYAR  119

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             +    + GLE  NP+KY++TK+ Y  S         + V+S+  +A  KESNW GYVAVA
Sbjct  120   RDFFSKVGLELGNPYKYSVTKFLYATSQV--QVPDAFIVKSLSREAWSKESNWIGYVAVA  177

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK VLGRRDI++ WRGT    EW+ DF   +V    I  +     VH+GWY +YTS 
Sbjct  178   TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQGWYSIYTSD  237

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N  SARDQV  EV RL++LYKNEE+SITVTGHSLG+++ATLNAVD+ AN  N  
Sbjct  238   DSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDIVANGLNQP  297

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FASPKVG+  F +AFS  ++LRALR+ N  D+VP  P L       
Sbjct  298   KDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIVPSYPIL-------  350

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
                  Y +VGV+  IN  KS+Y+K    +   WH L  YLHG+ G QG KG FK +   D
Sbjct  351   ----DYTEVGVELGINTRKSQYLKSPG-STSSWHNLECYLHGVAGTQGSKGGFKLEINRD  405

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             +  VNK    LK E   VP  W  EKNKGMVQQ+DG+W L DHE D+
Sbjct  406   VSLVNKRLDGLKDEYL-VPVSWRCEKNKGMVQQEDGSWKLMDHEEDN  451



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/408 (49%), Positives = 260/408 (64%), Gaps = 44/408 (11%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M+SI KRW VL+G++NW+GLLDPLD DLR+Y+IHYG M  A YDSF +E  S+YAG   Y
Sbjct  1     MDSIDKRWEVLSGNNNWDGLLDPLDYDLRQYIIHYGEMAQATYDSFNAEKASRYAGSCLY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AKK L  + GL+  NPFKY +TKY                         +KESNW GYVA
Sbjct  61    AKKDLFAKVGLQNGNPFKYRVTKY-------------------------LKESNWMGYVA  95

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDI++ WRGT    EW+ D    +V    IF +++   VH+GWY +YT
Sbjct  96    VATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVLVSAPKIFGENDDPKVHQGWYSIYT  155

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + +  S  N  SARDQV  EV RL++ +K+EE+SITVTGHSLG+++ATLNAVD+ AN FN
Sbjct  156   TDDSRSPFNKTSARDQVLDEVRRLVEEFKDEEISITVTGHSLGAAVATLNAVDIVANGFN  215

Query  849   NT------DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              +         +TAF++ASP+VG +GFKK FS  +NLR LR+ N+ D+VP          
Sbjct  216   KSLENPGKACPVTAFVYASPRVGGQGFKKVFSQQQNLRVLRIQNSLDVVPN---------  266

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PL+ Y DVG +  I+ +KS+Y+K+   N+  WH L  Y+HG+ G QG +  FK    
Sbjct  267   --YPLLGYADVGEELRIDTTKSKYLKNPG-NLSSWHSLECYMHGVAGKQGLQEGFKLVVN  323

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              D+  +NKY  +LK E C VP  WW  +NKGMVQQ DG+W L+DHE D
Sbjct  324   RDVALLNKYMDVLKDEHC-VPVSWWCIQNKGMVQQADGSWELEDHEDD  370



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score =   380 bits (975),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 210/403 (52%), Positives = 265/403 (66%), Gaps = 26/403 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RW +L+G +NWEGLLDPLD DLRRYLIHYG M  A+YDSF +E  SKY G SRY+K
Sbjct  31    NIAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAIYDSFNNEKVSKYRGTSRYSK  90

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+L    GL +    KY ITKYFY  S+                   +K SNW G+VAVA
Sbjct  91    KNLFTRVGLHRN---KYEITKYFYGASSKTEK---------------VKVSNWIGFVAVA  132

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMYTS  1027
             TD+GK  LGRRDIL+VWRGT T SEW +DF   MV+P  IF ++  + LVH+G+Y +YTS
Sbjct  133   TDEGKVALGRRDILIVWRGTITVSEWNDDFESSMVQPIEIFRENTDNILVHKGFYSIYTS  192

Query  1026  TNQDSHLN-SNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
              N  S+ N + SARDQV  EV RL+D YK EEVSI+VTGHSLGSSLATL A+D+A +  N
Sbjct  193   LNHASNFNRTTSARDQVLEEVKRLMDQYKKEEVSISVTGHSLGSSLATLCAIDIAVSQVN  252

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                  +TAFLFASP+VG   FKKA  +LKNL  LR+ N  DL+  +P      G      
Sbjct  253   K-GFPVTAFLFASPRVGEINFKKACENLKNLHILRITNASDLITKLPDRGQVEGCETDWR  311

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y+DVG +  I+ +KS+Y+K +    +  H L +YLHGI G  G +GEFK +   DI  +
Sbjct  312   VYEDVGFELSIDTTKSDYLKKE----INGHILEVYLHGIAGTHGFEGEFKLEMNRDIALM  367

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             NK   +LK ++  VP  WW+EKNKGMVQ ++G+WIL DHE DH
Sbjct  368   NKADDVLK-DEYGVPASWWIEKNKGMVQHENGSWILMDHEDDH  409



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   379 bits (972),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/407 (51%), Positives = 262/407 (64%), Gaps = 22/407 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRW+ L+G +NW+ LL+PLD DLRR++IHYG M  A YD+F S+  SK+AG S YAK
Sbjct  5     SIAKRWKHLSGENNWKNLLEPLDIDLRRFIIHYGEMAQATYDAFNSQKASKFAGSSLYAK  64

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                  + GL+K NP+KYT+TK+FY  S         + V+S+  +A  KESNW GY+AVA
Sbjct  65    NGFFSKVGLDKGNPYKYTVTKFFYATSQIQLPE--AFIVKSLSREAWSKESNWMGYIAVA  122

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-NGSLVHRGWYEMYTS  1027
             TD+G  VLGRRDI++ WRGT    EW++D    +V    +  +  N   VH+GW+ +YTS
Sbjct  123   TDEGTAVLGRRDIVIAWRGTVRTLEWVDDLEFVLVSASDLLGESGNDPKVHQGWHSVYTS  182

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              +  S  N +SARDQV  EV RL++ YKNEE+SITV GHSLG++LATLNAVD+ AN FN 
Sbjct  183   DDPLSPFNKSSARDQVLNEVRRLVEKYKNEEISITVCGHSLGAALATLNAVDIIANGFNK  242

Query  846   TDVL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
             +         +TA +FASP+VG+ GFKK FS  K LRALR+ NN D+VP           
Sbjct  243   SKTFPNKACPVTAIVFASPRVGDSGFKKVFSGYKELRALRIHNNLDIVPN----------  292

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               PLI Y +VG +  I+ +KS Y+K    NV  WH L  YLHG+ G QG KG FK +   
Sbjct  293   -YPLIGYAEVGEELVIDTTKSNYLKSPG-NVSSWHNLEGYLHGVAGTQGSKGGFKLEINR  350

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             DI  VNK    LK E   VP  W ++KNKGMVQQ DG+W L DHE D
Sbjct  351   DIALVNKSLDGLKDEYL-VPPSWRIQKNKGMVQQSDGSWKLMDHEED  396



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/410 (48%), Positives = 261/410 (64%), Gaps = 20/410 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+W+ L+G + W+GLLDPL+ DLRRY+IHYG M  A YD+F SE TSKYAG SRYA+
Sbjct  35    SIAKKWKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYAR  94

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+   + GLEK NPFKY +TK+ Y  S         + ++S+  ++  KESNW  Y+AVA
Sbjct  95    KNFFSKVGLEKGNPFKYNVTKFVYATSQIQVPE--AFLIKSLSRESWCKESNWMAYIAVA  152

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK VLGRRDI++ WRGT    EW+ D +  +V    I  ++    VH+GWY +YTS 
Sbjct  153   TDEGKAVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQGWYSIYTSD  212

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N  SAR QV  EV RL++ YK+EE+SIT+TGHSLG+++ATL+A+D+ AN  N  
Sbjct  213   DSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVANGLNRP  272

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N    +TA +FASP+VGN  F+K FS  K+LRALR+ N  D+VP  P         
Sbjct  273   KDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYPI--------  324

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
               L+ Y DVG +  I+  KS+Y+K     V+ WH +  YLHG+ G QG KG FK +   D
Sbjct  325   --LLGYSDVGEELKIDTQKSKYLKSPG-GVVSWHNMEGYLHGVAGTQGSKGGFKLEVKRD  381

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             I  VNK    LK E+  +P  W  EKNK M Q +DG+W+L DHE D   F
Sbjct  382   IALVNKSVDALK-EEYLIPASWRCEKNKCMTQLEDGSWVLKDHEEDDDQF  430



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   377 bits (968),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 206/406 (51%), Positives = 258/406 (64%), Gaps = 22/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRW+ L+G ++W  LLDPLD DLRRY+IHYG M  A YD+F +E  SK+AG S Y K
Sbjct  21    SIAKRWKPLSGQNHWGELLDPLDIDLRRYIIHYGEMAQATYDAFNNEKASKFAGSSLYGK  80

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             +    +  LEK NP++Y +TK+ Y  S         + V+S   +A  KESNW GYVAVA
Sbjct  81    EDFFSKVNLEKGNPYRYQVTKFLYATSQIQLPE--AFIVKSSSREAWSKESNWIGYVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
             TD+GK+VLGRRDI++ WRGT    EWI D    +V P  IF  +   + VH GWY +YTS
Sbjct  139   TDEGKDVLGRRDIVIAWRGTVQTLEWINDIEFNLVSPEKIFGHERRDIKVHEGWYSIYTS  198

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              +  S  N +SARDQV  EV RL+D +KNEE+SITVTGHSLG++LATLNA+D+ AN +N 
Sbjct  199   EDSRSPYNKSSARDQVLNEVRRLVDQFKNEEISITVTGHSLGAALATLNAIDIVANGYNR  258

Query  846   TDVL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                       +TAFLFASP+VG+  FKKAF+  K+LRALRV N  D+VP           
Sbjct  259   PKSQSRKASPVTAFLFASPRVGDSDFKKAFTGFKDLRALRVGNALDVVPN----------  308

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               PL+ Y DVG +  I+  KS+Y+ +   N+  WH L  YLHG+ G QG KG F      
Sbjct  309   -YPLVGYSDVGEELAIDTRKSKYL-NSPGNLSSWHNLEAYLHGVAGTQGSKGGFALVVNR  366

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEA  367
             DI  VNK    LK E   VP  W +EKNKGMVQQ+DG+W L DHE 
Sbjct  367   DIALVNKSIDGLKDEYL-VPVSWRIEKNKGMVQQEDGSWKLMDHEG  411



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/404 (49%), Positives = 256/404 (63%), Gaps = 20/404 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+W+ L+G  NWEGLLDPLD DLRRY+IHYG M  A YD+F +E TSKYAG SRYA+
Sbjct  44    SIAKKWKHLSGEHNWEGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKTSKYAGSSRYAR  103

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+   + GLEKANPFKY +TK+ Y  S         + ++S+  ++  KESNW  YVAVA
Sbjct  104   KNFFSKVGLEKANPFKYNVTKFVYATSQIQVPE--AFLIKSLSRESWCKESNWMAYVAVA  161

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D +  +V    I +++    VH+GWY +YTS 
Sbjct  162   TDEGKAALGRRDIVIAWRGTVQSLEWVSDLQFNLVSASNILSEEGDPKVHQGWYSIYTSN  221

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N  SAR QV  EV RL++ YK+EE+SIT+TGHSLG+++ATL+A+D+ AN  N  
Sbjct  222   DSHSPFNKTSARHQVIEEVRRLVEQYKDEEISITITGHSLGAAIATLSAIDIVANGLNRP  281

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N    +TA LFASP+VGN  F+K FS  K+LRALRV N  D+VP  P         
Sbjct  282   KDLPNKACPVTAILFASPRVGNSNFEKVFSGYKDLRALRVRNALDVVPNYPI--------  333

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
                  Y DVG +  I+  KS+Y+K     V  WH +  YLHG+ G QG K  FK +   D
Sbjct  334   --FFGYSDVGEELTIDTQKSKYLKSPG-GVASWHNMEGYLHGVAGTQGSKRGFKLEVKRD  390

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             I  VNK    LK E+  +P  W  EKNK M Q +DG+W+L DHE
Sbjct  391   IALVNKSTDALK-EEYLIPASWRCEKNKCMTQLEDGSWVLMDHE  433



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   374 bits (959),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/407 (50%), Positives = 254/407 (62%), Gaps = 40/407 (10%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M+SIAK+WR L+G +NWEGLLDPLD DLRRY+IHYG M  A YD+F SE  S++AG SRY
Sbjct  1     MDSIAKKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AKK    + G++  NPFKY +TKYF                         KESNW GYVA
Sbjct  61    AKKDFFSKVGIDIGNPFKYYVTKYF-------------------------KESNWMGYVA  95

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMY  1033
             VATD+GK VLGRRDI++ WRGT    EW+ DF   +V    I  +  G   VH+GWY +Y
Sbjct  96    VATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIY  155

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  +  SARDQV  EV RL++ +KNEE+SI++TGHSLG+++ATLNAVD+ AN  
Sbjct  156   TSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGL  215

Query  852   NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
             N     +TA +FASP+VG+  F K FS LKNLR LRV N  D++P             PL
Sbjct  216   NQG-CPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPN-----------YPL  263

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQ  493
             + Y DVG +  ++  KS+Y+K    N+  WH L  +LHG+ G QG +G F+ +   DI  
Sbjct  264   LGYSDVGEELGVDTRKSKYLKSPG-NLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIAL  322

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             VNK    L  E   VP  W  EKNKGMVQQ DG+W L DHE D +VF
Sbjct  323   VNKSIDALNDEYL-VPVSWRCEKNKGMVQQVDGSWKLMDHEEDDLVF  368



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   375 bits (963),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 208/402 (52%), Positives = 265/402 (66%), Gaps = 27/402 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA+RW +L+G +NWEGLLDPLD DLRRYLIHYG M  A+ DSF +E  SKY G SRY+K
Sbjct  31    SIAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNNEKVSKYRGTSRYSK  90

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+L    GL+K NP  Y ITKY Y  S+                    KESNW G+VAVA
Sbjct  91    KNLFTRVGLDK-NP--YEITKYVYAASSKTEE---------------TKESNWIGFVAVA  132

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMYTS  1027
             TD+GK  LGRRDIL+ WRGT+T+SE  ED +  +V+P  IF ++  + LVH+G+Y +YT 
Sbjct  133   TDEGKVALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHKGFYSVYTC  192

Query  1026  TNQDSHLN-SNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
              N+ S+ N + SARDQV  E+ RLL  Y  EE+SI+VTG S+GSSL TL A+D+  N  N
Sbjct  193   LNEASNFNRTTSARDQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAIDIVVNEIN  252

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVP-MVPFLAVEAGTILPL  673
               +  +TAFLF+SP+VG   FKKA+ +LKNL  LR+ N  D +P ++    VE   I   
Sbjct  253   K-EFPVTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKLMERGQVEGCAITEW  311

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQ  493
              AY+DVG +  I+ +KSEY+K D    +  H L +YLHGI G  G +GEFK +   DI  
Sbjct  312   RAYEDVGFELVIDTTKSEYLKKD----IFSHFLEVYLHGIAGTHGVEGEFKLEINRDIAL  367

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEA  367
             VNK G  LK E+  VP+ WW+EKNKGMVQQ+DG+WIL DHE 
Sbjct  368   VNKQGDFLK-EEYGVPSAWWIEKNKGMVQQEDGSWILIDHET  408



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   375 bits (964),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 197/410 (48%), Positives = 260/410 (63%), Gaps = 20/410 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+W+ L+G + W+GLLDPL+ DLRRY+IHYG M  A YD+F SE TSKYAG SRYA+
Sbjct  35    SIAKKWKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYAR  94

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+   + GLEK NPFKY +TK+ Y  S         + ++S+  ++  KESNW  Y+AVA
Sbjct  95    KNFFSKVGLEKGNPFKYNVTKFVYATSQIPIPE--AFLIKSLSRESWCKESNWMAYIAVA  152

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK VLGRRDI++ WRGT    EW+ D +  +V    I  ++    VH+GWY +YTS 
Sbjct  153   TDEGKAVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQGWYSIYTSD  212

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N  SAR QV  EV RL++ YK+EE+SIT+TGHSLG+++ATL+A+D+ AN  N  
Sbjct  213   DSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVANGLNRP  272

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N    +TA +FASP+VGN  F+K FS  K+LRALR+ N  D+VP  P         
Sbjct  273   KDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYPI--------  324

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
               L+ Y DVG +  I+  KS+Y+K     V  WH +  YLHG+ G QG KG FK +   D
Sbjct  325   --LLGYSDVGEELKIDTQKSKYLKSPG-GVASWHNMEGYLHGVAGTQGSKGGFKLEVKRD  381

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             I  VNK    LK E+  +P  W  E+NK M Q +DG+W+L DHE D   F
Sbjct  382   IALVNKSVDALK-EEYLIPASWRCEENKCMTQLEDGSWVLKDHEDDDDQF  430



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 208/405 (51%), Positives = 266/405 (66%), Gaps = 21/405 (5%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW++L+G++ WEGLLDPLD DLRRY+IHYG M  A YD+F SE  SKYAG SRYAK+
Sbjct  28    IAKRWKLLSGTNQWEGLLDPLDLDLRRYIIHYGEMAQAAYDTFNSEKASKYAGSSRYAKE  87

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +L  + G+E+ANPFKY +TKYFY  S+T       + ++S   +A  +ESNW GYVAVAT
Sbjct  88    NLFSKVGIEQANPFKYRVTKYFYATSST--KVPDAFILKSWSREAWSRESNWIGYVAVAT  145

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTN  1021
             D+GK  LGRRDIL+ WRGT    EW+ DF    V    IF  ++   VH GWY +YTS +
Sbjct  146   DEGKSALGRRDILIAWRGTIRTLEWMNDFEFATVSAPEIFGGNDEPNVHLGWYSIYTSDD  205

Query  1020  QDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTD  841
               S  N  SAR+QV  EV RL++ YKNEE+S+TVTGHSLG++++TLNA+D+  N +N   
Sbjct  206   PRSPFNKTSARNQVLTEVRRLVEEYKNEEISMTVTGHSLGAAVSTLNAIDIVVNGYNRPR  265

Query  840   VL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTIL  679
              +      +TAFLFASP+VG+  F+K  S L+NL  LRV N  D+VP  PF         
Sbjct  266   DMPDKACPVTAFLFASPRVGDYKFRKFLSTLQNLHILRVTNARDIVPTYPF---------  316

Query  678   PLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDI  499
               + Y +VG +  I+  KS Y+K    N+  WH L  YLHG+ G QG +G FK +   DI
Sbjct  317   --VNYAEVGQELPIDTDKSNYLKSPG-NLNSWHNLEAYLHGVAGTQGSRGGFKLEVNRDI  373

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               VNK+   LK E C VP  WW EK+KGMVQQ+DG+W L DHE D
Sbjct  374   ALVNKHLDGLKDEYC-VPVSWWCEKHKGMVQQEDGSWKLMDHEDD  417



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 204/410 (50%), Positives = 258/410 (63%), Gaps = 22/410 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA++W+ L+G  NWEGLLDPL+ DLRRY+IH G M  A YD+F  E  SKYAG SRY
Sbjct  32    MGSIAEKWKYLSGEKNWEGLLDPLNIDLRRYIIHNGEMAQATYDAFNGEKASKYAGSSRY  91

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              +K L  +  LE  NPFKY++TK+ Y  S         + V+S+  +A  KESNW GYVA
Sbjct  92    GRKDLFAKVSLENGNPFKYSVTKFLYATSQVDVPD--AFIVKSLSREAWSKESNWMGYVA  149

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMY  1033
             VATD+GK  LGRRDI++ WRGT    EWI DF   +V    I     G   VH+GWY +Y
Sbjct  150   VATDEGKAELGRRDIVIAWRGTVRTLEWINDFEFRLVSASKILGDKAGDPKVHQGWYSIY  209

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +Q S  N  SAR QV +E+ RL++ YK+EE+SIT+TGHSLG+++ATLNAVD+ +N +
Sbjct  210   TSEDQRSRFNKTSARQQVLSEIERLVEQYKDEEISITITGHSLGAAIATLNAVDIVSNRY  269

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      +    +TA +FASP+VG+  F+  FS  K+LRALRV N  D+VP         
Sbjct  270   NKPKHHPHKPCPVTAIIFASPRVGDSDFRNLFSSYKDLRALRVRNALDIVPN--------  321

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P+I Y DVG +  I+ SKS Y+K    N+  WH L  YLHG+ G QG KG FK + 
Sbjct  322   ---YPIIEYSDVGEELKIDTSKSSYLKSPG-NISSWHNLEGYLHGLAGTQGSKGGFKLEV  377

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
               DI  VNK    LK E   VP  W  EKNKGMVQ +DG+W L DHE D+
Sbjct  378   HRDIALVNKTMDGLKDEYL-VPESWRCEKNKGMVQLEDGSWKLIDHEEDN  426



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/409 (50%), Positives = 259/409 (63%), Gaps = 21/409 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIAKRWR+LNG + W+ LLDPLD DLRR +IHYG M  A YD+FI+E  SK+AG SRY
Sbjct  1     MGSIAKRWRLLNGQEMWKNLLDPLDIDLRRSIIHYGEMAQATYDAFITEKVSKFAGSSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK+    + GL  ANP+KY +TK+ Y  S         + ++S+  +A  +ESNW GYVA
Sbjct  61    AKRDFFSKVGLVNANPYKYNVTKFLYATSRMDVPE--AFIIKSLSREAWSRESNWMGYVA  118

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDI++ WRG+    EWI+DF   MV    I  +     VH+GW  +YT
Sbjct  119   VATDEGKAALGRRDIVIAWRGSLQALEWIDDFSFIMVSASQILGRTIDPFVHQGWLSIYT  178

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  +  N  SARDQV +EV RL++ YK+EE+SIT+TGHSLG++L TLNAVD+ AN FN
Sbjct  179   SDDPRAPFNRTSARDQVLSEVRRLVEEYKDEEISITITGHSLGAALGTLNAVDIVANGFN  238

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                   +   L+TAFLFASP+VG++ F+K  S L+NLR LRV N  D+VP          
Sbjct  239   RPKDRPDKACLVTAFLFASPRVGDDKFQKLLSSLENLRLLRVRNALDIVPN---------  289

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PLI Y DVG +  I+  KS ++K    N+ + H L  YLHG+ G QG KG FK +  
Sbjct  290   --YPLIGYSDVGQELVIDTQKSTFLKS-PANLSVSHNLEGYLHGVAGTQGSKGGFKLEVE  346

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
              DI  VNK    L+ E   V   W  EKNKGMVQ  DG+W L DHE D+
Sbjct  347   RDIALVNKSIDGLRDEYL-VLASWRCEKNKGMVQGADGSWKLMDHEEDY  394



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/401 (49%), Positives = 262/401 (65%), Gaps = 17/401 (4%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IAKRW +L+G +NWEGL+DPL+ DLRRY+IHYG M  A YD+F S   SK AG +RY+K
Sbjct  11    TIAKRWMLLSGKNNWEGLMDPLNYDLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSK  70

Query  1383  KSLLEETGLEK-ANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
              +L  + GL+K  NPFKY +TKY Y  S+        + V+S+  ++  KESNW G++AV
Sbjct  71    NNLFTKVGLDKDHNPFKYRVTKYLYATSSIQVPE--AFIVKSLSRESWSKESNWIGFIAV  128

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
              TD+GK  LGRR+IL+ WRGT    +W+ D     V    IF  +    +HRGWY +YTS
Sbjct  129   CTDEGKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTDPQIHRGWYSIYTS  188

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              +  S  N+ S RDQV  EV RL++ YK+E++SIT+TGHS+G+++ TLNA+D+  N FN 
Sbjct  189   EDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIVVNGFNK  248

Query  846   TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIA  667
                L+TA LFASP+VG+  F  AFS L+NLR LRV N  D++P             PLI 
Sbjct  249   -GCLVTAILFASPRVGDSSFVNAFSKLENLRILRVTNCLDIIPN-----------YPLID  296

Query  666   YKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQVN  487
             Y ++GV+  I+ +KS+Y+K    ++  WH L  ++HG+ G+QG  G FK +   DI  VN
Sbjct  297   YSEIGVELAIDTTKSKYLKVPG-DIRSWHSLEAHMHGVAGYQGANGGFKLEVRRDISLVN  355

Query  486   KYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             K+   LK E C VPT WWVEKN GMVQQDDG+W L DHE D
Sbjct  356   KHLNALKDEYC-VPTCWWVEKNNGMVQQDDGSWKLMDHEDD  395



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 255/406 (63%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G D+W+GL+DPLD DLRRY+IHYG M  A YD+F +E  SKYAG SRYAK
Sbjct  4     SIAKKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAK  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             KS   + GL   NPF Y++TK+ Y  S         + ++S   +A  +ESNW GYVAVA
Sbjct  64    KSFFSKVGLVNGNPFTYSVTKFLYATSEIDVPD--AFIIKSFSREAWSRESNWIGYVAVA  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D +  +V    +F ++    VH+GWY +YTS 
Sbjct  122   TDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSE  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N  SAR QV +EV RL++LYKNEE+SIT+TGHSLG+++ATLNAVD+  N +N  
Sbjct  182   DPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKP  241

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FASP+VG+  F+K FS  K+L  +R+ N  D+VP            
Sbjct  242   SDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPN-----------  290

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL+ Y DVG +  I+  KS Y+K    N   WH L  YLHG+ G Q  KG FK +   D
Sbjct  291   YPLVGYSDVGEELKIDTRKSMYLKSPG-NPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRD  349

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  VNK    LK E   VP  W  EKNKGMVQQ+DG+W L DHE D
Sbjct  350   IALVNKTLDALKDEFL-VPVSWRTEKNKGMVQQNDGSWKLMDHEDD  394



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   372 bits (955),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 194/406 (48%), Positives = 260/406 (64%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G  +W+GL++PLD DLRRY+IHYG M  A YD+FISE  SKYAG SRYAK
Sbjct  32    SIAKKWRELSGQSHWKGLMEPLDIDLRRYIIHYGEMAQAAYDAFISEKVSKYAGCSRYAK  91

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             ++   + GL   N F Y++TK+ Y  S+        + ++S   +A  +ESNW GYVAVA
Sbjct  92    RNFFSKVGLMNGNAFTYSVTKFLYATSSIDLPE--AFIIKSFSREAWSRESNWIGYVAVA  149

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D    +V    +F ++    VH+GWY +YTS 
Sbjct  150   TDEGKAALGRRDIVIAWRGTVQTLEWVNDLEFVLVSAPKVFGKNTDPKVHQGWYSIYTSE  209

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N +SAR QV +EV RL++LYKNEE+SI++TGHSLG+++ATL+AVD+ AN +N  
Sbjct  210   DPLSPFNKSSARSQVLSEVKRLVELYKNEEISISITGHSLGAAIATLSAVDIVANGYNKP  269

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FA P+VG+  F+K FS  K+L+ +R+ N  D+VP            
Sbjct  270   SDPSLKASPVTAIVFACPRVGDTNFRKVFSGYKDLKTIRIRNELDIVPN-----------  318

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL+ Y DVG +  I+  KS Y+K    N L WH L  YLHG+ G QG KG FK +   D
Sbjct  319   YPLVGYSDVGEELKIDTRKSMYLKSPG-NPLSWHNLEGYLHGVAGTQGSKGGFKLEVNRD  377

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  +NK    LK ++  VP  W +EKNKGMVQQ+DG+W L DHE D
Sbjct  378   IALLNKTLDALK-DELLVPVSWRIEKNKGMVQQNDGSWKLMDHEDD  422



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   372 bits (954),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 255/406 (63%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G D+W+GL+DPLD DLRRY+IHYG M  A YD+F +E  SKYAG SRYAK
Sbjct  31    SIAKKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAK  90

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             KS   + GL   NPF Y++TK+ Y  S         + ++S   +A  +ESNW GYVAVA
Sbjct  91    KSFFSKVGLVNGNPFTYSVTKFLYATSEIDVPD--AFIIKSFSREAWSRESNWIGYVAVA  148

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D +  +V    +F ++    VH+GWY +YTS 
Sbjct  149   TDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSE  208

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N  SAR QV +EV RL++LYKNEE+SIT+TGHSLG+++ATLNAVD+  N +N  
Sbjct  209   DPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKP  268

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FASP+VG+  F+K FS  K+L  +R+ N  D+VP            
Sbjct  269   SDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPN-----------  317

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL+ Y DVG +  I+  KS Y+K    N   WH L  YLHG+ G Q  KG FK +   D
Sbjct  318   YPLVGYSDVGEELKIDTRKSMYLKSPG-NPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRD  376

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  VNK    LK E   VP  W  EKNKGMVQQ+DG+W L DHE D
Sbjct  377   IALVNKTLDALKDEFL-VPVSWRTEKNKGMVQQNDGSWKLMDHEDD  421



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 265/404 (66%), Gaps = 29/404 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA+RW +L+G +NWEGLLDPLD DLRRYLIHYG M  A+ DSF +E  SKY G SRY+K
Sbjct  31    SIAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNNEKVSKYRGTSRYSK  90

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+L    GL+K NP  Y ITKY Y  S+                    KESNW G+VAVA
Sbjct  91    KNLFTRVGLDK-NP--YEITKYVYAASSKTEE---------------TKESNWIGFVAVA  132

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMYTS  1027
             TD+GK  LGRRDIL+ WRGT+T+SE  ED +  +V+P  IF ++  + LVH+G+Y +YT 
Sbjct  133   TDEGKVALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHKGFYSVYTC  192

Query  1026  TNQDSHLN-SNSARD--QVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
              N+ S+ N + SARD  QV  E+ RLL  Y  EE+SI+VTG S+GSSL TL A+D+  N 
Sbjct  193   LNEASNFNRTTSARDQRQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAIDIVVNE  252

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVP-MVPFLAVEAGTIL  679
              N  +  +TAFLF+SP+VG   FKKA+ +LKNL  LR+ N  D +P ++    VE   I 
Sbjct  253   INK-EFPVTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKLMERGQVEGCAIT  311

Query  678   PLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDI  499
                AY+DVG +  I+ +KSEY+K D    +  H L +YLHGI G  G +GEFK +   DI
Sbjct  312   EWRAYEDVGFELVIDTTKSEYLKKD----IFSHFLEVYLHGIAGTHGVEGEFKLEINRDI  367

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEA  367
               VNK G  LK E+  VP+ WW+EKNKGMVQQ+DG+WIL DHE 
Sbjct  368   ALVNKQGDFLK-EEYGVPSAWWIEKNKGMVQQEDGSWILIDHET  410



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 260/402 (65%), Gaps = 18/402 (4%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRW +L+G +NWEGL+DPLD +LRRY+IHYG M  A YD+F S   SK AG +RY++
Sbjct  19    SIAKRWMLLSGKNNWEGLMDPLDYNLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSR  78

Query  1383  KSLLEETGLEK--ANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              +   + GL+K   NPFKY +TKY Y  S+        + V+S+  ++  KESNW G++A
Sbjct  79    NNFFTKVGLDKDHNNPFKYRVTKYLYATSSIQVPE--AFIVKSLSRESWSKESNWIGFIA  136

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+GK  LGRR+IL+ WRGT    +W+ D     V    IF  +    +HRGWY +YT
Sbjct  137   VCTDEGKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTEPQIHRGWYSIYT  196

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N+ S RDQV  EV RL++ YK+E++SIT+TGHS+G+++ TLNA+D+  N F 
Sbjct  197   SDDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIVVNGF-  255

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
             N   L+TA LFASP+VG+  F  AFS L+NLR LRV N  D++P             PLI
Sbjct  256   NKGCLVTAILFASPRVGDSNFVNAFSKLENLRILRVTNCLDIIPN-----------YPLI  304

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y ++GV+  I+ +KS+Y+K    ++  WH L  Y+HG+ G+QG  G FK +   DI  +
Sbjct  305   DYSEIGVELGIDTTKSKYLKVPG-DIRSWHSLEAYMHGVAGYQGANGGFKLEVGRDISLL  363

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK+   LK E C VPT WWVEKN GMVQQDDG W L DHE D
Sbjct  364   NKHLNALKDEYC-VPTCWWVEKNNGMVQQDDGYWKLMDHEDD  404



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   368 bits (944),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/410 (48%), Positives = 256/410 (62%), Gaps = 21/410 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             ++SIA RW++LNG +NW+ LLDPLD DLRR +I YG    A YD+F SE  S +AG SRY
Sbjct  2     LQSIATRWKLLNGQNNWKNLLDPLDVDLRRNIIQYGERAQATYDTFNSEKASMFAGSSRY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K +   + GLEKANP+KY +TK+ Y  S         + ++S+  +A  +ESNW GYVA
Sbjct  62    SKANFFSKLGLEKANPYKYNVTKFLYATSRIDVPD--AFIIKSLSREAWSRESNWMGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK VLGRRDIL+ WRG+    EWI DF   +V    I    N   VH+GW  +YT
Sbjct  120   VATDEGKAVLGRRDILIAWRGSVQALEWINDFNFILVSASGILGTKNDPNVHQGWLSIYT  179

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N+ SAR QV  EV RL++ +K+EE+SITVTGHSLG++L TLNAVD+ AN  N
Sbjct  180   SDDPRSAYNTTSARQQVLEEVKRLVEEFKDEEISITVTGHSLGAALGTLNAVDIVANGVN  239

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                       L+TAFLF  P+VG+  F+K  S L+NLR LRV N+ DLVP          
Sbjct  240   KPKDHPEKACLVTAFLFGCPRVGDANFQKVVSSLENLRLLRVRNSLDLVPN---------  290

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PL+ Y DVG +  I+  +S ++K   ++   WH +  YLHG+ G QG KG FK +  
Sbjct  291   --YPLVGYSDVGQELVIDTRQSSFLKS-SVDPGNWHNMEGYLHGVAGTQGTKGGFKLEVG  347

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
              DI  VNK    LK E   VP  WW EKNKGM+Q +DG+W L DHE D +
Sbjct  348   RDISLVNKSTDALKDEYL-VPMMWWCEKNKGMIQGEDGSWKLVDHEPDAI  396



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   368 bits (945),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 261/406 (64%), Gaps = 22/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRW++L+G  NWEGLLDPLD DLRRY+IHYG+M  A YD+F SE  SK+AG SRYAK
Sbjct  20    SIAKRWKLLSGKSNWEGLLDPLDLDLRRYVIHYGTMAQATYDTFNSENASKFAGSSRYAK  79

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
               L    G++K NPFKY +TKYFY  +T+       + V S   +A  KESNW GYVAVA
Sbjct  80    NDLFSNVGMDKGNPFKYRVTKYFY--ATSSAQVPDAFIVPSWSREAWSKESNWMGYVAVA  137

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDIL+ WRGT    EW+ DF   +V    IF  ++   VH GW+ +YTS 
Sbjct  138   TDEGKSALGRRDILIAWRGTIRNLEWVNDFEFGLVPAPEIFGGNDDPKVHFGWHSIYTSD  197

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  + NSAR QV  EV RL++ YKNEE+SITVTGHSLG++++T+NAVD+  N +N  
Sbjct  198   DPKSPFSKNSARHQVLGEVRRLVERYKNEEISITVTGHSLGAAVSTINAVDIVVNGYNRP  257

Query  843   DVL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
               +      +TAF+FA P+VG+  F+    +L+NL  LRV N  D+VP  PF        
Sbjct  258   QGMLHKHCPVTAFVFACPRVGDNNFRDFVLNLQNLHILRVRNARDIVPKYPF--------  309

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
                I Y DVG +  I+  KS Y+K    N+  WH L  YLHG+ G +G +G FK +   D
Sbjct  310   ---IDYVDVGEELAIDTDKSSYLKEG--NLSSWHNLEAYLHGVAGTRGSEGGFKLEVNRD  364

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  VNK+   LK E C VP  WW EKNKGMVQQ DG+W+L DHE D
Sbjct  365   IALVNKHMDALKDEFC-VPVSWWCEKNKGMVQQADGSWVLMDHEYD  409



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 263/414 (64%), Gaps = 28/414 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA+RWR L+G +NWEGLLDPLD DLR+Y+IHYG    AV D+F  E  SK+ G SRY
Sbjct  11    MGSIAQRWRELSGENNWEGLLDPLDKDLRKYIIHYGERTQAVMDAFNGEKASKWVGFSRY  70

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + +    + GLE  NP+KY +TK+FY  S           +Q +   A + ESNW GYVA
Sbjct  71    STEDFFSKVGLEMGNPYKYKVTKFFYARS----------EIQILDWFAAV-ESNWIGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+GK VLGRRDIL+ WRGT    E I D +  +V    I   +    VH GW+ +YT
Sbjct  120   VTTDEGKAVLGRRDILICWRGTMRNLEVINDIKADLVSAADILGDNGDPKVHHGWHSIYT  179

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + +  S  N  SAR+QV +EV RL+DLY++EE+SIT+TGHSLG ++ATLNAVD+ AN +N
Sbjct  180   AKDSKSVYNQASAREQVLSEVRRLVDLYQDEEISITLTGHSLGGAVATLNAVDIIANGYN  239

Query  849   NT------DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              +      + L+TAF+FASP+VG+ GFKK FS LKNL  LR+ N  D+VP +P       
Sbjct  240   KSTTKPDKEYLVTAFVFASPRVGDSGFKKVFSGLKNLHVLRIKNELDMVPSLPIPLPLL-  298

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHD---KLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                    Y  VG +  I++ KS Y+K       N+++ H L  YLHG+ G QG KGEFK 
Sbjct  299   ------HYTHVGEKLLIDSHKSPYMKSHLDISENLVIAHQLEPYLHGVAGSQGAKGEFKL  352

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVV  355
             +   DI  +NK    LK ++  VP EWW+EKNKGM QQDDG+WILDDHE +  +
Sbjct  353   EVNRDIALLNKSLDALK-DEYKVPVEWWIEKNKGMAQQDDGSWILDDHEPEPAI  405



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 195/406 (48%), Positives = 254/406 (63%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G D+W+GL+DPLD DLRRY+I YG M  A YD+F +E  SKYAG  RYAK
Sbjct  29    SIAKKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAK  88

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             KS   +  L   NP+ Y++TK+ Y  S         + ++S   +A  +ESNW GYVAVA
Sbjct  89    KSFFSKVALVNGNPYTYSVTKFLYATSEIDVPD--AFIIKSFSREAWSRESNWIGYVAVA  146

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++VWRGT    EW+ D +  +V    +F ++    VH+GWY +YTS 
Sbjct  147   TDEGKAALGRRDIVIVWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSE  206

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N  SAR QV +EV RL++LYKNEE+SIT+TGHSLG+++ATLNAVD+  N +N  
Sbjct  207   DPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKP  266

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
             +        +TA +FASP+VG+  F+K FS  K+L  +R+ N  D+VP            
Sbjct  267   NDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPN-----------  315

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL+ Y DVG +  I+  KS Y+K    N   WH L  YLHG+ G QG KG F  +   D
Sbjct  316   YPLVGYSDVGEELKIDTRKSMYLKSPG-NPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRD  374

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  VNK    LK E   VP  W +EKNKGM QQ+DG+W L DHE D
Sbjct  375   IALVNKTLDALKDELL-VPVSWRIEKNKGMFQQNDGSWKLMDHEED  419



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 256/402 (64%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             S+A+RW +LNG +NWEGLLDPLD DLRRYLIHYG M  A+ DSF SE  SK  G +RY+K
Sbjct  31    SVAERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSEIASKNLGTNRYSK  90

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+  +  GL+K NPFKY +TKY Y  S                    +K SNW G+VAVA
Sbjct  91    KNFFKRVGLDKNNPFKYEVTKYIYGASDVPSKTEK------------IKSSNWIGFVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-NGSLVHRGWYEMYTS  1027
             TD+GK  LGRRDIL+ WRGT   +EW +D    +V P  IF ++ + +LVHRG+Y +YTS
Sbjct  139   TDEGKVALGRRDILIAWRGTMCPAEWNDDSDWVLVPPTKIFGENTHDTLVHRGFYSVYTS  198

Query  1026  TNQDSHLN-SNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
              N  S  N + SARDQV  EV RL++ YK ++VSIT++GHS+GSSL+TL A+D+  N  N
Sbjct  199   LNDASKFNRTASARDQVIEEVKRLVEQYKRDKVSITLSGHSIGSSLSTLCAIDIVVNKIN  258

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
               +  +TAFLFASP+ G   FKKA  HLKNL+ LR+ N  D VP  P      G+     
Sbjct  259   K-EFPVTAFLFASPRTGEANFKKAHQHLKNLQILRITNALDEVPEKPDRGQVEGSDTDWR  317

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y+ VG +  I+ +KSEY+K D  N    H L +YLHGI G  GP+GEFK +   DI  V
Sbjct  318   VYEHVGYEVKIDTTKSEYLKKDVNN----HSLEVYLHGIAGTHGPEGEFKLEITRDIALV  373

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK    LK E   VP  W   +NKGMVQQ+DG+WIL+D E D
Sbjct  374   NKETDALKNE-YGVPVYWRTVQNKGMVQQEDGSWILNDREDD  414



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   364 bits (935),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/406 (48%), Positives = 253/406 (62%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G D+W+GL+DPLD DLRRY+I YG M  A YD+F +E  SKYAG  RYAK
Sbjct  4     SIAKKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAK  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             KS   +  L   NP+ Y++TK+ Y  S         + ++S   +A  +ESNW GYVAVA
Sbjct  64    KSFFSKVALVNGNPYTYSVTKFLYATSEIDVPD--AFIIKSFSREAWSRESNWIGYVAVA  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D +  +V    +F ++    VH+GWY +YTS 
Sbjct  122   TDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSE  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             +  S  N  SAR QV +EV RL++LYKNEE+SIT+TGHSLG+++ATLNAVD+  N +N  
Sbjct  182   DPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKP  241

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
             +        +TA +FASP+VG+  F+K FS  K+L  +R+ N  D+VP            
Sbjct  242   NDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPN-----------  290

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL+ Y DVG +  I+  KS Y+K    N   WH L  YLHG+ G QG KG F  +   D
Sbjct  291   YPLVGYSDVGEELKIDTRKSMYLKSPG-NPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRD  349

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  VNK    LK E   VP  W +EKNKGM QQ+DG+W L DHE D
Sbjct  350   IALVNKTLDALKDELL-VPVSWRIEKNKGMFQQNDGSWKLMDHEED  394



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 201/402 (50%), Positives = 255/402 (63%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA+RW +LNG +NWEGLLDPLD DLRRYLIHYG M  A+ DSF SE  SK  G +RY+K
Sbjct  31    SIAERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSEIASKNLGTNRYSK  90

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+  +  GL+K NPFKY +TKY Y  S                    +K SNW G+VAVA
Sbjct  91    KNFFKRVGLDKNNPFKYEVTKYIYGASDVPSKTEK------------IKSSNWIGFVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS-LVHRGWYEMYTS  1027
             TD GK  LGRRDIL+ WRGT + +EW +D+   +V P  IF ++    LVHRG+Y +YTS
Sbjct  139   TDDGKVALGRRDILIAWRGTMSPAEWNDDYDWVLVPPTKIFGENTHDILVHRGFYSVYTS  198

Query  1026  TNQDSHLN-SNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
              N+ S  N + SARDQV  EV RL++ YK ++VSIT++GHS+GSSLATL AVD+  N   
Sbjct  199   LNEASKFNRTTSARDQVIEEVKRLVEQYKGDKVSITLSGHSIGSSLATLCAVDIVVNQI-  257

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
             N +  +TAFL ASP+ G   FKKA+ +LKNL+ LR+ N  D VP  P      G+     
Sbjct  258   NKEFPVTAFLLASPRTGEANFKKAYQNLKNLQILRITNALDEVPEKPDRGQVEGSETDWR  317

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y+ VG +  I+ +KSEY+K D  N    H + +YLHGI G  G +GEFK +   DI  V
Sbjct  318   VYEHVGFELKIDTTKSEYLKKDVNN----HTVEVYLHGIAGTHGAEGEFKLEINRDIALV  373

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK    LK E   VP  W + +NKGMVQQ+DG+W L+D E D
Sbjct  374   NKEADALKNE-YGVPVYWRIVQNKGMVQQEDGSWSLNDREDD  414



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   361 bits (927),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 253/407 (62%), Gaps = 28/407 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SI ++WR L+G  NWEG+LDPLD DLR+Y++HYG +  A YD+F SE  S +AG  RYAK
Sbjct  5     SIGRKWRDLSGRSNWEGMLDPLDIDLRQYILHYGQLAQATYDAFNSEKLSMHAGNCRYAK  64

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             +    + GLE  NPFKY +T++ Y  S    +    + ++    D    ESNW GYVAVA
Sbjct  65    RDFFSKVGLEHGNPFKYEVTEFLYATSKATASKQ--FALKLFSKDEWGMESNWIGYVAVA  122

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI+V WRGT   SEW++D  IP+    +IF +D  + +H G+Y +YTS 
Sbjct  123   TDEGKAALGRRDIVVAWRGTVQGSEWVQDLHIPLDPAPLIF-RDARAELHNGFYSVYTSN  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             N DSH+   SAR+QV  EV RL++ YKNEE+SI+VTGHSLG++LATLNAVD+AA   N  
Sbjct  182   NPDSHITQTSARNQVLEEVRRLVEKYKNEEISISVTGHSLGAALATLNAVDIAAQGLNKP  241

Query  843   D------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPF-LAVEAGT  685
                      +TAFLFASP+VGN  F K FS  K+LRALR+ N  D VP +P  LAV    
Sbjct  242   KDQPHRVFPVTAFLFASPRVGNSHFGKIFSEYKHLRALRIRNKKDQVPKLPIGLAV----  297

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
                      VG +  I+  KS+Y+K      +  H L  YLHG+ G QG KG F  +   
Sbjct  298   ---------VGQELVIDTRKSKYLKEG----VSAHNLEAYLHGVAGTQGKKGGFNLEVNR  344

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             DI  +NK    LK E   VP EW V +NKGMVQQ DGTW L DH  D
Sbjct  345   DIALLNKGMDALKDEYL-VPVEWRVHENKGMVQQSDGTWKLFDHNED  390



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   362 bits (929),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 252/400 (63%), Gaps = 20/400 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G +NW+GLLDPLD DLRRY+IHYG M  A YD+F +E  SKYAG SRYA+
Sbjct  35    SIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRYAR  94

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             KS      LEK N FKY +TK+ Y  S         + ++S+  ++  KESNW GYVAVA
Sbjct  95    KSFFSRVCLEKGNAFKYNVTKFVYATSQIQVPE--AFLIKSLSRESWCKESNWMGYVAVA  152

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D +  +V    +  +D    VH GWY +YTS 
Sbjct  153   TDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSASKLLGEDGDPKVHEGWYSIYTSD  212

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N  SAR QV  EV RL++ +K+EE+SIT+TGHSLG+++ATLNAVD+ AN  N  
Sbjct  213   DSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDIVANGVNRP  272

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N    +TA +FASP+VG+  F+K FS  K++RALRV N  D+VP  P         
Sbjct  273   KEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRALRVRNALDVVPNYP---------  323

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
             +PL  Y +VG +  I+  KS+Y+K     +  WH L  YLHG+ G QG KG FK +   D
Sbjct  324   IPL-GYSNVGEELAIDTRKSKYLKSPG-GLASWHNLEGYLHGVAGTQGSKGGFKLEVKRD  381

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             I  VNK    LK E+  +P  W  EKNK M Q DDG+W+L
Sbjct  382   IALVNKSADDLK-EEYLIPASWRCEKNKCMTQLDDGSWVL  420



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   360 bits (923),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/400 (48%), Positives = 252/400 (63%), Gaps = 20/400 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK+WR L+G +NW+GLLDPLD DLRRY+IHYG M  A YD+F +E  SKYAG SRYA+
Sbjct  6     SIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRYAR  65

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+     GLEK N FKY +TK+ Y  S         + ++S+  ++  KESNW GYVAVA
Sbjct  66    KNFFSRVGLEKGNAFKYNVTKFVYATSQIQVPE--AFLIKSLSRESWCKESNWMGYVAVA  123

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ D +  +V    +  +D    VH GWY +YTS 
Sbjct  124   TDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSVSKLLGEDGDPKVHEGWYSIYTSD  183

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N  SAR QV  EV RL++ +K+EE+SIT+TGHSLG+++ATLNAVD+ AN  N  
Sbjct  184   DSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDIVANGVNRP  243

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N    +TA +FASP+VG+  F+K FS  K++R LRV N  D+VP  P         
Sbjct  244   KEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRTLRVRNALDVVPNYP---------  294

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
             +PL  Y +VG +  I+  KS+Y+K     +  WH L  YLHG+ G QG KG FK +   D
Sbjct  295   IPL-GYSNVGEELAIDTRKSKYLKSPG-GLASWHNLEGYLHGVAGTQGSKGGFKLEVKRD  352

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             I  VNK    L+ E+  +P  W  EKNK M Q DDG+W+L
Sbjct  353   IALVNKSADDLE-EEYLIPASWRCEKNKCMTQLDDGSWVL  391



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   358 bits (920),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 204/404 (50%), Positives = 256/404 (63%), Gaps = 19/404 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAK W+ L+G +NW+ LLDPLD+DLR Y+IHYG M  A YDSF ++  SKYAG S YAK
Sbjct  4     SIAKGWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKVSKYAGSSLYAK  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                     LEK NPFKY +TK+ Y  S    +    + ++S+  +A  KESNW G+VAV+
Sbjct  64    DEFFNRVHLEKGNPFKYRVTKFLYATSQVHISE--AFIIKSLSREAWSKESNWMGFVAVS  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ DF   +V    I  +     VH+GWY +YTS 
Sbjct  122   TDEGKVALGRRDIVIAWRGTIQILEWVNDFEFNLVSASKILGESGNPKVHQGWYSIYTSD  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N NSARDQV  EV RL+D +KNEE+SIT+TGHSLG++LATLNAVD+ AN FN  
Sbjct  182   DSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVANGFNKS  241

Query  849   --NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
               N    +TA LFASP+VG+  FKK FS   +L+ALRV N  D+VP  PF          
Sbjct  242   HENKGCPVTAMLFASPRVGDSNFKKVFSRYMDLKALRVHNVLDVVPKYPF----------  291

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
              I Y DVG +  I+ +KS+Y+K    NV  WH L  YLHG+ G QG KG F+     DI 
Sbjct  292   -IGYADVGEELIIDTTKSKYLKSPG-NVSSWHNLEAYLHGVAGTQGSKGGFELVANRDIA  349

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              +NK    LK E   VP  W +++NKGMVQQ DG+W L DHE D
Sbjct  350   LINKTTDGLKDEYL-VPASWRIQENKGMVQQADGSWKLVDHEED  392



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   360 bits (923),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 206/414 (50%), Positives = 264/414 (64%), Gaps = 27/414 (7%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +SIA++W++L+G++NW+GLLDPLD DLR+Y+IHYG M  A YD+F SE  SKYAG SRY+
Sbjct  24    DSIARKWKLLSGANNWQGLLDPLDLDLRKYIIHYGQMSQATYDTFNSEKASKYAGSSRYS  83

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             K +LL + G++KANPFKY +TKY Y  S+        + ++S   +A  KESNW GYVAV
Sbjct  84    KDNLLSKVGVDKANPFKYRVTKYVYATSSLTEVPD-AFILRSWSREAWTKESNWIGYVAV  142

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ----DNGSLVHRGWYE  1039
             ATD+GK  LGRRDIL+ WRGT    EWI DF   +V   +IF      D+   VH GWY 
Sbjct  143   ATDEGKLALGRRDILIAWRGTVRTLEWINDFEFSLVDAPLIFGAANDGDDQPRVHLGWYS  202

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YTS +  S  N  SAR+QV  EV RL++ YKNEE SITVTGHSLG+++ TLNA D+  N
Sbjct  203   IYTSDDPRSPFNKTSARNQVLEEVKRLVEEYKNEETSITVTGHSLGAAVCTLNASDIVVN  262

Query  858   PFNNTDVL------ITAFLFASPKVGNEGFKKAFSHLK---NLRALRVVNNGDLVPMVPF  706
              +N  + +      +T F FASP+VG++ F+K  S LK   NL  LRV N  D+VP  PF
Sbjct  263   KYNKPNDMPDKSCPVTVFAFASPRVGDDKFRKILSSLKTNNNLNILRVRNAKDIVPKYPF  322

Query  705   LAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE  526
                        I Y +VGV+  I+  KS Y+K    N+  WH L  YLHG+ G QG +G 
Sbjct  323   -----------IDYSEVGVELVIDTDKSSYLKSPG-NLSSWHSLEGYLHGVAGTQGSRGG  370

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             FK +    +  VNK+   LK E C VP  WW E+NK MVQ DDG+W L DHE D
Sbjct  371   FKLEVNRSLALVNKHMDGLKDEYC-VPVSWWCERNKSMVQSDDGSWELIDHEDD  423



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   359 bits (922),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 196/410 (48%), Positives = 253/410 (62%), Gaps = 24/410 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA +W+ L+G ++W GLLDPLD DLRRY+IHYG M  A YD+F +E  SK+AG  RYAK
Sbjct  19    SIANKWQQLSGENHWIGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAK  78

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                  +  LE  NPFKY++TK+ Y  S         + ++S+  +A  KESNW G+VAVA
Sbjct  79    NDFFSKVFLENGNPFKYSVTKFIYATSEINVPE--AFIIKSLSREAWSKESNWIGFVAVA  136

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMY  1033
              D+GK+VLGRRDI++ WRGT    EW+ D +  +V    +F   N      VH+GWY +Y
Sbjct  137   NDEGKDVLGRRDIVIAWRGTIQTLEWVNDLQFLLVSAPKVFGNSNNINDPKVHQGWYSIY  196

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  +  SAR+QV +EV RL++ YKNEE+SIT+TGHSLG+++ATLNAVD+  N F
Sbjct  197   TSEDPRSPFSKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVTNGF  256

Query  852   NNTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +TA +FASP+VG+  F+K FS  K+L  LR+ N  D+VP  PF     
Sbjct  257   NKPSDPSLKASPVTAIVFASPRVGDTNFQKLFSSYKDLSTLRIRNELDIVPNYPF-----  311

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                   I Y DVG +  I+  KS Y+K    N+L WH L  YLHG+ G QG K  FK + 
Sbjct  312   ------IGYSDVGEELKIDTRKSMYLKSPG-NILSWHNLEAYLHGVAGTQGSKRVFKLEV  364

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
               DI  VNK    LK E   VP  W V +NKGMVQQ DG+W L DHE D 
Sbjct  365   NRDIALVNKTLDGLKDEYL-VPVSWRVVENKGMVQQLDGSWKLIDHEDDE  413



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   358 bits (920),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 189/407 (46%), Positives = 248/407 (61%), Gaps = 21/407 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA RWR+L+G DNW+ LLDPLD DLR+Y++HYG M  A YDSF S   SK+AG S +++
Sbjct  4     NIATRWRLLSGEDNWKNLLDPLDIDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSR  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+L    GL  ANP+KY ITK+ Y  S    +    + ++S+  +A  KESNW GY+AVA
Sbjct  64    KNLFSRVGLAIANPYKYNITKFLYATSGIEVSE--AFLLRSLSREAWNKESNWIGYIAVA  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ DF  P+V    +F   N S VH+GW  +YTS 
Sbjct  122   TDEGKAALGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLFGASNDSKVHKGWLSIYTSQ  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N+NSAR QV +E+ +LL+ +++E++SIT+TGHSLG++L TLNA D+ AN  N  
Sbjct  182   DARSPFNTNSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIANQINRG  241

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +T FLF SP VG+  F+K F+ +  L  LR  N  D+VP            
Sbjct  242   KKQPQKPCPVTVFLFGSPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDY----------  291

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL  Y  VG +  I+  KSEY+K        WH L  YLHG+ G QG +G F  +   D
Sbjct  292   -PLTGYAKVGEELIIDTRKSEYLKSPG-GFKSWHSLEAYLHGVAGTQGNEGGFTLEVKRD  349

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             I +VNK    LK E+  VP  WW  +NKGMVQ  DG W LDDHE D 
Sbjct  350   IARVNKALNALK-EEYLVPESWWCAQNKGMVQDADGFWKLDDHETDE  395



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/404 (50%), Positives = 258/404 (64%), Gaps = 19/404 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRW+ L+G +NW+ LLDPLD+DLR Y+IHYG M  A YDSF ++  SKYAG S YAK
Sbjct  4     SIAKRWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKASKYAGCSLYAK  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                     LEK NPFKY +TK+ Y  S    +    + ++S+  +A  KESNW G+VAV+
Sbjct  64    DEFFNRVHLEKGNPFKYRVTKFVYATSQVHISE--AFIIKSLSREAWSKESNWMGFVAVS  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ DF   +V    I  +     VH+GWY +YTS 
Sbjct  122   TDEGKVALGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKILGESGNPKVHQGWYSIYTSD  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N NSARDQV  EV RL+D +KNEE+SIT+TGHSLG++LATLNAVD+ AN FN  
Sbjct  182   DSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVANGFNMS  241

Query  849   --NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
               N    +TA LFASP+VG+  FKK FS   +L+A+R+ N  D+VP  PF          
Sbjct  242   HENKGCPVTAMLFASPRVGDSNFKKVFSGYMDLKAIRIHNFLDVVPKYPF----------  291

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
              I Y DVG +  I+ +KS+Y+K    NV  WH L  YLHG+ G QG KG F+     DI 
Sbjct  292   -IGYADVGEELIIDTTKSKYLKSPG-NVSSWHNLEAYLHGVAGTQGFKGGFELVVNRDIA  349

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              +NK    LK E   VP  W +++NKGMVQ+ DG+W L+DHE D
Sbjct  350   LINKTIDGLKDEYL-VPVSWRIQENKGMVQEADGSWKLEDHEED  392



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 204/411 (50%), Positives = 259/411 (63%), Gaps = 24/411 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + SI + WR L+G  NW+GLL PLD DLR+Y+IHYG M  A YD+F S   SKYAG S Y
Sbjct  2     LRSIGRGWRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIY  61

Query  1389  AKKSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             +++    + GLEK NP+ KY +TK+ Y  +T+       + V  V  +   KESNW GYV
Sbjct  62    SRQDFFSKVGLEKNNPYSKYQVTKFLY--ATSQIEVPDSFLVFPVSREGRTKESNWMGYV  119

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDN-GSLVHRGWYEM  1036
             AV TD+G E+LGRRDI+V WRG+    EWI DF   +V  + IF + + G  VH+GWY +
Sbjct  120   AVTTDEGTELLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQGWYSI  179

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS+++ S  N +SARDQV  EV RL++ YK+EE+SITV GHSLG++LATLNA D+ AN 
Sbjct  180   YTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIVANG  239

Query  855   FNNTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             +N T        L+TAF+FASP+VGN  FKK FS  K+LR LRV N  D+VP  P     
Sbjct  240   YNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP-----  294

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQG-PKGEFKP  517
                  PL  Y DVG +  I+  KS Y+K    +++ +H L   LHG+ G QG    EFK 
Sbjct  295   -----PL-GYSDVGEELTIDTRKSPYLKTPG-DLVSFHNLEANLHGVAGTQGTTTKEFKL  347

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             Q   DI  +NK    LK E   VP  W V KNKGMVQQDDG+W L DHE D
Sbjct  348   QVKRDISLINKSIDALKDEYM-VPGSWRVLKNKGMVQQDDGSWKLMDHEMD  397



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 205/406 (50%), Positives = 257/406 (63%), Gaps = 19/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SI KRW+ L+G ++W+ LLDPLD+DLRRY+IHYG M  A YDSF ++  SKYAG S YAK
Sbjct  21    SIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDSFNAQKASKYAGSSLYAK  80

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                  +  LEK NPFKY +TK+ Y  S         + V+S+  +A  KESNW G+VAVA
Sbjct  81    DDFFSKVHLEKGNPFKYRVTKFLYATSQVQLPE--AFIVKSLSREAWSKESNWIGFVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ DF    V    I  +     VH+GWY +YTS 
Sbjct  139   TDEGKTTLGRRDIVIAWRGTIRTLEWVNDFEFNFVSASKILGESGDPKVHQGWYSIYTSD  198

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N NSARDQV  EV RL+D Y NEE+SIT+ GHSLG+++ATLNAVD+ AN FN  
Sbjct  199   DSRSQYNKNSARDQVLNEVRRLVDKYTNEEISITIVGHSLGAAVATLNAVDIVANGFNQS  258

Query  849   --NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
               N    +TA LFASP+VG+  FK+ FS  K+LRALR+ N  D+VP             P
Sbjct  259   QKNKRCPVTAMLFASPRVGDSNFKRVFSGYKDLRALRIHNVRDVVPN-----------YP  307

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
             LI Y DVG +  I+ +KS+Y+K    N+  WH L  YLHG+ G QGPKG FK +   DI 
Sbjct  308   LIGYADVGEELVIDTTKSKYLKSPG-NLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDIA  366

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
              +NK    LK E   VP  W V++NKGMVQQ DG+W L D E D +
Sbjct  367   LLNKTIDSLKDEYL-VPASWRVQENKGMVQQADGSWKLMDLEEDFI  411



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   356 bits (914),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 196/414 (47%), Positives = 256/414 (62%), Gaps = 31/414 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA++WR L+G  NW+GLLDPLD DLR Y+IHYG +  A YD+F SE TSKYAG SRY K
Sbjct  4     NIARKWRDLSGRSNWKGLLDPLDIDLRPYIIHYGQLAQATYDAFNSEKTSKYAGNSRYPK  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K    + GLE  NPF+Y + K+ Y  S    A    + ++S   D+  K+SNW GYVAVA
Sbjct  64    KDFFSKVGLENGNPFRYDVKKFLYATSKASDAE--AFLLKSFSKDSWSKQSNWIGYVAVA  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD GKE LGRRDI+V WRGT   +EW++DF   +     IF  D+ + VH G+Y +YTS+
Sbjct  122   TDAGKEALGRRDIVVAWRGTIQAAEWVKDFHFHLDLAPEIFGGDSSAQVHHGFYSLYTSS  181

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLY--KNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             N  S     SAR+QV  EV RL++ Y  KNEE+SI+VTGHSLG++LATLNAVD+AA   N
Sbjct  182   NPGSKFTDTSARNQVLGEVGRLVEEYTSKNEEISISVTGHSLGAALATLNAVDIAAQGLN  241

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                        +TAF +A P+VG+  F++ F+  K+LR+LR+ N  D+VP+ PFL     
Sbjct  242   IPKNQPQKAFPVTAFAYACPRVGDSSFEETFNGYKDLRSLRIRNVTDIVPITPFL-----  296

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                    + DVG +  I+  KS+Y+K      +  H L  YLHG+ G QG KG F  +  
Sbjct  297   ------GFSDVGEELVIDTRKSKYLKSG----VSAHNLEAYLHGVAGTQGEKGGFNLEVN  346

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW-----ILDDHEADH  361
              DI  VNK    LK E   VP  W V++NKGMVQQ DG+W     + DD E+ H
Sbjct  347   RDIALVNKSMDALKDEYL-VPVAWRVQENKGMVQQSDGSWKIVDQVHDDMESIH  399



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   356 bits (913),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 203/412 (49%), Positives = 260/412 (63%), Gaps = 30/412 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLLDPLD DLR+Y+I YG +    YD+FI E  SKYAG SRY
Sbjct  1     MASMAEKWEQLSGKNNWEGLLDPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL+   P KY +TKYFY  +T+       + V+S+  +A  KESN+ GY+A
Sbjct  61    SMENLFTRAGLD---PLKYKVTKYFY--ATSSIPLPSAFLVKSLSREAWNKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT    EW+ D    ++    +F  D G       LVH G
Sbjct  116   VATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFG-DGGLLPLFQPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S  N  SARDQV  EV RL++ YKNEEVSITV GHSLG+SLATLNAVD+
Sbjct  175   FYNIYTSEDPRSMFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N FN T    +  +TAF+FASPKVG+  F+KAFS LKNL  LR+ N  D+VP      
Sbjct  235   AFNGFNKTSSGKEFPVTAFVFASPKVGDLNFQKAFSKLKNLHILRIHNLLDIVPKY----  290

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P I + DVG +  I+ +KS Y+K +  +    H L  YLHGIDG QG      
Sbjct  291   -------PPIGFIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGVLAG  343

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   D+  VN+   MLK E C +P  WW EK+KGMVQQ+DGTW+L D E
Sbjct  344   FKLEVNRDLALVNRIWDMLKDEYC-IPAAWWTEKHKGMVQQEDGTWLLLDRE  394



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 260/409 (64%), Gaps = 28/409 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLL+PLD DLR+YLI YG +  A YD+FI+E  SK AG SRY
Sbjct  1     MASMAEKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL   +P KY +TK+FY  +T+      G+ V+S+  +A  K+SN+ GYVA
Sbjct  61    SLENLFTRVGL---DPLKYRVTKFFY--ATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-----VHRGW  1045
             VATD+GK  LGRRDI++ WRGT  + EW+ +F+   V    +F            VH G+
Sbjct  116   VATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQPLVHHGF  175

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
             Y +YT+ N  S  N  S RDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+A
Sbjct  176   YNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIA  235

Query  864   ANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
              N  N T    +  +TAF FASPKVG+  FK AF  LK+LR LR+ N  D+VP V     
Sbjct  236   FNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPKV-----  290

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                   P I Y DVG +  I+ +KS YVK     V+ WH L  YLHGI G QG  G FK 
Sbjct  291   ------PPIGYIDVGEELMIDTTKSPYVKPPG-EVVSWHLLEPYLHGIAGTQGLIG-FKL  342

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             +   DI  VNK   +LK ++  +P  WWVEKNKGMVQQ DG+WIL D E
Sbjct  343   EVNRDISLVNKQWDILK-DEYGIPGLWWVEKNKGMVQQQDGSWILMDRE  390



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 207/410 (50%), Positives = 263/410 (64%), Gaps = 30/410 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLL+PLD DLR+YLI YG +  A YD+FI+E  SK AG SRY
Sbjct  1     MASMAEKWEQLSGKNNWEGLLNPLDLDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL   +P KY +TK+FY  +T+      G  V+S+  +A  KESN+ GYVA
Sbjct  61    SMENLFTRVGL---DPLKYRVTKFFY--ATSSIPLPDGLFVRSLSLEAWSKESNFMGYVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT  + EW+ +F+   V    +F  D G       LVH G
Sbjct  116   VATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFG-DRGLLHLLQPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YT+ N  S  N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+
Sbjct  175   FYNIYTTNNPRSQFNHTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N T    +  +TAF FASPKVG+  FK AF  LK++R LR+ N  D+VP V    
Sbjct  235   AFNGINKTSEGREFPVTAFAFASPKVGDLKFKAAFDKLKSVRTLRIHNLWDVVPKV----  290

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    P I Y DVG +  I+ +KS YVK     V+ WH L  YLHGI G QG +G FK
Sbjct  291   -------PPIGYIDVGEELMIDTTKSPYVKPPG-EVVSWHLLEPYLHGIAGTQGLRG-FK  341

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              +   DI  VNK   +LK ++  +P  W VEKNKGMVQQ DG+W+L D E
Sbjct  342   LEVDRDISLVNKQWDILK-DEYGIPGRWLVEKNKGMVQQKDGSWLLMDRE  390



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 205/406 (50%), Positives = 256/406 (63%), Gaps = 19/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SI KRW+ L+G ++W+ LLDPLD+DLRRY+IHYG M  A YD F ++  SKYAG S YAK
Sbjct  21    SIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDGFNAQKASKYAGSSLYAK  80

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                  +  LEK NPFKY +TK+ Y  S         + V+S+  +A  KESNW G+VAVA
Sbjct  81    DDFFTKVHLEKGNPFKYRVTKFLYATSQVQLPE--AFIVKSLSREAWSKESNWIGFVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ DF    V    I  +     VH+GWY +YTS 
Sbjct  139   TDEGKTTLGRRDIVIAWRGTIQTLEWVNDFEFNFVSASKILGESGDPKVHQGWYSIYTSD  198

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N NSARDQV  E+ RL+D Y NEE+SIT+ GHSLG+++ATLNAVD+ AN FN  
Sbjct  199   DSRSPYNKNSARDQVLNEIRRLVDKYTNEEISITIVGHSLGAAVATLNAVDIVANGFNQS  258

Query  849   --NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
               N    +TA LFASP+VG+  FKK FS  K+LRALR+ N  D+VP             P
Sbjct  259   QKNKRCPVTAILFASPRVGDSNFKKVFSGYKDLRALRIHNVLDVVPS-----------YP  307

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
             LI Y DVG +  I+ +KS+Y+K    N+  WH L  YLHG+ G QGPKG FK +   DI 
Sbjct  308   LIGYADVGEELVIDTTKSKYLKSPG-NLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDIA  366

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
              VNK    LK E   VP  W V++NKGMVQQ DG+W L D E D +
Sbjct  367   LVNKTIDSLKDEYL-VPASWRVQENKGMVQQADGSWKLMDVEEDFI  411



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   353 bits (907),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 203/412 (49%), Positives = 259/412 (63%), Gaps = 31/412 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  +A++W  L+G DNWEGLL+PLD DLRRY+I YG +  A YD+FI+E  SKYAG SRY
Sbjct  1     MACMAEKWEQLSGKDNWEGLLNPLDLDLRRYIIQYGELAQATYDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL+   P KY +TK+FY  +T+       + V+S+  +A  KESN+ GYVA
Sbjct  61    SMENLFTGVGLD---PLKYRVTKFFY--ATSSIPLPDAFVVKSLSREAWSKESNFMGYVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT    EW+ DF+  +V    +F  D G       LVH G
Sbjct  116   VATDEGKVSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFG-DGGLLPLFQPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S  N    RDQV  EV RL++ YKNE+VSITVTGHSLG+SLATLNAVD+
Sbjct  175   FYNIYTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N  N T    +  +TAF+FASPKVG+  F KAFS L NL  LR+ N  D+VP      
Sbjct  235   TFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNVLDIVPK-----  289

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P I Y DVG +  I+ +KS YVK    +++ WH L  YLHG+ G QG      
Sbjct  290   ------YPPIGYIDVGKELMIDTTKSPYVKPPG-DIVSWHLLEPYLHGVAGTQGISILAG  342

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   +I  VNK G +LK E C +P  WWVEK+KGMVQQ DGTW+  D E
Sbjct  343   FKLEVNRNISLVNKMGNILKDEHC-IPGLWWVEKHKGMVQQQDGTWLFLDRE  393



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   353 bits (907),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 193/408 (47%), Positives = 252/408 (62%), Gaps = 24/408 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA++WR L+G  NW+GLLDPLD DLRRY+IHYG +  A YD F SE  S  AG SRY
Sbjct  1     MGSIARKWRELSGRSNWKGLLDPLDIDLRRYIIHYGQLAQATYDGFNSEKASNLAGNSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K+    + GLE  NPFKY +TK+ Y  S    +    + ++S   DA   +SNW GYVA
Sbjct  61    SKREFFGKVGLENGNPFKYLVTKFLYATSKASDSEK--FLLRSFSKDAWSLQSNWIGYVA  118

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GKE LGRRDI+V WRGT   +EW++DF   +     IF     + +H G+Y +YT
Sbjct  119   VATDEGKEALGRRDIVVAWRGTIQAAEWVKDFHFHLDPAPEIFGDAASAELHHGFYSLYT  178

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S N  S   + SAR+QV  EV RL++ YKNEE+SI+VTGHSLG++LATLNAVD+AA   N
Sbjct  179   SKNPGSKFTNTSARNQVLEEVGRLVEEYKNEEISISVTGHSLGAALATLNAVDIAAQGLN  238

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                        +TAF +ASP+VG+  F+ AF+  K+LRALR+ N  D+VP          
Sbjct  239   KPKGQPQKACPVTAFAYASPRVGDSSFEDAFNGYKDLRALRIRNETDIVP----------  288

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
              +  L+ + DVG +  I+  KS+++K      +  H L  YLHG+ G QG KG F  +  
Sbjct  289   -VSLLLGFSDVGEELLIDTRKSKFLKEG----VSAHNLEAYLHGVAGTQGKKGGFNLEVN  343

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              DI  +NK    LK E   VP EW V++NKGMVQQ DGTW L +   D
Sbjct  344   RDIALLNKGMDALKDEYL-VPVEWRVQENKGMVQQLDGTWKLIEKNED  390



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   353 bits (907),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 205/411 (50%), Positives = 260/411 (63%), Gaps = 29/411 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLL+PLD DLR+YLI YG +  A YD+FI+E  SK AG SRY
Sbjct  1     MASMAEKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL+   P KY +TK+FY  +T+      G+ V+S+  +A  K+SN+ GYVA
Sbjct  61    SLENLFTRVGLD---PLKYRVTKFFY--ATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-----VHRGW  1045
             VATD+GK  LGRRDI++ WRGT  + EW+ +F+   V    +F            VH G+
Sbjct  116   VATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQPLVHHGF  175

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
             Y +YT+ N  S  N  S RDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+A
Sbjct  176   YNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIA  235

Query  864   ANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
              N  N T    +  +TAF FASPKVG+  FK AF  LK+LR LR+ N  D+VP V     
Sbjct  236   FNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPKV-----  290

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKG--EF  523
                   P I Y DVG +  I+ +KS YVK     V+ WH L  YLHGI G QG  G   F
Sbjct  291   ------PPIGYIDVGEELMIDTTKSPYVKPPG-EVVSWHLLEPYLHGIAGTQGLIGLIGF  343

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   DI  VNK   +LK ++  +P  WWVEKNKGMVQQ DG+WIL D E
Sbjct  344   KLEVNRDISLVNKQWDILK-DEYGIPGLWWVEKNKGMVQQQDGSWILMDRE  393



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   353 bits (905),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 203/406 (50%), Positives = 258/406 (64%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRW+ L+G  +W+ LLDPLD DLR Y+IHYG M  A YD+F ++  SK AG S Y K
Sbjct  27    SIAKRWKHLSGEHHWKDLLDPLDIDLRHYIIHYGEMAQAAYDAFNTQKASKNAGSSLYTK  86

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             ++   + GLE  NP+KY +TK+ Y  S         + ++S+  +A  KESNW GYVAVA
Sbjct  87    EAFFSKVGLENGNPYKYQVTKFLYATSQIQLPE--AFIIKSLSREAWSKESNWMGYVAVA  144

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK VLGRRDI++ WRGT    EW+ DF+  +V    IF + N   VH+GWY +YTS 
Sbjct  145   TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFQFTLVPAPKIFGESNDRKVHQGWYSVYTSD  204

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N +SARDQV  EV RL++ YK+EE+SITV GHSLG+++ATLNA D+ AN FN  
Sbjct  205   DPRSPYNKSSARDQVLNEVRRLVEQYKDEEISITVCGHSLGAAVATLNAADIVANGFNKS  264

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N    +TA +FASP+VG+  FKK FS  K+LR LRV N  D+VP            
Sbjct  265   KSWPNKPCPVTAIVFASPRVGDSDFKKVFSGYKDLRVLRVHNLLDVVPN-----------  313

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PLI Y DVG +  I+ +KS+Y+K    NV  WH L  YLHG+ G QG  G FK +   D
Sbjct  314   YPLIGYADVGEELTIDTTKSKYLKSPG-NVSSWHNLEGYLHGVAGTQGSTGGFKLEVNRD  372

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I  VNK    LK E   VPT W ++KNKGM+QQ DG+W L DHE D
Sbjct  373   IALVNKSLDGLKDEYL-VPTSWRIQKNKGMIQQADGSWKLMDHEED  417



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   352 bits (903),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 194/405 (48%), Positives = 249/405 (61%), Gaps = 22/405 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA +WR L+G +NW GLL PLD DLRRY+IHYG M  A YD+F +E  SK+AG  RYAK
Sbjct  22    SIANKWRQLSGENNWNGLLYPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAK  81

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                  +  LE  NPFKY +TKY Y  S         + ++S   +A  KESNW GYV V+
Sbjct  82    NDFFSKVYLENGNPFKYNVTKYIYATSEMDVPE--AFIIKSFSREAWSKESNWIGYVGVS  139

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-NGSLVHRGWYEMYTS  1027
             +D+GK+VLGRRDI++ WRGT    EW+ D    +V    +F  +     VH+GWY +YTS
Sbjct  140   SDEGKDVLGRRDIVIAWRGTIRSLEWVNDLNFVLVSAPKLFGNNIIDPKVHQGWYSIYTS  199

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              +  S  N  SAR+QV +EV RL++ YKNEE+SIT+TGHSLG+++ATLNAVD+  N +N 
Sbjct  200   EDPRSPFNKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVTNGYNK  259

Query  846   TD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
              +        +TA +FASP+VG+  F+K FS  K+L  LR+ N  D+VP  PF       
Sbjct  260   PNDSSIKASPVTAIVFASPRVGDTNFQKVFSDQKDLSTLRIRNELDIVPNYPF-------  312

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
                 I Y DVG +  I+ +KS Y+K    N L WH L  YLHG+ G QG K  FK +   
Sbjct  313   ----IGYSDVGEELKIDTTKSMYLKSPG-NPLSWHNLEAYLHGVAGTQGSKRGFKLEVNR  367

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             DI  VNK   +LK E   VP  W V +NKGMVQQ DG+W L D E
Sbjct  368   DISLVNKTLDVLKDEYL-VPISWRVVENKGMVQQPDGSWKLVDPE  411



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   351 bits (900),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 197/408 (48%), Positives = 257/408 (63%), Gaps = 24/408 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRWRVL G D+W+GLLDPLD DLRR L+ YG M  AVYD FI +  S++AG   YA+
Sbjct  4     SIAKRWRVLQGKDSWKGLLDPLDVDLRRSLVLYGEMAQAVYDGFIRQKKSRFAGAPLYAR  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              ++L++  L +     Y +TK+FY  +T+       + ++S+   A  K+SNW GYVAVA
Sbjct  64    SNILQKVALSQGQERLYRVTKFFY--ATSGVQVPDAFIIKSLSRQAWSKDSNWMGYVAVA  121

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMV-KPRIIFAQDNGSLVHRGWYEMYTS  1027
             TD+G   LGRRD+LV WRGT    EWI D    MV  P ++ +  +  LVHRGW  +YTS
Sbjct  122   TDEGAAQLGRRDVLVAWRGTLLPLEWINDLDFTMVPAPEVLGS--SSPLVHRGWLSIYTS  179

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              +  S  + +SAR+QV  EV RL++ YK+EE SIT+TGHSLG+++ATLNAVD+ AN FN 
Sbjct  180   EDPKSPYSKSSARNQVLKEVGRLIEEYKDEETSITITGHSLGAAVATLNAVDIVANSFNR  239

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +T   +TAF+FASP+VG+  F+K FS   +LR LRV N  DLVP           
Sbjct  240   SSNPSSTGCPVTAFVFASPRVGDFEFQKLFSGTPDLRLLRVRNAPDLVPN----------  289

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               P+I Y DVGV+  I+  KSEY+K    ++  WH L  YLHG  G QG +G FK     
Sbjct  290   -YPIIPYVDVGVELAIDTRKSEYLKAPG-DLTTWHNLECYLHGTAGAQGRRGGFKLAIDR  347

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             D+  VNK    LK E   VP  WWVEKNKGM++  DG + L+DHE D+
Sbjct  348   DVALVNKSTDALKDEYL-VPDSWWVEKNKGMMKGADGHYKLEDHEEDN  394



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   353 bits (907),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 247/406 (61%), Gaps = 21/406 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA RWR+L+G DNW+ LLDPLD DLR+Y++HYG M  A YDSF S   SK+AG S +++
Sbjct  85    NIATRWRLLSGEDNWKSLLDPLDVDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSR  144

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K+L    GL  ANP+KY ITK+ Y  S    +    + ++S+  +A  KESNW GY+AVA
Sbjct  145   KNLFSRVGLSIANPYKYNITKFLYATSGIEVSE--AFLLRSLSREAWNKESNWIGYIAVA  202

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDI++ WRGT    EW+ DF  P+V    +F   N S VH+GW  +YTS 
Sbjct  203   TDEGKAALGRRDIVIAWRGTVQALEWVNDFEFPLVPADKLFGAANDSKVHKGWLSIYTSQ  262

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N NSAR QV +E+ +LL+ +++E++SIT+TGHSLG++L TLNA D+ AN  N  
Sbjct  263   DARSPFNINSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIANRINKG  322

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TAFLF  P VG+  F+K F+ +  L  LR  N  D+VP            
Sbjct  323   KKQPQKPCPVTAFLFGCPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDY----------  372

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL  Y  VG +  I+  KSEY+K        WH L  YLHG+ G QG +G F  +   D
Sbjct  373   -PLTGYAKVGEELIIDTRKSEYLKSPG-GFKSWHSLEAYLHGVAGTQGNEGGFMLEVKRD  430

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             I +VNK    LK E+  VP  WW  +NKGMVQ  DG W LDDHE +
Sbjct  431   IARVNKALNALK-EEYLVPGSWWCAQNKGMVQDADGFWKLDDHETE  475



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 259/413 (63%), Gaps = 33/413 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLL+PLD DLR+Y+I YG      YD+FISE  SKYAG SRY
Sbjct  1     MASMAEKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGEKAEVTYDTFISETASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L  + GL+   P KY +TK+FY  +T+       + V+S+  +A  KESN+ GY+A
Sbjct  61    SMENLFAKVGLD---PSKYRVTKFFY--ATSSIPLPSAFLVKSLSREAWNKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLV-------HR  1051
             VATD+GK  LGRRDI++ WRGT    EW+ D    ++    +F   NG LV       H 
Sbjct  116   VATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFG--NGGLVPLFKPLVHH  173

Query  1050  GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVD  871
             G+Y +YT+ N  S  N  S RDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD
Sbjct  174   GFYSIYTTENPRSKFNQYSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVD  233

Query  870   LAANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
             +A N  N T    +  +TAF+FASPKVG+  F+ AFS LK L  LR+ N  D+VP  P  
Sbjct  234   IAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQMAFSKLKTLHILRIHNLLDIVPKYP--  291

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--G  529
                     PL  Y DVG +  I+ +KS Y+K    +VL WH L  Y+HG+ G QG     
Sbjct  292   --------PL-GYIDVGEELIIDTTKSPYLKLPG-DVLTWHNLECYMHGVAGTQGLGLLT  341

Query  528   EFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              FK +   D+   NK  G LK E C +P  WW EK+KGM+QQ+DGTW+L D E
Sbjct  342   GFKLEVNRDLALANKSSGALKDEYC-IPANWWTEKHKGMIQQEDGTWLLLDRE  393



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   349 bits (895),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 258/417 (62%), Gaps = 35/417 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA+ W  L+G +NW+GLL+PLD +LR+Y+I YG +  A YD+FISE  SKYAG SRY
Sbjct  1     MTSIAENWEQLSGKENWKGLLNPLDFNLRKYIIQYGELAQATYDTFISERASKYAGSSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K++L +  GL+   P  Y ITKYFY  +T+       + ++S   +A  KESN+ G+VA
Sbjct  61    SKENLFKRVGLD---PEMYHITKYFY--ATSSFPLPEAFMIRSWSREAWSKESNFMGFVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATDKGK VLGRRDI++ WRGT    EW+ D +  +V    +F   N        LVH+G
Sbjct  116   VATDKGKAVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGAGNSILPLLKPLVHQG  175

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             W  +YTS +  S  N  SARDQV  EV RL++ YKNE+VSITVTGHSLG++LATLNAVD+
Sbjct  176   WNSVYTSDDPRSPFNKASARDQVLEEVKRLVEKYKNEKVSITVTGHSLGAALATLNAVDI  235

Query  867   AANPFNN----TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N  N      +  +TAF+FASP VG+  F+ AFS LKNL  LR+ N  D+VP      
Sbjct  236   VYNGINKKSNGKEFPVTAFVFASPNVGDLNFRAAFSKLKNLHILRIDNLLDIVPK-----  290

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK----  532
                    P I Y DVG    I+ +KS+YVK    N+L WH L  Y+HG+ G QG      
Sbjct  291   ------YPPIGYIDVGQVLVIDTAKSDYVKSPG-NILTWHNLEAYMHGVAGTQGVGILPG  343

Query  531   ---GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                GEFK +   DI  VNK    LK E+  VP  WWVEKN GMVQ+ D +W+L D E
Sbjct  344   ELLGEFKLEVNRDIALVNKSMDALK-EEYGVPANWWVEKNNGMVQRADRSWVLMDRE  399



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   349 bits (895),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 199/412 (48%), Positives = 257/412 (62%), Gaps = 30/412 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLL+PLD DLR+Y+I YG +    YD+FI E  SKYAG SRY
Sbjct  1     MASMAEKWEHLSGKNNWEGLLNPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL+   P  Y +TKYFY  +T+       + V+S+  +A  KESN+ GY+A
Sbjct  61    SMENLFTRAGLD---PLNYKVTKYFY--ATSSIPLPSAFLVKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT    EW+ D    ++    +F  D G       LVH G
Sbjct  116   VATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFG-DGGLLPLFKPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S  N  SARDQV  EV RL++ YKNEEVSITV GHSLG+SLATLNAVD+
Sbjct  175   FYNIYTSEDPRSKFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N T    +  +TAF+FASPKVG+  F+K FS LKNL  LR+ N  D+VP      
Sbjct  235   AFNGINKTSSGKEFPVTAFVFASPKVGDLNFQKTFSKLKNLHILRIHNLLDIVPK-----  289

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P + Y DVG +  I+ +KS Y+K +  +    H L  YLHGIDG QG      
Sbjct  290   ------YPPVGYIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGILAG  343

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   D+  VN+   MLK E C +P  WW EK+KGMVQQ+DGTW+L D E
Sbjct  344   FKLEVNRDLALVNRIWDMLKDEYC-IPAAWWTEKHKGMVQQEDGTWLLLDRE  394



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 201/412 (49%), Positives = 256/412 (62%), Gaps = 31/412 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  +A++W  L+G DNWE LL+PLD DLR+Y+I YG +  A YD+FI+E  SKYAG SRY
Sbjct  1     MACMAEKWEQLSGKDNWEALLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    G    +P KY +TK+FY  +T+       + V+S+  +A  KESN+ GY+A
Sbjct  61    SMENLFTGVG---HDPLKYRVTKFFY--ATSSIPLPDAFVVKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT    EW+ DF+  +V    +F  D G       LVH G
Sbjct  116   VATDEGKVSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFG-DGGLLPLFQPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S  N    RDQV  EV RL++ YKNE+VSITVTGHSLG+SLATLNAVD+
Sbjct  175   FYNIYTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N  N T    +  +TAF+FASPKVG+  F KAFS L NL  LR+ N  D+VP      
Sbjct  235   TFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNLLDIVPK-----  289

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P I Y DVG +  I+ +KS YVK    ++  WH L  YLHG+ G QG      
Sbjct  290   ------YPPIGYIDVGKELMIDTTKSPYVKPPG-DIASWHLLEPYLHGVAGTQGIGILAG  342

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   DI  VNK G  LK E C +P  WWVEK+KGMVQQ DGTW+L D E
Sbjct  343   FKLEVNRDISLVNKMGDTLKDEHC-IPGHWWVEKHKGMVQQQDGTWLLLDRE  393



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 192/409 (47%), Positives = 248/409 (61%), Gaps = 22/409 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             ++ I +RWR+L+G DNW+ LLDPLD DLRRY+IHYG    A YD+F  E  SKYAG S Y
Sbjct  2     LKDIPRRWRLLSGQDNWKNLLDPLDIDLRRYIIHYGERAQATYDTFDHEKASKYAGSSLY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
                 L +  GL K NPFKY + KY Y  S         +  +S+  D+V KESN+ GYVA
Sbjct  62    KPDVLFKSVGLCKRNPFKYKVVKYLYATSKISVPD--AFIEKSLSKDSVCKESNFMGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDILV WRGT    E  +DF  P+V   +I  +D  + VH+G   +YT
Sbjct  120   VATDEGKIALGRRDILVAWRGTIRNIELAKDFDFPLVPASMILGKDINAKVHKGVLSIYT  179

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S++  S  N  SAR QV   +  L++ +K EEVSIT+ GHSLG++L+T+NA D+ AN +N
Sbjct  180   SSDPQSTYNKQSARVQVLEAIKSLVEEFKKEEVSITIAGHSLGAALSTMNAADIVANGYN  239

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                   N   ++TAF F SP+VG+  F+ AF  + +L  LRV N  DLVP V        
Sbjct  240   KTRGMPNKSCMVTAFAFGSPRVGDSNFRNAFESMNDLHLLRVRNIPDLVPQV--------  291

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGL-MIYLHGIDGFQGPKGEFKPQG  511
                P I Y DVG +  I++ KS Y+K    N+ +WH L   YLH + G QG KG F  + 
Sbjct  292   ---PPIPYADVGEELLIDSRKSPYLKRIG-NLEIWHNLEAAYLHAVAGTQGSKGGFHLEV  347

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    +K E   +PT WW  KNKGMVQQDDG+W L+DH+ D
Sbjct  348   KRDISLVNKILDAVKDEYL-IPTGWWCLKNKGMVQQDDGSWKLEDHDRD  395



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   348 bits (892),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 259/418 (62%), Gaps = 27/418 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA++WR L+G   W+GLLDPL  DLR+YL+HYG +  + YD+F SE  SKYAG   Y
Sbjct  1     MGSIARKWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRA-DAVMKESNWGGYV  1213
             +KK L  +  LEK NPFKY+ITK+ Y  +T+  +    + ++S+ + DA   ESNW GYV
Sbjct  61    SKKDLFSKVNLEKGNPFKYSITKFIY--ATSKASDSESFLLRSILSKDAWSMESNWIGYV  118

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AVATD+GK  LGRRDI+V WRGT   SEWI+DF   +    +IF   +   +H G+Y +Y
Sbjct  119   AVATDEGKVSLGRRDIVVAWRGTIQGSEWIKDFHFHLDSAPLIFGLQSPVQIHNGFYSLY  178

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS N      ++SAR+QV +E+ RL++ YKNEE+SIT+TGHSLG++LA +N+VD+ AN F
Sbjct  179   TSDNPGFQSANSSARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDIVANKF  238

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +T F FASP+VGN  F   FS+ K+L AL + N  D+VP+  FL    
Sbjct  239   NISKEQPQKSCPVTTFAFASPRVGNSSFGNIFSNYKDLNALLIRNQTDIVPISLFL----  294

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                     Y +VG +  I+  KS+Y+K      +  H L +YLHG+ G QG KG F  + 
Sbjct  295   -------GYSEVGEELLIDTKKSKYLKSG----VSSHNLEVYLHGVAGTQGSKGGFNLEV  343

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVFA*IKP  337
               DI  VNK    LK ++  VP  W V +NKGMVQQ DGTW L D   D V+   ++P
Sbjct  344   NRDIALVNKSNDGLK-DEYRVPNAWRVVENKGMVQQFDGTWKLMDDNEDVVLI--VRP  398



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 203/417 (49%), Positives = 259/417 (62%), Gaps = 35/417 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA++W  L+G +NW+GLL+PLD +LR+Y+I YG +  A YD+FIS+  SKYAG SRY
Sbjct  1     MASIAEKWEELSGKENWKGLLNPLDVNLRKYIIQYGELAQATYDTFISDRASKYAGSSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K++L  + GL+   P  Y +TKYFY  +T+       + V+S   +A  KESN+ GYVA
Sbjct  61    SKENLFAKVGLD---PEMYHVTKYFY--ATSSFPLPEAFMVKSWSREAWSKESNFMGYVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATDKGK VLGRRDI++ WRGT    EW+ D +  +V    +F   N        LVH+G
Sbjct  116   VATDKGKAVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGGGNSILPLFKPLVHQG  175

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             W  +YTS +  S  N  SARDQV  EV +L++ YKNEEVSITVTGHSLG+++ATLNAVD+
Sbjct  176   WKSIYTSDDPKSPFNKASARDQVLEEVKKLVEKYKNEEVSITVTGHSLGAAVATLNAVDI  235

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N FN T    +  +TA +FASP VG+  F+ AFS LKNL  LRV N  D+VP      
Sbjct  236   VYNGFNKTSNGKEFPVTACVFASPNVGDLNFRVAFSKLKNLHILRVDNIVDIVPK-----  290

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK----  532
                    P I Y DVG    I+ +KS+Y+K    N+  WH L  YLHG+ G QG      
Sbjct  291   ------YPPIGYIDVGEVLVIDTAKSDYLKSPG-NLQTWHNLEAYLHGVAGTQGVGILIG  343

Query  531   ---GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                G+FK +   DI  VNK    LK E   VP  WWVEKNKGMVQ+ D TW+L D E
Sbjct  344   EFFGDFKLEVDRDIALVNKSTDALKGEYG-VPANWWVEKNKGMVQKKDKTWVLMDRE  399



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 195/418 (47%), Positives = 254/418 (61%), Gaps = 27/418 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M++IA++WR L+G  NW+GLLDPLD+DLRRY+IHYG +  A YD+F +E  SK AG SRY
Sbjct  1     MDTIARKWRDLSGQSNWKGLLDPLDTDLRRYIIHYGQLAQAAYDAFNTEKASKCAGNSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHG-GYHVQSVRADAVMKESNWGGYV  1213
             A      + GLE  N FKY +TK+ Y    TC A     + ++S   DA  +ESNW GYV
Sbjct  61    AMSDFFSKVGLENGNCFKYVVTKFLY---ATCKAGASESFILKSFNKDAWSQESNWIGYV  117

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AVATD+GK  LGRRDI+V WRGT   +EW++D    +    +IF  D  + VH G+Y +Y
Sbjct  118   AVATDEGKAALGRRDIVVAWRGTINAAEWVQDLHFHLDSAPLIF-DDARAKVHHGFYSVY  176

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLY--KNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             TS    S  N    R QV  EV RL++ Y  KNEE+SITV GHSLG++LAT+NAVD+ A 
Sbjct  177   TSNKPGSEFNDTCVRHQVLEEVRRLVEEYNRKNEEISITVIGHSLGAALATINAVDIVAK  236

Query  858   PFN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
               N           +T F+FASP+VGN  F K F+  K+LRALR+ N  D+VP +P    
Sbjct  237   GLNIPKDQPEKACSVTTFVFASPRVGNSHFAKIFTGHKHLRALRIRNETDVVPKLPL---  293

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF--  523
                 +  L  + DVG +  I+ +KS+Y+K +    +  H L +YLHG+ G QG  GE   
Sbjct  294   --KHLFFLDGFSDVGEELVIDTTKSKYLKKE----VSAHNLEVYLHGVAGTQGKNGEIFD  347

Query  522   KPQGCFDIPQVNKYGGMLKVE-KCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
               +   DI  +NK    LK E  CPV   W V +NKGMVQQ DGTW L DH  D ++F
Sbjct  348   LDESLRDIALLNKSKDALKDEYHCPVA--WRVHENKGMVQQKDGTWKLMDHNKDGILF  403



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   347 bits (891),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 252/407 (62%), Gaps = 23/407 (6%)
 Frame = -2

Query  1548  WRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLE  1369
             W+ L GSDNW+GLL+PL  DLRRYLIHYG M  A YD+F +E  SK+AG SRY+K+    
Sbjct  44    WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  103

Query  1368  ETGLEKAN--PFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDK  1195
             + GLEK    P+KY +TK+ Y  S         + V+S+  +A  KESNW GYVAV TD+
Sbjct  104   KIGLEKGKTGPYKYRVTKFLYATSQVQVPD--AFIVRSLSREAWSKESNWIGYVAVGTDE  161

Query  1194  GKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTNQD  1015
             G   LGRRD+++ WRGT    EW++DF   +V    IF + +   +H+GWY +YTS ++ 
Sbjct  162   GAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQGWYSIYTSDDRR  221

Query  1014  SHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTDVL  835
             S   +NS R+QV  EV RL++ YKNEE+SI  TGHSLG++LATLNA D+AAN  N     
Sbjct  222   SPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDMAANKLNVAATT  281

Query  834   -----ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                  +T+F+FASP+VG+  FK+AFS  K++  LRV N  D+VP             P+I
Sbjct  282   GEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPN-----------YPII  330

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP-KGEFKPQGCFDIPQ  493
              Y +VG + +I+  KS+Y+K    ++  WH L  YLHG+ G QG  KG F+ +   DI  
Sbjct  331   GYSEVGEELEIDTRKSKYLKSPG-SLSSWHNLEAYLHGVAGTQGKNKGGFRLEIERDIAL  389

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             +NK    LK E   VP  W   +NKGMVQQ DG+W L DHE D   F
Sbjct  390   LNKSLDALKDEYL-VPVAWRCLQNKGMVQQSDGSWKLMDHEEDDEFF  435



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   346 bits (887),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 201/409 (49%), Positives = 260/409 (64%), Gaps = 31/409 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A++W  L+G +NWEGLL PLD DLR+Y+IHYG +  A YD+FI+E  SKYAG SRY+ +
Sbjct  1     MAEKWEELSGKNNWEGLLHPLDVDLRKYIIHYGELAQATYDTFITERASKYAGASRYSME  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +L  + GL   +P KY +TK+FY  +T       G+ V+S+  +A  KESN+ GY+AVAT
Sbjct  61    NLFTKVGL---DPNKYRVTKFFY--ATASIPLPDGFIVKSLSREAWSKESNFMGYIAVAT  115

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRGWYE  1039
             D+GK  LGRRDI++ WRGT  + EW+ D +  +V    +F  D G       LVH G+Y 
Sbjct  116   DEGKVSLGRRDIVIAWRGTMQKLEWVNDLQFLLVPAPQVFG-DGGLLPLFQPLVHHGFYN  174

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
              YTS++  S  N  SARDQV  EV RL++ YK+EEVSITVTGHSLG+SLATLNAVD+A N
Sbjct  175   AYTSSSSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFN  234

Query  858   PFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
               N T    +  +TAF FASPKVG+  FK AF  +K LR L++ N  D+VP         
Sbjct  235   GINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKGLRVLKIHNLLDIVPK--------  286

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEFKP  517
                 P I Y DVG +  I+ +KS YVK     V  WH L  YLHG+ G QG      FK 
Sbjct  287   ---YPPIGYFDVGQELMIDTTKSPYVKPPGEPV-SWHLLEPYLHGVAGTQGLGLLAGFKL  342

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             +   DI  VNK   +LK E C +P  WWVEKNKGMVQQ+DG+W++ D +
Sbjct  343   EVNRDISLVNKQWDVLKDEYC-IPGLWWVEKNKGMVQQEDGSWLMLDRD  390



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   346 bits (888),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 199/419 (47%), Positives = 260/419 (62%), Gaps = 31/419 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G + WEGLL+PLD DLR+Y+I YG +    YD+FIS+  SKYAG SRY
Sbjct  1     MSSMAEKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L    GL+   P KY +TKYFY  +T+       +  +S+  +A  KESN+ GY+A
Sbjct  61    SMENLFSNVGLD---PSKYRVTKYFY--ATSSIPLPDAFITKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT    EW+ D +  ++    +F  D G       LVH G
Sbjct  116   VATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFG-DGGLLPLFKPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S+ N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNA D+
Sbjct  175   FYNVYTSESARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAFDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N T    +  +TAF+FASPKVG+  F  AF+ LK+L  +R+ N  D+VP  P   
Sbjct  235   AYNKINKTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLDIVPKYP---  291

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    PL  Y DVG +  I+ +KS Y+     ++L WH L  YLHG+ G QG      
Sbjct  292   -------PL-GYFDVGQEIIIDTTKSPYLNLPG-DILTWHNLECYLHGVAGTQGIGLLAG  342

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVFA  349
             FK +   DI  VNK  G LK E   VP  WW  KNKGMVQQ+DG W+L+D E   +V A
Sbjct  343   FKLEVDRDIALVNKSSGALKSEYL-VPANWWTAKNKGMVQQEDGKWVLNDREEYDIVVA  400



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   346 bits (887),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 193/409 (47%), Positives = 251/409 (61%), Gaps = 23/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKR R LNG DN +GL DPLD DLRR ++ YG M  A YD+FI+E  S+YAG  RYA++
Sbjct  5     IAKRLRELNGRDNRKGLSDPLDIDLRRNILLYGEMAQATYDAFITEKKSRYAGDCRYARR  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
                ++          Y +TK+FY  S+        + ++S+  +A  KESNW GYVAVAT
Sbjct  65    DFFDKVATSTDQQSLYRVTKFFYATSSIDVPE--AFLIKSLSREAWSKESNWMGYVAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS--LVHRGWYEMYTS  1027
             D+GK+VLGRRD++V WRGT    EWI D    +V    I  + +     VHRGW  +YTS
Sbjct  123   DEGKKVLGRRDVVVAWRGTVQALEWINDLDFTLVSASAILGKGSSGNPQVHRGWLSIYTS  182

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              +  S  N +SARDQV +E+ RL++ YK+EE SIT+TGHSLG++LATLNA D+A+N  N 
Sbjct  183   NDPRSPYNKDSARDQVLSEIGRLMEEYKDEETSITITGHSLGAALATLNAADIASNGLNK  242

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  N +  +TAF+FASP+VG+  F++AFS +  LR LR+ N  DLVP           
Sbjct  243   SNAHPNKNSPVTAFVFASPRVGDSDFREAFSKIPELRLLRIRNVPDLVPN----------  292

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               PL+ Y DVGV+  I+  KS+Y+K    N+  WH L  YLHG+ G +G K  FK +   
Sbjct  293   -YPLLGYDDVGVELTIDTRKSQYLKSPG-NLSSWHNLEAYLHGVAGTRGGKKGFKLEVDR  350

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
             D+  VNK    LK E   VP  W VEKNKGMV+  DG W L DHE D V
Sbjct  351   DVALVNKSMDALKDEYL-VPASWRVEKNKGMVKGADGHWRLMDHEEDSV  398



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   347 bits (890),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 252/407 (62%), Gaps = 23/407 (6%)
 Frame = -2

Query  1548  WRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLE  1369
             W+ L GSDNW+GLL+PL  DLRRYLIHYG M  A YD+F +E  SK+AG SRY+K+    
Sbjct  50    WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  109

Query  1368  ETGLEKAN--PFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDK  1195
             + GLEK    P+KY +TK+ Y  S         + V+S+  +A  KESNW GYVAV TD+
Sbjct  110   KIGLEKGKTGPYKYRVTKFLYATSQVQVPD--AFIVRSLSREAWSKESNWIGYVAVGTDE  167

Query  1194  GKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTNQD  1015
             G   LGRRD+++ WRGT    EW++DF   +V    IF + +   +H+GWY +YTS ++ 
Sbjct  168   GAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQGWYSIYTSDDRR  227

Query  1014  SHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTDVL  835
             S   +NS R+QV  EV RL++ YKNEE+SI  TGHSLG++LATLNA D+AAN  N     
Sbjct  228   SPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDMAANKLNVAATT  287

Query  834   -----ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                  +T+F+FASP+VG+  FK+AFS  K++  LRV N  D+VP             P+I
Sbjct  288   GEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPN-----------YPII  336

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP-KGEFKPQGCFDIPQ  493
              Y +VG + +I+  KS+Y+K    ++  WH L  YLHG+ G QG  KG F+ +   DI  
Sbjct  337   GYSEVGEELEIDTRKSKYLKSPG-SLSSWHNLEAYLHGVAGTQGKNKGGFRLEIERDIAL  395

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             +NK    LK E   VP  W   +NKGMVQQ DG+W L DHE D   F
Sbjct  396   LNKSLDALKDEYL-VPVAWRCLQNKGMVQQSDGSWKLMDHEEDDEFF  441



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 259/411 (63%), Gaps = 29/411 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M ++A++W  L+G +NWEGLL+PLD DLR+Y+I YG +  A YD+FI+E  SKYAG SRY
Sbjct  1     MVNMAEKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L  + GL+   P KY +TK+FY  +T+       + V+S+  +A  KESN+ GY+A
Sbjct  61    SMENLFTKVGLD---PLKYRVTKFFY--ATSSIPLPDAFIVKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-----VHRGW  1045
             VATD+GK  LGRRDI+V WRGT  + EW+ D +   V    +F            VH G+
Sbjct  116   VATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLPLLKPLVHHGF  175

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
             Y +YT+ +  S  N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+A
Sbjct  176   YNIYTTEDLRSQFNQASARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIA  235

Query  864   ANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
              N  N T    +  +TAF+FASPKVG+  F KAFS L NL  LR+ N  D+VP       
Sbjct  236   FNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK------  289

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEF  523
                   P + Y DVG +  I+ +KS YVK     V+ WH L  YLHG+ G QG      F
Sbjct  290   -----YPPVGYIDVGEELIIDTTKSPYVKPPG-EVVSWHLLEPYLHGVAGTQGIGILAGF  343

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   DI  VNK   ++K E C +P  WWV+K+KGMVQQ DG+W+L D E
Sbjct  344   KLEVNRDISLVNKQWDIIKDEYC-IPGLWWVDKHKGMVQQQDGSWLLLDRE  393



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   343 bits (881),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 190/414 (46%), Positives = 252/414 (61%), Gaps = 26/414 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA+ WR L+G   W+GLL+PL  DLRRYL+HYG    A YD F  E  SKYAG  RY
Sbjct  1     MGSIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSV-RADAVMKESNWGGYV  1213
             +KK    +  LEK NPFKY++TKY Y  +T+       + + S+   DA   E+NW GYV
Sbjct  61    SKKDFFSKVYLEKGNPFKYSVTKYLY--ATSKARDSAAFLLTSIFSKDAWSLETNWMGYV  118

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AVATD+ KE LGRRDI+V WRGT   +EW+++F I +    +IF   +   +H G+Y +Y
Sbjct  119   AVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLY  178

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS N    L  +SAR QV  E+ RL++LYKNEE+SITVTGHSLG +LAT++++D+ AN F
Sbjct  179   TSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKF  238

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +T F F SP+VGN  F+K FS   +LRAL + NN D+VP    L    
Sbjct  239   NIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVPSSLRL----  294

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                    AY  VG + +I+  KS+Y+K      +  H + +YLHGI G QG KG F  + 
Sbjct  295   -------AYSKVGEELEIDTEKSKYLKSG----VSEHNMEVYLHGIAGTQGSKGGFNLEV  343

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW-ILDDHEADHVVF  352
               DI  +NK    LK ++  +P  W V +NKGMVQQ DGTW ++DDH  D ++ 
Sbjct  344   NRDIALLNKSNDGLK-DEYHIPENWRVVENKGMVQQSDGTWKLMDDHNDDVLIM  396



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 197/409 (48%), Positives = 256/409 (63%), Gaps = 27/409 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A +W  L+G +NWEGLL+PLD DLR+Y+I YG +  A+ D+FI+E  SKYAG SRY
Sbjct  1     MGSMADKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQAINDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L  + GL+   P KY +TKYFY  + +     G + V+S+  +A  KESN+ GY+A
Sbjct  61    SMENLFTKVGLD---PTKYRVTKYFYA-TASIPLPDGVFFVKSLSREAWSKESNFMGYIA  116

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYE  1039
             VATD+GK  LGRRDI++ WRG+    EW+ D +  +V    +F  D G    LVH+G+Y 
Sbjct  117   VATDEGKVSLGRRDIVINWRGSMQTLEWVNDLQFVLVPAPEVFG-DGGLLQPLVHQGFYN  175

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+++  S  N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+A N
Sbjct  176   VYTASSSRSQFNVTSARDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFN  235

Query  858   PFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
               N      +  +TAF FA PKVG+  FK AF  +  LR LR+ N  D+ P         
Sbjct  236   KINKASNGKEFPVTAFPFACPKVGDLQFKAAFDKIIGLRILRIDNLLDIAPK--------  287

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEFKP  517
                 P I Y DVG +  I+ +KS YVK     V  WH L  YLHGI G QG      F  
Sbjct  288   ---YPPIGYFDVGQELMIDTTKSPYVKPPGQPV-NWHSLESYLHGIAGTQGTGLLAGFNL  343

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             +   DI  +NK    LK E C +P  WWVEKNKGMVQQ+DG+W+L D +
Sbjct  344   EVNRDISLINKQLDGLKDEYC-IPVNWWVEKNKGMVQQEDGSWLLLDRD  391



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 192/408 (47%), Positives = 252/408 (62%), Gaps = 19/408 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E IAKRW++L+G   WEGLLDPLD DLRRYLIHYG M  A YD+FI E  SKYAG SRY
Sbjct  3     VEDIAKRWKLLSGQQKWEGLLDPLDLDLRRYLIHYGEMAQATYDTFIMEKVSKYAGDSRY  62

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + K+L  E GL   NPF Y   KY Y  S         + ++ +  DA  +ESNW GY+A
Sbjct  63    SMKNLFSEVGLVLNNPFVYQPVKYLYATSKIDVPE--SFILKPLSRDAWNRESNWIGYIA  120

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK+ LGRRDI + WRGT    EWI+DF  P+     I   +  + VH+G+  +YT
Sbjct  121   VATDQGKQALGRRDITIAWRGTIQPLEWIKDFDFPLTSASDIVGVEKDAQVHQGFLSIYT  180

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S N  S  N  S R+Q+   +  L+D Y+NE++S+TVTGHSLG++LATL+AVD+ AN  N
Sbjct  181   SDNPQSQFNKTSVREQIFETLKELVDKYENEDISVTVTGHSLGAALATLSAVDIVANGLN  240

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              +D        +TAF+FA P+ G+  F++      +LR LRV N  D++P VP LA    
Sbjct  241   RSDDQASKACPVTAFVFACPRTGDLAFREVSDSFSDLRILRVTNTPDIIPKVPPLA----  296

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                  I Y+DVG   ++++ KS Y+K      + WH L  Y+H I G QG K +F  +  
Sbjct  297   -----IGYRDVGQNLELDSRKSTYLKPTGA-FITWHNLEAYMHCIAGTQGGKPDFHLEVN  350

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              DI  VNK    LK +   VP+ WW EK+KGMVQQ+DG+W LDDHE D
Sbjct  351   RDIALVNKKLNSLK-DIYLVPSAWWQEKHKGMVQQEDGSWKLDDHEDD  397



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   342 bits (876),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 200/410 (49%), Positives = 260/410 (63%), Gaps = 33/410 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A++W  L+G +NWEGLL PLD DLR+Y+I YG +  A YD+FI+E  SKYAG SRY+ +
Sbjct  1     MAEKWEELSGKNNWEGLLHPLDIDLRKYIIQYGELAQATYDTFITERASKYAGASRYSME  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +L  + GL+   P KY +TK+FY  +T        + V+S   +A  KESN+ GY+AVAT
Sbjct  61    NLFTKVGLD---PNKYRVTKFFY--ATASIPLPDAFIVKSFSREAWSKESNFMGYIAVAT  115

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNG------SLVHRGWY  1042
             D+GK  LGRRDI++ WRGT  + EW+ D + +P+  P++    D G       LVH G+Y
Sbjct  116   DEGKVSLGRRDIVINWRGTLQKMEWVNDLQFLPVPAPKVF--GDGGLLPLFKPLVHHGFY  173

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
              +YTS +  S  N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+A 
Sbjct  174   NVYTSASSRSQFNLTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAF  233

Query  861   NPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             N  N T    +  +TAF FASPKVG+  FK AF  LK+LR L++ N  D+VP        
Sbjct  234   NGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKLKSLRILKIHNLLDIVPK-------  286

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEFK  520
                  P I Y DVG +  I+ ++S YVK    +   WH L  YLHG+ G QG      FK
Sbjct  287   ----YPPIGYFDVGKELMIDTARSPYVKPPG-DPASWHLLEPYLHGVAGTQGLGLLAGFK  341

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              +   DI  VNK   +LK E C +P  WWVEKNKGMVQQ+DG+W+  DH+
Sbjct  342   LEVNRDISLVNKQWNVLKDEYC-IPGFWWVEKNKGMVQQEDGSWLQLDHD  390



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 198/405 (49%), Positives = 260/405 (64%), Gaps = 28/405 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA-K  1384
             +A++W  L+G +NW+GLL+PLD DLR+Y+I YG +  A+YD+FI+E  SKYAG SRY+ +
Sbjct  1     MAEKWEELSGKNNWDGLLNPLDIDLRKYIIQYGELCQAIYDTFITETASKYAGASRYSME  60

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K      GL   +P KY +TKYFY  +T+       +  +S+  +A  KESN+ GY+AVA
Sbjct  61    KPFFTRFGL---DPNKYRVTKYFY--ATSSIPLPDAFITKSLSREAWSKESNFMGYIAVA  115

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMY  1033
             TD+GK  LGRRDI++ WRGT+ + E+I D +  +V    +F  D G    LVH G+Y +Y
Sbjct  116   TDEGKVSLGRRDIVINWRGTQQKLEFINDLQFLLVPAPKVFG-DGGLLQPLVHNGFYNVY  174

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  N  SARDQV  EV RL++ YK+EEVSITVTGHSLG+SLATLNAVD+A N  
Sbjct  175   TSASSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNGI  234

Query  852   NNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
             N T    +  +TAF FASPKVG+  FK AF  +K+LR L++ N  D+ P           
Sbjct  235   NKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKSLRILKIHNLLDIFPK----------  284

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               P I Y DVG +  I+ +KS YV+        WH L  YLHG+ G QG  G FK +   
Sbjct  285   -YPPIGYFDVGQELMIDTTKSPYVRPPG-EPFSWHLLEPYLHGVAGTQGLAG-FKLEVNR  341

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             DI  VNK   +LK E C +P  WWVEKNKGMVQQ+DG+W+L DH+
Sbjct  342   DISLVNKQWDVLKDEYC-IPGFWWVEKNKGMVQQEDGSWLLLDHD  385



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   343 bits (879),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 250/403 (62%), Gaps = 22/403 (5%)
 Frame = -2

Query  1548  WRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLE  1369
             W+ L GSDNW+GLL+PL  DLRRYLIHYG M  A YD+F +E  SK+AG SRY+K+    
Sbjct  50    WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKVSKFAGSSRYSKQDFFA  109

Query  1368  ETGLEKAN--PFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDK  1195
             + GL K    P+KY +TK+ Y  S         + V+S+  +A  KESNW GYVAV+TD+
Sbjct  110   KIGLGKGKTGPYKYRVTKFLYATSQV--QVPDAFIVRSLSREAWSKESNWIGYVAVSTDE  167

Query  1194  GKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTNQD  1015
             G   LGRRD+++ WRGT    EWI+DF   +V    IF + +   +H+GWY +YTS ++ 
Sbjct  168   GAAELGRRDVVIAWRGTVRSLEWIDDFEFGLVSAPQIFGESSDVKIHQGWYSIYTSDDRR  227

Query  1014  SHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTDVL  835
             S   +NS R+QV  EV RL++ YKNEE+SI  TGHSLG++LATLNAVD+AAN  N     
Sbjct  228   SPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAVDIAANKLNIAAAT  287

Query  834   -----ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
                  +T+F+FA P+VG+  FK+AFS  K++  LRV N  D+VP  P            I
Sbjct  288   GQAYPVTSFVFACPRVGDSEFKRAFSEYKDVHVLRVKNAMDVVPNYPM----------FI  337

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP-KGEFKPQGCFDIPQ  493
              Y +VG + +I+  KS+Y+K    ++  WH L  YLHG+ G QG  KG F+ +   DI  
Sbjct  338   GYSEVGEELEIDTRKSKYLKSPG-SLSSWHNLEGYLHGVAGTQGKNKGGFRLEIERDIAL  396

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             +NK    LK E   VP  W   +NKGMVQQ DG+W L DHE D
Sbjct  397   LNKSLDALKDEYL-VPVAWRCLQNKGMVQQTDGSWKLMDHEED  438



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   341 bits (874),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 198/412 (48%), Positives = 257/412 (62%), Gaps = 31/412 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G +NWEGLL+PLD DLR+Y+I YG +  A YD+FISE  SKYAG SRY
Sbjct  1     MGSMAEKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++   + GL+   P KY +TK+FY   T+       +  +S+  +A  KESN+ GY+A
Sbjct  61    SMENFFTKVGLD---PSKYHVTKFFY--GTSSIPLPDAFMTRSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI++ WRGT    EW+ D +  +V    +F  D G       LVH G
Sbjct  116   VATDEGKVALGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFG-DGGLLPLFHPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             ++ +YT+ N  S  N    RDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+
Sbjct  175   FHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N +    +  +TAF+FASPKVG+  F KAFS LK+L  LR+ N  D+VP      
Sbjct  235   AFNGINKSSNGKEFPVTAFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPK-----  289

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQ--GPKGE  526
                    P + Y DVG +  I+ +KS YVK     V+ WH L  YLHGI G Q  G    
Sbjct  290   ------YPPVGYFDVGQELMIDTTKSPYVKPPG-EVVSWHLLEPYLHGIAGTQGIGMTAG  342

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   DI  VNK   +LK E C +P  WW EK+KGMVQQ DG+W+L D +
Sbjct  343   FKLEVNRDISLVNKQWMILKDEYC-IPPLWWSEKHKGMVQQQDGSWLLQDRD  393



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   341 bits (874),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 197/411 (48%), Positives = 254/411 (62%), Gaps = 29/411 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L G +NW GLL+PL  DLR+Y+IHYG +  A YD+FI E  SKYAG SRY
Sbjct  1     MGSMAEKWEELGGKNNWNGLLNPLAVDLRKYIIHYGELAQATYDTFIMERASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++   + GL+   P KY +TK+FY  +T+      G+ V+S   +A  KESN+ GY+A
Sbjct  61    SMENFFTKVGLD---PNKYRVTKFFY--ATSSIPLPDGFIVKSFSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDN-----GSLVHRGW  1045
             VATD+GK  LGRRDI+V WRGT  + EW+ D +  ++    IF           LVH G+
Sbjct  116   VATDEGKASLGRRDIVVNWRGTIQKMEWVNDLQFLLIPAPKIFGAGGLLPLFKPLVHHGF  175

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
             Y +YTS +  S  N  S RDQV  EV RL++ YK+EEVSITVTGHSLG+SLAT+NAVD+A
Sbjct  176   YNVYTSASSRSQFNKTSVRDQVIKEVKRLVEEYKDEEVSITVTGHSLGASLATMNAVDIA  235

Query  864   ANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
              N  N      +  +TAF FASPKVG+  FK  F  LK+L  LR+ N  D+VP       
Sbjct  236   FNKINKASNGKEFPVTAFAFASPKVGDIQFKATFDKLKHLHILRIHNLLDIVPK------  289

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEF  523
                   P I Y DVG +  I+ +KS YVK    NV  WH L  YLHG+ G QG      F
Sbjct  290   -----YPPIGYFDVGKELMIDTTKSPYVKPPGENV-SWHLLEPYLHGVAGTQGLGLFAGF  343

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   DI  VNK   +LK E C +P  WWVEKNKGMVQQ+DG+W++ D +
Sbjct  344   KLEVNRDISLVNKQWNILKDEYC-IPGMWWVEKNKGMVQQEDGSWLMLDRD  393



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 257/417 (62%), Gaps = 33/417 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A++W  L+G +NWEGLL+PLD DLR+Y+I YG      YD+FIS+  SKYAG SRY+ +
Sbjct  1     MAEKWEELSGKNNWEGLLNPLDVDLRKYIIQYGEKAEVTYDTFISDKVSKYAGASRYSME  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +L    GL+   P KY +TKYFY  +T+       +  +S+  +A  KESN+ GYVAVAT
Sbjct  61    NLFSNVGLD---PSKYRVTKYFY--ATSSMPLPDAFITKSLSREAWSKESNFMGYVAVAT  115

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNG------SLVHRGWY  1042
             D+GK  LGRRDI++ WRGT    EW+ D + +P+  P++    D G       LVH G+Y
Sbjct  116   DEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLPIPGPKVF--GDGGLLPLFKPLVHHGFY  173

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
              +YTS +  S  N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+A 
Sbjct  174   NVYTSESARSKFNKTSARDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAY  233

Query  861   NPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             N  N +    +  +TAF+FASPKVG+  F  AF+ LK L  +R+ N  D+VP        
Sbjct  234   NKINKSSHGKEFPVTAFVFASPKVGDLNFLNAFNKLKYLHVMRIHNILDIVPK-------  286

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEFK  520
                  P I Y DVG +  I+ +KS Y+     ++L WH L  Y+HG+ G QG      FK
Sbjct  287   ----YPPIGYLDVGQEIIIDTTKSPYLNLPG-DILTWHNLECYMHGVAGTQGIGLLTGFK  341

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVFA  349
              +   DI  VNK  G LK E   VP  WW  KNKGM QQ+DG W+L+D E   +V A
Sbjct  342   LEVDRDIALVNKSSGALKSEYL-VPANWWTVKNKGMFQQEDGKWVLNDREEYDIVVA  397



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 201/464 (43%), Positives = 256/464 (55%), Gaps = 73/464 (16%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +SIA RWR LNG DNW+ LLDPLD DLRR +IHYG    A YD+F SE  S +AG SRY+
Sbjct  3     DSIATRWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRYS  62

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             K +      LEK NP+KY ITK+ Y  S         + ++S+  +A  +ESNW GYVAV
Sbjct  63    KANFFSGLFLEKGNPYKYNITKFLYATSRIDVP--DAFIIKSLSREAWSRESNWMGYVAV  120

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+GK VLGRRDIL+ WRG+    EWI+DF   +V    I      + VH+GW  +YTS
Sbjct  121   ATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQGWLSIYTS  180

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              +  S  N+ SAR QV  EV RL++ +K+EE++IT+TGHSLG++L  LNAVD+ AN  N 
Sbjct  181   DDPRSPYNTTSARQQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDIVANGLNK  240

Query  846   -TD-----VLITAFLFASPKVGNEGFKKAFSHL---KNLRALRVVNNGDLVPMVPFLAVE  694
              TD      L+TAFLF  P VG+  F+  FS L   ++LR LR+ N  D+VP  P     
Sbjct  241   PTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPNYP-----  295

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK------  532
                  P+I Y  VG +  IN   S ++K +    + WH L IYLHGI G QG        
Sbjct  296   -----PMIGYTQVGEELVINTDTSPFLK-ESAEPMSWHNLEIYLHGIAGTQGSSVLPATT  349

Query  531   --------------------------------------------GEFKPQGCFDIPQVNK  484
                                                         GEFK     DI  VNK
Sbjct  350   NKTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNK  409

Query  483   YGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
                 LK ++  VP +WW EKNKGMVQ+DDG+W L DHE+D + F
Sbjct  410   VMDALK-DEFHVPAKWWCEKNKGMVQEDDGSWKLMDHESDALEF  452



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 190/409 (46%), Positives = 253/409 (62%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W+GLL PLD DLR+Y+IHYG M  A YD+F     SKYAG S Y++K
Sbjct  35    IAKRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRK  94

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +TK+ Y  S         + +  V  +   KESNW GYVAV 
Sbjct  95    DFFAKVGLEKAHPYTKYKVTKFLYATSEIHVPE--AFLLFPVSREGWSKESNWMGYVAVT  152

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-NGSLVHRGWYEMYTS  1027
              D+G  VLGRRDI++ WRG+    EW+ DF   +V  + IF +  N   +H+GW+ +Y S
Sbjct  153   DDQGTAVLGRRDIVIAWRGSVQPLEWVSDFDFSLVNAKKIFGEKYNQVQIHQGWHSIYMS  212

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              ++ SH N  +ARDQV  E+ RLL+ YK+EEVSI++ GHSLG++LATLNA D+ AN +N 
Sbjct  213   EDERSHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNR  272

Query  846   ------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                       +TAF+FASP+VGN  +KK FS L+++R LRV N  D+VP           
Sbjct  273   PKSRLGKSCPVTAFVFASPRVGNSEYKKLFSGLEDIRVLRVRNLPDVVP-----------  321

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P + Y +VG +F I+  KS+Y+K    N   +H L  YLHG+ G QG      F+   
Sbjct  322   IYPPLGYAEVGDEFPIDTRKSQYMKTPG-NFATFHCLESYLHGVAGTQGTSSADLFRLDV  380

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    LK ++  +P  W V KNKGMVQQDDG+W+L DHE D
Sbjct  381   KRDIGLVNKSVDGLK-DQYMIPGHWRVLKNKGMVQQDDGSWVLLDHEID  428



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   339 bits (869),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 191/411 (46%), Positives = 253/411 (62%), Gaps = 25/411 (6%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +  AKRWR L+G ++W+G+L PLD DLR Y+IHYG M  A YD+F     SK+AG S Y+
Sbjct  33    KEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYS  92

Query  1386  KKSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K    + GLEKA+P+ KY +TK+ Y  S         + +  V  +   KESNW GYVA
Sbjct  93    RKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPE--SFLLFPVSREGWTKESNWMGYVA  150

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMY  1033
             V  D+G  +LGRRDI+V WRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y
Sbjct  151   VTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYLIY  210

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
              S ++ S     +ARDQV  EV RLLD YK+EEVSIT+ GHSLG++LATLNA D+ AN +
Sbjct  211   MSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGY  270

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      +    +TAF+FASP+VG+  FKK FS L++LR LR  N  D++P         
Sbjct  271   NRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIP---------  321

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQG--PKGEFKP  517
               I P I Y +VG +  I+  KS+Y+K    N+  +H L  YLHG+ G QG     EF+ 
Sbjct  322   --IYPPIGYSEVGDELPIDTRKSQYMKSPG-NLATFHCLEAYLHGVAGTQGTAKADEFRL  378

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 DI  VNK    LK ++C VP +W V KNKGMVQQDDG+W L DHE D
Sbjct  379   DVKRDIGLVNKSVDGLK-DECMVPGKWRVLKNKGMVQQDDGSWNLLDHEID  428



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   338 bits (866),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 192/411 (47%), Positives = 256/411 (62%), Gaps = 28/411 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A +W  L+G + WEGLL+PLD DLR+Y+I YG +    YD+FI+E  SKYAG SRY
Sbjct  1     MSSMADKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAHVTYDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L  + GL+   P KY +TKYFY  +T+       +  +S+  +A  KESN+ GY+A
Sbjct  61    SMENLFSKAGLD---PSKYRVTKYFY--ATSSIPLPDAFITKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-----NGSLVHRGW  1045
             VATD+GK  LGRRDI++ WRGT    EW+ D +  ++    +F +         LVH G+
Sbjct  116   VATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPAPEVFGKGGLLPLTQPLVHHGF  175

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
             Y +YTS ++ S  N  SARDQV  EV RL++ YK++EVSITV GHSLG+SLATLNAVD+A
Sbjct  176   YNIYTSESERSKFNKTSARDQVLEEVKRLVEEYKDDEVSITVAGHSLGASLATLNAVDIA  235

Query  864   ANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
              N  N T    +  +TAF+FASPKVG+  F   F+ LKNL  +R+ N  D+VP       
Sbjct  236   FNGINKTSEGKEFPVTAFVFASPKVGDVNFVNTFNKLKNLHIMRIDNLLDIVPK------  289

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQ--GPKGEF  523
                   P I Y DVG +  I+ +KS Y+K +  +    H L  YLHGIDG Q  GP   F
Sbjct  290   -----YPPIGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGF  344

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   D+  VN+   +LK E   VP  WWVEK+ GMVQQ++G WIL DHE
Sbjct  345   KLEVNRDLALVNRIWDILKDEHL-VPGAWWVEKHNGMVQQENGKWILMDHE  394



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   337 bits (865),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 197/409 (48%), Positives = 254/409 (62%), Gaps = 31/409 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
              A++W  L+G +NW+GLL+PLD DLR+Y+IHYG +  A YD+FISE  SKYAG SRY+ +
Sbjct  5     FAEKWEELSGKNNWDGLLNPLDLDLRKYIIHYGELAQATYDTFISERASKYAGASRYSME  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +   + GL+   P KY +TKYFY  +T+       +  +S+  +A  KESN+ GY+AVAT
Sbjct  65    NFFTKVGLD---PKKYCVTKYFY--ATSSMPLPDAFITKSLSREAWSKESNFMGYIAVAT  119

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRGWYE  1039
             D+GK  LGRRDI++ WRGT    EW+ D +  +V    +F  D G       LVH G++ 
Sbjct  120   DEGKASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPQVFG-DGGLLPLFHPLVHHGFHN  178

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+ N  S  N    RDQV  EV RL++ YK+EEVSITVTGHSLG+SLATLNAVD+A N
Sbjct  179   IYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFN  238

Query  858   PFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
               N      +  +TAF+FASPKVG+  F  AFS LK+L  LR+ N  D+VP         
Sbjct  239   KINKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNVLDIVPK--------  290

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEFKP  517
                 P I Y DVG +  I+ +KS YVK     V  WH L  YLHGI G QG      FK 
Sbjct  291   ---YPPIGYFDVGQEIMIDTTKSPYVKPPGEPV-SWHLLEPYLHGIAGTQGIGMLAGFKL  346

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             +   DI  VNK   +LK E C +P  WW EK+KGMVQQ+DGTW+L D +
Sbjct  347   EVNRDISLVNKQWNVLKDEHC-IPPLWWSEKHKGMVQQEDGTWLLQDRD  394



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 189/413 (46%), Positives = 254/413 (62%), Gaps = 26/413 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIAK WR L+G   W+GLL+PL  DLR+YL+HYG    A YD+F  E  SKYAG  RY
Sbjct  10    MGSIAKTWRELSGKSKWKGLLEPLHIDLRKYLLHYGQFAQATYDAFNFEKASKYAGNCRY  69

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRA-DAVMKESNWGGYV  1213
             +KK    +  LE+ NP+KY++TKY Y  +T+  +    + + S+ + DA   ESNW GYV
Sbjct  70    SKKDFFSKVYLEEGNPYKYSVTKYLY--ATSKASDSAAFLLTSIFSKDAWSLESNWIGYV  127

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AVATD+ KE LGRRDI+VVWRGT   SEW+++F I +    +IF   +   +H G+Y +Y
Sbjct  128   AVATDEAKEALGRRDIVVVWRGTIQGSEWVQNFNIDLDPAPLIFGPKSNVQIHNGFYSLY  187

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS N       +SAR QV  E+ RL++LYKNEE+SITVTGHSLG +LAT+++VD+ AN F
Sbjct  188   TSENSGLPSADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSVDIVANKF  247

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +T F F +P+VGN  F+K FS  K+L AL V N  D+VP         
Sbjct  248   NMPKEQPQKACPVTTFAFGAPRVGNSYFQKIFSDHKDLSALFVRNENDIVPKS-------  300

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                L    YK VG + +I+  +S+Y+K      +  H + +YLHGI G QG KG F  + 
Sbjct  301   ---LTFFYYK-VGEELEIDTEESKYLKSG----VSAHNMEVYLHGIAGTQGSKGGFNLEV  352

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW-ILDDHEADHVV  355
               DI  +NK    LK ++  +P  W V +NKGMVQQ DGTW ++DDH  D ++
Sbjct  353   NRDIALLNKSNDGLK-DEYHIPENWRVVENKGMVQQSDGTWKLMDDHNDDVLI  404



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   337 bits (863),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 196/412 (48%), Positives = 254/412 (62%), Gaps = 31/412 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S A++W  L+G +NW+GLL+PLD DLR+Y+IHYG +  A YD+ I E  SKYAG SRY
Sbjct  1     MGSTAEKWEELSGKNNWDGLLNPLDVDLRKYIIHYGELAHATYDTLIMERASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++   + GL+   P KY +TK+FY  +T        + V+S   +A  KESN+ GY+A
Sbjct  61    SMENFFTKVGLD---PNKYRVTKFFY--ATASIPLPDAFIVKSFSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             V+TD+GK  LGRRDI++ WRGT  + EW+ D +  ++    IF  D G       LVH G
Sbjct  116   VSTDEGKASLGRRDIVINWRGTIQKMEWVNDLQFLLIPAPKIFG-DGGLLHLFKPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S  N  S RDQV  EV RL++ YK+EEVSITVTGHSLG+SLATLNAVD+
Sbjct  175   FYNVYTSASSRSQFNQTSVRDQVIKEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N  N T    +  +TAF FASPKVG+  FK AF  LK+L  LR+ N  D+VP      
Sbjct  235   TFNGINKTSEGKEFPVTAFAFASPKVGDLQFKAAFDKLKHLHVLRIHNLMDIVPK-----  289

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P I Y DVG +  I+ +KS YVK      L WH L  YLHG+ G QG      
Sbjct  290   ------YPPIGYFDVGKELMIDTTKSPYVKPPG-EPLSWHLLEPYLHGVAGTQGLGIFAG  342

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   DI  VNK   +LK E C +P  WWVEK KGMVQQ+DG+W++ D +
Sbjct  343   FKLEVNRDISLVNKQWNILKDEYC-IPGRWWVEKCKGMVQQEDGSWLMLDRD  393



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   337 bits (863),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 198/406 (49%), Positives = 255/406 (63%), Gaps = 21/406 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + ++A RWR+L G DNWEGLLDPLD DLRR L+ YG M  A YD+F  E  SKYAG  RY
Sbjct  3     IRTVASRWRILQGRDNWEGLLDPLDLDLRRLLLLYGDMAQAAYDAFNHERVSKYAGSCRY  62

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK+    +  L   NPF+YTITK+ Y  S+        + ++S+  +A  KESNW G+VA
Sbjct  63    AKRDFFSKVNLVNGNPFEYTITKFIYATSSVQVPE--AFLIRSLSREAWSKESNWMGFVA  120

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD GK+ LGRRD+++ WRGT    EW+EDF I  V    I    + + VHRGW+ +YT
Sbjct  121   VATDNGKKQLGRRDVVIAWRGTIEALEWVEDFDIGQVSAAPISGGGDDAKVHRGWFSIYT  180

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N+ SAR+QV +EV RL++ YK+EE+SIT+TGHSLG++L TLNA+D+ AN  N
Sbjct  181   SDDSKSPYNNTSAREQVMSEVRRLVEAYKDEEMSITITGHSLGAALTTLNAIDIVANGTN  240

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                    T + +T  +FASP+VGN  FKK F   + L+ LRV N  D+VP          
Sbjct  241   IPKGRPGTQIPVTGIVFASPRVGNTEFKKRFEGSQGLKLLRVTNALDIVPN---------  291

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PLI+Y DVGV   I+  KS+++K   +     H L IYLHG+ G QG KG FK +  
Sbjct  292   --YPLISYDDVGVNLGIDTRKSDFLKS-PVGPSGVHNLEIYLHGVAGTQGKKGGFKLEIP  348

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              DI  VNK   +LKV+   VP  W VEKNKGMVQ  DG+W L DHE
Sbjct  349   RDIALVNKSLDVLKVDYT-VPASWKVEKNKGMVQLPDGSWKLMDHE  393



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   336 bits (862),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 194/412 (47%), Positives = 253/412 (61%), Gaps = 23/412 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + +IAKRWR LNG DNW+ LLDPLD DLRR ++ YG M  A YD+FI+E  S+YAG  RY
Sbjct  2     LRNIAKRWRELNGKDNWKDLLDPLDIDLRRNILLYGEMAEATYDAFITEKKSRYAGDCRY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A++   ++  +       Y +TK+FY  S+        + ++S+  +A  KESNW GYVA
Sbjct  62    ARRDFFDKVAISTGQHSLYRVTKFFYATSSIDVPD--AFLIRSLSREAWSKESNWMGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ--DNGSLVHRGWYEM  1036
             VATD+GK+VLGRRD++V WRGT    EWI D    +V    I  +       VHRGW  +
Sbjct  120   VATDEGKKVLGRRDVVVAWRGTVQALEWINDLDFTLVSASGILGKGYSGDPQVHRGWLSI  179

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS +  S  N +SAR+QV  E+ RL+D Y  EE SITVTGHSLG++LATLNA D+A+N 
Sbjct  180   YTSDDPRSPYNKDSARNQVLREIGRLMDEYNKEETSITVTGHSLGAALATLNAADIASNG  239

Query  855   FNNTDVL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
              N ++        + AF+FASP+VG+  F++AFS++  LR LR+ N  DLVP        
Sbjct  240   LNKSNARPNKSSPVAAFVFASPRVGDSDFREAFSNIPELRLLRIRNVPDLVPN-------  292

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                  PL+ Y D+GV+  I+  KS+Y+K    N+  WH L  YLHG+ G  G KG FK +
Sbjct  293   ----YPLLGYDDIGVELTIDTRKSQYLKSPG-NLSSWHNLEAYLHGVAGTNGGKGRFKLE  347

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
                D+  VNK    LK E   VP  WWVEKNKGMV+  DG W L DHE D V
Sbjct  348   VDRDVALVNKGLDALKDEYL-VPASWWVEKNKGMVKGADGHWRLMDHEEDSV  398



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 190/411 (46%), Positives = 251/411 (61%), Gaps = 25/411 (6%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +  AKRWR L+G ++W+G+L PLD DLR Y+IHYG M  A YD+F     SK+AG S Y+
Sbjct  33    KEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYS  92

Query  1386  KKSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K    + GLEKA+P+ KY +TK+ Y  S         + +  V  +   KESNW GYVA
Sbjct  93    RKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPE--SFLLFPVSREGWTKESNWMGYVA  150

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMY  1033
             V  D+G  +LGRRDI+V WRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y
Sbjct  151   VTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIY  210

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
              S ++ S     +ARDQV  EV RLLD YK+EEVSIT+ GHSLG++LATLNA D+ AN +
Sbjct  211   MSQDERSPFTKVNARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGY  270

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      +    +TAF+FASP+VG+  FKK FS L++LR LR  N  D++P         
Sbjct  271   NRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIP---------  321

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKP  517
               I P I Y +VG +  I+  KS+Y+K    N+  +H L  YLHG+ G QG      F+ 
Sbjct  322   --IYPPIGYSEVGDEIPIDTRKSQYMKSPG-NLATFHCLEAYLHGVAGTQGTAKADLFRL  378

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 D+  VNK    L VE C VP +W V KNKGMVQQDDG+W L DHE D
Sbjct  379   DVKRDVGLVNKSVDGLNVE-CMVPGKWRVLKNKGMVQQDDGSWKLLDHEID  428



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   337 bits (864),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/407 (46%), Positives = 256/407 (63%), Gaps = 23/407 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             + KRWR L+G ++W+  L+PLD +LR+Y+IHYG M  A YD+F +   SKYAG S Y+++
Sbjct  27    LGKRWRDLSGRNHWKDALEPLDLELRQYIIHYGEMAQATYDTFNANTKSKYAGSSIYSRQ  86

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEK +P+ KY +TK+ Y  ST+  +    + V  V  +   KESNW GYVAVA
Sbjct  87    DFFSKVGLEKGHPYCKYQVTKFLY--STSQISVPDSFLVFPVSREGWTKESNWIGYVAVA  144

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-NGSLVHRGWYEMYTS  1027
             TD+GK+VLGRRDI+V WRGT    EWI DF    +  + IF  + +G  VH+GWY +YTS
Sbjct  145   TDQGKQVLGRRDIVVAWRGTIQTLEWINDFDFGTINAKKIFGDNGDGVGVHQGWYSIYTS  204

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              ++ S  N  SARDQV  E+ RL++ YK+EE+SIT+ GHSLG++L+TL+A D+ AN +N 
Sbjct  205   EDERSPFNKASARDQVLREIRRLVEKYKDEEISITICGHSLGAALSTLSAADIVANGYNR  264

Query  846   TDVL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                L      +T F FASP+VG+  FK+ FS L +LRALR+ N  D+VP           
Sbjct  265   PKNLPDKSCPVTVFAFASPRVGDSDFKRLFSGLDDLRALRIRNLPDVVP-----------  313

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
             I P I Y +VG +  ++  KS Y+K    N  ++H + +YLHGI G +G K +FK +   
Sbjct  314   IYPPIGYSEVGEELVMDTRKSPYLKSPG-NPTLFHTMEVYLHGIAGTRGTKSDFKLEIER  372

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             DI  VNK    LK E   VP  W   KNKGM QQ+DG+W L DHE D
Sbjct  373   DIALVNKPIDGLKDEFM-VPGSWRALKNKGMAQQNDGSWKLMDHETD  418



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   337 bits (864),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 250/409 (61%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W+G+L PLD DLR+Y+IHYG M  A YD+F     SK+AG S Y++K
Sbjct  36    IAKRWRELSGQNHWKGMLHPLDQDLRQYIIHYGEMAQAGYDTFNINTESKFAGASIYSRK  95

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +TK+ Y  S         + +  +  +   KESNW GYVAV 
Sbjct  96    DFFSKVGLEKAHPYTKYKVTKFLYATSQIHVPE--SFLLFPMSREGWTKESNWMGYVAVT  153

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              D+G  +LGRRDI+V WRG+    EW+ DF   +V    IF  +N  + +H+GWY +Y S
Sbjct  154   DDQGTAILGRRDIVVAWRGSVQPLEWVSDFDFSLVNANKIFGDNNDHVQIHQGWYSIYMS  213

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              ++ SH N  +ARDQV  E+ RLL+ YK EEVSITV GHSLG++LATLNA D+ AN +N 
Sbjct  214   QDERSHFNKANARDQVLREIGRLLEKYKEEEVSITVCGHSLGAALATLNATDIVANGYNR  273

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  F K F  L++LR LR+ N  D+VP           
Sbjct  274   PKSRPDKSCPVTAFVFASPRVGDSDFMKLFYGLQDLRVLRIRNLPDVVP-----------  322

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P + Y +VG +  I+  KS+Y+K    N   +H L  YLHG+ G QG      F+   
Sbjct  323   IYPPLGYAEVGDELPIDTRKSQYMKSPG-NFATFHCLEAYLHGVAGTQGTAKSDLFRLDV  381

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    LK ++C +P  W V KNKGMVQQDDG+W L DHE D
Sbjct  382   KRDIGLVNKSVDGLK-DECMIPGHWRVLKNKGMVQQDDGSWKLLDHEID  429



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   336 bits (861),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/408 (46%), Positives = 247/408 (61%), Gaps = 23/408 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA+RWR L+G  +W GLL+PLD DLR+Y++HYG M+ A YD+F S   S+YAG S Y++
Sbjct  40    SIAQRWRDLSGQSHWNGLLEPLDLDLRQYIVHYGEMVQAAYDTFNSCTESQYAGSSIYSR  99

Query  1383  KSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             +    + G+   NP+ KY +TK+ Y  +T+     G + V         K+SNW GYVAV
Sbjct  100   QDFFSKVGIVNGNPYCKYQVTKFLY--ATSEARMPGAFMVFPASGQGWTKQSNWIGYVAV  157

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYT  1030
             AT+ G  VLGRRDI+V WRGT   +EWI+DF   +V    IFA  +  + VHRGW  +YT
Sbjct  158   ATNDGTAVLGRRDIVVAWRGTIETTEWIDDFDFGLVDGSKIFAGKSKPIKVHRGWLSIYT  217

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N   ARDQ+  E+ RL++LYK+E++SITV GHSLG++LATL+A D+  N +N
Sbjct  218   SYDTRSKFNKICARDQLLQEISRLVELYKDEDISITVCGHSLGAALATLSATDIVFNGYN  277

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                   +    +TAF FA P+VG   FK  FS L NLRALR  N  D+V           
Sbjct  278   KPKGRPDKACPVTAFPFACPRVGASDFKNLFSGLDNLRALRTKNLPDVV-----------  326

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                P++ Y DVG +  I+  KS Y+K    NV  +H +  Y+HG+ G  G KGEF+ +  
Sbjct  327   CAYPMVGYSDVGDELAIDTRKSPYLKSPG-NVTTFHSMEHYMHGVAGTHGTKGEFRLEIN  385

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              DI  VNK    LK E   VP  W V KNKGMVQQ DG+W L DHE D
Sbjct  386   RDISLVNKNTDSLKDEHM-VPDHWRVLKNKGMVQQGDGSWKLMDHEPD  432



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   335 bits (860),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 201/471 (43%), Positives = 256/471 (54%), Gaps = 80/471 (17%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +SIA RWR LNG DNW+ LLDPLD DLRR +IHYG    A YD+F SE  S +AG SRY+
Sbjct  3     DSIATRWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRYS  62

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             K +      LEK NP+KY ITK+ Y  S         + ++S+  +A  +ESNW GYVAV
Sbjct  63    KANFFSGLFLEKGNPYKYNITKFLYATSRIDVP--DAFIIKSLSREAWSRESNWMGYVAV  120

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+GK VLGRRDIL+ WRG+    EWI+DF   +V    I      + VH+GW  +YTS
Sbjct  121   ATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQGWLSIYTS  180

Query  1026  TNQDSHLNSNSARD-------QVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
              +  S  N+ SAR        QV  EV RL++ +K+EE++IT+TGHSLG++L  LNAVD+
Sbjct  181   DDPRSPYNTTSARQQSITVKFQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDI  240

Query  867   AANPFNN-TD-----VLITAFLFASPKVGNEGFKKAFSHL---KNLRALRVVNNGDLVPM  715
              AN  N  TD      L+TAFLF  P VG+  F+  FS L   ++LR LR+ N  D+VP 
Sbjct  241   VANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPN  300

Query  714   VPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP  535
              P          P+I Y  VG +  IN   S ++K +    + WH L IYLHGI G QG 
Sbjct  301   YP----------PMIGYTQVGEELVINTDTSPFLK-ESAEPMSWHNLEIYLHGIAGTQGS  349

Query  534   K--------------------------------------------------GEFKPQGCF  505
                                                                GEFK     
Sbjct  350   SVLPATTNKTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKR  409

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             DI  VNK    LK ++  VP +WW EKNKGMVQ+DDG+W L DHE+D + F
Sbjct  410   DITLVNKVMDALK-DEFHVPAKWWCEKNKGMVQEDDGSWKLMDHESDALEF  459



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   333 bits (854),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 244/405 (60%), Gaps = 24/405 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA+RW+ L+G   W+GLLDPLD+DLRRY++HYG M    YD+F S+  SKYAG S ++K 
Sbjct  5     IARRWKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKT  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  K NP++Y +TK+FY  +T+     G + V+S+  +A  KESNW GY+AVAT
Sbjct  65    ELFARTGFLKGNPYRYKVTKFFY--ATSSVKLPGSFIVKSLSREAWSKESNWMGYIAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFA---QDNGSLVHRGWYEMYT  1030
             D+GKE LGRRDI+V WRGT    EW  DF  P+     +F      +   +  GW  +YT
Sbjct  123   DEGKEKLGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHKPQIASGWLALYT  182

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + +  S  N  SAR+QV  EV RLL+ YK+EEVSIT+TGHSLG++++TL A D+A N   
Sbjct  183   TDDPRSPFNKTSAREQVLGEVNRLLEQYKDEEVSITLTGHSLGATMSTLCATDIAYNGHK  242

Query  849   NTDVL------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                 L      +TAF FASP+VG++ FK     ++NL  LR+ N  D+VP          
Sbjct  243   KMKSLQHKPFYVTAFAFASPRVGDKNFKMLVDSIENLNILRITNVPDVVPR---------  293

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PL+ Y D G    IN  KS+Y+K   LN+  +H + IYLHG+ G QG  G FK +  
Sbjct  294   --YPLLGYDDAGEVLTINTLKSKYLKQ-SLNLRNYHNIDIYLHGVAGTQGSLGGFKLEIE  350

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDH  373
              DI  VNK    L  E   +P  WW  +NKGMVQ DDG+W L  H
Sbjct  351   KDISSVNKRLDALDDEYL-IPGSWWCVENKGMVQMDDGSWKLYTH  394



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   332 bits (852),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 192/411 (47%), Positives = 246/411 (60%), Gaps = 53/411 (13%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + SI + WR L+G  NW+GLL PLD DLR+Y+IHYG M  A YD+F S   SKYAG S Y
Sbjct  2     LRSIGRGWRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIY  61

Query  1389  AKKSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             +++    + GLEK NP+ KY +TK+ Y  +T+       + V  V  +   KESNW GYV
Sbjct  62    SRQDFFSKVGLEKNNPYSKYQVTKFLY--ATSQIEVPDSFLVFPVSREGRTKESNWMGYV  119

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDN-GSLVHRGWYEM  1036
             AV TD+G E+LGRRDI+V WRG+    EWI DF   +V  + IF + + G  VH+GWY +
Sbjct  120   AVTTDEGTELLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQGWYSI  179

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS+++ S  N +SARDQV  EV RL++ YK+EE+SITV GHSLG++LATLNA D+ AN 
Sbjct  180   YTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIVANG  239

Query  855   FNNTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             +N T        L+TAF+FASP+VGN  FKK FS  K+LR LRV N  D+VP  P     
Sbjct  240   YNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP-----  294

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQG-PKGEFKP  517
                  PL  Y DVG +  I+  KS Y+K    +++ +H L   LHG+ G QG    EFK 
Sbjct  295   -----PL-GYSDVGEELTIDTRKSPYLKTPG-DLVSFHNLEANLHGVAGTQGTTTKEFKL  347

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             Q                              NKGMVQQDDG+W L DHE D
Sbjct  348   Q------------------------------NKGMVQQDDGSWKLMDHEMD  368



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 195/409 (48%), Positives = 250/409 (61%), Gaps = 31/409 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
              A +W  L+G +NW+GLL+PLD DLR+Y+I YG +  A YD+FISE  SKYAG SRY+ +
Sbjct  5     FADKWEELSGKNNWDGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSME  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +   + GL+   P KY +TKYFY  +T+       +  +S   +A  KESN+ GY+AVAT
Sbjct  65    NFFTKVGLD---PKKYCVTKYFY--ATSSMPLPDAFITKSFSREAWSKESNFMGYIAVAT  119

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRGWYE  1039
             D+GK  LGRRDI++ WRGT    EW+ D +  +V    +F  D G       LVH G++ 
Sbjct  120   DEGKASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFG-DGGLLPLFHPLVHHGFHN  178

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+ N  S  N    RDQV  EV RL++ YK+EEVSITVTGHSLG+SLATLNAVD+A N
Sbjct  179   IYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFN  238

Query  858   PFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
               N      +  +TAF+FASPKVG+  F  AFS LK+L  LR+ N  D+VP         
Sbjct  239   KINKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNLLDIVPK--------  290

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GEFKP  517
                 P I Y DVG +  I+ +KS YVK     V  WH L  YLHGI G QG      FK 
Sbjct  291   ---YPPIGYFDVGQEIMIDTTKSPYVKPPGEPV-SWHLLEPYLHGIAGTQGIGMFAGFKL  346

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             +   DI  VNK   +LK E C +P  WW EK+KGMVQQ+DG W+L D +
Sbjct  347   EVNRDISLVNKQWNILKDEHC-IPPLWWSEKHKGMVQQEDGCWLLQDRD  394



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 184/409 (45%), Positives = 250/409 (61%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W G+L PLD DLR Y+IHYG M  A YD+F     SK+AG S Y++K
Sbjct  33    IAKRWRDLSGQNHWNGMLQPLDQDLREYVIHYGEMAQAGYDTFNINTESKFAGASIYSRK  92

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +T++ Y  S         + +  +  +   KESNW GYVAV 
Sbjct  93    DFFAKVGLEKAHPYTKYKVTRFLYATSQIHVPE--SFLLFPLSREGWTKESNWMGYVAVT  150

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              ++G  VLGRRDI+V WRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y S
Sbjct  151   DNQGTAVLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQVQIHQGWYSIYMS  210

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              ++ S  N  +ARDQV  E+ RLL+ YK+EEVSI++ GHSLG++LATLNA D+ AN +N 
Sbjct  211   EDERSPFNKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNR  270

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  ++K FS  ++LR LRV N  D+VP           
Sbjct  271   PKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGFEDLRVLRVKNLPDIVP-----------  319

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P + Y +VG +  I+  KS+Y+K    N   +H L  YLHG+ G QG      F+   
Sbjct  320   IYPPLGYAEVGEELSIDTRKSQYMKSPG-NFATFHCLESYLHGVAGTQGTSKNDIFRLDV  378

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    L  ++C VP  W V KNKGMVQQDDG+W+L DHE D
Sbjct  379   KRDIGLVNKSVDGL-TDECMVPGNWRVLKNKGMVQQDDGSWVLLDHEID  426



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 257/429 (60%), Gaps = 41/429 (10%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
              + I +RWR L+G +NW+ LLDPLD DLRRYLIHYG    A YD+F SE  SKYAG SRY
Sbjct  2     FKQIPERWRELSGQNNWKNLLDPLDLDLRRYLIHYGERASATYDTFNSEVKSKYAGDSRY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
               K+L    GL  ANPF+YT TKYFY  S+      G + ++S+  +A  KESNW GYVA
Sbjct  62    GLKNLFSNVGLSIANPFEYTATKYFYATSSV--KLPGCFLLRSLSREAWNKESNWIGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL----------  1060
             VATDKGK  LGRRDIL+ WRGT    EW  DF  P+     I    +             
Sbjct  120   VATDKGKAALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADTAADAAA  179

Query  1059  ---------VHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHS  907
                      VH G+  +YTS +  S  N +SAR+QV  EV RL+D YK+EE+SITV GHS
Sbjct  180   DDVDDIIPKVHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISITVAGHS  239

Query  906   LGSSLATLNAVDLAANPFNNTDVL-------ITAFLFASPKVGNEGFKKAFSHLKNLRAL  748
             LG++LA+LNAVD+A N +N +  +       +TAF++ASP+VGN  F    + + +LR L
Sbjct  240   LGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSIPSLRLL  299

Query  747   RVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMI  568
             R  N  D+VP VP     AG       Y D G +  IN   S+Y+K+   N+  WH +  
Sbjct  300   RTANLLDVVPKVP----GAG-------YSDAGQELLINTQLSKYLKNPG-NISKWHSVET  347

Query  567   YLHGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW  388
             YLHG+ G QG KG FK +   D+  VNK+   ++ E   VP EWWV KN+GMVQ +DG+W
Sbjct  348   YLHGLAGTQGTKGGFKLEVKRDVALVNKHQSFVRDEYL-VPDEWWVMKNRGMVQMEDGSW  406

Query  387   ILDDHEADH  361
              L+DHE D+
Sbjct  407   QLEDHEMDN  415



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   332 bits (850),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 190/411 (46%), Positives = 252/411 (61%), Gaps = 25/411 (6%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             + IAK+WR L+G ++W+G+L PLD DLR+Y++HYG M  A YD+F +   SK+AG S Y+
Sbjct  15    KEIAKKWRDLSGQNHWKGMLHPLDQDLRQYIVHYGEMAQAGYDTFNTNTESKFAGASIYS  74

Query  1386  KKSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K    + GLEKANP+ KY +TK+ Y  S         + +  V  +   KESNW GYVA
Sbjct  75    RKDFFAKVGLEKANPYTKYKVTKFLYATSQIHVPD--SFLLFPVSREGWTKESNWMGYVA  132

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMY  1033
             V  D+G  VLGRRDI+V WRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y
Sbjct  133   VTDDQGTAVLGRRDIVVSWRGSVQPLEWVNDFEFGLVDAKKIFGEKNDKVQIHQGWYSIY  192

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
              S +Q S  N  +ARDQV  E+ RLL+ YK+EEVSI+V GHSLG++LATLNA D+ AN +
Sbjct  193   MSDDQRSPFNKANARDQVLREIGRLLEKYKDEEVSISVCGHSLGAALATLNAADIVANGY  252

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      +    +TAF+FASP+VG+  FKK FS L++LR LR+ N  D+VP         
Sbjct  253   NRPKNRPDKSCPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRIRNLPDVVP---------  303

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKP  517
               I P + Y +VG +  I+  KS Y+K    N+  +H L  YLHG+ G QG      F+ 
Sbjct  304   --IYPPLGYSEVGDELQIDNRKSPYMKSPG-NLSTFHNLEGYLHGVAGTQGTTKADLFRL  360

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 DI  VNK    LK E   VP  W V KNKGMVQ DDG+W L DHE D
Sbjct  361   DVKRDIGLVNKSVDGLKDEYM-VPGYWRVLKNKGMVQLDDGSWKLLDHEID  410



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 249/409 (61%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
              AKRW+ L+G ++W+G+L PLD DLR Y+IHYG M  A YD+F     SK+AG S YA+K
Sbjct  40    FAKRWKDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYARK  99

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 +  LEKA+P+ KY +TK+ Y  S         + +  +  +   KESNW GYVAV 
Sbjct  100   DFFAKVCLEKAHPYTKYKVTKFLYATSEVHVPE--SFLLFPISREGWTKESNWMGYVAVT  157

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              D+G  +LGRRDI+VVWRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y S
Sbjct  158   DDQGTALLGRRDIVVVWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMS  217

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              +  S     +AR+QV  EV RLLD YK+EEVSIT+ GHSLG++LATLNA D+ AN +N 
Sbjct  218   QDDRSPFTKANAREQVLREVGRLLDRYKDEEVSITICGHSLGAALATLNAADIVANGYNR  277

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  FKK F  L+NLR LR  N  D++P           
Sbjct  278   PKSRPDKACPVTAFVFASPRVGDSDFKKLFYGLENLRVLRTRNLPDVIP-----------  326

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P I Y +VG +  I+  KS+Y+K    N+  +H L  YLHG+ G QG      F+   
Sbjct  327   IYPPIGYSEVGDELPIDTRKSQYMKSPG-NLASYHCLEAYLHGVAGTQGTAKADIFRLDV  385

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    LK ++C VP +W V KNKGMVQQDDG+W L DHE D
Sbjct  386   KRDIGLVNKSVDGLK-DECMVPGKWRVLKNKGMVQQDDGSWKLLDHETD  433



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   330 bits (847),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 194/413 (47%), Positives = 253/413 (61%), Gaps = 33/413 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  +A++W  L+G  NW+GL+ PL  DLR+Y+I YG +  A YD+FI+E  SKYAG SRY
Sbjct  1     MAGMAEKWEELSGKSNWDGLVHPLAVDLRKYIIQYGELAQATYDTFITERASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++   + GL+   P KY +TK+FY  +T        +  +S   +A  KESN+ GYVA
Sbjct  61    SNENFFTKVGLD---PNKYGVTKFFY--ATASIPLPDAFITRSFSREAWSKESNFMGYVA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-------VHR  1051
             VATD+GK  LGRRDI+V WRGT+   EW+ D +  +V    +F   NG L       VH 
Sbjct  116   VATDEGKVSLGRRDIVVAWRGTKQALEWVNDLQFLLVPAPNVFG--NGGLLPLFQPLVHH  173

Query  1050  GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVD  871
             G+Y +YTS +  S  N  S RDQV  EV RL++ YK+EEVSITVTGHSLG+SLATLNAVD
Sbjct  174   GFYNIYTSESARSQFNQTSVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVD  233

Query  870   LAANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
             +A N  N T    +  +TAF+FASPKVG+  F   FS LK+L  LR+ N  D+VP     
Sbjct  234   IAFNGINKTSEGKEFPVTAFVFASPKVGDINFLNKFSKLKHLHILRIHNLLDIVPK----  289

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--G  529
                     P I Y DVG +  I+ +KS YVK     ++ WH L  YLHG+ G QG     
Sbjct  290   -------YPPIGYFDVGQEIMIDTTKSPYVKPPG-EIVSWHLLEPYLHGVAGTQGLGLLA  341

Query  528   EFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              FK +   DI  VNK   +LK E C VP  WW EK+KGMVQQ++G+W+L D +
Sbjct  342   GFKLEVNRDISLVNKEWDILKNEYC-VPAFWWTEKHKGMVQQENGSWLLMDRD  393



>ref|XP_009333706.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=378

 Score =   330 bits (845),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 240/410 (59%), Gaps = 38/410 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M +IA RWR+L G  +WEGLLDPLD DLRR ++HYG  + A+ DSFIS+P SK  GL RY
Sbjct  1     MNTIATRWRLLGGETDWEGLLDPLDIDLRRCILHYGERVAAIGDSFISDPRSKNCGLPRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              K  L  + GLE +NP+KYT+ KY Y  +                 + +  +S W GYVA
Sbjct  61    TKTHLFSKVGLENSNPYKYTVNKYIYAAT-----------------EFLPGKSIWLGYVA  103

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+GKEVLGRRDILV WRGTE  +EW  D    +V    I        VH G +  Y 
Sbjct  104   VTTDEGKEVLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHGIHSYYN  163

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S + +S  +  S R QV   +  ++D YK+EE+SITV GHS+G + A LNA+D+  N +N
Sbjct  164   SADPESPYSKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNAIDIVCNGYN  223

Query  849   N-TD-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
               TD      L+T+ +FASP++G++GF   FS L NL  LRV N+ D+VP +P       
Sbjct  224   KPTDRPDKACLVTSIVFASPRLGDQGFHNVFSSLNNLHVLRVTNSYDIVPYLP-------  276

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PL  Y DVG +  I+  KS Y+K+ K +    H L IYLHG+ G QG  G F+    
Sbjct  277   ---PLEKYVDVGKELKIDTLKSPYLKNAKKDA---HRLEIYLHGVAGTQGRNG-FQLVIN  329

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
              DI  VNK    LK ++  V   WW EKNK MVQ DDG+W+L DHE D V
Sbjct  330   RDIALVNKKLDGLK-DEYNVIVNWWTEKNKSMVQMDDGSWVLLDHEKDDV  378



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 194/412 (47%), Positives = 256/412 (62%), Gaps = 30/412 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S+A++W  L+G + WEGLL+PLD DLRRY+I YG +    YD+FISE  SKYAG SRY
Sbjct  1     MGSMAEKWEELSGKNKWEGLLNPLDVDLRRYIIQYGELAHVTYDTFISEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + ++L  + GL+   P KY +TKYFY  +T+       +  +S+  +A  KESN+ GY+A
Sbjct  61    SMENLFSKAGLD---PTKYRVTKYFY--ATSSIPLPDAFITKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDIL+ WRGT    EW+ D +  ++    +F  D G       LVH G
Sbjct  116   VATDEGKASLGRRDILIAWRGTIQTLEWVNDLQFLLIPGPKVFG-DGGLLPLFKPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YTS +  S  N  SARDQV  EV RL++ YK++EVSITV GHSLG+SLATLNAVD+
Sbjct  175   FYNVYTSESARSKYNQASARDQVIEEVKRLVEEYKDDEVSITVAGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N T    +  +TAF+FASPKVG+  F  A + L++L  +R+ N  D+V       
Sbjct  235   AYNGINKTSSGKEFPVTAFVFASPKVGDLNFVNAVNKLEHLHIMRIHNLLDIV-------  287

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQ--GPKGE  526
                 +  P I Y DVG +  I+ +KS Y+K +  +    H L  YLHGIDG Q  GP   
Sbjct  288   ----SKYPPIGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDG  343

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   D+  VN+   +LK E   VP  WWVEK+ GMVQQ+DG WIL D E
Sbjct  344   FKLEVNRDLSLVNRIWDILKDEYL-VPGAWWVEKHNGMVQQEDGKWILMDRE  394



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/413 (45%), Positives = 243/413 (59%), Gaps = 25/413 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+ L+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  SKYAG   Y
Sbjct  2     LEGIPKRWKELSGLNKWQGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSKYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +KK +   TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKKQVFARTGYLKANPFRYNVTKYIY--ATASIKLPICFIVKSLSKDATRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWYE  1039
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +   V R   GW +
Sbjct  120   VATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAASVFPVTDPKDVPRIGSGWLD  179

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+++ +S  ++ SA++QV+ E+ RLL+LYKNEE+SIT TGHSLG  ++TL A DL  N
Sbjct  180   IYTASDSNSPYDTTSAQEQVQGELTRLLELYKNEEISITFTGHSLGGVMSTLAAADLVHN  239

Query  858   PFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N  +       V IT F F  P++G++ FKK    L+ +  LR+VN  D+ P      
Sbjct  240   RKNTINTGLQKKTVPITVFAFGCPRIGDQDFKKLVDSLQQINILRIVNVPDVAPH-----  294

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PL+ Y +VG +  IN   S Y+K   LN   +H L IYLHG+ G Q   G F 
Sbjct  295   ------YPLLLYAEVGEELQINTLNSTYLKR-SLNFRNYHNLEIYLHGLAGMQDRAGVFT  347

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
              Q   D+  VNK    LK E   VP+ W    NKGMVQ DDGTW LD H  DH
Sbjct  348   LQVGRDVSLVNKGLDALKDEYL-VPSIWRCLANKGMVQMDDGTWQLDVHRRDH  399



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   327 bits (839),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 237/376 (63%), Gaps = 26/376 (7%)
 Frame = -2

Query  1458  MIGAVYDSFISEPTSKYAGLSRYAKKSLLEETGLE-KANPFKYTITKYFYTPSTTCGAHH  1282
             M  A YD+FISE  SKYAG SRY+KK LL + G+E KANP+KY +TKYFY  + +     
Sbjct  1     MAQATYDTFISEKASKYAGASRYSKKDLLSKVGIEYKANPYKYRVTKYFY--AASSSLVL  58

Query  1281  GGYHVQSVRADAVMKESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPM  1102
             G   V S+  +A  KESNW G+VAVATD+G+  LGRRDIL+ WRGT    EW+ D +  +
Sbjct  59    GSLLVVSLSREAWSKESNWMGFVAVATDEGRLALGRRDILISWRGTIQNLEWVNDLQFEL  118

Query  1101  VKPRIIFAQDNGS----LVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEE  934
             V    IF + N       VH GW  +YTS +  S  N  SAR QV  EV RL++ YKNEE
Sbjct  119   VSAPEIFGETNNEGDEPKVHLGWRSIYTSDDPKSPFNKTSARHQVLDEVRRLVEEYKNEE  178

Query  933   VSITVTGHSLGSSLATLNAVDLAANPFN------NTDVLITAFLFASPKVGNEGFKKAFS  772
              SIT+TGHS+G++++TLNAVD+ A  +N      N    +TAF+FASP+VGN  F+K FS
Sbjct  179   TSITITGHSMGAAVSTLNAVDIVAQGYNKPKDMPNKACPVTAFVFASPRVGNGSFQKFFS  238

Query  771   HLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNV  592
              L+NLR LRV N  D+VP+            PLI Y +VG +  I+  +S Y+K    N 
Sbjct  239   SLQNLRILRVRNARDVVPL-----------YPLIGYSEVGEELVIDTEESSYLKKPG-NF  286

Query  591   LMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGM  412
               WH L  YLHG+ G QG KG FK +   DI  VNK+  +LK E C VP  WW E+NKGM
Sbjct  287   SSWHTLEGYLHGVAGTQGSKGGFKLEVDRDIALVNKHMNLLKDEYC-VPESWWCERNKGM  345

Query  411   VQQDDGTWILDDHEAD  364
             VQ++DG+W+L DHE D
Sbjct  346   VQKEDGSWLLMDHEHD  361



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   328 bits (841),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/409 (44%), Positives = 241/409 (59%), Gaps = 25/409 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + SIAKRWR L+G D+W+ LLDPLD DLR+Y+IHYG M  A YD+F  EP SK+AG S Y
Sbjct  2     IRSIAKRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             ++++L  + GL K NP+ YT TKY Y  +T+       + ++ +  DA  K+SNW G+VA
Sbjct  62    SRRNLFSQVGLAKPNPYTYTPTKYLY--ATSEIKVPTAFILKPIPIDAWSKQSNWIGFVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDI+V WRG+    EW++DF  P+    +I  +      HR W  +YT
Sbjct  120   VATDEGKTALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRCWVSIYT  179

Query  1029  STNQDSHLNSNSARDQVRAEV-CRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             S +  S  N  SARDQV   +  RL+D YK+EE+SIT+TGHSLG++L TL A D+ AN F
Sbjct  180   SHDPKSRFNKQSARDQVYIYIPTRLVDKYKDEEISITITGHSLGAALGTLCAADIVANKF  239

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +TAFLF SP+VG+  F+     L+NL  +RV N  D+V  +P      
Sbjct  240   NKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRVTNVPDIVTTLP------  293

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P   Y +VG +  I+   S ++K        WH L  +LHG+ G QG KG F  + 
Sbjct  294   ----PEGYYSEVGQELVIDTRFSNFLKFPGC-YDTWHSLEAHLHGVAGTQGSKGGFHLEV  348

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                I  VNK    LK ++ PVP  WW  +NKGM     G+W L DHE D
Sbjct  349   DRSIALVNKMLDALK-DEYPVPASWWCMRNKGM----KGSWELKDHEKD  392



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score =   328 bits (840),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 185/414 (45%), Positives = 245/414 (59%), Gaps = 39/414 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA+ WR L+G   W+GLL+PL  DLRRYL+HYG    A YD F  E  SKYAG  RY
Sbjct  1     MGSIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRA-DAVMKESNWGGYV  1213
             +KK    +  LEK NPFKY++TKY Y  +T+       + + S+ + DA   E+NW GYV
Sbjct  61    SKKDFFSKVYLEKGNPFKYSVTKYLY--ATSKARDSAAFLLTSIFSKDAWSLETNWMGYV  118

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AVATD+ KE LGRRDI+V WRGT   +EW+++F I +    +IF   +   +H G+Y +Y
Sbjct  119   AVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLY  178

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS N    L  +SAR QV  E+ RL++LYKNEE+SITVTGHSLG +LAT++++D+ AN F
Sbjct  179   TSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKF  238

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +T F F SP+VGN  F+K FS   +LRAL + NN D+VP    LA   
Sbjct  239   NIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVPSSLRLAY--  296

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                                   S+Y+K      +  H + +YLHGI G QG KG F  + 
Sbjct  297   ----------------------SKYLKSG----VSEHNMEVYLHGIAGTQGSKGGFNLEV  330

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW-ILDDHEADHVVF  352
               DI  +NK    LK ++  +P  W V +NKGMVQQ DGTW ++DDH  D ++ 
Sbjct  331   NRDIALLNKSNDGLK-DEYHIPENWRVVENKGMVQQSDGTWKLMDDHNDDVLIM  383



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   328 bits (841),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 182/408 (45%), Positives = 239/408 (59%), Gaps = 20/408 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RWR L+G   W+GLL+PLD+DLR+YLIHYG +  A YD+FI +  S++AG +R++ 
Sbjct  5     NIARRWRQLSGQQKWQGLLEPLDNDLRQYLIHYGDLAQATYDNFIMQKYSQFAGDNRFSM  64

Query  1383  KSLLEETGL-EKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             K+L    GL  + N F Y   KY Y  S             S        ESNW GY+AV
Sbjct  65    KNLFSRVGLGMRNNQFVYKPVKYLYATSKVDVPQSFIMSPASTSRAVPNGESNWIGYIAV  124

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+ KE LGRRDI V WRGT    EWI+DF  P+     +    N + VH+G++ +YTS
Sbjct  125   ATDQAKEKLGRRDIAVAWRGTLQPLEWIKDFDFPLTSASDVLGGHNDAQVHQGFHSVYTS  184

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              N  S  +  SAR QV   +  L++ Y+NEE+S+TV GHSLG++LATL+A D+ AN FN 
Sbjct  185   DNPQSQTSKTSARQQVLDGLRELVNKYENEEISVTVVGHSLGAALATLSAADIVANGFNR  244

Query  846   TD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
             TD        +TAF FA P+ GN GFK+    L++LR LR+ N  D+VP VP        
Sbjct  245   TDKQANKSCPVTAFAFACPRTGNRGFKQVCDSLEDLRILRITNTPDMVPKVP--------  296

Query  684   ILPLIA-YKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
               PLIA Y +VG   +I++ KS Y+K      + WH L  YLH I G QG +  F+ +  
Sbjct  297   --PLIAGYSEVGENLEIDSRKSMYLKPTG-GFISWHNLETYLHTIAGTQGKRSAFRLECQ  353

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              DI  VNK    LK EK  VP  WW   N GM+QQ+DG W L D + D
Sbjct  354   RDISLVNKNLDALK-EKYMVPGNWWCGLNNGMIQQEDGLWKLFDRDKD  400



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   328 bits (841),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 182/420 (43%), Positives = 240/420 (57%), Gaps = 36/420 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + SIAKRWR L+G D+W+ LLDPLD DLR+Y+IHYG M  A YD+F  EP SK+AG S Y
Sbjct  2     IRSIAKRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             ++++L  + GL K NP+ YT TKY Y  S         + ++ +  DA  K+SNW G+VA
Sbjct  62    SRRNLFSQVGLAKPNPYTYTPTKYLYATSEI--KVPTAFILKPIPIDAWSKQSNWIGFVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRDI+V WRG+    EW++DF  P+    +I  +      HR W  +YT
Sbjct  120   VATDEGKTALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRCWVSIYT  179

Query  1029  STNQDSHLNSNSARDQVRAEVC------------RLLDLYKNEEVSITVTGHSLGSSLAT  886
             S +  S  N  SARDQV   +C            RL+D YK+EE+SIT+TGHSLG++L T
Sbjct  180   SHDPKSRFNKQSARDQVIVGICAHKQMRFLSEVKRLVDKYKDEEISITITGHSLGAALGT  239

Query  885   LNAVDLAANPFN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDL  724
             L A D+ AN FN           +TAFLF SP+VG+  F+     L+NL  +RV N  D+
Sbjct  240   LCAADIVANKFNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRVTNVPDI  299

Query  723   VPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGF  544
             V  +P          P   Y +VG +  I+   S ++K        WH L  +LHG+ G 
Sbjct  300   VTTLP----------PEGYYSEVGQELVIDTRFSNFLKFPGC-YDTWHSLEAHLHGVAGT  348

Query  543   QGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             QG KG F  +    I  VNK    LK ++ PVP  WW  +NKGM     G+W L DHE D
Sbjct  349   QGSKGGFHLEVDRSIALVNKMLDALK-DEYPVPASWWCMRNKGM----KGSWELKDHEKD  403



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   327 bits (839),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 203/412 (49%), Positives = 258/412 (63%), Gaps = 31/412 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M ++A+ W  L+G +NWEGLL PLD DLR+Y+I YG +  A YD+FI+E  SKYAG SRY
Sbjct  1     MANMAENWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + +SL  + GL+   P KY +TK+FY  +T        + V+S+  +A  KESN+ GY+A
Sbjct  61    SMESLFTKVGLD---PLKYRVTKFFY--ATASIPLPDAFIVKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI+V WRGT  + EW+ D +   V    +F  D G       LVH G
Sbjct  116   VATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFG-DGGLLSLLQPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YT+ +  S  N  SARDQV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+
Sbjct  175   FYNIYTTEDPRSQFNQVSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDI  234

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N T    +  +TAF+FASPKVG+  F KAFS L NL  LR+ N  D+VP      
Sbjct  235   AFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK-----  289

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P I Y DVG +  I+ +KS YVK     V+ WH L  YLHG+ G QG      
Sbjct  290   ------YPPIGYIDVGEELMIDTTKSPYVKPPG-EVVSWHLLEPYLHGVAGTQGIGILAG  342

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   DI  VNK   +LK E C +P  WW +K+KGMVQQ DG+W+L D E
Sbjct  343   FKLEVNRDISLVNKQWDILKDEYC-IPGLWWADKHKGMVQQQDGSWLLLDRE  393



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 184/409 (45%), Positives = 249/409 (61%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
              AKRWR L+G ++W+G+L PLD DLR Y+IHYG M  A YD+F     S++AG S Y++K
Sbjct  18    FAKRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTDSQFAGASIYSRK  77

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +TK+ Y  S         + +  V  +   KESNW GYVAV 
Sbjct  78    DFFAKVGLEKAHPYTKYKVTKFLYATSEIHVPE--SFLLFPVSREGWTKESNWMGYVAVT  135

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              D+G  +LGRRDI+V WRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y S
Sbjct  136   DDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMS  195

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              ++ S     +ARDQV  E+ RLL+ YK+EEVSIT+ GHSLG++LATLNA D+ AN +N 
Sbjct  196   QDERSPFTKANARDQVLRELGRLLEKYKDEEVSITICGHSLGAALATLNATDIVANGYNR  255

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  FKK  S L+++R LR  N  D++P           
Sbjct  256   PKSRPDKSCPVTAFVFASPRVGDSDFKKLLSILEDMRVLRTRNLPDVIP-----------  304

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P I Y +VG +  I+  KS+Y+K    N+  +H L  YLHG+ G QG      F+   
Sbjct  305   IYPPIGYSEVGDELPIDTRKSQYMKSPG-NLATFHCLEAYLHGVAGTQGTAKADLFRLDV  363

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                I  VNK    LK ++C VP +W V KNKGMVQQDDG+W L DHE D
Sbjct  364   KRAIGLVNKSVDGLK-DECMVPGKWRVLKNKGMVQQDDGSWKLLDHEID  411



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 249/409 (61%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W+GLL PLD DLR+YLIHYG M  A YD+F     SK+AG S Y++K
Sbjct  34    IAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIYSRK  93

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +TK+ +  S         + +  V  +   KESNW GYVAV 
Sbjct  94    DFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPE--SFLLFPVSREGCTKESNWIGYVAVT  151

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              D+G   LGRRDI+V WRG+    EW+ DF    V  + IF + N  + +H+GWY +Y S
Sbjct  152   DDQGTAALGRRDIVVAWRGSVQPLEWVNDFEFGFVNAKKIFGEKNDQVQIHQGWYSIYMS  211

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              ++ S  N  +ARDQV  E+ RLL+ YK+E++SI++ GH LG+++ATLNA D+ AN +N 
Sbjct  212   KDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHILGAAIATLNAADIVANGYNR  271

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  FKK FS LK+LR LRV N  D+VP           
Sbjct  272   PKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVP-----------  320

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P + Y +VG +  I+  KS Y+K    ++  +H L +YLHG+ G QG      F+   
Sbjct  321   IYPPLGYAEVGDELPIDTRKSPYLKSPG-DLATFHCLEVYLHGLAGTQGTSKADLFRLDV  379

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    LK E   VP  W + KNKGMVQQ+DG+W L DHE D
Sbjct  380   KRDIGLVNKSVDGLKDEYM-VPGHWRILKNKGMVQQNDGSWKLMDHEID  427



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score =   326 bits (835),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 187/414 (45%), Positives = 241/414 (58%), Gaps = 33/414 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+VL+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  S YAG   Y+K 
Sbjct  5     IAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCYYSKS  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPST----TCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
              +   TG  KANPF+Y +TKY Y  ++     C      + V+S+  +A   ++NW GYV
Sbjct  65    QIFARTGYLKANPFRYNVTKYIYATASLNLPIC------FIVKSLSKEASRVQTNWIGYV  118

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWY  1042
             AVATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +  +V R   GW 
Sbjct  119   AVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVIDSKIVPRIGSGWL  178

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA-  865
             ++YTS++  S  ++ SAR+QV+ E+ RLLD+YKNEEVSIT TGHSLG  ++TL A DL  
Sbjct  179   DVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVN  238

Query  864   ------ANPFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
                   ++      V IT F F  P++G++ F K    LK L  LR+VN  D+ P     
Sbjct  239   GKKNTISSGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAPH----  294

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                     PL+ Y +VG +  IN   S Y+K   LN   +H L IYLHG+ G Q   G F
Sbjct  295   -------YPLLLYAEVGQELQINTLNSTYLKR-SLNFRNYHNLEIYLHGMAGMQDKAGLF  346

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             K     DI  VNK    LK E   VP+ W    NKGMVQ+DDGTW LD H  DH
Sbjct  347   KLVIGRDISLVNKGLDALKDEFL-VPSTWRCLANKGMVQKDDGTWQLDVHRKDH  399



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score =   327 bits (837),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 194/441 (44%), Positives = 249/441 (56%), Gaps = 33/441 (7%)
 Frame = -2

Query  1641  TSLHQQRNTPKC*LHSEkknnnkKMESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYG  1462
             T+   QRN         KK     + +IAKRW+VL+G + W+GLLDPLD DLRRY+IHYG
Sbjct  16    TNSFTQRNNVTIQKKQGKKLKASMLGAIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYG  75

Query  1461  SMIGAVYDSFISEPTSKYAGLSRYAKKSLLEETGLEKANPFKYTITKYFYTPST----TC  1294
              M    YD+F  +  S YAG   Y+K  +   TG  KANPF+Y +TKY Y  ++     C
Sbjct  76    EMAQVGYDAFNWDRKSLYAGDCYYSKSQIFARTGYLKANPFRYNVTKYIYATASLNLPIC  135

Query  1293  GAHHGGYHVQSVRADAVMKESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDF  1114
                   + V+S+  +A   ++NW GYVAVATD+GK +LGRRDI+V WRGT    EW  DF
Sbjct  136   ------FIVKSLSKEASRVQTNWIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDF  189

Query  1113  RIPMVKPRIIFAQDNGSLVHR---GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYK  943
               P+     +F   +  +V R   GW ++YTS++  S  ++ SAR+QV+ E+ RLLD+YK
Sbjct  190   DFPLESGVKVFPVFDSKIVPRIGSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYK  249

Query  942   NEEVSITVTGHSLGSSLATLNAVDLAANPFNNT-------DVLITAFLFASPKVGNEGFK  784
             NEEVSIT TGHSLG  ++TL A DL     N          V IT F F  P++G++ F 
Sbjct  250   NEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISSGLERKQVPITVFAFGCPRIGDQDFV  309

Query  783   KAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHD  604
             K    LK L  LR+VN  D+ P             PL+ Y +VG +  IN   S Y+K  
Sbjct  310   KIVDSLKQLNILRIVNVPDVAPH-----------YPLLLYAEVGQELQINTLNSTYLKR-  357

Query  603   KLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEK  424
              LN   +H L IYLHG+ G Q   G FK     DI  VNK    LK E   VP+ W    
Sbjct  358   SLNFRNYHNLEIYLHGMAGMQDKAGLFKLVIGRDISLVNKGLDALKDEFL-VPSTWRCLA  416

Query  423   NKGMVQQDDGTWILDDHEADH  361
             NKGMVQ+DDGTW LD H  DH
Sbjct  417   NKGMVQKDDGTWQLDVHRKDH  437



>ref|XP_008345355.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=407

 Score =   325 bits (834),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/410 (45%), Positives = 240/410 (59%), Gaps = 38/410 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M++IA RWR+L G  +WEGLLDPLD DLRR ++H G  + A+ DSFIS+P SK  GL RY
Sbjct  30    MDTIATRWRLLGGETDWEGLLDPLDIDLRRCILHXGERVAAIGDSFISDPRSKNCGLPRY  89

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
                 L  + GLE +NP+KYT+ KY Y  +                 + +  +S W GYVA
Sbjct  90    TXTHLFSKVGLENSNPYKYTVNKYIYAAT-----------------EVLPGKSIWLGYVA  132

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V T +GKEVLGRRDILV WRGTE  +EW  D    +V    I        VH G++  Y 
Sbjct  133   VTTXEGKEVLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHGFHSYYN  192

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S + +S  +  S R QV   +  ++D YK+EE+SITV GHS+G + A LNA D+  N +N
Sbjct  193   SADPESPYSKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDIVCNGYN  252

Query  849   N-TD-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
               TD      L+T+ +FASP++G++GF   FS LKNL  LRV N+ D+VP +P       
Sbjct  253   KPTDRPDKACLVTSIVFASPRLGDQGFHDVFSSLKNLHVLRVTNSYDIVPHLP-------  305

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                PL  Y DVG +  I+  KS Y+K+ K +    H L IYLHG+ G QG  G F+    
Sbjct  306   ---PLEKYVDVGKELKIDTLKSPYLKNAKKDA---HRLEIYLHGVAGTQGRNG-FQLVIN  358

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
              DI  VNK    LK ++  V  +WW EKNK MVQ DDG+W+L DHE D V
Sbjct  359   RDIALVNKKLDGLK-DEYNVIVKWWTEKNKSMVQMDDGSWVLLDHEKDDV  407



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   326 bits (836),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 190/411 (46%), Positives = 249/411 (61%), Gaps = 25/411 (6%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +  AKRWR L+G ++W+G+L PLD DLR Y+IHYG M  A YD+F     SK+AG S Y+
Sbjct  33    KEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYS  92

Query  1386  KKSLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K    + GLEKA+P+ KY +TK+ Y  S         + +  V  +   KESNW GYVA
Sbjct  93    RKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPE--SFLLFPVSREGWTKESNWMGYVA  150

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMY  1033
             V  D+G  +LGRRDI+V WRG+    EW+ DF   +V  + IF + N  + +H+GWY +Y
Sbjct  151   VTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIY  210

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
              S ++ S     +ARDQV  EV RLLD YK+EEVSIT+ GHSLG++LATLNA D+ AN +
Sbjct  211   MSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGY  270

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      +    +TAF+FASP+VG+  FKK FS L++LR LR  N             + 
Sbjct  271   NRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRN-----------LPDI  319

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQG--PKGEFKP  517
               I P I Y +VG +  I+  KS+Y+K    N+  +H L  YLHG+ G QG     EF+ 
Sbjct  320   IPIYPPIGYSEVGDELPIDTRKSQYMKSPG-NLATFHCLEAYLHGVAGTQGTAKADEFRL  378

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 DI  VNK    LK E C VP +W V KNKGMVQQDDG+W L DHE D
Sbjct  379   DVKRDIGLVNKSVDGLKDE-CMVPGKWRVLKNKGMVQQDDGSWNLLDHEID  428



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   325 bits (832),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 182/404 (45%), Positives = 245/404 (61%), Gaps = 20/404 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + ++A+RWR LNG + W+GLLDPLD DLRR +I+YG +  A Y     E  S+YAG   +
Sbjct  7     LGNVARRWRELNGVNYWKGLLDPLDIDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLF  66

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              ++  L    ++ +NP  Y ITK+ Y   T   +   G+ V+S+   A  ++SNW G+VA
Sbjct  67    NRRDFLSR--VDVSNPDLYEITKFVYAMCTV--SLPDGFMVKSLSKAAWSRQSNWMGFVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG--SLVHRGWYEM  1036
             VATD+GKEVLGRRD++V WRGT    EW++D  I +V    I    +     VH GW  +
Sbjct  123   VATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSAINPCVHGGWLSV  182

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YT+ +  S  N  SAR QV  EV R+ DLYKNEE SIT+TGHSLG++LAT+NA+D+ +N 
Sbjct  183   YTTADPGSQYNQESARHQVLNEVKRIQDLYKNEETSITITGHSLGAALATINAIDIVSNG  242

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
             +N +   ++AF+F SP+VGN  F+KAF    +LR LRV N+ D+VP  P L         
Sbjct  243   YNKS-CPVSAFVFGSPRVGNPDFQKAFDSAADLRLLRVRNSPDVVPKWPKL---------  292

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
                Y DVG +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G FK     DI 
Sbjct  293   --GYNDVGTELMIDTGESPYLKAPG-NPLTWHDMECYMHGVAGTQGSSGGFKLLVDRDIA  349

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              VNK+   LK E   +PT WWV +NKGMV+  DG W L DHE D
Sbjct  350   LVNKHEDALKNEYS-IPTSWWVVQNKGMVKGKDGRWHLADHEDD  392



>ref|XP_004301748.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/418 (44%), Positives = 248/418 (59%), Gaps = 42/418 (10%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA RW+ L+G D WEGLL+PLD DLRRY+IHYG   GA+  + ++EP SK   L RY
Sbjct  1     MGSIATRWKALSGQDEWEGLLNPLDIDLRRYIIHYGERAGAI--AVVNEPKSKNYRLPRY  58

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK++L    GLE  NP+KY + KY Y    T                  +++SN+ GYVA
Sbjct  59    AKENLFSNMGLESGNPYKYMVNKYLYAAHMTFS----------------LQKSNFLGYVA  102

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+G +VLGRRDIL+ WRGT+   EW  D    +V    I  ++N  LVH+GW   YT
Sbjct  103   VTTDEGAKVLGRRDILISWRGTQLVHEWDVDKETDLVSASHILGEENDPLVHQGWLSYYT  162

Query  1029  STNQDS-HLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             + +  S H   +S RDQ  A +  +LD YK+EE+SIT+TGHS+G+++A LNA D+  N +
Sbjct  163   NIDLLSPHNQLSSCRDQAVAALKEILDEYKDEEISITITGHSMGAAMAILNAADIVHNGY  222

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N      N  + +TA +FA P++GN+GF+  FS L+NL  LR+ N+ D+VP +P L    
Sbjct  223   NKLACQPNKLIPVTAIVFACPRLGNKGFENVFSGLENLHVLRITNDQDIVPNLPDLE---  279

Query  690   GTILPLIAYKDVGVQFDINASKSEYVK--HDKL---NVLMWHGLMIYLHGIDGFQGPKGE  526
                     Y  VG +  I+  KS ++K   D L    +   H L +YLHG+ G QG K  
Sbjct  280   -------DYAHVGKELRIDTLKSPFLKVIPDTLVTERIGNLHNLEVYLHGVAGTQGVKSS  332

Query  525   -FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVV  355
              FK +   D+  VNK+   LK E   V  +WW EKNK M+Q+DDG+W+LDDHE D  +
Sbjct  333   GFKMEVDRDLALVNKHIDGLKDEH-NVVAQWWTEKNKSMIQKDDGSWVLDDHEEDATI  389



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 244/410 (60%), Gaps = 25/410 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+ L+G + W+GLL+PLD DLRRY+IHYG M    YD+F  +  S+YAG   Y
Sbjct  2     LEGIPKRWKELSGVNKWQGLLEPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K+ +   TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKRQIFARTGFLKANPFRYNVTKYIY--ATASLKLPICFIVKSLSKDASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWYE  1039
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +  +V R   GW +
Sbjct  120   VATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVTDPKVVPRVGSGWLD  179

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL--A  865
             +YT+++ +S  ++ SAR+QV+ E+ RLL++YKNEEVSIT TGHSLG  ++TL A DL  A
Sbjct  180   VYTASDSNSPYDTTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHA  239

Query  864   ANPFNNT-----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
                 NNT      V IT F F  P++G++ FKK    L+ L  LR+VN  D+ P      
Sbjct  240   RKNKNNTSLQRNQVPITVFAFGCPRIGDQDFKKIVDSLQPLNILRIVNVPDVAPH-----  294

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PL+ Y +VG   +IN   S Y+K   LN   +H L IYLHGI G Q   G FK
Sbjct  295   ------YPLLLYAEVGEVLEINTLNSTYLKR-SLNFRNYHNLEIYLHGIAGMQDRAGVFK  347

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              +   D+  VNK    LK E   VP+ W    NKGMVQ DDGTW LD H 
Sbjct  348   LEVGRDVSLVNKGLDALKDEYL-VPSTWRCLANKGMVQMDDGTWKLDVHR  396



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   324 bits (830),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 240/404 (59%), Gaps = 24/404 (6%)
 Frame = -2

Query  1554  KRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSL  1375
             K W+ L+G +NWEGLLDPLD +LRR +I YG M  A YD+F S   SKYAG SRY KK  
Sbjct  11    KNWKNLSGQNNWEGLLDPLDINLRRSIIRYGEMAQASYDTFNSTNISKYAGSSRYTKKDF  70

Query  1374  LEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDK  1195
               + GL    P+KY +TK+ Y  +T+       +  +S+  +A  KESN+ GYVAVA D+
Sbjct  71    FTKVGLAMGKPYKYRVTKFLY--ATSGIDLPSAFMFKSLSREAWSKESNFIGYVAVAEDE  128

Query  1194  GKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS---LVHRGWYEMYTST  1024
                 LGRRDI++ WRGT    EW+ D +   V    I  + +G+    VH+GWY +YTS 
Sbjct  129   SVAALGRRDIVISWRGTIQSLEWVNDLQFLQVSASSIVGKSDGNDDPKVHQGWYSVYTSD  188

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN----P  856
             +  S  N  SAR QV  E+  L++ YK+EE+SIT+TGHSLG++LATLNA+D+  N    P
Sbjct  189   DPKSPFNKTSARYQVLQEIENLVEQYKDEEISITITGHSLGAALATLNAIDIVVNNKNKP  248

Query  855   FNN--TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
              +N     L+TA +FASP+VG+  FKK F    NL+ LRV N  D+VP            
Sbjct  249   KDNPQKQCLVTAIIFASPRVGDSNFKKIFPKYDNLKLLRVHNTLDIVPN-----------  297

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              PL+ Y DVG +  I+ +KS Y+K        WH +  YLHG+ G QG K  FK     D
Sbjct  298   YPLLGYSDVGQELLIDTTKSPYLKVPG-TFSNWHNMEAYLHGVAGTQGSKNGFKLVVDRD  356

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             I  VNK    LK E   +P  WW  KNKGMVQQ DG+W+L D+E
Sbjct  357   IALVNKSMDNLKDEYL-IPVAWWSLKNKGMVQQSDGSWLLMDNE  399



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 248/409 (61%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
              AKRWR L+G ++W+G+L PLD DLR Y+IHYG M  A YD+F     S++AG S Y++K
Sbjct  19    FAKRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRK  78

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLE A+P+ KY +TK+ Y  S         + +  +  +   KESNW GYVAV 
Sbjct  79    DFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPE--SFLLFPISREGWSKESNWMGYVAVT  136

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              D+G  +LGRRDI+V WRG+    EW+EDF   +V    IF + N  + +H+GWY +Y S
Sbjct  137   DDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMS  196

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              ++ S     +ARDQV  EV RLL+ YK+EEVSIT+ GHSLG++LATL+A D+ AN +N 
Sbjct  197   QDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNR  256

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  F+K FS L+++R LR  N  D++P           
Sbjct  257   PKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIP-----------  305

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P I Y +VG +F I+  KS Y+K    N+  +H L  YLHG+ G QG      F+   
Sbjct  306   IYPPIGYSEVGDEFPIDTRKSPYMKSPG-NLATFHCLEGYLHGVAGTQGTNKADLFRLDV  364

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                I  VNK    LK ++C VP +W V KNKGM QQDDG+W L DHE D
Sbjct  365   ERAIGLVNKSVDGLK-DECMVPGKWRVLKNKGMAQQDDGSWELVDHEID  412



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 242/417 (58%), Gaps = 33/417 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + +IAKRW+VL+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  S YAG   Y
Sbjct  145   LGAIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCYY  204

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPST----TCGAHHGGYHVQSVRADAVMKESNWG  1222
             +K  +   TG  KANPF+Y +TKY Y  ++     C      + V+S+  +A   ++NW 
Sbjct  205   SKSQIFARTGYLKANPFRYNVTKYIYATASLNLPIC------FIVKSLSKEASRVQTNWI  258

Query  1221  GYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---  1051
             GYVAVATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +  +V R   
Sbjct  259   GYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRIGS  318

Query  1050  GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVD  871
             GW ++YTS++  S  ++ SAR+QV+ E+ RLLD+YKNEEVSIT TGHSLG  ++TL A D
Sbjct  319   GWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAAD  378

Query  870   LAANPFNNT-------DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMV  712
             L     N          V IT F F  P++G++ F K    LK L  LR+VN  D+ P  
Sbjct  379   LVNGKKNTISAGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAPHY  438

Query  711   PFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK  532
                        PL+ Y +VG +  IN   S Y+K   LN   +H L IYLHG+ G Q   
Sbjct  439   -----------PLLLYAEVGQELQINTLNSTYLKRS-LNFRNYHNLEIYLHGMAGMQDKA  486

Query  531   GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             G FK     DI  VNK    LK E   VP+ W    NKGMVQ+DDGTW LD H  DH
Sbjct  487   GLFKLVIGRDISLVNKGLDALKDEFL-VPSTWRCLANKGMVQKDDGTWQLDVHRKDH  542



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/402 (45%), Positives = 243/402 (60%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RWR LNG++ W+GLLDPLD DLR+ +I+YG +  A Y     E  S+YAG   + +
Sbjct  9     NIARRWRELNGANYWKGLLDPLDIDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  68

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K  L    ++ +NP  Y ITK+ Y   T   +    + ++ +   A  K+SNW G+VAVA
Sbjct  69    KDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDDFMIKPLSKAAWSKQSNWMGFVAVA  124

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEMYT  1030
             TD+GKEVLGRRD++V WRGT    EW++D  I +V    I      N   VH GW  +YT
Sbjct  125   TDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSANDPRVHGGWLSVYT  184

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+  S  N  SAR QV  EV RL DLYK EE SIT+TGHSLG++LAT++A D+ +N +N
Sbjct  185   STDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYN  244

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
              T   ++AF+F SP+VGN  F+KAF   ++LR LRV N+ D+VP  P L           
Sbjct  245   KT-CPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPKL-----------  292

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y D G +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G F+ +   DI  V
Sbjct  293   GYSDAGTELMIDTGESPYIKSPG-NPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALV  351

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK+   LK E+  +P  WWV +NKGMV+  DG W L DHE D
Sbjct  352   NKHEDALK-EEYSIPPSWWVVQNKGMVKGKDGRWHLADHEDD  392



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 243/404 (60%), Gaps = 19/404 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M ++AKRW+ LNG + W+GL+DPLD DLRR +I+YG +  A Y     E  S+YAG   +
Sbjct  7     MGNVAKRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQATYTGLNRERRSRYAGSCLF  66

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              ++  L    ++ +NP  Y ITK+ Y   T   +   G+ V+S+   A  ++SNW G+VA
Sbjct  67    NRRDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDGFMVKSLSKAAWSRQSNWMGFVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS--LVHRGWYEM  1036
             VATD+GKE+LGRRD++V WRGT    EW++D  I +V    I    + +   VH GW  +
Sbjct  123   VATDEGKELLGRRDVVVAWRGTIRMVEWVDDLDISLVPASEIVLPGSAANPCVHGGWLSV  182

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS +  S  N  SAR QV  EV R+ DLYK EE SIT+TGHSLG++LAT+NA D+ +N 
Sbjct  183   YTSADPGSQYNKESARHQVLNEVKRIQDLYKPEETSITITGHSLGAALATINATDIVSNG  242

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
             +N +   ++AF+F SP+VGN  F+KAF    +LR LRV N+ D+VP  P L         
Sbjct  243   YNRSCCPVSAFVFGSPRVGNLDFQKAFDSAADLRLLRVRNSPDVVPKWPKL---------  293

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
                Y DVG +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G F+     D+ 
Sbjct  294   --GYSDVGTELMIDTGESPYLKAPG-NPLTWHDMECYMHGVAGAQGSSGGFELLVDRDVA  350

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              VNK+   L+ E   VP  WWV +NKGMV+  DG W L DHE D
Sbjct  351   LVNKHEDALRNE-FAVPPSWWVVQNKGMVKGKDGRWHLADHEED  393



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score =   321 bits (823),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 182/414 (44%), Positives = 238/414 (57%), Gaps = 33/414 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +  IAKRW+ LNG   W+GLLDPLD DLRRYLIHYG M    YD+F  +  S+YAG   Y
Sbjct  2     LNDIAKRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPST----TCGAHHGGYHVQSVRADAVMKESNWG  1222
             +KK L   TG  KANPF+Y +TKY Y  ++     C      + V+S+  DA   ++NW 
Sbjct  62    SKKQLFARTGFIKANPFRYEVTKYIYATASLNLPIC------FIVKSLSKDASRVQTNWM  115

Query  1221  GYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFA---QDNGSLVHR  1051
             GY+AVATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F      +   +  
Sbjct  116   GYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRIGS  175

Query  1050  GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVD  871
             GW ++YT+++  S  +  SAR+QV+ E+ RLL++YKNEEVSIT TGHSLG+ ++ L+A D
Sbjct  176   GWLDIYTASDSRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAAD  235

Query  870   LAAN-------PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMV  712
             +                V IT F F SP++G++ FKK    LK L  LR+VN  D+ P  
Sbjct  236   IVYGKNSIINISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLKPLNILRIVNVPDVAPH-  294

Query  711   PFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK  532
                        PL+ Y ++G   +IN   S Y+K   LN   +H L IYLHGI G Q   
Sbjct  295   ----------YPLLLYAEIGEVLEINTLNSTYLKR-SLNFRNYHNLEIYLHGIAGMQDTA  343

Query  531   GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             G FK +   DI  VNK    LK E   VP+ W    NKGMVQ +DGTW L+ H 
Sbjct  344   GVFKLEIGRDISLVNKGLDALKDEYL-VPSTWRCLANKGMVQMNDGTWKLNVHR  396



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 180/402 (45%), Positives = 241/402 (60%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RWR LNG++ W+GLLDPLD DLR+ +I+YG +  A Y     E  S+YAG   + +
Sbjct  9     NIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  68

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K  L    ++ +NP  Y ITK+ Y   T   +    + ++ +   A  K+SNW G+VAVA
Sbjct  69    KDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDDFMIKPLSKAAWSKQSNWMGFVAVA  124

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEMYT  1030
             TD+GKEVLGRRD++V WRGT    EW++D  I +     I      N   VH GW  +YT
Sbjct  125   TDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLAPASEIVRPGSANDPRVHGGWLSVYT  184

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+  S  N  SAR QV  EV RL DLYK EE SIT+TGHSLG++LAT++A D+ +N +N
Sbjct  185   STDPGSRYNEQSARYQVLDEVKRLQDLYKQEETSITITGHSLGAALATISATDIVSNGYN  244

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
              T   ++AF+F SP+VGN  F+KAF   ++LR LRV N+ D+VP  P L           
Sbjct  245   KT-CPVSAFVFGSPRVGNSDFRKAFDSAEDLRLLRVRNSPDVVPNWPKL-----------  292

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y D G +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G F+ +   DI  V
Sbjct  293   GYSDAGTELMIDTGESPYIKSPG-NPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALV  351

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK+   LK E   +P  WWV +NKGMV+  DG W L DHE D
Sbjct  352   NKHEDALKKEYS-IPPSWWVVQNKGMVKGKDGRWHLADHEDD  392



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/414 (44%), Positives = 239/414 (58%), Gaps = 33/414 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             ++ IAKRW+ LNG   W+GLLDPLD DLRRYLIHYG M    YD+F  +  S+YAG   Y
Sbjct  2     LDDIAKRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPST----TCGAHHGGYHVQSVRADAVMKESNWG  1222
             +KK L   TG  KANPF+Y +TKY Y  ++     C      + V+ +  DA   ++NW 
Sbjct  62    SKKQLFARTGFIKANPFRYEVTKYIYATASINLPIC------FIVKPLSKDASRVQTNWM  115

Query  1221  GYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFA---QDNGSLVHR  1051
             GY+AVATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F      +   +  
Sbjct  116   GYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRIGS  175

Query  1050  GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVD  871
             GW ++YT+++  S     SAR+QV+ E+ RLL++YKNEEVSIT TGHSLG+ ++ L+A D
Sbjct  176   GWLDIYTASDSRSPYAKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAAD  235

Query  870   LAANPFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMV  712
             +     +  D       V IT F F SP++G++ FKK    LK L  LR+VN  D+ P  
Sbjct  236   IVYGKNSKIDISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLKPLNILRIVNVPDVAPH-  294

Query  711   PFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK  532
                        PL+ Y ++G   +IN   S Y+K   LN   +H L IYLHGI G Q   
Sbjct  295   ----------YPLLLYAEIGEVLEINTLNSTYLKR-SLNFRNYHNLEIYLHGIAGMQDAA  343

Query  531   GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             G FK +   DI  VNK    LK E   VP+ W    NKGMVQ +DGTW L+ H 
Sbjct  344   GVFKLEIGRDISLVNKGLDALKDEYL-VPSTWRCLANKGMVQMNDGTWKLNVHR  396



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 242/404 (60%), Gaps = 20/404 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + +IA+RWR LNG   W+GLLDPLD DLR  +I+YG +  A Y     E  S+YAG   +
Sbjct  7     LGNIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLF  66

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             ++K  L    ++ +NP  Y ITK+ Y   T   +    + ++S    A  K+SNW G+VA
Sbjct  67    SRKDFLSR--VDVSNPNLYVITKFIYAMCTV--SLPDAFMIKSWSKAAWSKQSNWMGFVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEM  1036
             VATD+GKEVLGRRD++V WRGT    EW++D  I +V    I      +   VH GW  +
Sbjct  123   VATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSV  182

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS + +S  N  SAR QV  E+ RL D+Y++EE SIT+TGHSLG++LAT+NA D+ +N 
Sbjct  183   YTSADPESQYNKQSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINATDIVSNG  242

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
             +N +   ++AF+F SP+VGN  F+KAF    +LR LR+ N+ D+VP  P L         
Sbjct  243   YNKS-CPVSAFVFGSPRVGNPDFQKAFDSAPDLRLLRIRNSPDVVPNWPKL---------  292

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
                Y D G +  I+  KS Y+K    N L WH +  Y+HG+ G QG  G FK +   DI 
Sbjct  293   --GYSDAGTELMIDTGKSPYLKAPG-NPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIA  349

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              VNK+   LK E   +P+ WWV +NKGMV+  DG W L DHE D
Sbjct  350   LVNKHEDALKNEYA-IPSSWWVVQNKGMVKGTDGRWHLADHEDD  392



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/408 (43%), Positives = 239/408 (59%), Gaps = 26/408 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RWR ++GS+ W GLLDPLD D+RR +I YG +  A  D+FI++P S YAG  RY+ 
Sbjct  19    AIAQRWREISGSNQWSGLLDPLDIDVRREVIRYGELAQATSDAFITDPASPYAGACRYSP  78

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              S   +  ++ ++P  Y +T++ Y  +T+      G+  + + A A   +SNW GYVAVA
Sbjct  79    ASFFNK--VQASDPGAYRVTRFIY--ATSSARLPDGFMARPLPAGAWSTDSNWMGYVAVA  134

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMY  1033
             TD+G   LGRRDI+V WR T+  +EW  D    +V    I     G     VHRG+  +Y
Sbjct  135   TDRGAAALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYVHRGFLSVY  194

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS N  S  N  SAR+ V  EV  LLD YKNE+ SI++TGHSLG +L TLNA+DL AN F
Sbjct  195   TSKNSTSRFNRRSARELVLTEVRGLLDTYKNEDCSISITGHSLGGALTTLNAIDLVANGF  254

Query  852   N-----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
             N      + V +TA  F +P+VG+E FKKAF  +  L  LRV N  D+VP          
Sbjct  255   NVRGPSRSPVPVTAIHFGAPRVGDEQFKKAFHSMAGLSLLRVRNVPDIVP----------  304

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQ  514
             TILP + Y DVGV+  ++  KS Y+K +K     WH L  YLHG+ G  G +    F  +
Sbjct  305   TILPPVIYADVGVELLVDTRKSPYLK-EKAGPAQWHNLEGYLHGVAGTHGARDSAGFGME  363

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                D+  +NK    L+ ++ PVP  WW E NKGMV+   G W+L DHE
Sbjct  364   VDRDLALINKEEDALR-DEYPVPAMWWAENNKGMVKNATGHWVLHDHE  410



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/402 (45%), Positives = 242/402 (60%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RWR LNG++ W+GLLDPLD DLR+ +I+YG +  A Y     E  S+YAG   + +
Sbjct  9     NIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  68

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K  L    ++ +NP  Y ITK+ Y   T   +    + ++ +   A  K+SNW G+VAVA
Sbjct  69    KDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDDFMIKPLSKAAWSKQSNWMGFVAVA  124

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEMYT  1030
             TD+GKEVLGRRD++V WRGT    EW++D  I +     I      +   VH GW  +YT
Sbjct  125   TDEGKEVLGRRDVMVAWRGTIRVLEWMDDLDISLAPASEIVRPGSADDPRVHGGWLSVYT  184

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+  S  N  SAR QV  EV RL DLYK EE SIT+TGHSLG++LAT++A D+ +N +N
Sbjct  185   STDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYN  244

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
              T   ++AF+F SP+VGN  F+KAF   ++LR LRV N+ D+VP  P L           
Sbjct  245   KT-CPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPKL-----------  292

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y D G +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G F+ +   DI  V
Sbjct  293   GYSDAGTELMIDTGESPYIKSPG-NPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALV  351

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK+   LK E   +P+ WWV +NKGMV+  DG W L DHE D
Sbjct  352   NKHEDALKKEYS-IPSSWWVVQNKGMVKGKDGRWHLADHEDD  392



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/404 (44%), Positives = 244/404 (60%), Gaps = 20/404 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M +IAKRW+ LNG + W+GL+DPLD DLRR +I+YG +  A Y     E  S+YAG   +
Sbjct  7     MGNIAKRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLF  66

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              ++  L    ++ +NP  Y ITK+ Y   T   +   G+ V+S+   A  ++SNW G+VA
Sbjct  67    NRRDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDGFMVKSLSKAAWSRQSNWMGFVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS--LVHRGWYEM  1036
             VATD+GKEVLGRRD++V WRGT    EW++D  I +V    I    + +   VH GW  +
Sbjct  123   VATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSATNPCVHGGWLSV  182

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS +  S  N  SAR QV  EV R+ DLYK EE SI++TGHSLG++LAT+NA+D+ +N 
Sbjct  183   YTSADPGSQYNKESARHQVLNEVKRIQDLYKTEETSISITGHSLGAALATINAIDIVSNG  242

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
             +N +   ++AF+F SP+VGN  F++AF    +LR LRV N+ D+VP  P L         
Sbjct  243   YNRS-CPVSAFVFGSPRVGNPDFQEAFDSAADLRLLRVRNSPDVVPKWPKL---------  292

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
                Y DVG +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G F+     DI 
Sbjct  293   --GYSDVGTELRIDTGESPYLKSPG-NPLTWHDMECYMHGVAGAQGSSGGFELAVDRDIA  349

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              VNK+   LK E   VP+ WWV +NK MV+  DG W L DHE D
Sbjct  350   LVNKHEDALKNE-FAVPSSWWVVQNKDMVKGKDGRWHLADHEDD  392



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 178/415 (43%), Positives = 236/415 (57%), Gaps = 27/415 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             + A+RWR ++G D W GLLDPL+ +LRR +I YG +  A  D+FI +P S YAG SRY  
Sbjct  20    ATAQRWREISGRDQWSGLLDPLNIELRREIIRYGELAQATSDAFIGDPASPYAGASRYGP  79

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              +   +  ++ A+P  Y +T++ Y  +T+       +  + V A A   ESNW GYVAVA
Sbjct  80    GTFFYK--VQAADPGAYRVTRFLY--ATSSARLRDAFMTRPVPAGAWSTESNWMGYVAVA  135

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD     LGRRD++V WRGT+   EW  D  I +V    +        VHRG+  +YTS 
Sbjct  136   TDGAARALGRRDVVVAWRGTKRMVEWASDLDIVLVPAAGVVGPGGRGSVHRGFLSLYTSK  195

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             N  S  N  SAR+QV  EV RLLD YK+E  S+T+TGHSLG++L+TLNA+D+ AN  N  
Sbjct  196   NSTSRFNKQSAREQVLTEVRRLLDTYKDENCSVTLTGHSLGAALSTLNAIDIVANGINAL  255

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKN-LRALRVVNNGDLVPMVPFLAVEA  691
                   N  V +TA LF SP+VG+E FKKA   +   +  LRV N  D+VP         
Sbjct  256   RSSSGDNITVPVTAILFGSPRVGDEQFKKALDSMAGAVSLLRVRNAPDIVP---------  306

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKP  517
              TILP   Y+DVGV+  ++  KS Y+K        WH L  YLH + G QGP  +  F  
Sbjct  307   -TILPTPFYRDVGVELLVDTLKSPYLKTPA-GPAQWHNLECYLHAVAGTQGPGDDAGFSL  364

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVF  352
             +   D+  VNK    LK E  PVP  WW E NKGMV+   G W+L+DHE  ++  
Sbjct  365   EVDRDVALVNKEEDALKGE-YPVPASWWAENNKGMVKNATGHWVLEDHEEGNLAL  418



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 240/407 (59%), Gaps = 25/407 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E IAKRW+ L+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  S+YAG   Y
Sbjct  2     LEGIAKRWKELSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +KK +   TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKKQIFARTGYLKANPFRYNVTKYIY--ATASIKLPICFIVKSLSKDASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWYE  1039
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +     R   GW +
Sbjct  120   VATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVKDAKANPRIGSGWLD  179

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+++  S  +  SAR+QV+ E+ RLL++YKNEEVSIT TGHSLG+ ++ L+A D    
Sbjct  180   IYTASDSRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADFVYG  239

Query  858   PFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N T+       V IT F F SP++G++ FKK    L+ +  LR+VN  D+ P      
Sbjct  240   KNNKTNISLPKKQVPITVFAFGSPRIGDQDFKKIVDSLQQINILRIVNVPDVAPH-----  294

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PL+ Y ++G   +IN   S Y+K   LN   +H L IYLHG+ G +   G FK
Sbjct  295   ------YPLLLYAEIGEVLEINTLNSTYLKRS-LNFRNYHNLEIYLHGMAGMKDTAGVFK  347

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
              +   DI  VNK    LK E   VP+ W    NKGMVQ DDGTW L+
Sbjct  348   LEIGRDISLVNKGLDALKDEYL-VPSTWRCLANKGMVQMDDGTWKLN  393



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 186/413 (45%), Positives = 236/413 (57%), Gaps = 34/413 (8%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIAKRWR+L GS  WEGL DPLDSDLR+ ++ YG    A YD+FIS+  SKYAG SRY  
Sbjct  5     SIAKRWRLLQGSQRWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGG  64

Query  1383  KSLLEETGLEK-ANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
                 E+ GL K    + Y+++K+ Y  ST        +   S+  +   +ESNW GYVA 
Sbjct  65    PHFFEDLGLTKRPTEWGYSLSKFIYATSTIKVPE--AFIRTSLSREGGSRESNWMGYVAH  122

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------------S  1063
              TD GK   GRRDI V WRGT    EW+ DF         +     G            +
Sbjct  123   VTDTGKTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETDKVLRNDA  182

Query  1062  LVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKN-EEVSITVTGHSLGSSLAT  886
              V RGW+++YTS +  S  N +SAR+QV  EV RLL+ YK+ EE+SIT TGHSLG++LAT
Sbjct  183   RVQRGWFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLAT  242

Query  885   LNAVDLAANPFNNTD-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLV  721
             L A D+  N  N        + +TA +FASP+VGN+ FKK    L +LR LRV NN DLV
Sbjct  243   LCAFDIVINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLRVTNNPDLV  302

Query  720   PMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQ  541
             P+ PFL            Y +VGV+  ++  KS Y+K+   +   WH L  YLH + G Q
Sbjct  303   PLHPFL-----------GYVEVGVELPVDTVKSPYLKNPG-DASRWHNLEAYLHTVAGTQ  350

Query  540   GPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             G  G FK +   DI  VNK    LK E   VP  WWVEKNKGMVQ +DG W++
Sbjct  351   GKNGAFKLEVDRDIALVNKSTDWLKDEYL-VPVSWWVEKNKGMVQGNDGHWLM  402



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 183/411 (45%), Positives = 242/411 (59%), Gaps = 27/411 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             ++ IAKRW+ LNG   W+GLLDPLD DLRR LIHYG M    YD+F  +  S+YAG   Y
Sbjct  2     LDDIAKRWKELNGQKKWQGLLDPLDPDLRRCLIHYGEMSQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +KK L   TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKKQLFARTGFLKANPFRYEVTKYIY--ATASIKLPICFIVKSLSKDASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F     +DN   +  GW 
Sbjct  120   VATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDNPR-IGSGWL  178

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
             ++YT+++  S  +  SAR+QV+ E+ RLL++YKNEEVSIT TGHSLG+ ++ L+A D+  
Sbjct  179   DIYTASDPRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVY  238

Query  861   NPFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
                +N +       V IT F F SP++G++ FKK    L+ L  LR+VN  D+ P     
Sbjct  239   GKNSNINISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLQPLNILRIVNVPDVAPH----  294

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                     PL+ Y ++G   +IN   S Y+K   LN   +H L IYLHGI G Q   G F
Sbjct  295   -------YPLLLYAEIGEVLEINTLNSTYLKR-SLNFRNYHNLEIYLHGIAGMQDAAGVF  346

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   DI  VNK    LK E   VP+ W    NKGMVQ +DGTW L+ H 
Sbjct  347   KLEIGRDISLVNKGLDALKDEYL-VPSTWRCLANKGMVQMNDGTWKLNVHR  396



>ref|XP_006428645.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
 ref|XP_006480462.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|ESR41885.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
Length=410

 Score =   318 bits (815),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 186/416 (45%), Positives = 246/416 (59%), Gaps = 36/416 (9%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA  W+ L+G++NW+GLL+PL+ +LRRY+IHYG  + A+YDSF  E TSK  G  RYA 
Sbjct  5     SIADNWKELSGNNNWDGLLNPLNINLRRYIIHYGERVQAIYDSFNGETTSKMYGFPRYAP  64

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             +       L+  NP+KY +T Y Y  S T         ++ +  D    +S W GYVAVA
Sbjct  65    EDFFSNVALQNGNPYKYIVTNYLYARSDTD-------FLEWLLPD----QSAWIGYVAVA  113

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL--VHRGWYEMYT  1030
             TD+GK VLGRRDIL+ WRGT++ +EW +D    +     IF    G    VH G++ +Y 
Sbjct  114   TDEGKAVLGRRDILISWRGTQSAAEWFKDIEFSLTAASDIFEDTYGPTPEVHSGFHSLYV  173

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
              ++  S  N +SA+DQVR+ V  L+D YK EE+SITV GHSLGS+LATLNA DL AN +N
Sbjct  174   KSDSASTYNKSSAKDQVRSAVRTLVDKYKEEEMSITVIGHSLGSALATLNAADLVANGYN  233

Query  849   N-------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
                     +  ++TA +FASP+VGN  FK  F  L +L  LR+ N  D+VP +P      
Sbjct  234   KPTGSDAASGCMVTAIVFASPRVGNSAFKTVFEDLNHLHLLRITNKDDIVPDLP------  287

Query  690   GTILPLIA--YKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKG----  529
                LP IA  Y  VG +  I+ +KS YVK  K ++ + H L  YLHGI G   PKG    
Sbjct  288   PRYLPHIAMGYVHVGQELKIDTTKSTYVKKRKPSLSVLHNLENYLHGIAG--TPKGDDDD  345

Query  528   -EFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              +F+     DI  VNK   +L+V K  VP  WW  KNK MVQ D+G W L+D+  D
Sbjct  346   DDFELAIDRDIALVNKGLDLLEV-KYGVPPNWWAVKNKSMVQLDNGFWKLEDYVPD  400



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score =   317 bits (811),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 183/418 (44%), Positives = 242/418 (58%), Gaps = 42/418 (10%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLD-PLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSR  1393
             M SIA++W+V +G ++W+GLLD PLD+D RRY+IHYG    A+ D+FI+E  SK  G SR
Sbjct  1     MGSIAEKWKVFSGENDWKGLLDHPLDNDFRRYIIHYGERNEALGDAFIAEEKSKNYGRSR  60

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYT------PSTTCGAHHGGYHVQSVRADAVMKES  1231
             YAK+    + GLEK NP+KY +T + Y       PS T                 V+K+S
Sbjct  61    YAKRDFFSKVGLEKGNPYKYEVTNFIYAALELKPPSLTATWK-------------VIKQS  107

Query  1230  NWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR  1051
             N   YVAVATD GK  LGRRDILV WRGT    EWI+D     V    I    N   VH 
Sbjct  108   NLMAYVAVATDDGKAALGRRDILVSWRGTMLDPEWIKDLDFASVSASKILGTANDPKVHN  167

Query  1050  GWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVD  871
             GWY +YT TN DS L S SARDQ+  E+ + +  YK+E++SIT  GHS+G+++ TLNA D
Sbjct  168   GWYSLYTGTNPDSPLTSISARDQIINEIKKQVAAYKDEDLSITFVGHSMGAAIVTLNATD  227

Query  870   LAANPFN------NTDVLITAFLFASPKVGNEGFKKAFSHL--KNLRALRVVNNGDLVPM  715
             +  N FN      +  + +TAF  A P++G+EGF K F+ L   NL  LR+ N  D+VP 
Sbjct  228   IVFNGFNKLPDKPDKAIPVTAFCIACPRIGDEGFSKVFTGLIGSNLHVLRINNYLDIVPK  287

Query  714   VPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP  535
              P      G  L    Y DVG +  +++ +S Y+K     +L  H L ++LH + G+QGP
Sbjct  288   YP-----PGYYL----YSDVGQELVVDSLESPYLKK---ALLTLHSLEVHLHTVAGYQGP  335

Query  534   KGEFKPQG-CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               EF  +    D   +NKYG  L  ++  V  EWW EKNK M+Q DDGTW L D E +
Sbjct  336   DKEFDLKAIARDKVFLNKYGDYLD-DEYRVVAEWWTEKNKSMIQNDDGTWELKDSEEE  392



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/407 (44%), Positives = 241/407 (59%), Gaps = 27/407 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+VL+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  S+YAG   Y
Sbjct  2     VEGIPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K  LL  TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKNRLLARTGFLKANPFRYKVTKYIY--ATASIKLPISFIVKSLSKDASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F     +DN   +  GW 
Sbjct  120   VATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPR-IGSGWL  178

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
             ++YT+++  S  ++ SA++QV+ E+ RLL+LYK+EE+SIT TGHSLG+ ++ L+A DL  
Sbjct  179   DIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVY  238

Query  861   NPFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
                NN +       V IT F F SP++G+  FK     L+ L  LR+VN  D+ P     
Sbjct  239   GKKNNININLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAPH----  294

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                     PL+ Y ++G   +IN   S Y+K   LN   +H L IYLHG+ G Q   G F
Sbjct  295   -------YPLLLYSEIGEVLEINTLNSTYLKR-SLNFRNYHNLEIYLHGMAGMQDTDGVF  346

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             K +   DI  VNK    LK E   VP+ W    NKGM+Q DDGTW L
Sbjct  347   KLEIGRDISLVNKGLDALKDEYL-VPSTWRCLANKGMLQMDDGTWKL  392



>emb|CDX86530.1| BnaC08g01730D [Brassica napus]
Length=408

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 184/410 (45%), Positives = 239/410 (58%), Gaps = 25/410 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+VL+G + W+GLLDPLDSDLRRYLIHYG M    YD+F  +  S+Y G   Y
Sbjct  2     LEDIPKRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K  +   TG  KANP +Y +TKY Y  +T        + V+S+   A   ++NW GY+A
Sbjct  62    SKSQIHARTGYLKANPIRYNVTKYIY--ATASIKMPLCFIVKSLSKKASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWYE  1039
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +   V R   GW +
Sbjct  120   VATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVSDRKHVPRIGSGWLD  179

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+++  S  ++ SAR+QV+AE+ RLL++YKNEEVSIT TGHSLG  ++TL A DL  +
Sbjct  180   VYTASDAKSPYDTTSAREQVQAELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHS  239

Query  858   PFN-------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N       +  V IT F F  P++G++ FKK  S  K L  LR+VN  D+ P      
Sbjct  240   SQNKIHTGIQSKQVPITVFAFGCPRIGDQDFKKVVSSHKQLNILRIVNVPDVAPN-----  294

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PL  Y +VG    IN   S Y+K   LN   +H L IYLHGI G Q   G FK
Sbjct  295   ------YPLFMYAEVGEVLQINTLNSTYLKR-SLNWRNYHNLEIYLHGIAGMQDKSGVFK  347

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              +   D+  VNK    LK +K  VP+ W    N+GMVQ DDGTW LD H 
Sbjct  348   LEIGRDVSLVNKGLDALK-DKYLVPSVWRCLANRGMVQMDDGTWKLDVHR  396



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 183/415 (44%), Positives = 242/415 (58%), Gaps = 28/415 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +   A RWR L+G +NW+GLLDP D DLRR +I YG M  A YD+F  E  S +AGLSR+
Sbjct  5     LRGTAHRWRELHGQNNWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRF  64

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              ++   E   L   +   Y +TK+ Y  S+        + ++SV      +ESNW GYVA
Sbjct  65    GRRRFFERVQLPD-HAAAYRVTKFLYATSSVAVPEP--FILRSVSLGRRCRESNWIGYVA  121

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-NGSLVHRGWYEMY  1033
             VATD GK  LGRRDI+V WRGT    EWI D    M  PR +   + + + VHRGW  MY
Sbjct  122   VATDDGKTALGRRDIVVAWRGTTQALEWINDMEFVMAPPRSLLGDEASEATVHRGWLSMY  181

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS++ +S  N +SARDQV +EV RL+ +Y  EE+SITVTGHSLG++L TLNA D+AAN +
Sbjct  182   TSSDPESSHNKDSARDQVLSEVARLVSMYDGEELSITVTGHSLGAALGTLNAFDIAANGY  241

Query  852   NN---------TDVLITAFLFASPKVGNEGFKKAFSHLK--NLRALRVVNNGDLVPMVPF  706
             N          T   +TAF FASP+VG  GF++ F   +   LR LRV N  D+VP  P 
Sbjct  242   NRSPRAAAATATGCPVTAFAFASPRVGGHGFRRRFDGARGAGLRLLRVRNARDIVPRYP-  300

Query  705   LAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK-G  529
                        + Y DVG +  I+  +S Y+++   N L+WH L  YLHG+ G +G + G
Sbjct  301   ---------TALLYHDVGAELAIDTGESPYLRNPG-NELLWHNLESYLHGVAGARGGEAG  350

Query  528   EFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              F+     D+   NK+ G L+ E  PVP  WW+  N+GMV+  DG W L D E D
Sbjct  351   RFELAVERDVALTNKFYGALRDEH-PVPAGWWIPSNRGMVRGADGRWTLMDCEED  404



>ref|XP_009110999.1| PREDICTED: phospholipase A1-IIalpha-like [Brassica rapa]
 emb|CDY15570.1| BnaA08g28540D [Brassica napus]
Length=408

 Score =   315 bits (808),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 183/410 (45%), Positives = 239/410 (58%), Gaps = 25/410 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+VL+G + W+GLLDPLDSDLRRYLIHYG M    YD+F  +  S+Y G   Y
Sbjct  2     LEDIPKRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K  +   TG  KANP +Y +TKY Y  +T        + V+S+   A   ++NW GY+A
Sbjct  62    SKSQIHARTGYLKANPIRYNVTKYIY--ATASIKMPLCFIVKSLSKKASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWYE  1039
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F   +   V R   GW +
Sbjct  120   VATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVTDRKHVPRIGSGWLD  179

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+++  S  ++ SAR+QV+AE+ RLL++YKNEEVSIT TGHSLG  ++TL A DL  +
Sbjct  180   VYTASDAKSPYDTTSAREQVQAELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHS  239

Query  858   PFN-------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N       +  V IT F F  P++G++ FKK  S  K L  LR+VN  D+ P      
Sbjct  240   SQNKIHTGLQSKQVPITVFAFGCPRIGDQDFKKVVSSHKQLNILRIVNVPDVAPN-----  294

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PL  Y +VG    IN   S Y+K   LN   +H L IYLHGI G Q   G F+
Sbjct  295   ------YPLFMYAEVGEVLQINTLNSTYLKR-SLNWRNYHNLEIYLHGIAGMQDKTGVFR  347

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              +   D+  VNK    LK +K  VP+ W    N+GMVQ DDGTW LD H 
Sbjct  348   LEIGRDVSLVNKGLDALK-DKYLVPSVWRCLANRGMVQMDDGTWKLDVHR  396



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   315 bits (808),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 180/413 (44%), Positives = 243/413 (59%), Gaps = 27/413 (7%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +  A+RWR L+G  +W+GLLDP D DLRR +I YG M  A YD+F  E  S +AGLSR+A
Sbjct  9     DGTARRWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFA  68

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
              +   E   L   +   Y + ++ Y  +T+C A      ++S       +ESNW GYVAV
Sbjct  69    ARRFFERAQL-PGHSAAYRVARFVY--ATSCVAVPEPLILRSASRARRCRESNWIGYVAV  125

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPR-IIFAQDNGSLVHRGWYEMYT  1030
             ATD+GK  LGRRDI+V WRGT    EWI+D    MV P+ ++  + + ++VHRGW  MYT
Sbjct  126   ATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHRGWLSMYT  185

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S + +S  N +SARDQV +EV +L+ +Y++EE+SITVTGHSLG++LATLNA D+  N +N
Sbjct  186   SRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYN  245

Query  849   NTDVL--------ITAFLFASPKVGNEGFKKAFSHLK--NLRALRVVNNGDLVPMVPFLA  700
                          +TAF+FASP+VG  GFK+ F   +   LR LRV N  D+VP  P   
Sbjct  246   RAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP---  302

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK-GEF  523
                    P   Y  VG +  I+  +S Y++    N L+WH L  YLHG+ G +G + G F
Sbjct  303   -------PAPPYHGVGTELAIDTGESPYLRRPG-NELVWHNLECYLHGVAGARGGEAGRF  354

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             K     D+   NK  G L+ E   VP  WW+  N+GMV+  DG W L D E D
Sbjct  355   KLAVERDVALANKSYGALRDEHA-VPAGWWIPSNRGMVRGADGRWTLMDREED  406



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 181/409 (44%), Positives = 244/409 (60%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
              AKRWR L+G ++W+G L PLD DLR Y+IHYG    A YD+F     S++AG S Y++K
Sbjct  19    FAKRWRDLSGQNHWKGXLQPLDQDLREYIIHYGEXAQAGYDTFNINTESQFAGASIYSRK  78

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLE A+P+ KY +TK+ Y  S         + +  +  +   KESNW GYVAV 
Sbjct  79    DFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPE--SFLLFPISREGWSKESNWXGYVAVT  136

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
              D+G  +LGRRDI+V WRG+    EW+EDF   +V    IF + N  + +H+GWY +Y S
Sbjct  137   DDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYXS  196

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              ++ S     +ARDQV  EV RLL+ YK+EEVSIT+ GHSLG++LATL+A D+ AN +N 
Sbjct  197   QDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNR  256

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  +    +TAF+FASP+VG+  F+K FS L+++R LR  N  D++P           
Sbjct  257   PKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIP-----------  305

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQG  511
             I P I Y +VG +F I+  KS Y K    N+  +H L  YLHG+ G QG      F+   
Sbjct  306   IYPPIGYSEVGDEFPIDTRKSPYXKSPG-NLATFHCLEGYLHGVAGTQGTNKADLFRLDV  364

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                I  VNK    LK ++C VP +W V KNKG  QQDDG+W L DHE D
Sbjct  365   ERAIGLVNKSVDGLK-DECXVPGKWRVLKNKGXAQQDDGSWELVDHEID  412



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score =   315 bits (808),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 240/407 (59%), Gaps = 27/407 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+VL+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  S+YAG   Y
Sbjct  2     VEGIPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K  L   TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKNRLFARTGFLKANPFRYKVTKYIY--ATASIKLPISFIVKSLSKDASHVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F     +DN   +  GW 
Sbjct  120   VATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPR-IGSGWL  178

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
             ++YT+++  S  ++ SA++QV+ E+ RLL+LYK+EE+SIT TGHSLG+ ++ L+A DL  
Sbjct  179   DIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVY  238

Query  861   NPFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
                NN +       V IT F F SP++G+  FK     L+ L  LR+VN  D+ P     
Sbjct  239   GKKNNININLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAPH----  294

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                     PL+ Y ++G   +IN   S Y+K   LN   +H L IYLHG+ G Q   G F
Sbjct  295   -------YPLLLYSEIGEVLEINTLNSTYLKR-SLNFRNYHNLEIYLHGMAGMQDTDGVF  346

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             K +   DI  VNK    LK E   VP+ W    NKGM+Q DDGTW L
Sbjct  347   KLEIGRDISLVNKGLDALKDEYL-VPSTWRCLANKGMLQMDDGTWKL  392



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   314 bits (805),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 176/404 (44%), Positives = 241/404 (60%), Gaps = 20/404 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + +IA+RWR LNG   W+GLLDPLD DLR  +I+YG +  A Y     E  S+YAG   +
Sbjct  10    LGNIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLF  69

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             ++K  L    ++ +NP  Y ITK+ Y   T       G+ ++S    A  K+SNW G+VA
Sbjct  70    SRKDFLSR--VDVSNPNLYVITKFIYAMCTV--NLPDGFMIKSWSKAAWSKQSNWMGFVA  125

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEM  1036
             VATD+GKEVLGRRD++V WRGT    EW++D  I +V    I      +   VH GW  +
Sbjct  126   VATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSV  185

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS + +S  N  SAR QV  E+ RL D+Y++EE SIT+TGHSLG++LAT++A D+ +N 
Sbjct  186   YTSADPESQYNKQSARYQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSNG  245

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
             +N +   ++ F+F SP+VGN  F+KAF    +LR LR+ N+ D+VP  P L         
Sbjct  246   YNKS-CPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWPKL---------  295

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIP  496
                Y D G +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G FK +   DI 
Sbjct  296   --GYSDAGTELMIDTGESPYLKAPG-NPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIS  352

Query  495   QVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              VNK+   LK E   +P+ WWV +NKGMV+  DG W L DHE D
Sbjct  353   LVNKHEDALKNEYA-IPSSWWVVQNKGMVKGTDGRWHLADHEDD  395



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   314 bits (804),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 199/412 (48%), Positives = 254/412 (62%), Gaps = 37/412 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M ++A+ W  L+G +NWEGLL PLD DLR+Y+I YG +  A YD+FI+E  SKYAG SRY
Sbjct  1     MANMAENWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             + +SL  + GL+   P KY +TK+FY  +T        + V+S+  +A  KESN+ GY+A
Sbjct  61    SMESLFTKVGLD---PLKYRVTKFFY--ATASIPLPDAFIVKSLSREAWSKESNFMGYIA  115

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------SLVHRG  1048
             VATD+GK  LGRRDI+V WRGT  + EW+ D +   V    +F  D G       LVH G
Sbjct  116   VATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFG-DGGLLSLLQPLVHHG  174

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             +Y +YT+ +  S  N      QV  EV RL++ YKNEEVSITVTGHSLG+SLATLNAVD+
Sbjct  175   FYNIYTTEDPRSQFN------QVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDI  228

Query  867   AANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             A N  N T    +  +TAF+FASPKVG+  F KAFS L NL  LR+ N  D+VP      
Sbjct  229   AFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK-----  283

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK--GE  526
                    P I Y DVG +  I+ +KS YVK     V+ WH L  YLHG+ G QG      
Sbjct  284   ------YPPIGYIDVGEELMIDTTKSPYVKPPG-EVVSWHLLEPYLHGVAGTQGIGILAG  336

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FK +   DI  VNK   +LK E C +P  WW +K+KGMVQQ DG+W+L D E
Sbjct  337   FKLEVNRDISLVNKQWDILKDEYC-IPGLWWADKHKGMVQQQDGSWLLLDRE  387



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   315 bits (808),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 225/403 (56%), Gaps = 25/403 (6%)
 Frame = -2

Query  1548  WRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLE  1369
             W  L+G DNW+GLLDPLD DLRR +I YG +  A  D+FI +P S YAG SRYA  + L 
Sbjct  37    WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  1368  ETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDKGK  1189
                 +  +P  Y +T++ Y  +T+     G +  +     A   ESNW GYVAVATD G 
Sbjct  97    RA--QAPDPDAYNVTRFLY--ATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGV  152

Query  1188  EVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMYTSTNQ  1018
               LGRRDI+V WRGT+   EW  D  I +V    +     G     VHRG+  +Y S N 
Sbjct  153   ARLGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNS  212

Query  1017  DSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF-----  853
              S  N  SAR+QV AE+ RLLD YK E  SIT+TGHSLG++L+TL A+D+ AN       
Sbjct  213   TSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANGLNVRGP  272

Query  852   NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
             NN  V + A +F SP+VG++ FKKAF      R LRV N  D+VP          T+LP 
Sbjct  273   NNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVP----------TVLPN  322

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGEFKPQGCFDI  499
               YKDVGV+  ++  KS ++K        WH L  YLHG+ G QG      F  +   D+
Sbjct  323   AFYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDV  382

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
               VNK    L  +  PVP  WWVE NKGM +   G W+L DHE
Sbjct  383   ALVNKEVDALS-DDYPVPAAWWVEGNKGMTRDASGRWVLQDHE  424



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   315 bits (806),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 184/413 (45%), Positives = 234/413 (57%), Gaps = 34/413 (8%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             S+AKRWR+L GS  WEGL DPLDSDLR+ ++ YG    A YD+FIS+  SKYAG SRY  
Sbjct  5     SVAKRWRLLQGSQLWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGG  64

Query  1383  KSLLEETGLEK-ANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
                 ++ GL K    + Y+++K+ Y  ST        +   S+  +   +ESNW GYVA 
Sbjct  65    PHFFDDLGLTKRPTEWGYSLSKFIYATSTIKVPE--AFITTSLSREGGSRESNWMGYVAH  122

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG------------S  1063
              TD GK   GRRDI V WRGT    EW+ DF         +     G             
Sbjct  123   VTDTGKTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETDKVLRNDV  182

Query  1062  LVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKN-EEVSITVTGHSLGSSLAT  886
              V RGW+++YTS +  S  N +SAR+QV  EV RLL+ YK+ EE+SIT TGHSLG++LAT
Sbjct  183   RVQRGWFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLAT  242

Query  885   LNAVDLAANPFNNTD-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLV  721
             L A D+  N  N        + +TA +FASP+VGN+ FKK    L +LR LRV NN DLV
Sbjct  243   LCAFDIVINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLRVTNNPDLV  302

Query  720   PMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQ  541
             P+ PFL            Y +VGV+  ++  KS Y+K+   +   WH L  YLH + G Q
Sbjct  303   PLHPFL-----------GYVEVGVELRVDTVKSPYLKNPG-DASRWHNLEAYLHTVAGTQ  350

Query  540   GPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             G  G FK +   DI  VNK    LK E   VP  WWVEKNKGMVQ +DG W +
Sbjct  351   GKNGAFKLEVDRDIALVNKSTDWLKDEYL-VPVSWWVEKNKGMVQGNDGHWFM  402



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 180/407 (44%), Positives = 229/407 (56%), Gaps = 27/407 (7%)
 Frame = -2

Query  1554  KRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSL  1375
             + W  L+G DNW+GLLDPLD+DLRR +I YG +  A  D+FIS+P S +AG SRYA  + 
Sbjct  27    RPWAELSGRDNWDGLLDPLDADLRRVVIRYGELAQATSDAFISDPASPHAGASRYAPGAF  86

Query  1374  LEETGLEKANPFKYTITKYFYTPSTTCGAH-HGGYHVQSVRADAVMKESNWGGYVAVATD  1198
             L         P  Y +T++ Y    T GA    G  ++     A   ESNW GYVAVATD
Sbjct  87    LRRAQAGADVPDLYRVTRFLYA---TSGARVPDGIIMRPAPPGAWSLESNWMGYVAVATD  143

Query  1197  KGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMYTS  1027
              G   LGRRD++V WRGT+   EW  D  I +V    +     G     VHRG+  +Y S
Sbjct  144   AGAARLGRRDVVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYAS  203

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
             +N  S  N  SAR+QV AE+ RLLD YK E  SIT+TGHSLG++L+TL A+D+ +N  N 
Sbjct  204   SNSTSRFNKQSAREQVLAEIKRLLDAYKGENCSITITGHSLGAALSTLTAIDIVSNGVNV  263

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N  V + A +F SP+VG+E  KKAF      R LRV N  D+VP          TI
Sbjct  264   RGSTNDTVPVAAIVFGSPRVGDEQLKKAFDSTPGARLLRVRNAPDIVP----------TI  313

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF-  505
             LP   YKDVGV+  ++  KS ++K        WH L  YLHG+ G QG  G+    G   
Sbjct  314   LPAAFYKDVGVELLVDTRKSPHLKQPGPGPAAWHNLECYLHGVAGTQG-AGDGAGFGLVV  372

Query  504   --DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
               D+  VNK    L  ++ PVP  WWVE NKGMV+   G W+L DHE
Sbjct  373   DRDLALVNKEVDALD-DEYPVPAGWWVEGNKGMVKDGSGRWVLQDHE  418



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score =   313 bits (801),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 240/416 (58%), Gaps = 39/416 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  IAK W+VL+G +NW+GLLDP+D +LRRYLI+YG+   A  DSF     S    L RY
Sbjct  1     MADIAKNWKVLSGENNWKGLLDPIDDNLRRYLINYGAFTRAPADSFNDVKVSDGFALCRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMK----ESNWG  1222
               + L    GL+  NPFKY +T YFY  S                ADA  +     S + 
Sbjct  61    PPEVLFTRVGLQSGNPFKYLVTDYFYARS---------------EADAFREYLPATSTFV  105

Query  1221  GYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWY  1042
             G+VAV+TD+GK VLGRRDI+V WRGT    EW +D     V    IF  D+ +LVH G+Y
Sbjct  106   GFVAVSTDEGKLVLGRRDIIVCWRGTTLPIEWFQDILCDQVPATDIFP-DSEALVHNGFY  164

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLY----KNEEVSITVTGHSLGSSLATLNAV  874
              MYT+ +  S  N  S R+QV A V RL+D +     NE VSITV GHSLG++LATLNAV
Sbjct  165   NMYTAKDSTSTYNKMSVREQVLAAVRRLVDKHYEAGSNEVVSITVIGHSLGAALATLNAV  224

Query  873   DLAANPFN-----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVP  709
             D+ AN +N       ++ + +F+F SP+VG++GF   FS LKNL  LR+ N  D +P +P
Sbjct  225   DIVANEYNRPTGSTVELPVASFVFGSPRVGDKGFLDVFSGLKNLHLLRIRNAQDFIPELP  284

Query  708   FLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKG  529
                +         +Y DVG + DI+ S S Y+K  K   +  H L +Y HGI G+QG   
Sbjct  285   PKKILG------YSYADVGAELDIDTSLSPYIK--KATFMEPHDLNLYCHGISGYQGKDR  336

Query  528   EFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVE-KNKGMVQQDDGTWILDDHEAD  364
             +FK    FD+  VNKY  +L +E   VP +WW    NKGM Q DDG+W L D+  D
Sbjct  337   KFKLAVDFDLALVNKYNDLL-LEDYKVPPKWWSNVMNKGMAQMDDGSWKLHDYVPD  391



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   314 bits (804),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 229/412 (56%), Gaps = 28/412 (7%)
 Frame = -2

Query  1554  KRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSL  1375
             + W  L+G DNW+GLLDPLD+DLRR +I YG +  A  D+FI +P S YAG SRYA  + 
Sbjct  34    RSWAELSGRDNWDGLLDPLDADLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAF  93

Query  1374  LEETGLEK-ANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATD  1198
             L  T     ++P  Y +T++ Y  S+        +  +     A   ESNW GYVAVATD
Sbjct  94    LHRTQAPGGSDPDAYAVTRFLYATSSARVPVPDTFITRPAPPGAWSAESNWMGYVAVATD  153

Query  1197  KGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMYTS  1027
              G   LGRRDI+V WRGT+   EW +D  I +V    +     G     VHRG+  +Y S
Sbjct  154   AGAARLGRRDIVVAWRGTKRAVEWADDLDITLVPATGVVGPGPGWSQPAVHRGFLSVYAS  213

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
              N  S  N  SAR+QV +EV RLLD YK E  SIT+TGHSLG++LATL A+D+ AN  N 
Sbjct  214   RNSTSRFNKQSAREQVLSEVRRLLDAYKGENCSITLTGHSLGAALATLTAIDIVANGLNV  273

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKN----LRALRVVNNGDLVPMVPFLA  700
                   N  V + A +F SP+VG++ FKKAF          R LRV N  D+VP      
Sbjct  274   RGGSNSNDTVPVAAIVFGSPRVGDDQFKKAFESPSTPGGGARLLRVRNAPDIVP------  327

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGE  526
                 TILP   Y+DVGV+  ++  KS ++K        WH L  YLHG+ G QG      
Sbjct  328   ----TILPAAFYRDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDGAG  383

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             F+ +   D+  VNK    L  ++ PVP  WWVE NKGM +   G W+L DHE
Sbjct  384   FRLEVDRDVALVNKEVDALS-DEYPVPAAWWVEGNKGMTRDKSGRWVLQDHE  434



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/412 (42%), Positives = 245/412 (59%), Gaps = 38/412 (9%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +I +RW+ L+G  NW  LLDPLD DL++Y+IHYG+M  A YD+F S+P S+ AG + ++K
Sbjct  7     NIPQRWKSLSGDGNWRSLLDPLDVDLQQYIIHYGAMAQATYDNFNSDPVSRNAGCNIHSK  66

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              ++    GL+K NPFKY +TKY Y  +T+  A    +  +S+   A  KESNW GYVAVA
Sbjct  67    SNMFSSVGLDKGNPFKYRVTKYIY--ATSSIALPLSFLCKSLSEKAWSKESNWIGYVAVA  124

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRD++V WRGT    EW+ D   P+V    +F +   + VH+G+  +YTST
Sbjct  125   TDEGKVALGRRDVVVAWRGTIMPMEWVNDLEFPLVPASELFGESGVANVHQGFLSLYTST  184

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNT  844
             N+   ++  SARDQV +EV + +DL+++EE+SITV GHSLG SL+TLNA+D+  N  N  
Sbjct  185   NESVSVSRTSARDQVLSEVRKQVDLHQDEEISITVVGHSLGGSLSTLNAMDITYNGVNKP  244

Query  843   D-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTIL  679
                     + AF FA P+ G+  F+     L +L  LR+ N  D+VP +P          
Sbjct  245   SSREKGCPVAAFAFACPRSGDINFRSVMRSLHDLHILRISNATDIVPRIP----------  294

Query  678   PLIAYKDVGVQFDINASKSEYVK-------HDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
             P + Y DVGV+  ++++KS+++K       H  L V   H L I  +G +  +       
Sbjct  295   PFL-YVDVGVELTVDSTKSKFLKVFSDFSNHHNLEVAYLHPLAI-ANGDEDIRR------  346

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                  DI   NK    L+  K  + T WW ++N GMVQQ+DG+W L+DHE D
Sbjct  347   -----DIALANKNSDALR-SKYLIKTNWWCQQNHGMVQQEDGSWKLEDHEHD  392



>ref|XP_007208858.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
 gb|EMJ10057.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
Length=379

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 182/416 (44%), Positives = 238/416 (57%), Gaps = 54/416 (13%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M++IA+RWR+L+G   WEGLL PLD DLRRY+IHYG    A+ D+FI EP SK +GL RY
Sbjct  1     MDAIARRWRLLSGQTEWEGLLYPLDIDLRRYIIHYGERASAIADAFIDEPKSKNSGLPRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK++L  + GLE  +P+KY +  Y Y  +                   V  +S W GYVA
Sbjct  61    AKRNLFSKVGLESYSPYKYVVKTYLYAATKL-----------------VPGKSIWLGYVA  103

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS--LVHRGWYEM  1036
             V TD+GK VLGRRDIL+ WRGT+   E+  D    +V    I  +DN +   VH GW   
Sbjct  104   VTTDEGKRVLGRRDILISWRGTKLEKEFDIDRETTLVPASDILGKDNVNEPKVHSGWLNY  163

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YT           S R+Q  A V  LL  YK EE+SITVTGHS+G+++  LNA D+A N 
Sbjct  164   YT-----------SCRNQALAAVKELLKKYKGEEISITVTGHSMGAAIGILNATDIAYNG  212

Query  855   FNNTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             +N          L+TA +FA P +G+ GF K FS LKNL  LRV N  DL P+   L+ E
Sbjct  213   YNKLSDNPGKASLVTAIVFACPGLGDSGFNKVFSSLKNLHVLRVANTNDLAPI---LSAE  269

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVK-----HDKLNVL-MWHGLMIYLHGIDGFQGPK  532
                      Y  VG +   N+  S Y+K      D + ++ M+H L +YLHG+ G QG  
Sbjct  270   G-------KYVHVGKELRFNSLMSPYLKALSDYDDWIGIVEMFHDLEVYLHGVAGTQGEN  322

Query  531   GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             G FK +   DI  VNK    +K ++  +  +WW+EKNK MVQQDDG+W+L DHE D
Sbjct  323   G-FKLEVDRDIALVNKLLDAVK-DEYRIVVKWWIEKNKSMVQQDDGSWVLMDHEKD  376



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/405 (43%), Positives = 241/405 (60%), Gaps = 21/405 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + +IA+RWR LNG   W+GLLDPLD DLR  +I+YG +  A Y     E  S+YAG   +
Sbjct  10    LGNIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLF  69

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             ++K  L    ++ +NP  Y ITK+ Y   T       G+ ++S    A  K+SNW G+VA
Sbjct  70    SRKDFLSR--VDVSNPNLYVITKFIYAMCTV--NLPDGFMIKSWSKAAWSKQSNWMGFVA  125

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEM  1036
             VATD+GKEVLGRRD++V WRGT    EW++D  I +V    I      +   VH GW  +
Sbjct  126   VATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSV  185

Query  1035  YTSTNQDSHLNSNSAR-DQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             YTS + +S  N  SAR  QV  E+ RL D+Y++EE SIT+TGHSLG++LAT++A D+ +N
Sbjct  186   YTSADPESQYNKQSARYQQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSN  245

Query  858   PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTIL  679
              +N +   ++ F+F SP+VGN  F+KAF    +LR LR+ N+ D+VP  P L        
Sbjct  246   GYNKS-CPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWPKL--------  296

Query  678   PLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDI  499
                 Y D G +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G FK +   DI
Sbjct  297   ---GYSDAGTELMIDTGESPYLKAPG-NPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDI  352

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               VNK+   LK E   +P+ WWV +NKGMV+  DG W L DHE D
Sbjct  353   SLVNKHEDALKNEYA-IPSSWWVVQNKGMVKGTDGRWHLADHEDD  396



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/411 (43%), Positives = 246/411 (60%), Gaps = 31/411 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLD-PLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSR  1393
             M S+A  W+  +G+ NWEGLLD P+++D RRYLIHYG  +GA+ D+F     S    LSR
Sbjct  1     MASMADNWKDFSGAKNWEGLLDHPINTDFRRYLIHYGERVGAIGDAFNYVKASDSYALSR  60

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             Y  +       L+  NPFKY +TKYFY  S            + +  D  ++ S W GYV
Sbjct  61    YPPEEFFMNVNLQNGNPFKYQVTKYFYLKSDDIA--------EVLELD--LEGSAWVGYV  110

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AV TD+G+ VLGRRDILV WRGT   SEW +DF+  +     IF   N   VH G++ +Y
Sbjct  111   AVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVY  170

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLY--KNEEVSITVTGHSLGSSLATLNAVDLAAN  859
              + +  S  N  SAR+QV AEV RL+D+Y    EEVSITV GHSLG++LATLN VD+ AN
Sbjct  171   VAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGVDMVAN  230

Query  858   PFNN---TDV--LITAFLFASPKVGNEGFKKAFSHL-KNLRALRVVNNGDLVPMVPFLAV  697
              FN    +DV   +T F +ASP+VG++GF+  F+ L  +L  LR+ N+ D++P +P +  
Sbjct  231   GFNKPSGSDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRLPPVF-  289

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                    L+ Y+DVG + +I++ KS Y+K  K      H L +YLH I G+QG + EFK 
Sbjct  290   -------LLGYQDVGEKLEIDSIKSPYLKDPKAQP---HNLELYLHTIAGYQGQEEEFKL  339

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 DI  +NK   ++ ++K  +P  WW  KN GM+Q D+G W L+D+  D
Sbjct  340   VVDRDIALLNKSLDLV-LDKYNIPPTWWNVKNNGMIQIDNGFWKLNDYVPD  389



>ref|XP_008238422.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=390

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 181/408 (44%), Positives = 238/408 (58%), Gaps = 40/408 (10%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPT--SKYAGLS  1396
             M S A RWRVL+G D WEGLLDPLD DLRRY+IHYG   GA+   FI +PT  SK  GL 
Sbjct  1     MGSFAARWRVLSGEDEWEGLLDPLDIDLRRYIIHYGERAGAIGYGFIDKPTSISKNIGLP  60

Query  1395  RYAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGY  1216
             RYAK++L  + GLE  NP+KY + KY Y  +                      +S   G+
Sbjct  61    RYAKRNLFSKVGLETGNPYKYEVKKYLYAATRFAPG-----------------KSILLGF  103

Query  1215  VAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEM  1036
             VAV+TD+G +VLGRRDIL+ WRGT    E   D  I       I  +++   VH GW+  
Sbjct  104   VAVSTDEGSKVLGRRDILISWRGTMLDQEVEVDATILFFSASDILGKEHNPQVHLGWHGY  163

Query  1035  YTSTNQDS-HLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             YT+ + +S H  + S RDQV A V  L+D  K+EE+SITVTGHS+GS++A LNA D+  N
Sbjct  164   YTNLDSESAHNKTASCRDQVLAAVRELVDQNKDEEISITVTGHSMGSAIAVLNATDIVYN  223

Query  858   PFN-----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
              +N     N   L+TA +FA P VG++GFKK FS L+NLR LR+ N  D VP        
Sbjct  224   GYNKPTNSNNVSLVTAIVFACPNVGDQGFKKVFSSLENLRVLRITNEWDPVPK-------  276

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                 LP++ Y  VG +  I+  KS Y+K+   +V   H L +YLHG+ G QG   +FK +
Sbjct  277   ----LPILPYVPVGKELVIDTLKSPYLKNAIDSV---HQLEVYLHGVAGTQGRNNDFKLE  329

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                D+  VNK    L  +K  +  +WW+E+N  MVQ +DG+W L DHE
Sbjct  330   INRDLALVNKILDGLD-DKYHIIPKWWIERNNSMVQMEDGSWELMDHE  376



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score =   308 bits (790),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 232/413 (56%), Gaps = 51/413 (12%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +  A+RWR L+G  +W+GLLDP D DLRR +I YG M  A YD+F  E  S +AGLSR+A
Sbjct  9     DGTARRWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFA  68

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
              +   E   L                       H   Y V   R      ESNW GYVAV
Sbjct  69    ARRFFERAQLP---------------------GHSAAYRVARCR------ESNWIGYVAV  101

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPR-IIFAQDNGSLVHRGWYEMYT  1030
             ATD+GK  LGRRDI+V WRGT    EWI+D    MV P+ ++  + + ++VHRGW  MYT
Sbjct  102   ATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHRGWLSMYT  161

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S + +S  N +SARDQV +EV +L+ +Y++EE+SITVTGHSLG++LATLNA D+  N +N
Sbjct  162   SRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYN  221

Query  849   NTDVL--------ITAFLFASPKVGNEGFKKAFSHLK--NLRALRVVNNGDLVPMVPFLA  700
                          +TAF+FASP+VG  GFK+ F   +   LR LRV N  D+VP  P   
Sbjct  222   RAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP---  278

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK-GEF  523
                    P   Y  VG +  I+  +S Y++    N L+WH L  YLHG+ G +G + G F
Sbjct  279   -------PAPPYHGVGTELAIDTGESPYLRRPG-NELVWHNLECYLHGVAGARGGEAGRF  330

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             K     D+   NK  G L+ E   VP  WW+  N+GMV+  DG W L D E D
Sbjct  331   KLAVERDVALANKSYGALRDEHA-VPAGWWIPSNRGMVRGADGRWTLMDREED  382



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 183/415 (44%), Positives = 239/415 (58%), Gaps = 31/415 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAK W+ L+G +NW+GLL PLD DLRRY+IHYG M  + YD+F S   SKY G S Y+KK
Sbjct  25    IAKEWKELSGENNWDGLLSPLDMDLRRYVIHYGEMSQSTYDTFNSSKLSKYGGSSIYSKK  84

Query  1380  SLLEETGLEKAN--PFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
                 + GL K N  P+KY +TKY Y  +T+       + ++S   +A  KESN+ GYVAV
Sbjct  85    DFFSKVGLVKGNNDPYKYRVTKYLY--ATSGIDVPDAFILKSSSREAWSKESNFIGYVAV  142

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDN-------GSLVHRG  1048
             A D     LGRRDI++ WRG+    EW+ + +   V    +    +        + VH+G
Sbjct  143   AEDTAVASLGRRDIVIAWRGSIQSLEWVNNLQFLQVSASDVVGDGDVADHDKAKAKVHQG  202

Query  1047  WYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDL  868
             WY +YTS +  S  N  SARDQV  E+  L++ YKNEE+SIT+TGHS+G++LATLNAVDL
Sbjct  203   WYSIYTSDDPRSPFNKTSARDQVLLEIQSLMEQYKNEEISITITGHSMGAALATLNAVDL  262

Query  867   AANPFN------NTDVLITAFLFASPKVGNEGFKKAFSHLK-NLRALRVVNNGDLVPMVP  709
              AN  N          L+TA LFASP+VG+  FK   S    +L+ LRV N  D+V    
Sbjct  263   VANNINIPKSSPKNPCLVTAILFASPRVGDFNFKNIISKYDHSLKLLRVCNALDVVLH--  320

Query  708   FLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKG  529
                       P I Y  VG +  I+  +S Y+K    N   WH    YLHGI G QG + 
Sbjct  321   ---------YPPIGYCHVGKELSIDTIRSPYLKFPG-NFWTWHNSEAYLHGIAGGQGSEE  370

Query  528   EFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             EFK     D+  +NK+   LK E   +P  WW  +NKGMVQQ DG+W+L DHE D
Sbjct  371   EFKLVVDRDLSLLNKHWDNLKDEYL-IPAFWWTLRNKGMVQQSDGSWLLMDHEMD  424



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   320 bits (819),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/402 (45%), Positives = 242/402 (60%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA+RWR LNG++ W+GLLDPLD DLR+ +I+YG +  A Y     E  S+YAG   + +
Sbjct  412   NIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  471

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K  L    ++ +NP  Y ITK+ Y   T   +    + ++ +   A  K+SNW G+VAVA
Sbjct  472   KDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDDFMIKPLSKAAWSKQSNWMGFVAVA  527

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEMYT  1030
             TD+GKEVLGRRD++V WRGT    EW++D  I +V    I      +   VH GW  +YT
Sbjct  528   TDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAHDPRVHGGWLSVYT  587

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+  S  N  SAR QV  EV RL DLYK EE SIT+TGHSLG++LAT++A D+ +N +N
Sbjct  588   STDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYN  647

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
              T   ++AF+F SP+VGN  F+KAF   ++LR LRV N+ D+VP  P L           
Sbjct  648   KT-CPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPKL-----------  695

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y D G +  I+  +S Y+K    N L WH +  Y+HG+ G QG  G F+ +   DI  V
Sbjct  696   GYSDAGTELMIDTGESPYIKSPG-NPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALV  754

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK+   LK E   +P  WWV +NKGMV+  DG W L DHE D
Sbjct  755   NKHEDALKKEY-SIPPSWWVVQNKGMVKGKDGRWHLADHEDD  795



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   308 bits (788),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/401 (44%), Positives = 235/401 (59%), Gaps = 22/401 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +   A+RWR L+G   W G LDPLD DLRR ++ YG M  A YD+F +E  S +AGLSR+
Sbjct  7     LGDTARRWRELHGDGGWAGTLDPLDLDLRRTVLRYGEMAQATYDAFNNERASPHAGLSRF  66

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A+    +   L  A+   Y +T++ Y  S+   A    + ++SV      +ESNW GYVA
Sbjct  67    ARARFFDRVRL-PAHAAAYRVTRFLYATSSV--AVPDAFILRSVSRSRRCRESNWIGYVA  123

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK  LGRRD++V WRGT    EW +D   PMV P      D  ++VHRGW  MYT
Sbjct  124   VATDEGKAALGRRDVVVAWRGTMRALEWADDLEFPMV-PTGGLLGDGDAMVHRGWLSMYT  182

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S++  S  N +SAR Q   EV RL+D Y+ EE+SITVTGHSLG++LATLNA D+AAN +N
Sbjct  183   SSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDIAANGYN  242

Query  849   NTDV-----LITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
              T        +T+F FASP+VG  GFKK F  +  LR LRV N  D+VP           
Sbjct  243   VTATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPK----------  292

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
               P++ Y DVG +  I+  +S Y++        WH L +YLHG+ G +G +G F+     
Sbjct  293   -YPVVFYHDVGAELAIDTGESPYLRSPG-GEQTWHNLEVYLHGVAGTRGARGGFELAVAR  350

Query  504   DIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             D+  VNK    L+ +   VP  WWV  N+GMV+  DG W L
Sbjct  351   DVALVNKAYDALR-DHHGVPPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 243/409 (59%), Gaps = 25/409 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IAKRWKELSGTSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y  TK+ Y  S+        + ++S+  +A+ KESNW GYVAVAT
Sbjct  65    ELFARTGYLKANPFRYEATKFIYGTSSIRLPE--CFIIKSLSREALYKESNWLGYVAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHR---GWYEMYT  1030
             D+GK +LGRRDI+V WRGT    EW  DF  P+     +F Q N +   R   GW  +YT
Sbjct  123   DEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLETAETVFPQANPNDTPRIANGWLSLYT  182

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN---  859
             ST+Q S  +  SAR+QV+ E+ RLL+LYK+EEV+IT+TGHSLG+ L+ L+A D   N   
Sbjct  183   STDQRSRFDKTSAREQVQGELNRLLELYKDEEVTITITGHSLGAVLSILSAADFLYNESL  242

Query  858   ----PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
                    +    +T F F SP++G+  FK+    L++L  LRV N  DL+P         
Sbjct  243   KIRPSLQHRLSCVTVFAFGSPRIGDRSFKRLVESLEHLHILRVTNVPDLIPHY-------  295

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P+  + DVG    IN  KSEY+K   LN+  +H L  YLHG+ G Q  +GEFK + 
Sbjct  296   ----PVFRFTDVGEDLQINTLKSEYLKR-SLNLGHFHNLEAYLHGVAGTQHDQGEFKLEI  350

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               DI  VNK    L  +K  VP  WWV +NK MVQ DDGTW L+   A+
Sbjct  351   NRDIALVNKGLDALD-DKYLVPGHWWVLENKRMVQSDDGTWKLNGDRAN  398



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score =   306 bits (785),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/418 (44%), Positives = 242/418 (58%), Gaps = 64/418 (15%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIA++WR L+G   W+GLLDPL  DLR+YL+HYG +  + YD+F SE  SKYAG   Y
Sbjct  1     MGSIARKWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRA-DAVMKESNWGGYV  1213
             +KK L  +  LEK NPFKY+ITK+ Y  +T+  +    + ++S+ + DA   ESNW GYV
Sbjct  61    SKKDLFSKVNLEKGNPFKYSITKFIY--ATSKASDSESFLLRSILSKDAWSMESNWIGYV  118

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AVATD+GK  LGRRDI+V WRGT                      QDN           +
Sbjct  119   AVATDEGKVSLGRRDIVVAWRGT---------------------IQDNPG---------F  148

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
              S N       +SAR+QV +E+ RL++ YKNEE+SIT+TGHSLG++LA +N+VD+ AN F
Sbjct  149   QSAN-------SSARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDIVANKF  201

Query  852   N------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
             N           +T F FASP+VGN  F   FS+ K+L AL + N  D+VP+  FL    
Sbjct  202   NISKEQPQKSCPVTTFAFASPRVGNSSFGNIFSNYKDLNALLIRNQTDIVPISLFL----  257

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                     Y +VG +  I+  KS+Y+K      +  H L +YLHG+ G QG KG F  + 
Sbjct  258   -------GYSEVGEELLIDTKKSKYLKSG----VSSHNLEVYLHGVAGTQGSKGGFNLEV  306

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHVVFA*IKP  337
               DI  VNK    LK ++  VP  W V +NKGMVQQ DGTW L D   D V+   ++P
Sbjct  307   NRDIALVNKSNDGLK-DEYRVPNAWRVVENKGMVQQFDGTWKLMDDNEDVVLI--VRP  361



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 176/397 (44%), Positives = 233/397 (59%), Gaps = 22/397 (6%)
 Frame = -2

Query  1557  AKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKS  1378
             A+RWR L+G   W G+LDPLD DLRR ++ YG M  A YD+F  E  S +AGLSR+A+  
Sbjct  11    ARRWRELHGDGGWAGMLDPLDLDLRRTVLRYGEMAQATYDAFNRERASPHAGLSRFARAH  70

Query  1377  LLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATD  1198
               +   L  A+   Y +T++ Y  S+   A    + ++SV      +ESNW GYVAVATD
Sbjct  71    FFDRVRL-PAHAAAYRVTRFLYATSSV--AVPDAFILRSVSRSRRCRESNWIGYVAVATD  127

Query  1197  KGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTNQ  1018
             +GK  LGRRD++V WRGT    EW +D   PMV P      D  ++VHRGW  MYTS++ 
Sbjct  128   EGKAALGRRDVVVAWRGTMRALEWADDLEFPMV-PTGGLLGDGDAMVHRGWLSMYTSSDP  186

Query  1017  DSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN----  850
              S  N +SAR Q   EV RL+D Y+ EE+SITVTGHSLG++LATLNA D+AAN +N    
Sbjct  187   ASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDIAANGYNVAAT  246

Query  849   -NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
                   +T+F FASP+VG  GFKK F  +  LR LRV N  D+VP             P+
Sbjct  247   GAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPK-----------YPV  295

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQ  493
             + Y DVG +  I+  +S Y++        WH L +YLHG+ G +G +G F+     D+  
Sbjct  296   VFYHDVGAELAIDTGESPYLRSPG-GEQTWHNLEVYLHGVAGTRGARGGFELAVARDVAL  354

Query  492   VNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             VNK    L+ +   VP  WWV  N+GMV+  DG W L
Sbjct  355   VNKAYDALR-DHHGVPPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 232/411 (56%), Gaps = 28/411 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA RWR L G+D+W GLLDPLD DLR  LI YG +  A YD F  E  S +AG   +  
Sbjct  5     SIASRWRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGY  64

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHG--GYHVQSVRADAVMKESNWGGYVA  1210
              +LL  +G   A    Y +T++ Y  S   G         +  +  ++  +ESNW GYVA
Sbjct  65    SNLLAGSGAAAAG--SYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD G   LGRRDILV WRGT    EW+ DF    V    +     A +  +LVHRG+ 
Sbjct  123   VATDDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFALVHRGFL  182

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
              +YTS+N DS  N  SARDQV AEV RL+ LYK+E  SITV GHSLG+SLATLNAVDLAA
Sbjct  183   SVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDLAA  242

Query  861   NPFN-------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
             N  N            +TA +FASP+VG+  FK+A +   +LRAL V N GD+VP  P L
Sbjct  243   NGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIVPTYPPL  302

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                         Y DV VQ  I   +S Y++     +   H L  YLHG+ G QG  G F
Sbjct  303   -----------GYVDVAVQLPIATGRSPYLRQPG-TIATLHNLECYLHGVAGEQGSAGGF  350

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             + +   D+  VNK    LK ++ PVP +WWV KNK MV+  DG + L D E
Sbjct  351   RLEVDRDVALVNKGEDALK-DQYPVPAQWWVAKNKCMVKGADGHYALQDFE  400



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 173/411 (42%), Positives = 235/411 (57%), Gaps = 28/411 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A RWR L GSD+WEGLLDPLD+ LRR LI YG MI A Y++FI E  S  AG+ RY + 
Sbjct  24    MAGRWRELQGSDHWEGLLDPLDAGLRRCLIAYGEMITATYEAFIGERRSPNAGMCRYRRA  83

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              LL    ++ ++P  Y  T+Y Y  +T      G   +  +      +E NW GYVAVAT
Sbjct  84    DLLRR--VDVSHPGWYAATRYIY--ATASAEVRGEALLSPLCRHGRARECNWMGYVAVAT  139

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYEMY  1033
             D+G   LGRRDI+V WRGT+   EW+ D ++ +     I     A  +   VHRG+  +Y
Sbjct  140   DEGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGADGSDPSVHRGYLSLY  199

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS ++ S L+  SAR QV  E+ RL+D YK+EE SITV GHSLG++LATLNA D+ AN  
Sbjct  200   TSADEGSKLSKKSARMQVLTEIARLMDKYKDEETSITVVGHSLGATLATLNAADIVANAC  259

Query  852   NNTDVL-------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             N +          +TA +F SP+ G+  F+  F  L+ LR LRV N  D +P        
Sbjct  260   NKSSGFDDGRRAPVTAVVFGSPRTGDRAFRDVFHRLRGLRMLRVRNKPDRIPH-------  312

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                  P + Y DVGV+  I+  +S ++K    N    H L ++LHG+ G+QG  G F+  
Sbjct  313   ----YPPVGYADVGVELLIDTRRSPFLKPHG-NESQSHDLEVHLHGVAGWQGDGGGFELV  367

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
                D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L+DHE D+
Sbjct  368   VERDVALVNKFDDCL-ADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDY  417



>ref|XP_004301746.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 172/418 (41%), Positives = 239/418 (57%), Gaps = 46/418 (11%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M S A  W+ L+G + WEGLLDPLD +LRRY+IHYG   G++  + ++E  SK  GL RY
Sbjct  1     MASFATNWKDLSGENEWEGLLDPLDINLRRYIIHYGERSGSIA-TVVTEQKSKNYGLPRY  59

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK  L ++ GLE  NP+KY +  YFY                        K+SN+ G+VA
Sbjct  60    AKGHLFQKVGLENGNPYKYVVKNYFYAAHVELSP----------------KKSNFVGFVA  103

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+G ++LGRRD+L+ WRGT+ + EW+   +I +V    I  + N   VH GW   YT
Sbjct  104   VTTDEGTKLLGRRDVLISWRGTQLKHEWLVGIKINLVPAAHILGEQNDPKVHHGWLSYYT  163

Query  1029  STN-QDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
               +   SH    ++RDQ  A +  +L+ YK EE+SITVTGHS+G+++ATL A D+  N +
Sbjct  164   DIDPASSHNRLTNSRDQALAALKEVLNEYKGEEISITVTGHSMGAAMATLKATDIVRNGY  223

Query  852   N-------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             N       N  + +TAF+FA P+VGNEGF   FS L+NL  LRV N+ D+VP  P  A  
Sbjct  224   NILLEDQPNKVIPVTAFVFACPRVGNEGFGNVFSGLENLHVLRVTNDQDIVPKQPETA--  281

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVK-------HDKLNVLMWHGLMIYLHGIDGFQG-  538
                      Y  VG +   ++ KS ++K        +K+ +L  H L +YLHG+ G  G 
Sbjct  282   --------DYVHVGKELRFDSVKSPFMKVIPDVVIKEKVGIL--HDLEVYLHGVAGTHGI  331

Query  537   PKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                +FK +   D+  VNKY   +K ++  +  EWW EKNK M+Q  DG W+LDDHE D
Sbjct  332   NSSDFKLEVDRDLSLVNKYIDGVK-DEYNIVAEWWTEKNKSMIQTSDGFWVLDDHEKD  388



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 231/411 (56%), Gaps = 28/411 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA RWR L G+D+W GLLDPLD DLR  LI YG +  A YD F  E  S +AG   +  
Sbjct  5     SIASRWRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGY  64

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHG--GYHVQSVRADAVMKESNWGGYVA  1210
               LL  +G   A    Y +T++ Y  S   G         +  +  ++  +ESNW GYVA
Sbjct  65    SDLLAGSGAAAAG--SYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD G   LGRRDILV WRGT    EW+ DF    V    +     A +  +LVHRG+ 
Sbjct  123   VATDDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFALVHRGFL  182

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
              +YTS+N DS  N  SARDQV AEV RL+ LYK+E  SITV GHSLG+SLATLNAVDLAA
Sbjct  183   SVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDLAA  242

Query  861   NPFN-------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
             N  N            +TA +FASP+VG+  FK+A +   +LRAL V N GD+VP  P L
Sbjct  243   NGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIVPTYPPL  302

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                         Y DV VQ  I   +S Y++     +   H L  YLHG+ G QG  G F
Sbjct  303   -----------GYVDVAVQLPIATGRSPYLRQPG-TIATLHNLECYLHGVAGEQGSAGGF  350

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             + +   D+  VNK    LK ++ PVP +WWV KNK MV+  DG + L D E
Sbjct  351   RLEVDRDVALVNKGEDALK-DQYPVPAQWWVAKNKCMVKGADGHYALQDFE  400



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   321 bits (822),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 179/402 (45%), Positives = 244/402 (61%), Gaps = 20/402 (5%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IAKRWR LNG++ W+GLLDPLD DLR+ +I+YG +  A Y     E  S+YAG   + +
Sbjct  606   NIAKRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  665

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             +  L    ++ +NP  Y ITK+ Y   T   +   G+ ++S+   A  K+SNW G+VAVA
Sbjct  666   EDFLSR--VDVSNPNLYEITKFIYAMCTV--SLPDGFMIKSLSKAAWSKQSNWMGFVAVA  721

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF--AQDNGSLVHRGWYEMYT  1030
             TD+GKEVLGRRD++V WRGT    EW++D  I +V    I      +   VH GW  +YT
Sbjct  722   TDEGKEVLGRRDVVVAWRGTIRILEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYT  781

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+  S  N  SAR QV  E+ RL D+YK EE SIT+TGHSLG++LAT++A D+ +N +N
Sbjct  782   STDPGSRYNKQSARYQVLDEIKRLQDVYKQEETSITITGHSLGAALATISATDIVSNGYN  841

Query  849   NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLI  670
              +   ++AF+F SP+VGN  F+KAF    +LR LRV N+ D+VP  P L           
Sbjct  842   QS-CPVSAFVFGSPRVGNSDFQKAFDSADDLRLLRVENSPDVVPKWPKL-----------  889

Query  669   AYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQV  490
              Y + G +  I+  +S Y+K    N L WH +  Y+HGI G QG  G F+ +   DI  V
Sbjct  890   GYSEAGTELMIDTGESPYIKTPG-NPLTWHDMECYMHGIAGTQGSNGGFELEVDRDIALV  948

Query  489   NKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             NK+   LK E   +P+ WWV +NKGMV+  DG W L DHE D
Sbjct  949   NKHEDALKNEY-SIPSSWWVMQNKGMVKGKDGRWHLADHEDD  989



>ref|XP_008238420.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=379

 Score =   305 bits (780),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 177/416 (43%), Positives = 233/416 (56%), Gaps = 54/416 (13%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M++IA+RWR+L+G   WEGLL PLD DLRRY+IHYG    A+ D+FI EP SK +GL RY
Sbjct  1     MDAIARRWRLLSGETEWEGLLYPLDIDLRRYIIHYGERASAIADAFIDEPKSKNSGLPRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK++L  + GLE  +P+KY +  Y Y  +                   V  +S W GYVA
Sbjct  61    AKRNLFSKVGLESYSPYKYVVKTYLYAATKL-----------------VPGKSIWLGYVA  103

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD--NGSLVHRGWYEM  1036
             V TD+GK VLGRRDIL+ WRGT+   E+  D    +V    +  +D  N   VH GW   
Sbjct  104   VTTDEGKRVLGRRDILISWRGTKLEKEFDIDRETTLVPASDVLGKDNVNKPKVHSGWLNY  163

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YT           S R+Q    V  LL  YK EE+SITVTGHS+G+++  LNA D+  N 
Sbjct  164   YT-----------SCRNQALVAVKELLKKYKGEEISITVTGHSMGAAIGILNATDIVYNG  212

Query  855   FNNTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             +N          L+TA +FA P +G+ GF K F+ LKNL  LRV N  DL P++      
Sbjct  213   YNKLSDKPGKASLVTAIVFACPGLGDSGFNKVFASLKNLHVLRVANTNDLAPILS-----  267

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVK-----HDKLNVL-MWHGLMIYLHGIDGFQGPK  532
                  P   Y  VG +   N+  S Y+K      D + ++ M+H L +YLHG+ G QG  
Sbjct  268   -----PEGKYVHVGKELRFNSLMSPYLKALSDYDDWIGIVEMFHDLEVYLHGVAGTQGEN  322

Query  531   GEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             G FK     DI  VNK    +K ++  +  +WW+EKNK MVQQDDG+W+L DHE D
Sbjct  323   G-FKLAVDRDIALVNKLLDAVK-DEYRIVVKWWIEKNKSMVQQDDGSWVLMDHEKD  376



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/410 (42%), Positives = 236/410 (58%), Gaps = 30/410 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLL-DPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSR  1393
             M  IA  W+  +G +NW+GLL  P+++D RRYLIHYG  +GA+ D F +   S    LSR
Sbjct  1     MAGIADHWKAFSGFNNWDGLLVHPINTDFRRYLIHYGERVGAIGDGFNNVKASNSFALSR  60

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             Y  + L    GL+  NPFKY +TKYFY        +           +  +KES W GYV
Sbjct  61    YPPEELFSHVGLQNGNPFKYQVTKYFYLKQDDFADY----------MEFDIKESAWIGYV  110

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AV TD+G  VLGRRDILV WRGT   SEW ++ +  +V    I    +   +H G++ +Y
Sbjct  111   AVTTDEGNTVLGRRDILVCWRGTILASEWAKNLQFDLVSAAEILGGAHNPKMHHGFHSVY  170

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKN--EEVSITVTGHSLGSSLATLNAVDLAAN  859
              + +  S  N  SAR+QV AEV RL+D Y +  E+VSITV GHSLG++LATLNA+D+ +N
Sbjct  171   LAKSSSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAMDIVSN  230

Query  858   PFNN-----TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
              +N      T   +T F +ASP++G++GF+  F+ L NL  LR+ N  D++P +P     
Sbjct  231   GYNKPAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLANLHVLRIKNENDIIPSLPPAFYN  290

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                      YKD+G + +I++SKS Y+K         H L IYLH I G+QG  GEF+  
Sbjct  291   --------TYKDIGEELEIDSSKSPYLKDPNAEP---HNLDIYLHAIAGYQGKLGEFRLV  339

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                DI  VNK   +L  EK  VP  W    NKGM+Q D+G W L+D+  D
Sbjct  340   IDRDIALVNKSADVLP-EKYKVPPNWRTVMNKGMIQMDNGFWKLNDYVPD  388



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 183/411 (45%), Positives = 231/411 (56%), Gaps = 26/411 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + SIA RWR L G+ +W GLLDPLD DLR  LI YG +  A YD F  E  S + G   +
Sbjct  9     LGSIANRWRELQGAGSWAGLLDPLDIDLRANLIAYGELTQATYDGFNQEKRSPHCGACVF  68

Query  1389  AKKSLLEETGLEKANPFKYTITKYFY-TPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
                 LL  +G   A    Y++TK+ Y T +           +  +  ++  +ESNW GYV
Sbjct  69    GYSDLLASSGAAAAG--SYSVTKFIYATSALPVPEAFLVLPLPDLLPESWSRESNWMGYV  126

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS----LVHRGW  1045
             AVATD G   LGRRDILV WRGT    EW+ DF    V    +      +    LVHRG+
Sbjct  127   AVATDAGVAALGRRDILVAWRGTMRNLEWVNDFDFTPVSAAPVLGSAAAANPAALVHRGF  186

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
               +Y S+N DS  N +SARDQV  EV RL+ LYK+E  SITVTGHSLG+SLATLNAVDLA
Sbjct  187   LSVYRSSNPDSKYNQSSARDQVFEEVRRLMALYKDEVTSITVTGHSLGASLATLNAVDLA  246

Query  864   ANPFN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
             AN  N           +TAF++ASP+VG+  FK AF+   +LRAL V N GD+VP+ P L
Sbjct  247   ANGLNAPADSSQPPCPVTAFVYASPRVGDANFKNAFASFPDLRALHVKNAGDVVPLYPPL  306

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                         Y DV V   I+  +S Y++     +   H L  YLHG+ G QG  G F
Sbjct  307   -----------GYVDVAVPLPIDTGRSPYLRQPG-TIPTRHNLECYLHGVAGEQGSAGGF  354

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   D+   NK  G LK ++ PVP +WWV KNK MV+  DG W L D +
Sbjct  355   KLEVDRDVALANKEEGALK-DQYPVPADWWVAKNKFMVKGADGHWALQDFQ  404



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 169/406 (42%), Positives = 235/406 (58%), Gaps = 25/406 (6%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
              ++A+RWR L+G D+W+GLLDPLD+DLRR +I YG +  A  D+FI E  S +AG  RY+
Sbjct  7     RAVAERWRELHGEDHWKGLLDPLDADLRRSVIGYGELAQATNDAFIREAWSPHAGACRYS  66

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
             +   LE+          Y +T +FY  +   G     + V++       +ESNW GYVAV
Sbjct  67    RDRFLEKAQASTQLAGLYEVTAFFYA-TAGAGGVPAPFMVRN-------RESNWMGYVAV  118

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS---LVHRGWYEM  1036
             ATD G   LGRRD++V WRGT    EW+ D    +V    +      S    VHRGW  +
Sbjct  119   ATDAGVAALGRRDVVVAWRGTVRPMEWLNDLDFTLVSAAGVLGAGGRSPAPRVHRGWLSI  178

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YT+++  S  +  SAR+Q+  E+ RL+D YK+EE SITV GHSLG+++ATLNA D+ +N 
Sbjct  179   YTASDPASKYSKLSAREQISDEIKRLMDKYKDEETSITVVGHSLGAAVATLNAADIVSNG  238

Query  855   FNNTDVL-ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTIL  679
              N      +TA  FA P+VG+ GF+K F  L  LR LRV N+ D+VP             
Sbjct  239   LNQHGACPVTAVAFACPRVGDSGFRKLFDELPGLRLLRVCNSPDVVPK-----------Y  287

Query  678   PLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDI  499
             P + Y DVGV+  ++  +S Y+K    N  +WH L  Y+HG+ G QG +G FK +   D+
Sbjct  288   PPMGYADVGVELPVDTRRSPYLKSPG-NQAVWHSLECYMHGVAGAQGKRGGFKLEVDRDV  346

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
               VNK    LK E+  VP  W V+++KGMV+  DG W L D+E + 
Sbjct  347   ALVNKNVDALK-EEYHVPPSWSVQRDKGMVRGADGHWKLMDYEGEE  391



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score =   304 bits (779),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 243/414 (59%), Gaps = 37/414 (9%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA  W+ L+GS++W+GLL PL+ +LRRY+IHYG    A YDSF  E  SK  G  RYA +
Sbjct  6     IADNWKELSGSNHWDGLLKPLNINLRRYIIHYGETAQANYDSFNDETISKMYGFPRYAPE  65

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
                    L   NP+KYT+T Y Y  S T            +    +  +S W GYVAVAT
Sbjct  66    DFFYHVALHNGNPYKYTVTNYLYGRSDT-----------DLWDWVLPDQSAWIGYVAVAT  114

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ--DNGSLVHRGWYEMYTS  1027
             D+GK +LGRRDIL+ WRGT++ +EW +DF+ P+     +F    D   +VH G++ +Y  
Sbjct  115   DEGKTLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQ  174

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
             +N DS     SA+DQVR+ V  L+D Y +EE+SITV GHSLGS+LATLNA DLAAN +N 
Sbjct  175   SNPDSTYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAADLAANGYNK  234

Query  846   -------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                    +  ++T  +FASP+VG+  FK AF   K LR LRV N  D+VP VP       
Sbjct  235   PTGSDTASGCMVTTIVFASPRVGDSAFKTAFEDQKLLRLLRVTNKNDIVPNVP-------  287

Query  687   TILPLIA-YKDVGVQFDINASKSEYVKH--DKLNV-LMWHGLMIYLHGIDGF-QG-PKGE  526
                P+ + Y DVG +  ++A+KS YVK     L++  + H L  YLHGI G  QG    +
Sbjct  288   ---PVFSGYVDVGRELKVDATKSTYVKTVIPPLSLPSVLHNLENYLHGIAGTSQGDDDDD  344

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             F+     DI  +NK   +LK E   VP  WW  KNKGMVQ D+G W L+D+  D
Sbjct  345   FELAIDRDIALLNKGLDLLKDEYG-VPPNWWTVKNKGMVQLDNGFWKLEDYVPD  397



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score =   305 bits (780),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 242/407 (59%), Gaps = 28/407 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+ L+G   W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IAKRWKQLSGDSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TKY Y  S+        + + S+  +A  K+SNW GY AVAT
Sbjct  65    ELFARTGYLKANPFRYEVTKYIYGTSSIRLPE--CFLINSLSREAWNKDSNWLGYTAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ------DNGSLVHRGWYE  1039
             D+GKE+LGRRDI+V WRGT    EW  DF  P+     +F        ++   +  GW  
Sbjct  123   DEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPSTDPNDPNDPPRIANGWLS  182

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT++N  S  +  SA++QV+ E+ RLL+LYK+EEVSIT TGHSLG+ L+ L+A D   N
Sbjct  183   LYTTSNTHSRFDKTSAQEQVQGELKRLLELYKHEEVSITFTGHSLGAVLSILSATDFLHN  242

Query  858   PFNNTDV-------LITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
              +  T          +T F F SP++G+  F++    LK L  LR+ N  DL+P      
Sbjct  243   EWPKTTTSLGDRLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPDLIPHY----  298

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    P+  ++DVG + +IN  KSEY+K   LN+  +H L  YLHG+ G Q  + EFK
Sbjct  299   -------PVFRFRDVGEELEINTLKSEYLKR-SLNLAHFHNLEAYLHGVAGTQHNQAEFK  350

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
              +   DI  VNK    L+ +K  VP+ WWV +N+GMVQ DDGTWIL+
Sbjct  351   LEINRDIALVNKELDALQ-DKYLVPSHWWVVENRGMVQADDGTWILN  396



>ref|XP_011005461.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   304 bits (779),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 180/411 (44%), Positives = 246/411 (60%), Gaps = 31/411 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLD-PLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSR  1393
             M SIA  W+  +G+ NWEGLLD P+++D RRYLIHYG  + A+ D+F     S    LSR
Sbjct  1     MASIADNWKDFSGAQNWEGLLDHPINTDFRRYLIHYGERVEAIGDAFNYVKASDSYALSR  60

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             Y  + L     L+  NPFKY +TKYFY  S            + +  D  ++ S W GYV
Sbjct  61    YPPEELFMNVNLQNGNPFKYQVTKYFYLKSDDIA--------EVLELD--LEGSAWIGYV  110

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AV TD+G+ VLGRRDILV WRGT   SEW +DF+  +     IF   N   VH G++ +Y
Sbjct  111   AVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVY  170

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLY--KNEEVSITVTGHSLGSSLATLNAVDLAAN  859
              + +  S  N  SAR+QV AEV RL+D+Y    EEVSITV GHSLG++LATLN VD+ AN
Sbjct  171   VAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGVDMVAN  230

Query  858   PFNN---TDV--LITAFLFASPKVGNEGFKKAFSHL-KNLRALRVVNNGDLVPMVPFLAV  697
              FN    +DV   +T F +ASP+VG++GF+  F+ L  +L  LR+ N+ D++P +P +  
Sbjct  231   GFNKPSGSDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRLPPVF-  289

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                    L+ Y+DVG + +I++ KS Y+K  K      H L +YLH I G+QG + EFK 
Sbjct  290   -------LLGYQDVGEKLEIDSIKSPYLKDPKAQP---HNLELYLHTIAGYQGQEEEFKL  339

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 DI  +NK    L ++K  +P +WW  KN GM+Q D+G W L+D+  D
Sbjct  340   VVDRDIALLNK-SLDLLLDKYNIPPKWWNVKNNGMIQIDNGFWKLNDYVPD  389



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 234/409 (57%), Gaps = 27/409 (7%)
 Frame = -2

Query  1557  AKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKS  1378
             A RWR L+GS++WEGLLDPLD +LRR LI YG MI A Y++FI E  S  AG+ RY +  
Sbjct  8     AGRWRELHGSNHWEGLLDPLDVNLRRCLITYGEMIMATYEAFIGESRSPNAGMCRYRRAD  67

Query  1377  LLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATD  1198
             L     + +  P  Y  T+Y Y  +T      G   ++ +      +E NW GYVAVATD
Sbjct  68    LFRRVDVSR--PGWYEATRYLY--ATASAEVRGKVLLRPLCRQGRARECNWMGYVAVATD  123

Query  1197  KGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS----LVHRGWYEMYT  1030
             +G   LGRRDI+V WRGT+   EW+ D ++ +     I   +        VHRG+  +YT
Sbjct  124   QGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGAGGSDPSVHRGYLSLYT  183

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S ++ S+L+  SAR QV  E+ RL+D YK+EE SITV GHSLG+++ATLNA D+ AN +N
Sbjct  184   SADEGSNLSKQSARMQVLTEIARLMDKYKDEETSITVVGHSLGATMATLNAADIVANAYN  243

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              T         +TA +F SP+ G+  F+  F  L +LR LR+ N  D +P          
Sbjct  244   KTPGYDSRRAPVTAIVFGSPRTGDRDFRDVFHRLPDLRMLRIRNRPDRIPH---------  294

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                P + Y DVGV+  I+  +S ++K    N    H L ++LHG+ G+QG  G F+    
Sbjct  295   --YPPVGYADVGVELLIDTRRSPFLKPHG-NESQSHDLEVHLHGVAGWQGDHGGFELVVD  351

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
              D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L+DHE D+
Sbjct  352   RDVALVNKFDDCL-ADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDY  399



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   302 bits (774),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 232/409 (57%), Gaps = 29/409 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A RWR L+GS +W+GLLDPLD DLRR LI YG MI A Y++FI E  S  AG+ RY + 
Sbjct  1     MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRA  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L     ++ ++P  Y  T+Y Y  +T     HG   ++ +  +    E NW GYVAVAT
Sbjct  61    DLFRR--VDVSHPGWYAATRYIY--ATANADVHGKVLLRPLCREGRATECNWMGYVAVAT  116

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYEMY  1033
             D+G   LGRRDI+V WRGT+   EW+ D ++       I     A      VHRG+  +Y
Sbjct  117   DEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLY  176

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +Q S LN  SAR QV  E+ RL+D YK+EE SITV GHSLG++LATLNA D+AAN +
Sbjct  177   TSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSY  236

Query  852   NN--------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
             N         T   +TA +F SP+ G+ GF+ AF  L++LR LRV N  D +P       
Sbjct  237   NTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPH------  290

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                   P + Y DVGV+  I+   S +++    +    H L  +LHG+ G+ G    F+ 
Sbjct  291   -----YPPVGYADVGVELLIDTRLSPFLRRHG-SESQSHDLECHLHGVAGWHGDHRGFEL  344

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                 D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L DHE
Sbjct  345   VVDRDVALVNKFDDCL-ADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  392



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score =   302 bits (774),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/405 (42%), Positives = 243/405 (60%), Gaps = 22/405 (5%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + ++AKRWR L+G   W  LL+PLD+D++ YL+HYG M    YD+F  +  S+YAG SRY
Sbjct  2     IRNVAKRWRELSGQHGWRNLLNPLDADMQTYLLHYGGMAQVTYDTFNKQQMSRYAGSSRY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A+ +L   TG  K +P++Y   KY Y  ++  G    G+ V+S+  +  M ESNW GYVA
Sbjct  62    ARNNLFHATGSAKGSPYRYDAVKYIYATASIGGLPQ-GFMVKSMADNPWMDESNWMGYVA  120

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD--NGSLVHRGWYEM  1036
             V+T++G + LGRRDILV WRGT    EW++D    ++    I      +G+ +H+G++ +
Sbjct  121   VSTNEGSKALGRRDILVAWRGTVLPVEWMKDADAQLIPATDIMGGGGASGAKLHQGFHSI  180

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YT+ +  S  N  SARDQV +EV + LD +K E+VSIT+TGHSLG +LAT+NA D+A N 
Sbjct  181   YTAKSASSSFNKTSARDQVLSEVKKQLDKHKGEDVSITITGHSLGGALATINATDIAYNG  240

Query  855   FNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILP  676
              N +   +TA  FA+P+VG+  +K+     K+ R L V N  D+VP VP  A        
Sbjct  241   LNKSRP-VTAITFAAPQVGDRRYKEVLDSTKDCRVLSVRNVPDIVPRVPGAAA-------  292

Query  675   LIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGL-MIYLHGIDGFQGPKGEFKPQGCFDI  499
                YK+VGV++ IN++++   +    + L  H L   YLH I   +  K +       DI
Sbjct  293   --GYKNVGVEYKINSTRAPDTRAPG-DPLTGHLLESAYLHTIATARPGKNK------RDI  343

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
               VNK   MLK E   VP  WW EKN G VQ++DG+W +DDH+ D
Sbjct  344   NLVNKDSDMLKPE-FKVPGFWWGEKNGGFVQRNDGSWAMDDHQMD  387



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 182/414 (44%), Positives = 242/414 (58%), Gaps = 37/414 (9%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA  W+ L+GS++W+GLL PL+ +LRRY+IHYG    A YDSF  E  SK  G  RYA +
Sbjct  6     IADNWKELSGSNHWDGLLKPLNINLRRYIIHYGETAQANYDSFNDETISKMYGFPRYAPE  65

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
                    L   NP+KYT+T Y Y  S T            +    +  +S W GYVAVAT
Sbjct  66    DFFYHVALHNGNPYKYTVTNYLYGRSDT-----------DLWDWVLPDQSAWIGYVAVAT  114

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ--DNGSLVHRGWYEMYTS  1027
             D+GK +LGRRDIL+ WRGT++ +EW +DF+ P+     +F    D   +VH G++ +Y  
Sbjct  115   DEGKTLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQ  174

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
             +N DS     SA+DQVR+ V  L+D Y +EE+SITV GHSLGS+LATLNA DLAAN +N 
Sbjct  175   SNPDSTYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAADLAANGYNK  234

Query  846   -------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                    +  ++T  +FASP+VG+  FK AF   K LR LR+ N  D+VP VP       
Sbjct  235   PTGSDTASGCMVTTIVFASPRVGDSAFKTAFEDQKLLRLLRITNKNDIVPNVP-------  287

Query  687   TILPLIA-YKDVGVQFDINASKSEYVKH--DKLNV-LMWHGLMIYLHGIDGF-QG-PKGE  526
                P+ + Y DVG +  ++ +KS YVK     L++  + H L  YLHGI G  QG    +
Sbjct  288   ---PVFSGYVDVGRELKVDTTKSTYVKTVIPPLSLPSVLHNLENYLHGIAGTSQGDDDDD  344

Query  525   FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             F+     DI  +NK   +LK E   VP  WW  KNKGMVQ D+G W L+D+  D
Sbjct  345   FELAIDRDIALLNKGLDLLKDEYG-VPPNWWTVKNKGMVQLDNGFWKLEDYVPD  397



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score =   303 bits (775),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 244/407 (60%), Gaps = 28/407 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TKY Y  S+        + + S+  +A  KESNW GY+AVAT
Sbjct  65    ELFARTGYLKANPFRYEVTKYIYGTSSIRLPE--CFIINSLSREAWNKESNWLGYIAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS------LVHRGWYE  1039
             D+GKE+LGRRDI+V WRGT    EW  DF  P+     +F + + +       +  GW  
Sbjct  123   DQGKELLGRRDIVVAWRGTIQLYEWANDFDFPLEPAISVFPKTDPNDPSDPPRIANGWLS  182

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+ +  S  +  SA++QV+ E+ RLL+LYK+EEV+IT+TGHSLG+ L+ L+A D   N
Sbjct  183   LYTTADPRSRFDKTSAQEQVQGELKRLLELYKDEEVTITLTGHSLGAVLSILSATDFLHN  242

Query  858   PFNNTDV-------LITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
              +  T          +T F F SP++G+  FK+    LK L  LR+ N  DL+P      
Sbjct  243   EWPKTTTSLQDRLSCVTVFAFGSPRIGDLNFKRLVESLKKLNILRISNVPDLIPRY----  298

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    P+  + D+G +  IN  KSEY+K   LN+  +H L  YLHG+ G Q  +GEFK
Sbjct  299   -------PVFRFADIGEELQINTLKSEYLKR-SLNIKHFHNLEAYLHGVAGTQQNQGEFK  350

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
              +   DI  VNK    L+ +K  VP  WWV +NKGMVQ+DDGTW+L+
Sbjct  351   LEINRDIALVNKGLDALE-DKYLVPDHWWVLENKGMVQRDDGTWMLN  396



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score =   302 bits (773),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 173/410 (42%), Positives = 236/410 (58%), Gaps = 30/410 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLL-DPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSR  1393
             M  IA  W+  +G +NW+GLL  P+++D RRYLIHYG  +GA+ D F +   S    LSR
Sbjct  1     MAGIADHWKAFSGFNNWDGLLIHPINTDFRRYLIHYGERVGAIGDGFNNVKASNSFALSR  60

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             Y  + L    GL+  NPFKY +TKYFY        +           +  +KES W GYV
Sbjct  61    YPPEELFSHVGLQNGNPFKYQVTKYFYLKLDDFADY----------MEFDIKESAWIGYV  110

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AV TD+G  VLGRRDILV WRGT   SEW ++ +  +V    I    +   +H G++ +Y
Sbjct  111   AVTTDEGNTVLGRRDILVCWRGTILGSEWAKNLQFDLVSAAEILGGAHNPKMHHGFHSVY  170

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKN--EEVSITVTGHSLGSSLATLNAVDLAAN  859
              + +  S  N  SAR+QV AEV RL+D Y +  E+VSITV GHSLG++LATLNA+D+ +N
Sbjct  171   LAKSSSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAMDIVSN  230

Query  858   PFNN-----TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
              +N      T   +T F +ASP++G++GF+  F+ L NL  LR+ N  D++P +P     
Sbjct  231   GYNKPAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLANLHVLRIKNEKDIIPNLPPAFYN  290

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                      YKD+G + +I++SKS Y+K         H L IYLH I G+QG  GEF+  
Sbjct  291   --------TYKDIGEELEIDSSKSPYLKDPNAEP---HNLDIYLHTIAGYQGKLGEFRLV  339

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                DI  VNK   +L  EK  VP  W    NKGM+Q D+G W L+D+  D
Sbjct  340   IDRDIALVNKSADVLP-EKYKVPPNWRTVMNKGMIQLDNGFWKLNDYVPD  388



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   302 bits (773),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 179/404 (44%), Positives = 241/404 (60%), Gaps = 25/404 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA RW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IANRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TK+ Y  S+        + ++S+  +A  KESNW GY+AVAT
Sbjct  65    ELFARTGYLKANPFRYEVTKFIYGTSSIRLPE--CFIIKSLSREAWNKESNWLGYIAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ---DNGSLVHRGWYEMYT  1030
             D+GK +LGRRDI+V WRGT    EW  DF  P+     +F +   ++   V  GW  +YT
Sbjct  123   DEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYT  182

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN---  859
             ST+  S  +  SAR+QV+ E+ RLL+LYK+EEV+IT+TGHSLG+ L+ L+A D   N   
Sbjct  183   STDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLHNELP  242

Query  858   ----PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
                    +    +T F F SP++G+  FK+     ++L  LRV N  DL+P         
Sbjct  243   KITPSLQHRLTCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIPR--------  294

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P+  + DVG +  IN  KSEY+K   LN+  +H L  YLHG+ G Q  +GEFK + 
Sbjct  295   ---YPVFRFTDVGEELQINTLKSEYLKRS-LNLGHFHNLEAYLHGVAGTQHNQGEFKLEI  350

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
               DI  VNK    L+ +K  VP  WWV +NKGMVQ DDGTW L+
Sbjct  351   KRDIALVNKGLDALE-DKYLVPGHWWVLENKGMVQSDDGTWKLN  393



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   301 bits (772),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 231/409 (56%), Gaps = 29/409 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A RWR L+GS +W+GLLDPLD DLRR LI YG MI A Y++FI E  S  AG+ RY   
Sbjct  6     MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHA  65

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L     ++ ++P  Y  T+Y Y  +T     HG   ++ +  +    E NW GYVAVAT
Sbjct  66    DLFRR--VDVSHPGWYAATRYIY--ATANADVHGKVLLRPLCREGRATECNWMGYVAVAT  121

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYEMY  1033
             D+G   LGRRDI+V WRGT+   EW+ D ++       I     A      VHRG+  +Y
Sbjct  122   DEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLY  181

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +Q S LN  SAR QV  E+ RL+D YK+EE SITV GHSLG++LATLNA D+AAN +
Sbjct  182   TSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSY  241

Query  852   NN--------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
             N         T   +TA +F SP+ G+ GF+ AF  L++LR LRV N  D +P       
Sbjct  242   NTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPH------  295

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                   P + Y DVGV+  I+   S +++    +    H L  +LHG+ G+ G    F+ 
Sbjct  296   -----YPPVGYADVGVELLIDTRLSPFLRRHG-SESQSHDLECHLHGVAGWHGDHRGFEL  349

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                 D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L DHE
Sbjct  350   VVDRDVALVNKFDDCL-ADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  397



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/414 (41%), Positives = 240/414 (58%), Gaps = 31/414 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A +W+ L GS++WEGLLDPLD  LRR L+ YG MI A Y++FI E  S  AG+ RY + 
Sbjct  7     MAAQWKELQGSNHWEGLLDPLDVGLRRCLVTYGEMIMATYEAFIGESRSPNAGMCRYRRA  66

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L +   ++ ++P  Y  T+Y Y  +T      G   ++ +  +   +E NW GYVAVAT
Sbjct  67    DLFQR--VDVSHPGWYEATRYLY--ATASAEVRGKVLLRPLCRERCARECNWMGYVAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL--------VHRGW  1045
             D+G   LGRRDI+V WRGT+   EW+ D ++ +     I   + G          VHRG+
Sbjct  123   DEGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGGGGGSGGSDPSVHRGY  182

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
               +YTS  + S+L+  SAR QV  E+ RL+D YK EE SITV GHSLG+++ATLNAVD+A
Sbjct  183   LSLYTSDYEGSNLSKQSARMQVLTEIVRLMDKYKGEETSITVVGHSLGATMATLNAVDIA  242

Query  864   ANPFN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
             AN +N      +    +TA +F SP+ G++ F+  F    +LR LRV N  D +P     
Sbjct  243   ANAYNKIPGYDSRRAPVTAIVFGSPRTGDQDFRDVFHRTPDLRMLRVRNRPDRIPH----  298

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                     P + Y DVGV+  I+  +S ++KH   +    H L ++LHGI G+QG +G F
Sbjct  299   -------YPPVGYADVGVELLIDTRRSPFLKHHG-SESQSHDLEVHLHGIAGWQGDRGGF  350

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             +     D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L+DH+ D+
Sbjct  351   ELVVDRDVALVNKFDDCL-ADEYPVPVRWKVHHNKSMVKGGDGRWVLEDHDPDY  403



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/404 (44%), Positives = 241/404 (60%), Gaps = 25/404 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA RW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  14    IANRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  73

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TK+ Y  S+        + ++S+  +A  KESNW GY+AVAT
Sbjct  74    ELFARTGYLKANPFRYEVTKFIYGTSSIRLPE--CFIIKSLSREAWNKESNWLGYIAVAT  131

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ---DNGSLVHRGWYEMYT  1030
             D+GK +LGRRDI+V WRGT    EW  DF  P+     +F +   ++   V  GW  +YT
Sbjct  132   DEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYT  191

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN---  859
             ST+  S  +  SAR+QV+ E+ RLL+LYK+EEV+IT+TGHSLG+ L+ L+A D   N   
Sbjct  192   STDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLHNELP  251

Query  858   ----PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
                    +    +T F   SP++G+  FK+    L++L  LRV N  DL+P         
Sbjct  252   KIRPSLQHRLTCVTVFALGSPRIGDRSFKRLVESLQHLHILRVTNVPDLIPRY-------  304

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P+  + DVG +  IN  KSEY+K   LN+  +H L  YLHG+ G Q  +GEFK + 
Sbjct  305   ----PVFRFTDVGEELQINTLKSEYLKRS-LNLGHFHNLEAYLHGVAGTQHNQGEFKLEI  359

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
               DI  VNK    L+ +K  VP  WWV +NKGMVQ DDGTW L+
Sbjct  360   KRDIALVNKGLDALE-DKYLVPGHWWVLENKGMVQSDDGTWKLN  402



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 180/404 (45%), Positives = 241/404 (60%), Gaps = 25/404 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IAKRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TK+ Y  S+        + ++S+  +A  KESNW GY+AVAT
Sbjct  65    ELFARTGYLKANPFRYEVTKFIYGTSSIRLPE--CFIIKSLSREAWNKESNWLGYIAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ---DNGSLVHRGWYEMYT  1030
             D+GK +LGRRDI+V WRGT    EW  DF  P+     +F +   ++   V  GW  +YT
Sbjct  123   DEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYT  182

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+  S  +  SAR+QV+ E+ RLL+LYK+EEV+IT+TGHSLG+ L+ L+A D   N F 
Sbjct  183   STDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLHNEFP  242

Query  849   NTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
                         +T F F SP++G+  FK+     ++L  LRV N  DL+P         
Sbjct  243   KITPSLQQRLSCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIPR--------  294

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P+  + DVG +  IN  KSEY+K   LN+  +H L  YLHG+ G Q  +GEFK + 
Sbjct  295   ---YPVFRFTDVGEELQINTLKSEYLKRS-LNLGHFHNLEAYLHGVAGTQHNQGEFKLEI  350

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
               DI  VNK    L+ +K  VP   WV +NKGMVQ DDGTW L+
Sbjct  351   KRDIALVNKGLDALE-DKYLVPGHGWVLENKGMVQSDDGTWKLN  393



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 178/411 (43%), Positives = 241/411 (59%), Gaps = 35/411 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLD-PLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSR  1393
             M SIA  W+  +G+ NWEGLLD P+++D RRYLIHYG  +GA+ D+F     S    LSR
Sbjct  16    MASIADNWKDFSGAKNWEGLLDHPINTDFRRYLIHYGERVGAIGDAFNYVKASDSYALSR  75

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             +  + L     L+  NPFKY +TKYFY  S            + +  D  ++ S W GYV
Sbjct  76    HPPEELFMNVNLQNGNPFKYQVTKYFYLKSEDIA--------EVLELD--LEGSAWIGYV  125

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMY  1033
             AV TD+G+ VLGRRDILV WRGT   +EW++DF   ++    IF   N   VH G++ +Y
Sbjct  126   AVTTDEGQRVLGRRDILVCWRGTILPAEWLKDFLFVLIPASDIFGATNNPKVHSGFHNVY  185

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLY--KNEEVSITVTGHSLGSSLATLNAVDLAAN  859
              + +  S  N  SAR+QV AEV RL+D Y    EEVSITV GHSLG++LATLNA+D+ AN
Sbjct  186   VAKSSKSKYNKTSAREQVLAEVRRLVDRYALNGEEVSITVAGHSLGAALATLNAMDIVAN  245

Query  858   PFNN---TDV--LITAFLFASPKVGNEGFKKAFSHLKN-LRALRVVNNGDLVPMVPFLAV  697
              +N    +D+   +T F +A P+VG++GF+  F+ L N L  LR+ N+ D VP  P L  
Sbjct  246   GYNKPSGSDIGFPVTVFAYACPRVGDQGFQDVFNGLTNDLHVLRIKNSKDPVPRHPVL--  303

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                       Y+DVG + +I++ KS Y K    +    H L +YLH I G+QG + EFK 
Sbjct  304   ---------LYQDVGKELEIDSIKSPYPK----DPTKPHDLELYLHTIAGYQGKEEEFKL  350

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                 DI  +NK G  L  +K  +P  WW  KN GM+Q D+G W L+D+  D
Sbjct  351   VVDRDIALLNK-GLDLLPDKYKIPPNWWNVKNNGMIQTDNGFWKLNDYVPD  400



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/406 (44%), Positives = 230/406 (57%), Gaps = 25/406 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             ++A RWR L+G ++W+GLLDPLD  LR  +I YG M+ A YD F +E  S + G   Y  
Sbjct  39    TVASRWRELHGENSWKGLLDPLDLHLRATIISYGEMVQATYDGFNTERRSPHCGACFYGH  98

Query  1383  KSLLEETGL-EKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
               LL   G+   AN   Y +TK+ Y  S+                D   +ESNW GYVAV
Sbjct  99    DDLLAGVGVPHHAN--NYQVTKFVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAV  156

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYE  1039
             ATD+G   LGRRDI+V WRGT    EW+ D     V    +     +Q+  ++VHRG+  
Sbjct  157   ATDEGAAALGRRDIVVAWRGTIKNLEWVNDLDFTPVPAAPVLGSAASQNRFAVVHRGFLS  216

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YTS+N+ S     SA++QV  EV RL++LYK+EEVSITV GHSLG+SLATLNAVDL ++
Sbjct  217   VYTSSNKSSEFTKTSAKEQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLVSS  276

Query  858   PFNNTD-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
               N  +       +TA +FASP VG+  F+ AF+   +L+AL V N GD+VPM P L   
Sbjct  277   GANKPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPMYPPL---  333

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                      Y DV V+  I   +S Y++     VL  H L  YLHG+ G QG  G FK +
Sbjct  334   --------GYVDVAVELTIRTIRSPYMRMPA-TVLTLHNLECYLHGVAGEQGSAGGFKLE  384

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDD  376
                D+  VNK    L  E  PVP EWWV K+K MV+  DG W L D
Sbjct  385   VERDVALVNKGVDALTNEH-PVPAEWWVPKHKFMVKGKDGRWTLQD  429



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 243/407 (60%), Gaps = 28/407 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TKY Y  S+        + + S+  +A  K+SNW GY AV+T
Sbjct  65    ELFARTGYLKANPFRYEVTKYIYGTSSIRLPE--CFLINSLSREAWNKDSNWLGYTAVST  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFA------QDNGSLVHRGWYE  1039
             D+GKE+LGRRDI+V WRGT    EW  DF  P+     +F        ++   +  GW  
Sbjct  123   DEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDPPRIANGWLS  182

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT++N  S  +  SA++QV+ E+ RLL+LYK+EE+SIT TGHSLG+ L+ L+A D   N
Sbjct  183   LYTTSNTHSRFDKTSAKEQVQGELKRLLELYKHEEISITFTGHSLGAVLSILSATDFLHN  242

Query  858   PFNNT-----DVL--ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
              +  T     D L  +T F F SP++G+  F++    LK L  LR+ N  DL+P      
Sbjct  243   EWPKTTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPDLIPHY----  298

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    P+  + DVG + +IN  KSEY+K   LN+  +H L  YLHG+ G Q  + EFK
Sbjct  299   -------PVFRFTDVGEELEINTLKSEYLKR-SLNLAHFHNLEAYLHGVAGTQHNQAEFK  350

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
              +   DI  VNK    L+ +K  VP  WWV +N+GMVQ DDGTWIL+
Sbjct  351   LEINRDIALVNKELDALQ-DKYLVPGHWWVLENRGMVQADDGTWILN  396



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 176/411 (43%), Positives = 240/411 (58%), Gaps = 31/411 (8%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W+GL+DPLD DLR+ +I YG +  A YD F +E  S +AG   Y   
Sbjct  13    IAKRWRELHGDNSWKGLMDPLDLDLRKTIISYGELAEATYDGFNTERRSPHAGACIYGYS  72

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRA--DAVMKESNWGGYVAV  1207
              LL  +G+  A    Y +T++ Y  +T+       + V+ + A  D   +ESN+ GYVAV
Sbjct  73    DLLASSGVAAAG--HYEVTRFIY--ATSGQPLPDAFLVRPLAALKDVWSRESNFMGYVAV  128

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS----LVHRGWYE  1039
             ATD+G   LGRRDI+V WRGT    EW+ D     V    +  +   +    +VH G+  
Sbjct  129   ATDEGAAALGRRDIVVAWRGTVQSLEWVNDLTFTPVPAAPVLGKKAAANPLAMVHMGFLS  188

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YTS++  S  N  SARDQV  EV RL++LYK+EE+SIT+TGHSLG++++ LNAVD+ +N
Sbjct  189   LYTSSHAGSKFNKTSARDQVFEEVRRLVELYKDEELSITITGHSLGAAISILNAVDIVSN  248

Query  858   PFN-------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
               N       +    +TAF+FA P VG+  F+ AF   ++LRAL V N GD+VPM P L 
Sbjct  249   GVNVPAGGGGSAACPVTAFVFACPHVGDRFFRAAFHSFRDLRALHVKNAGDVVPMYPPL-  307

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                       AY DV V  +IN  +S Y+K     VL  H L  YLHG+ G QG  G FK
Sbjct  308   ----------AYVDVAVTLNINTGRSPYLKWPG-TVLTLHNLECYLHGVAGEQGSAGGFK  356

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQD-DGTWILDDHE  370
              +   D+  VNK    LK ++ PVP  WW  +NKGMV+ D DG   L+D +
Sbjct  357   LEVKRDVALVNKGADALK-DEYPVPASWWALENKGMVKDDADGLLKLNDFQ  406



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 180/403 (45%), Positives = 243/403 (60%), Gaps = 24/403 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA RW+ L+GS  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IATRWKELSGSSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TKY Y  S+        + ++S+  +A  KESNW GY+AVAT
Sbjct  65    ELFARTGYLKANPFRYEVTKYIYGTSSIRLPE--CFIIKSLSREAWNKESNWLGYIAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS---LVHRGWYEMYT  1030
             D+GK++LGRR I+V WRGT    EW  DF  P+    ++F   N +    V  GW  +YT
Sbjct  123   DEGKKLLGRRGIVVAWRGTIQLYEWANDFDFPLESAVMVFPGANPNDEPRVANGWLSLYT  182

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN---  859
             ST+  S  +  SA++QV+ E+ RLL+LYKNE+V+IT+TGHSLG+ ++ L+A D   N   
Sbjct  183   STDPRSRFDKTSAQEQVQEELKRLLELYKNEDVTITLTGHSLGAVMSILSAADFLHNEWP  242

Query  858   ---PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                P     + +T F F SP++G+  FK+    L++L  LRV N  DL+P          
Sbjct  243   KITPSLQHSLCVTVFAFGSPQIGDRSFKRLVESLEHLHILRVTNVPDLIPRY--------  294

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
                P+  + D+G +  IN  KSEY+K   LN+  +H L  YLHG+ G Q  +GEFK +  
Sbjct  295   ---PVFRFTDIGEELQINTLKSEYLKRS-LNLGHFHNLEAYLHGVAGTQHNQGEFKLEIN  350

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
              DI  VNK    L+ +K  VP  WWV +NKGMVQ DDGTW L+
Sbjct  351   RDIALVNKGLDALE-DKYLVPGHWWVLENKGMVQSDDGTWKLN  392



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 242/407 (59%), Gaps = 28/407 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S Y K+
Sbjct  5     IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKE  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L   TG  KANPF+Y +TKY Y  S+        + + S+  +A  K+SNW GY AV+T
Sbjct  65    ELFARTGYLKANPFRYEVTKYIYGTSSIRLPE--CFLINSLSREAWNKDSNWLGYTAVST  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFA------QDNGSLVHRGWYE  1039
             D+GKE+LGRRDI+V WRGT    EW  DF  P+     +F        ++   +  GW  
Sbjct  123   DEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDPPRIANGWLS  182

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT++N  S  +  SA++QV+ E+ RLL+LYK EE+SIT TGHSLG+ L+ L+A D   N
Sbjct  183   LYTTSNTHSRFDKTSAQEQVQGELKRLLELYKQEEISITFTGHSLGAVLSILSATDFLHN  242

Query  858   PFNNT-----DVL--ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
              +  T     D L  +T F F SP++G+  F++    LK L  LR+ N  DL+P      
Sbjct  243   EWPKTTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPDLIPHY----  298

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    P+  + DVG + +IN  KSEY+K   LN+  +H L  YLHG+ G Q  + EFK
Sbjct  299   -------PVFRFTDVGEELEINTLKSEYLKR-SLNLAHFHNLEAYLHGVAGTQHNQAEFK  350

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
              +   DI  VNK    L+ +K  VP  WWV +N+GMVQ DDGTWIL+
Sbjct  351   LEINRDIALVNKELDALQ-DKYLVPGHWWVLENRGMVQADDGTWILN  396



>ref|XP_008238421.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=376

 Score =   298 bits (764),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 176/406 (43%), Positives = 233/406 (57%), Gaps = 36/406 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIAKRWR L+G   WEGLL+PLD DLRRY++HYG    A  D+FI E  S   GL RY
Sbjct  1     MNSIAKRWRRLSGETEWEGLLNPLDLDLRRYILHYGERTAATADAFIDETKSDNCGLPRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK+ L  + GLE +NP+KY + KY Y  +T                     +S W GYVA
Sbjct  61    AKRYLFSKVGLENSNPYKYKVKKYLYAATTLSPG-----------------KSIWLGYVA  103

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+GK+VLGRRDILV WRGTE   EW  D    +V    I  + +   VH G++  YT
Sbjct  104   VTTDEGKKVLGRRDILVSWRGTELVEEWGIDIVFDLVSASDILGEKHDPKVHHGFHSYYT  163

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
               +  S  N  S R Q  A +  +++ YKNE +SITVTGHS+G+++  LNA D+  N +N
Sbjct  164   HVDPQSPHNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDIVNNGYN  223

Query  849   NTD----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FA+P++G++GF   F  LKNL  LRV N+ DL+P +P         
Sbjct  224   KPPGHPVCPVTAIVFAAPRLGDQGFSNVFYGLKNLHVLRVTNDYDLIPSLP---------  274

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              P   Y  VG +   +  KS Y+K  K ++   H L +YLHG+ G QG + +FK     D
Sbjct  275   -PFANYLHVGKELRFDTFKSPYLKDPKQSL---HSLEVYLHGVAGTQG-ENDFKLAVKRD  329

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             +  VNKY   LK +K  V  +WW EKNK M+Q  DG+W+L DHE+D
Sbjct  330   LALVNKYLDGLK-DKYLVVAKWWTEKNKSMLQVGDGSWVLMDHESD  374



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score =   299 bits (765),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 235/408 (58%), Gaps = 27/408 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA+RWR+L+G +NW  LL PLDSDL+RYL+HYG M  A  D+F  +  SKY G S++++K
Sbjct  5     IAQRWRLLSGHNNWTNLLKPLDSDLQRYLLHYGGMAQATNDAFDFDILSKYIGYSKFSRK  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L E  GL K NPF+Y   KY Y  S    +    + ++ +      KESNW GY+AVAT
Sbjct  65    HLFERCGLVKGNPFRYKAVKYIYATSGPGISLPESFILKPLSEKTWYKESNWMGYIAVAT  124

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS--LVHRGWYEMYTS  1027
             D+GK  LGRRDIL+ WRGT    EW +DF  P+V    I  +  GS   VH+G+  +YT+
Sbjct  125   DEGKAALGRRDILIAWRGTIMPIEWEKDFEFPLVPASKILGKCGGSNAHVHQGFLSIYTA  184

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
             TN  S  +  SARDQV +E+ +L++ YK+EE+SIT+TGHSLG +L+TL A D+  N +N 
Sbjct  185   TNPRSKYSKTSARDQVLSELKKLIEQYKHEELSITLTGHSLGGALSTLCATDIVCNGYNK  244

Query  846   T------DVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                       +TAF + +P VG+  FK     + +L  L + N  D+VP  P +      
Sbjct  245   ICHNPYKTCPVTAFRYGAPMVGDSNFKHTAESMNDLHMLSIHNVPDIVPKSPAMP-----  299

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLM-IYLHGIDGFQGPKGEFKPQGC  508
                   Y  VG +  +++ KS Y+     +   WH L   YLH +    G  GE K    
Sbjct  300   -----GYTRVGQEHFVDSKKSPYLTFPG-DTYTWHNLEGAYLHSLAIENG--GEPKR---  348

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              D+  VNK  G LK  K  +P  WW E+NKGMVQ+ DG+W L D+E D
Sbjct  349   -DLALVNKGSGALK-PKYGIPFSWWCEENKGMVQKSDGSWQLRDYEGD  394



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   300 bits (768),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 247/412 (60%), Gaps = 28/412 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A RW +L G +NWE LLDPLD DLR  +IHYG M  A YD+FI +  SKYAG SR++K 
Sbjct  38    VANRWELLMGENNWEDLLDPLDKDLRELIIHYGEMAQAAYDTFIRDKYSKYAGSSRFSKN  97

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRA-DAVMKESNWGGYVAVA  1204
             +   + GLE  +P+KY +TK+FY  +T+       +  +S+ + +   K++N+ GY+AVA
Sbjct  98    NFFAKLGLELGHPYKYRVTKFFY--ATSAIDVPDAFIFKSLSSIEQSSKDTNFMGYIAVA  155

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ--DNGSL---VHRGWYE  1039
              D   E+LGRR+I+V WRG+    EW+ D +   V    I A   D+G     VH+GW+ 
Sbjct  156   EDDAVELLGRREIVVAWRGSVEFMEWLNDLKFLQVSASDILAHEGDDGEPEPEVHQGWHS  215

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+ N  S     SAR QV  E+ +L++ YKNEE+SIT+TGHSLG++LATLNA D+ AN
Sbjct  216   IYTTDNLSSPFEKTSARQQVLTELTKLVEQYKNEEISITITGHSLGAALATLNAADIVAN  275

Query  858   PF-------NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
                      N+    +TA +FASP+VG+  FKK  S   +L  LRV N  D VP      
Sbjct  276   KINQPKNSPNSKPCKVTAIVFASPRVGDANFKKTLSKYDDLGVLRVRNAQDFVPN-----  330

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PLI Y DVG +  I+ ++S Y+K+  L + + H L +Y+HG+ G QG    FK
Sbjct  331   ------YPLIDYSDVGEELTIDTTQSAYLKNPGL-LSVSHNLEVYMHGVAGTQGSVEGFK  383

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                  D+  +NK+   LK +   VP  WWV + KGMVQQ DG+W+L DHE D
Sbjct  384   LVVERDVALLNKFYDFLK-DDYLVPVGWWVAQYKGMVQQADGSWLLMDHEMD  434



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   315 bits (806),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 225/403 (56%), Gaps = 25/403 (6%)
 Frame = -2

Query  1548  WRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLE  1369
             W  L+G DNW+GLLDPLD DLRR +I YG +  A  D+FI +P S YAG SRYA  + L 
Sbjct  674   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  733

Query  1368  ETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDKGK  1189
                 +  +P  Y +T++ Y  +T+     G +  +     A   ESNW GYVAVATD G 
Sbjct  734   RA--QAPDPDAYNVTRFLY--ATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGV  789

Query  1188  EVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMYTSTNQ  1018
               LGRRDI+V WRGT+   EW  D  I +V    +     G     VHRG+  +Y S N 
Sbjct  790   ARLGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNS  849

Query  1017  DSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF-----  853
              S  N  SAR+QV AE+ RLLD YK E  SIT+TGHSLG++L+TL A+D+ AN       
Sbjct  850   TSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANGLNVRGP  909

Query  852   NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPL  673
             NN  V + A +F SP+VG++ FKKAF      R LRV N  D+VP          T+LP 
Sbjct  910   NNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVP----------TVLPN  959

Query  672   IAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGEFKPQGCFDI  499
               YKDVGV+  ++  KS ++K        WH L  YLHG+ G QG      F  +   D+
Sbjct  960   AFYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDV  1019

Query  498   PQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
               VNK    L  +  PVP  WWVE NKGM +   G W+L DHE
Sbjct  1020  ALVNKEVDALS-DDYPVPAAWWVEGNKGMTRDASGRWVLQDHE  1061



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 233/407 (57%), Gaps = 30/407 (7%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             + +A RWR L+GSD+W GLLDPLD+DLRR LI YG M  A +++FI E  S  AG+ RY 
Sbjct  5     DGMASRWRELHGSDSWAGLLDPLDADLRRSLITYGEMAMATHEAFIGERRSPNAGMCRYR  64

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCG-AHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +  L     +E ++P  Y +T+Y Y  +T C    HG   ++ +  D   +E NW GYVA
Sbjct  65    RADLFRR--VEVSHPGWYAVTRYVY--ATACADVLHGETLLRPLCRDGRARECNWMGYVA  120

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
              ATD+G   LGRRDI+V WRGT+   EW+ D ++       I     A  +   VHRG+ 
Sbjct  121   AATDEGAARLGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGPEGADGSDPSVHRGYL  180

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
              +YTS +  S L+  SAR QV  E+ RL+D YK+EE SITV GHSLG++LATLNAVD+AA
Sbjct  181   SLYTSADPGSELSKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAVDIAA  240

Query  861   NPFN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
             N +N           +TA +F SP+ G+  F+ AF  +  LR LRV N  D +P+     
Sbjct  241   NSYNRFALNGRRATPVTAVVFGSPRTGDRDFRDAFHRVPGLRMLRVRNRPDRIPL-----  295

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVK-HDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                    P + Y DVGV+  I+  +S ++K H   +    H L  +LHGI G+ G  G F
Sbjct  296   ------YPPVGYADVGVELLIDTRRSPFLKPHGSES--QSHDLECHLHGIAGWHGEHGAF  347

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             +     D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L
Sbjct  348   ELVVDRDVALVNKFDDCL-ADEYPVPVGWKVNHNKNMVKGRDGRWVL  393



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   297 bits (760),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 237/415 (57%), Gaps = 32/415 (8%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
              + A RWR L G+++W GLLDPLD DLRR +I YG ++ A YD F  E  S +AG   Y 
Sbjct  27    SATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLYG  86

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPST--TCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             +  LL   G+  A   +Y +T++ Y  S     G+      +   R +A  +ESNW GYV
Sbjct  87    RADLLPGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETR-EAWTRESNWIGYV  143

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGW  1045
             AVATD+G   LGRRD++V WRGT    EW  DF    V    +     A +  ++VH+G+
Sbjct  144   AVATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAANPLAVVHQGF  203

Query  1044  YEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLA  865
               +YTS+N DS  N  SARDQV  EV RL++LYK E  SITV GHSLG++LATLNAVD+A
Sbjct  204   LSVYTSSNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVDIA  263

Query  864   ANPFN-------NTDVLITAFLFASPKVGNEGFKKAF-SHLKNLRALRVVNNGDLVPMVP  709
             AN  N            +TA LFA P VG+  F+ AF  + ++LRAL V N GD+VP+VP
Sbjct  264   ANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGYFRDLRALHVRNAGDVVPVVP  323

Query  708   FLAVEAGTILPLIAYKDVGVQ-FDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQG-P  535
              L           AY DV V    I+ S+S Y++       + H L  YLHG+ G QG  
Sbjct  324   PL-----------AYVDVAVAVLPIDTSRSPYLRSPGPAGTL-HNLECYLHGVAGEQGSA  371

Query  534   KGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
              G F+ +   D+  VNK    L+ ++ PVP  WWV +N+ MV+  DG W+L D E
Sbjct  372   AGGFRLEVDRDVALVNKGADALR-DEYPVPANWWVPENRWMVRGSDGHWVLKDFE  425



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 170/429 (40%), Positives = 241/429 (56%), Gaps = 39/429 (9%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             E+ + +WR + GSDNWEGLL+PLD+DLR  ++ YG +  A YD+F S+P SK+ G SRY 
Sbjct  5     ENGSVKWRAVQGSDNWEGLLEPLDNDLREAILLYGDLTQATYDAFNSDPHSKFCGSSRYG  64

Query  1386  KKSLLEETGLEKA-NPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             KK   ++  L    + + Y +T++ Y  +T+       + ++S+  +A  +ESNW GYVA
Sbjct  65    KKDFFQKVSLATGDDEWNYEVTRFLY--ATSRLELPQAFMLKSLSREAWSRESNWIGYVA  122

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL----------  1060
             VATD+GK+ LGRR+I+V WRGT    EW + F    V    I +Q+              
Sbjct  123   VATDRGKQRLGRREIVVAWRGTIRDLEWSDVFNPIPVSIAPILSQEQRHDHDHDHHWYDR  182

Query  1059  -----------VHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTG  913
                        V  GW+ +YTST+  S    +SAR+Q  AE+ RL++LYK+EE+SIT+ G
Sbjct  183   VLHLVDEEEPKVMNGWFVIYTSTDPKSPFTKSSAREQFLAEIKRLVELYKDEELSITLVG  242

Query  912   HSLGSSLATLNAVDLAANPFNNT----DVLITAFLFASPKVGNEGFKKAFSHLKNLRALR  745
             HSLG++LA L+  D+  +   +     ++ +TAF+   P VGN  FKK F  L  LR LR
Sbjct  243   HSLGAALAILSGFDIVQSGLTSVPGKPNIPVTAFVVGCPGVGNAAFKKRFEALPGLRVLR  302

Query  744   VVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIY  565
             +VN  DL+P  P           L+  + VG   +I+  KS ++K  K N   WH L   
Sbjct  303   IVNLPDLIPHYPG---------KLLMSEHVGSHLEIDTRKSPFLKDSK-NPSDWHNLQAQ  352

Query  564   LHGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWI  385
             LH + G+QGPK   K +G   +  VNK    LK E+C +P  WWVEKNKGM+Q   G W 
Sbjct  353   LHIVAGWQGPKNPLKFEGNRSVALVNKSCDFLK-EECLIPASWWVEKNKGMIQDLKGMWA  411

Query  384   LDDHEADHV  358
             L D   D +
Sbjct  412   LADPPEDDL  420



>gb|KDP46905.1| hypothetical protein JCGZ_24114 [Jatropha curcas]
Length=403

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 174/403 (43%), Positives = 231/403 (57%), Gaps = 27/403 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSK-YAGLSR  1393
             + +IA RWR L+G +NWEGLLDPLD DLR  +++YG    A+ D++ S    K   G SR
Sbjct  9     IANIADRWRELSGENNWEGLLDPLDFDLRSSILNYGDRAVAIGDAYNSYRKFKDLHGFSR  68

Query  1392  YAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             Y    +  + G+   N F YT+T + Y+             +++   D V+ ES W  YV
Sbjct  69    YPPNEVFTKVGIRARNEFDYTVTDFIYS------------RLEAQWFDNVINESTWCAYV  116

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNGSLVHRGWYEM  1036
             AVATD GK+ LGRRDI+V WR T    E +ED+  IP+    I    +N  L+H G+  +
Sbjct  117   AVATDDGKKKLGRRDIVVSWRETALDGEKLEDYEFIPVSASDIFPNNNNDPLIHFGFRSI  176

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YT+ +  S  N  SARDQV   V +L+D YK+EEVSIT+TGHSLGS+LATLNAVD+A   
Sbjct  177   YTTKDDKSIYNKKSARDQVLDAVSKLVDQYKDEEVSITLTGHSLGSALATLNAVDIAYKG  236

Query  855   FN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
              N      N    +TA +F  P VGNEGFKK F  L ++R LRV N  D VP +P   + 
Sbjct  237   INKPTGISNKSFPVTAIVFGCPMVGNEGFKKVFDELSDVRVLRVENANDPVPKLPPNEL-  295

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                ++P   Y  VG    I+ + S ++K   +N    H L +YLHG+ G QG KG F  +
Sbjct  296   --ILMPQHRYYHVGESLPIDTTLSPFLKTSDVNP---HDLNVYLHGVAGTQGSKGGFNLE  350

Query  513   GCFDIPQVNKYGGMLKVE-KCPVPTEWWVEKNKGMVQQDDGTW  388
                D   +NK G  L  E    +P  WWVE+NKGMV QDDGT+
Sbjct  351   YPLDTALINKRGDDLNAENNYNIPPIWWVEENKGMVLQDDGTY  393



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/407 (43%), Positives = 229/407 (56%), Gaps = 23/407 (6%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + ++A RWR L+G ++W+GLLDPLD  LR  +I YG M+ A YD F +E  S + G   Y
Sbjct  38    LGTVASRWRELHGENSWDGLLDPLDPHLRSSIISYGEMVQAAYDGFNTERRSPHCGACFY  97

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A + LL   G+       Y +TK+ Y  S+                D   +ESNW GYVA
Sbjct  98    AYEDLLAGVGVPHHG-NNYQVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVA  156

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRII---FAQDNGSLVHRGWY  1042
             VATD+G   LGRRDI+V WRGT    EW+ D   +P+    ++    +Q+  ++VH G+ 
Sbjct  157   VATDEGAAKLGRRDIVVAWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAVVHHGFL  216

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
              MYTS+N+ S     SARDQV  EV RL++LYK+EEVSITV GHSLG+S+ATLNAVD+ +
Sbjct  217   SMYTSSNKSSEFTKTSARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLNAVDMVS  276

Query  861   NPFNNTD-----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAV  697
             +  N  +       +TA +FASP VG   F+ AF    +L+AL V N GD+VP+ P L  
Sbjct  277   SGINKPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPLYPPL--  334

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKP  517
                       Y DV VQ  I   +S Y++     V   H L  YLHG+ G QG  G FK 
Sbjct  335   ---------GYVDVAVQLTITTIRSPYLR-VPATVGTLHNLECYLHGVAGEQGSAGGFKL  384

Query  516   QGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDD  376
             +   DI  VNK    L  E  PVP  WWV K+K MV+  DG W L D
Sbjct  385   EVDRDIALVNKGADALADEH-PVPASWWVPKHKFMVKGGDGRWTLQD  430



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/404 (42%), Positives = 238/404 (59%), Gaps = 32/404 (8%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSF--ISEPTSKYAGLSRY  1390
             SIA RWR L+G ++W GLL+PLD DLRR +I+YG    A  ++F   S  ++   G SRY
Sbjct  11    SIADRWRELSGEESWNGLLNPLDIDLRRSIINYGDRATANGNAFNKTSLRSANCCGFSRY  70

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A +    +TG++  NP+KY +T + Y          G    + +  D    ES W  YVA
Sbjct  71    APRDFFSKTGIQTRNPYKYQVTDFIY----------GKVDAKVLLLDD--SESTWSAYVA  118

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VAT++GK +LGRRDI+V WRGT    EW++DF   ++    IF  D   + H+G++ +YT
Sbjct  119   VATNEGKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPEIFGNDVAKM-HKGFHSLYT  177

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + +  S  +  SARDQ  A V +L+D YK+EE+SITVTGHSLG+++ATLNA+D+    +N
Sbjct  178   AKDDKSTYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDIVVKGYN  237

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              T         +TA +FASP+VG+  FKK    L++L  LRV N  D+VP +PF      
Sbjct  238   KTTGEQNKAFPVTAIVFASPRVGDTNFKKLCEGLEDLHVLRVTNEKDIVPNLPF------  291

Query  687   TILPLIAYKDVGVQFDINASKSEYVKH-DKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
              I P  ++K VG +  I+  KS YVK  D L    +H L +Y+HG+ G QG +G F  + 
Sbjct  292   DIPPSFSFKHVGEELRIDTRKSPYVKSMDDLG--DFHNLELYIHGVAGTQGSEGGFNLEV  349

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWW-VEKNKGMVQQDDGTWIL  382
               DI  VNK    LK ++  +P  WW +E NKGMV  DDG W L
Sbjct  350   DRDIALVNKDLDGLK-DEYNIPAGWWGIEDNKGMVLGDDGRWKL  392



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 231/419 (55%), Gaps = 35/419 (8%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SI  RWR L G+ +W+GLLDPLD DLR  +I YG +  A YD F S+  S +AG   Y  
Sbjct  8     SIPSRWRELQGAGSWKGLLDPLDRDLRASIIAYGELAEATYDGFNSQRRSPHAGACFYGH  67

Query  1383  KSLLEETGLEKA-----NPFKYTITKYFYTPSTTCGAHHGGY--HVQSVRADAVMKESNW  1225
               LL   G+ +A       F Y  + +F  P+T        +   + S+  +   +ES+W
Sbjct  68    ADLLAAAGVSRAGYYSVTKFIYATSGFFLAPTTGTSVPDAFFVLPLPSLLEEPWCRESHW  127

Query  1224  GGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG----SLV  1057
              GYVAVATD+G   LGRRDI+V WRGT    EW+ D          +     G    ++V
Sbjct  128   MGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDLDFTPASAEPVLGPAAGDFDSAVV  187

Query  1056  HRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNA  877
             H G+  +YTS+++DS  N  SARDQV  EV RL++ +K E  SITVTGHSLG+SLATLNA
Sbjct  188   HHGFLSVYTSSDEDSKFNQQSARDQVTEEVRRLMEAHKEEATSITVTGHSLGASLATLNA  247

Query  876   VDLAANPFN--------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLV  721
             VD+ ++  N             +TA LFASP VG++ FK AF+   +LRAL V N GD+V
Sbjct  248   VDMVSHGVNVPPSSPQQQPPCPVTAILFASPHVGDDSFKSAFASFPDLRALHVRNAGDVV  307

Query  720   PMVPFLA-VEAGT-ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDG  547
             P+ P L  V+A T +LP            ++  +S Y+K     V   H L  YLHG+ G
Sbjct  308   PLYPPLGYVDAATAVLP------------VDTGRSPYLKQPG-TVQTRHNLECYLHGVAG  354

Query  546   FQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             FQG  G FK +   D+  VNK    LK +K PVP  W V  NK MV+  DG W L D E
Sbjct  355   FQGASGGFKLEVDRDVALVNKGADALK-DKYPVPPNWHVINNKSMVRDSDGHWKLRDFE  412



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 184/427 (43%), Positives = 232/427 (54%), Gaps = 48/427 (11%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDP-LDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             + A RW+ ++G  +WEGLL P LD DLRR +I YG M  A YD+F  E  S  AGLSR+ 
Sbjct  17    TAASRWKEMHGERSWEGLLRPALDVDLRRTVIWYGEMAQATYDAFNHERVSPNAGLSRFR  76

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQ------SVRADAV------  1243
             +        L   +   Y +T++ Y  S+  G H   + V+      S RA A       
Sbjct  77    RGRFFHGAMLPD-HAGAYKVTRFLYATSSAPG-HAAAFMVRGRGGHVSWRAAAGGHVSGG  134

Query  1242  -MKESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD-N  1069
               +ESNW GYVAVAT+ GK  LGRRDI+V WRGT    EW++D    MV PR I      
Sbjct  135   GCRESNWIGYVAVATEAGKAALGRRDIVVAWRGTVESLEWVDDLEFAMVAPRGIVKDGCE  194

Query  1068  GSLVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLA  889
              +LVHRGW  MYTST+  S  N +SARDQV  EV RL+++YK EEVSITVTGHSLG++LA
Sbjct  195   DALVHRGWLSMYTSTHPASSHNKDSARDQVLGEVRRLVEMYKEEEVSITVTGHSLGAALA  254

Query  888   TLNAVDLAANPFNN------------TDVLITAFLFASPKVGNEGFKKAFSH---LKNLR  754
             TLNA D+A N +N             T   +  F FASP++G  GFKK F+       LR
Sbjct  255   TLNAFDIAENGYNTAIRAGAAPGPRATTFPVAVFAFASPRIGGAGFKKRFAAAAIASPLR  314

Query  753   ALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGL  574
              LR+ N  D+VP  P L            Y DVG +  I+   S Y+K    N  +WH L
Sbjct  315   VLRIRNARDIVPKYPAL-----------LYHDVGCELTIDTGASPYLKAPG-NERVWHNL  362

Query  573   MIYLHGIDGFQ---GPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQ  403
               YLHG+ G      P   F+     D+  VNK    L+ E+  VP  WWV +NKGM + 
Sbjct  363   ESYLHGVAGVPASGAPSSGFELVVARDVALVNKAYDALR-EEHGVPAGWWVPQNKGMAKG  421

Query  402   DDGTWIL  382
             DDG W L
Sbjct  422   DDGRWRL  428



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/404 (42%), Positives = 237/404 (59%), Gaps = 32/404 (8%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSF--ISEPTSKYAGLSRY  1390
             SIA RWR L+G  +W GLL+PLD DLRR +I+YG    A+ ++F   S  ++   G SRY
Sbjct  11    SIADRWRELSGEKSWNGLLNPLDIDLRRSIINYGDRATAIGNAFNKTSLRSANCCGFSRY  70

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A +    +TG++  NP+KY +T + Y          G    + +  D    ES W  YVA
Sbjct  71    APRDFFSKTGIQTRNPYKYQVTDFIY----------GEVDAKILLLDD--SESTWSAYVA  118

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VAT++GK +LGRRDI+V WRGT    EW++DF   ++    IF  D   + H+G++ +YT
Sbjct  119   VATNEGKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPGIFGNDVAKM-HKGFHSLYT  177

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + +  S  +  SARDQ  A V +L+D YK+EE+SITVTGHSLG+++ATLNA+D+    +N
Sbjct  178   AKDDKSTYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDIVVKGYN  237

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              T         +TA +FASP+VG+  FKK    L++L  LRV N  D+VP +P       
Sbjct  238   KTTGEQNKAFPVTAIVFASPRVGDANFKKLCEGLEDLHVLRVTNEKDIVPNLPL------  291

Query  687   TILPLIAYKDVGVQFDINASKSEYVKH-DKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
              I P  ++K VG +  I+  KS YVK  D L    +H L +Y+HG+ G QG +G F  + 
Sbjct  292   DIPPSFSFKHVGEELRIDTRKSPYVKSMDDLG--DFHNLELYIHGVAGTQGSEGGFNLEV  349

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWW-VEKNKGMVQQDDGTWIL  382
               DI  VNK    LK ++  +P  WW +E NKGMV  DDG W L
Sbjct  350   DRDIALVNKDLDGLK-DEYNIPAGWWGIEDNKGMVLGDDGRWKL  392



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 173/424 (41%), Positives = 232/424 (55%), Gaps = 44/424 (10%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A RWR L+GS +W+GLLDPLD DLRR LI YG MI A Y++FI E  S  AG+ RY + 
Sbjct  1     MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRA  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L     ++ ++P  Y  T+Y Y  +T     HG   ++ +  +    E NW GYVAVAT
Sbjct  61    DLFRR--VDVSHPGWYAATRYIY--ATANADVHGKVLLRPLCREGRATECNWMGYVAVAT  116

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYEMY  1033
             D+G   LGRRDI+V WRGT+   EW+ D ++       I     A      VHRG+  +Y
Sbjct  117   DEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLY  176

Query  1032  TSTNQDSHLNSNSARDQ---------------VRAEVCRLLDLYKNEEVSITVTGHSLGS  898
             TS +Q S LN  SAR Q               V  E+ RL+D YK+EE SITV GHSLG+
Sbjct  177   TSEDQCSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSITVIGHSLGA  236

Query  897   SLATLNAVDLAANPFNN--------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRV  742
             +LATLNA D+AAN +N         T   +TA +F SP+ G+ GF+ AF  L++LR LRV
Sbjct  237   TLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRV  296

Query  741   VNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYL  562
              N  D +P             P + Y DVGV+  I+   S +++    +    H L  +L
Sbjct  297   RNRPDRIPH-----------YPPVGYADVGVELLIDTRLSPFLRRHG-SESQSHDLECHL  344

Query  561   HGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             HG+ G+ G    F+     D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L
Sbjct  345   HGVAGWHGDHRGFELVVDRDVALVNKFDDCL-ADEYPVPVRWKVHHNKSMVKGPDGRWVL  403

Query  381   DDHE  370
              DHE
Sbjct  404   QDHE  407



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 175/408 (43%), Positives = 232/408 (57%), Gaps = 59/408 (14%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W+GLL PLD DLR+YLIHYG M  A YD+F     SK+AG S Y++K
Sbjct  34    IAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIYSRK  93

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +TK+ +  S         + +  V  +   KESNW GYVAV 
Sbjct  94    DFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPE--SFLLFPVSREGCTKESNWIGYVAVT  151

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
              D+G   LGRRDI                                   VH+GWY +Y S 
Sbjct  152   DDQGTAALGRRDI-----------------------------------VHQGWYSIYMSK  176

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             ++ S  N  +ARDQV  E+ RLL+ YK+E++SI++ GHSLG+++ATLNA D+ AN +N  
Sbjct  177   DERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADIVANGYNRP  236

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 +    +TAF+FASP+VG+  FKK FS LK+LR LRV N  D+VP           I
Sbjct  237   KSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVP-----------I  285

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQGC  508
              P + Y +VG +  I+  KS Y+K    ++  +H L +YLHG+ G QG      F+    
Sbjct  286   YPPLGYAEVGDELPIDTRKSPYLKSPG-DLATFHCLEVYLHGLAGTQGTSKADLFRLDVK  344

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
              DI  VNK    LK E   VP  W + KNKGMVQQ+DG+W L DHE D
Sbjct  345   RDIGLVNKSVDGLKDEYM-VPGHWRILKNKGMVQQNDGSWKLMDHEID  391



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 181/405 (45%), Positives = 238/405 (59%), Gaps = 26/405 (6%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA RW+ L+G+  W+ LLDPLD DLRRY++HYG M    Y +F S+  SKY G S +  K
Sbjct  5     IATRWKELSGAGKWKNLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRQSKYVGDSCFTMK  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L  ++G  +ANPF+Y +TK+ Y  S+        + V S   +A  +ESNW GY+AVAT
Sbjct  65    ELFAQSGYLRANPFRYEVTKFIYGTSSIRLPE--CFIVNSWSREAWNRESNWLGYIAVAT  122

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPM-----VKPRIIFAQDNG-SLVHRGWYE  1039
             D+GK++LGRRDI+V WRGT    EW  DF  P+     V PRI     N    V  GW  
Sbjct  123   DEGKKLLGRRDIVVAWRGTIQLYEWANDFDFPLELAVSVFPRIDPNDPNDPPRVANGWLS  182

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YTST+  S  +  SAR+QV+ E+ RLL LYK+EEVSIT+TGHSLG+ L+ L+A D   N
Sbjct  183   LYTSTDPRSRFDKTSAREQVQGELKRLLALYKDEEVSITLTGHSLGAVLSILSAADFLQN  242

Query  858   -----PFNNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
                  P  N    +T F F SP++G+  FK+     K L  LR+ N  DL+P        
Sbjct  243   EWPKIPPQNKVSCVTVFAFGSPRIGDLNFKRLVESFKPLNILRIANVPDLIPRY------  296

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                  P+  + DVG +  IN  KSEY+K   LN+  +H L  YLHG+ G Q  + EFK +
Sbjct  297   -----PVFRFTDVGEELQINTLKSEYLKRS-LNLKHFHNLEAYLHGVAGTQHNQTEFKLE  350

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
                DI  VNK    L+ +K  VP  WWV +NKGM+Q+ DGTW LD
Sbjct  351   INRDIALVNKGLDALQ-DKYLVPGNWWVLENKGMIQKADGTWKLD  394



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   299 bits (766),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 169/402 (42%), Positives = 237/402 (59%), Gaps = 28/402 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A+RWR L+GSD+W+GLL+PLD DLRR LI+YG MI A Y++FI+E  S  AG+ RY + 
Sbjct  210   MAERWRELHGSDHWDGLLNPLDIDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRA  269

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L     +E ++P    + +Y Y  ++     HG   ++ +  +   +E NW GYVAVAT
Sbjct  270   DLFRR--VEVSHPGWSAVPRYIYAAAS--ADVHGKVLLRPLCRNGRARECNWMGYVAVAT  325

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQD--NGS--LVHRGWYEMY  1033
             D+G   LGRRDI+V WRGT+   EW+ D ++       I   +  +GS   VHRG+  +Y
Sbjct  326   DEGAAALGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGAEGADGSEPSVHRGYLSLY  385

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS ++ S ++  SAR QV  E+ R++D YK+E+ SITV GHSLG++LATLNAVD+AAN +
Sbjct  386   TSADEGSEISKQSARMQVLTEIARMMDKYKDEQTSITVVGHSLGATLATLNAVDIAANYY  445

Query  852   NNTDVL-------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             N + +        +TA +F SP+ G+  F+  F  L  LR LRV N  D +P+       
Sbjct  446   NKSALCTAGSRAPVTAVVFGSPRTGDRDFRDIFHRLPGLRMLRVRNRPDRIPL-------  498

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                  P + Y DVGV+  I+  +S ++K    N    H L  +LHGI G+QG  GEF+  
Sbjct  499   ----YPPVGYADVGVELLIDTRRSLFLKPHG-NESQSHDLECHLHGIAGWQGEHGEFELV  553

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW  388
                DI  VNK+   L  E  PVP  W V  NK MV+  DG+W
Sbjct  554   VDRDIALVNKFDDCLTDEH-PVPVGWKVHHNKNMVKGTDGSW  594



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   291 bits (745),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 167/407 (41%), Positives = 231/407 (57%), Gaps = 35/407 (9%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A+RWR L+GSD+W+ LLDPLD DLRR LI+YG MI A Y++FI+E  S  AG+ RY + 
Sbjct  1     MAERWRELHGSDHWDSLLDPLDVDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRA  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L     +E ++P  Y +T+Y Y  +T     HG   ++ +  +   +E NW GYVAVAT
Sbjct  61    DLFRR--VEVSHPGWYAVTRYIY--ATASADVHGKVLLRPLCRNGRARECNWMGYVAVAT  116

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTN  1021
             D+G   LGRRDI+V WRGT+   EW+ D ++       +     G           T+  
Sbjct  117   DEGAAALGRRDIVVAWRGTQRALEWVADLKLAFASAARVLGAATGP------NRRCTAVQ  170

Query  1020  QDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTD  841
               S L      +QV  E+ RL+D YK+E+ SITV GHSLG++LATLNAVD+AAN +N + 
Sbjct  171   YRSKLA-----EQVLTEIARLMDKYKDEQTSITVVGHSLGATLATLNAVDIAANYYNKSA  225

Query  840   VL-------ITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
             +        +TA +F SP+ G+  F+  F  L  LR LRV N  D +P+           
Sbjct  226   LCTAGSRAPVTAVVFGSPRTGDHDFRDIFHRLPGLRMLRVRNRPDRIPL-----------  274

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              P + Y DVGV+  I+  +S ++K    N    H L  +LHG+ G+QG  GEF+     D
Sbjct  275   YPPVGYADVGVELLIDTRRSPFLKPHG-NESQSHDLECHLHGVAGWQGEHGEFELVVDRD  333

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADH  361
             I  VNK+   L  E  PVP  W V  NK MV+  DG W+L+DHE+D+
Sbjct  334   IALVNKFDDCLTDEH-PVPVGWKVHHNKNMVKGPDGRWVLEDHESDY  379



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   291 bits (746),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 173/424 (41%), Positives = 231/424 (54%), Gaps = 44/424 (10%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             +A RWR L+GS +W+GLLDPLD DLRR LI YG MI A Y++FI E  S  AG+ RY   
Sbjct  1     MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHA  60

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
              L     ++ ++P  Y  T+Y Y  +T     HG   ++ +  +    E NW GYVAVAT
Sbjct  61    DLFRR--VDVSHPGWYAATRYIY--ATANADVHGKVLLRPLCREGRATECNWMGYVAVAT  116

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYEMY  1033
             D+G   LGRRDI+V WRGT+   EW+ D ++       I     A      VHRG+  +Y
Sbjct  117   DEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLY  176

Query  1032  TSTNQDSHLNSNSARDQ---------------VRAEVCRLLDLYKNEEVSITVTGHSLGS  898
             TS +Q S LN  SAR Q               V  E+ RL+D YK+EE SITV GHSLG+
Sbjct  177   TSEDQCSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSITVIGHSLGA  236

Query  897   SLATLNAVDLAANPFNN--------TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRV  742
             +LATLNA D+AAN +N         T   +TA +F SP+ G+ GF+ AF  L++LR LRV
Sbjct  237   TLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRV  296

Query  741   VNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYL  562
              N  D +P             P + Y DVGV+  I+   S +++    +    H L  +L
Sbjct  297   RNRPDRIPH-----------YPPVGYADVGVELLIDTRLSPFLRRHG-SESQSHDLECHL  344

Query  561   HGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWIL  382
             HG+ G+ G    F+     D+  VNK+   L  ++ PVP  W V  NK MV+  DG W+L
Sbjct  345   HGVAGWHGDHRGFELVVDRDVALVNKFDDCL-ADEYPVPVRWKVHHNKSMVKGPDGRWVL  403

Query  381   DDHE  370
              DHE
Sbjct  404   QDHE  407



>ref|XP_007210039.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
 gb|EMJ11238.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
Length=376

 Score =   290 bits (742),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 177/406 (44%), Positives = 237/406 (58%), Gaps = 36/406 (9%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M SIAKRWR+L+G   WEGLL+PLD DLRRY++HYG    A+ D+FI E  S   GL RY
Sbjct  1     MHSIAKRWRLLSGETEWEGLLNPLDLDLRRYILHYGERAAAIADAFIDETKSDNCGLPRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             AK+ L  + GLE +NP+KY + KY Y  +T                     +S W GYVA
Sbjct  61    AKRYLFSKVGLENSNPYKYKVKKYLYAATTLSPG-----------------KSIWLGYVA  103

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GK+VLGRRDILV WRGTE  +EW  D    +V    I  + +   VH G++  YT
Sbjct  104   VATDEGKKVLGRRDILVSWRGTELVAEWGIDVVFDLVSASDILGEKHDPKVHHGFHSYYT  163

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
               +  S  N  S R Q  A +  +++ YKNE +SITVTGHS+G+++  LNA D+  N +N
Sbjct  164   HIDPQSPHNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDIVYNGYN  223

Query  849   NTD----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TA +FA+P++G++G    F  LKNL  LRV N+ DL+P +P         
Sbjct  224   KPPGHPVCPVTAIVFAAPRLGDQGLSNVFYGLKNLHVLRVTNDYDLIPSLP---------  274

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
              P   Y  VG +   +  KS Y+K  K ++   H L +YLHG+ G QG + +FK     D
Sbjct  275   -PFANYLHVGKELRFDTFKSPYLKDPKQSL---HSLEVYLHGVAGTQG-ENDFKLAVKRD  329

Query  501   IPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
             +  VNKY   LK +K  V  +WW EKNK M+Q DDG+W+L DHE+D
Sbjct  330   LALVNKYLDGLK-DKYLVVAKWWTEKNKSMLQIDDGSWVLMDHESD  374



>gb|KDP21072.1| hypothetical protein JCGZ_21543 [Jatropha curcas]
Length=407

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 172/410 (42%), Positives = 243/410 (59%), Gaps = 34/410 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  IA  W+VL+G +NW+GLLDP+D +LR YLI+YG +  A   +      S    LSRY
Sbjct  1     MAGIASNWKVLSGENNWDGLLDPIDDNLRHYLINYGFLTAAAPAALNGVKKSPGYALSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
               ++   E G+EK NPFKY +T +FY  S               R   +  +S + G+VA
Sbjct  61    PPENYFSEVGIEKGNPFKYQVTDFFYGRSEI-----------DFRDWMIAGQSAYFGFVA  109

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+GK V GRRDI+V WRGT    EW EDF         +F  D  + VH+G++ +YT
Sbjct  110   VTTDEGKIVTGRRDIVVCWRGTTFTIEWFEDFDATFTSGSDLFP-DTDAKVHKGFHSVYT  168

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYK--NEEVSITVTGHSLGSSLATLNAVDLAANP  856
             ++  DS  N  SAR+QV A V R  D Y    E+VSIT+TGHSLGS+LATLNA+D+A N 
Sbjct  169   TSKSDSTYNKRSAREQVLAAVRRNADKYAALKEDVSITITGHSLGSALATLNAMDIAFNG  228

Query  855   FN-----NTDVLITAFLFASPKVGNEGFKKAFSHLKN---LRALRVVNNGDLVPMVPFLA  700
             +N     +T   +TAF+FASP+VGN+ F+  FS L++   L  LR+ N+ D+VP +P   
Sbjct  229   YNKPSGSDTGYPVTAFVFASPRVGNKEFQDVFSGLQDAGTLHLLRIRNHKDIVPELP---  285

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                  I   I Y+DVGV+  ++ +KS  +K +  ++   H L +Y+HG+ G+QG + +FK
Sbjct  286   ---PKIFDFI-YEDVGVELYLDTTKSPNIKGE--SIPEAHDLNLYMHGVAGYQGNE-DFK  338

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEK-NKGMVQQDDGTWILDDH  373
                  D   +NKY  +L+ + C VP +WW     +GM+Q DDGTW L+D+
Sbjct  339   LVINLDFALLNKYNDLLQ-DSCGVPPKWWSNVFRQGMIQLDDGTWKLNDY  387



>ref|XP_007014120.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY31739.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=428

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 178/424 (42%), Positives = 236/424 (56%), Gaps = 41/424 (10%)
 Frame = -2

Query  1623  RNTPKC*LHSEkknnnkKMESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAV  1444
             RN  K  L S  +       SIA RWR L+G  +W+ LL PLD DLRRY+IHYG   GAV
Sbjct  30    RNHKKV-LRSTDQLKIVMANSIASRWRDLSGESDWKDLLHPLDLDLRRYIIHYGERCGAV  88

Query  1443  YDSFISEPTSKYAGLSRYAKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQ  1264
              D F     S+  G S Y         GLE  NPFKY++T +FY  S             
Sbjct  89    GDLFNDTKASRGFGHSLYPADEFFSRAGLEIGNPFKYSVTNFFYAASDIV----------  138

Query  1263  SVRADAVMKESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRII  1084
                      +S W GYVAV TD GK VLGRRDILV WRGT T SE I D +        +
Sbjct  139   ---------QSAWFGYVAVTTDDGKAVLGRRDILVAWRGTMTDSESINDVQFFPTSASEL  189

Query  1083  FAQDNGSLVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSL  904
             F +DN   VH G+  +YT  + +S  +  SARDQVR  V +L+D Y++E++SITVTG+SL
Sbjct  190   FGEDNDPQVHSGFLSLYTGRSSNSPYSQTSARDQVREAVRKLVDKYQDEDISITVTGYSL  249

Query  903   GSSLATLNAVDLAANPFN------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRV  742
             G++LATL+A+D+ A+ +N          ++T F +A P+VGNEGFKK F  L +L  LR+
Sbjct  250   GAALATLSAMDIVASGYNKPTGNSEKSCMVTTFTYAGPRVGNEGFKKVFEGLSDLHLLRI  309

Query  741   VNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYL  562
              N+ D+VP +P L            Y  VG + +I+ +KS+Y+K +       H L +YL
Sbjct  310   TNSTDIVPKIPIL---------FGIYTHVGEELEIDTTKSDYLKSNA----DAHNLDVYL  356

Query  561   HGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKN-KGMVQQDDGTWI  385
             HG+ G Q   G+F  +   DI  +NK+   LK +   +P EWW  +N K MVQ DDG W 
Sbjct  357   HGVAGVQETNGDFTLEVDHDIALINKHLDGLK-DDYKIPPEWWNNENFKNMVQMDDGHWK  415

Query  384   LDDH  373
             L D+
Sbjct  416   LVDN  419



>ref|XP_003528483.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31004.1| Phospholipase A1-IIgamma [Glycine soja]
Length=366

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 215/358 (60%), Gaps = 28/358 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M+SIA++WR L+G  NW+GLLD LD DLRRY++HYG +  A YD+F SE      G  RY
Sbjct  1     MDSIARKWRDLSGQSNWQGLLDSLDIDLRRYILHYGQLAQATYDAFNSE-----NGNCRY  55

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
                    + GLE  NPFKY +TK+ Y  S T        ++ S +       +NW GYVA
Sbjct  56    PMSDFFSKVGLENGNPFKYVVTKFLYATSQTSAPRACILNLFSKKE--WNTRTNWIGYVA  113

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VATD+GKE LGRRDI+V WRGT   SEW+++    +     +FA D+   VH G+Y MYT
Sbjct  114   VATDEGKEALGRRDIVVTWRGTIQASEWVDNLNFDLDPAPEMFAVDSPFQVHDGFYSMYT  173

Query  1029  STN-QDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             S N +D      S R+QV+ EV RL++ YKNEE+SITVTGHSLG++LATL+A+D+ A  +
Sbjct  174   SNNPEDVQFGLTSVRNQVQEEVKRLVEEYKNEEISITVTGHSLGAALATLSALDIVAQKW  233

Query  852   N-------NTDVLITAFLFASPKVGNEGFKKAFSHL--KNLRALRVVNNGDLVPMVPFLA  700
             N       +    +TAFLFASP+VGN  F K F+    KNLRALR+ N  D VP VPF  
Sbjct  234   NISKDQQPSKACPVTAFLFASPRVGNSHFGKIFNEYKDKNLRALRIRNKKDNVPKVPFRL  293

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE  526
                G       +  VG +  I+  KSE++K D  +    H L +YLHGI G +  K +
Sbjct  294   FPWG-------FTHVGEELVIDTRKSEFLKSDASS----HSLEVYLHGIAGTKEKKSD  340



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score =   288 bits (738),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 172/412 (42%), Positives = 231/412 (56%), Gaps = 37/412 (9%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
             +  A+RWR L+G  +W+GLLDP D DLRR +I YG M  A YD+F  E  S +AGLSR+A
Sbjct  9     DGTARRWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFA  68

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAV  1207
                  E   L   +   Y + ++ Y  +T+C A      ++S       +ESNW GYVAV
Sbjct  69    ACRFFERAQL-PGHAAAYRVARFVY--ATSCVAVPEPLILRSASRARRCRESNWIGYVAV  125

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             ATD+GK  LGRRDI+V WRGT    EWI+D    MV P+ +              ++ T 
Sbjct  126   ATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRD-----------KLPTP  174

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN  847
              + +S  N +SARDQV +EV +L+ +Y++EE+SITVTGHSLG++LATLNA D+  N +N 
Sbjct  175   WDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNR  234

Query  846   TDVL--------ITAFLFASPKVGNEGFKKAFSHLK--NLRALRVVNNGDLVPMVPFLAV  697
                         +TAF+FASP+VG  GFK+ F   +   LR LRV N  D+VP  P    
Sbjct  235   APRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP----  290

Query  696   EAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPK-GEFK  520
                   P   Y  VG +  I+  +S Y++    N L+WH L  YLHG+ G +G + G FK
Sbjct  291   ------PAPPYHGVGTELAIDTGESPYLRRPG-NELVWHNLECYLHGVAGARGGEAGRFK  343

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEAD  364
                  D+   NK  G L+ E   VP  WW+  N+GMV+  DG W L D E D
Sbjct  344   LAVERDVALANKSYGALRDEHA-VPAGWWIPSNRGMVRGADGRWTLMDREED  394



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score =   288 bits (736),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 173/403 (43%), Positives = 221/403 (55%), Gaps = 43/403 (11%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA RWR L+G  NW+ LL P+D DLRRY+IHYG   GA  D F     S+  G   Y  
Sbjct  4     SIATRWRDLSGEKNWKDLLHPVDPDLRRYVIHYGERAGAAGDLFNDTMASRGFGYCLYPP  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                    GLE  NPF Y +T +FY      GA             A   +SNW GYVAVA
Sbjct  64    DEFFSRAGLENGNPFMYEVTNFFY------GA-------------ADSNDSNWFGYVAVA  104

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK  LGRRDILV WRGT T  EWI+D R      + +F  D+   VH G+  +YT  
Sbjct  105   TDEGKTALGRRDILVSWRGTGTEPEWIDDARFFTTPAKELFGTDHAK-VHSGFLAIYTGK  163

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
               +S  N  SARDQV   V +L+D Y+NE++SITV GHSLG++LATLNA D+AA  +N  
Sbjct  164   VSNSPYNQTSARDQVLKAVRKLVDKYQNEDISITVVGHSLGAALATLNATDIAAKGYNKP  223

Query  849   ----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                 N   ++TAF +ASP VGN+ FK+    L  L  LR+ N+ D++P +P         
Sbjct  224   TDNSNKTCMVTAFAYASPHVGNQEFKEVIDGLIELHILRITNSTDIIPKLPV--------  275

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFD  502
               L+ Y DVG    I+ +KS Y++      +  H L ++LHG+ G Q   GEFK +   D
Sbjct  276   --LLGYTDVGENLAIDTTKSSYLRQG----INAHNLEVHLHGVAGVQ-ESGEFKLEVDRD  328

Query  501   IPQVNKYGGMLKVEKCPVPTEWWV-EKNKGMVQQDDGTWILDD  376
             I  +NK    L+  K  +P EWW  EK K MVQ   G W   D
Sbjct  329   IALINKKIDGLQ-NKYKIPPEWWNHEKFKNMVQMYTGRWQFVD  370



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 224/408 (55%), Gaps = 27/408 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA RWR L+G  +W+ LLDPLD  LR  LI YG +  A YD F SE  S  AG   +  
Sbjct  42    TIATRWRELHGETSWKNLLDPLDPHLRATLIAYGELAQATYDGFNSERRSPNAGSCLHGH  101

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
               LL  + +  ++P  Y +T++ Y  S+                DA  ++SNW GYVAVA
Sbjct  102   DDLLTASSV--SSPGHYKVTRFIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVAVA  159

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG----SLVHRGWYEM  1036
             TD+G E LGRRDI+V WRGT    EW+ D     V    +     G    ++VHRG+  +
Sbjct  160   TDEGAEALGRRDIVVAWRGTVKNLEWVNDLDFTPVSAAPVLGSAAGKNRLAVVHRGFLSV  219

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS+N+ S     SARDQV  EV RL++L+K+EE SITVTGHSLG+SLATLNAVDL ++ 
Sbjct  220   YTSSNKSSKFTKTSARDQVLEEVRRLVELHKDEETSITVTGHSLGASLATLNAVDLVSSG  279

Query  855   FNNTD--------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
              N             +TA +FASP VG+  F+ AF    +L+AL V N GD+VP+ P L 
Sbjct  280   TNKPSSSDGDKKPFPVTAIVFASPHVGDRFFRSAFGSFPDLKALHVQNVGDIVPLYPPL-  338

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                        Y DV  +  I   +S Y+      V + H L  YLHG+ G QG +G FK
Sbjct  339   ----------GYVDVATELTIRTIRSPYLSVPGTPVTL-HNLECYLHGVAGEQGSRGGFK  387

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDD  376
              +   D+  VNK    L  E  PVP  WW  K++ MV+ DDG W L D
Sbjct  388   LEVARDVALVNKGVDALTDEH-PVPAGWWTPKHRCMVRGDDGRWTLQD  434



>ref|XP_010686472.1| PREDICTED: phospholipase A1-II 1-like [Beta vulgaris subsp. vulgaris]
Length=411

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/388 (42%), Positives = 229/388 (59%), Gaps = 26/388 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA +W +L G ++WEG LDPLD DLRR +IHYG M  A YD+FI E  SK+AG SR+ K 
Sbjct  37    IADKWELLMGRNHWEGQLDPLDIDLRRNIIHYGEMAQATYDTFIREKYSKHAGASRFNKN  96

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             +   + GLE  +P+KY +TK+ Y  +T+       Y  +S+  +   ++SN+ G+VAVA 
Sbjct  97    NFFAKLGLELGHPYKYCVTKFIY--ATSGLEMPDAYIFKSLSIEPWCEDSNFMGFVAVAD  154

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQ--DNGS--LVHRGWYEMY  1033
             D+  E+LGRR+I+V WRGT    EW+ D +   V    I A   D+GS   VH+GW+ +Y
Sbjct  155   DESVELLGRREIVVAWRGTVQFLEWLNDLQFMQVSASEILAHEGDHGSEPEVHQGWHSVY  214

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             T+ N  S     +    V  E+ +L+D YKNE +SITVTGHSLG++LATLNA D+ AN  
Sbjct  215   TTDNLSSSFQKTNDTISVLTELTKLVDQYKNEVISITVTGHSLGAALATLNAADIVANKI  274

Query  852   NNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVE  694
             N           ++TA LFASP+VG+  F+K  S   +LR LRV N+ D VP        
Sbjct  275   NQPKSSSNAKPYMVTAILFASPRVGDANFQKLLSKCDDLRILRVRNSHDFVPN-------  327

Query  693   AGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQ  514
                  PL+ Y DVG +  I+ ++S Y+K+  L  +  H L +Y+HG+ G QG    FK  
Sbjct  328   ----YPLLGYSDVGEELIIDVAQSVYLKNPTLPSVS-HNLEVYMHGVAGSQGCAKGFKLV  382

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWV  430
                DI  +NK+   LK ++  VP +WWV
Sbjct  383   VKRDIALLNKFFDFLK-DEYDVPVDWWV  409



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/400 (42%), Positives = 227/400 (57%), Gaps = 25/400 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA RWR L+G +NW+GLLDPLD DLR  +++YG    A+ D++ ++      G SR+  
Sbjct  11    NIADRWRELSGENNWKGLLDPLDFDLRSSILNYGDRAVAIGDAYNNKKYEDLHGFSRFPP  70

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
               L  + G+   N F Y +T + Y+      A   G  ++         ES W  YVAVA
Sbjct  71    NELFTKVGVRARNEFDYNVTDFIYS---RLEAQLFGIVIED--------ESTWCAYVAVA  119

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNGSLVHRGWYEMYTS  1027
             TD GK+ LGRRDI+V WRGT    E +ED   IP+    +    +N  L+H G++++YT+
Sbjct  120   TDDGKKKLGRRDIVVSWRGTILPGEKLEDVEFIPIPASDMFPNNNNDPLIHSGFHQIYTT  179

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
                +S  N  SARDQV   V +L+D YK+EEVSITVTGHSLGS+LATLNA+D+     N 
Sbjct  180   EKDNSIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMDIVYKGINK  239

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  N    +TA +FASP VGNEGFKK F  L ++  LRV N  D VP +P   +    
Sbjct  240   PTGTANKSFPVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENAKDPVPTLPPNKL---I  296

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCF  505
             ++P   Y  VG    I+ + S ++K   +N    H L +YLHG+ G QG KG F      
Sbjct  297   VIPQHRYYHVGESLPIDTTLSPFLKTSDVNP---HDLNVYLHGVAGTQGSKGGFNLDYPL  353

Query  504   DIPQVNK-YGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW  388
             D   +NK   G+ +     +P  WWVE+N GMV QDDGT+
Sbjct  354   DTALINKTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTY  393



>gb|KDP46903.1| hypothetical protein JCGZ_24112 [Jatropha curcas]
Length=402

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 168/401 (42%), Positives = 226/401 (56%), Gaps = 28/401 (7%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             ++A RWR L+G +NWEGLLDPLD DLR  +++YG    A+ D++ ++      G SR   
Sbjct  11    NVADRWRELSGENNWEGLLDPLDFDLRCSILNYGDRAAAIGDAYNNKKYEDLHGFSRVPP  70

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMK-ESNWGGYVAV  1207
               L  + G+   N F YT+T + Y+             ++    D V++ ES W  YVA 
Sbjct  71    NELFTKVGVRARNEFDYTVTDFIYS------------RLEVQWFDTVIEDESTWCAYVAG  118

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFR-IPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             ATD GK+ LGRRDI+V WRGT    E + D   IP+    I    +N  L+H G++ +YT
Sbjct  119   ATDDGKKKLGRRDIVVSWRGTILPGEKLNDLEFIPIPASDIFPNNNNDPLIHFGFHRIYT  178

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + N +S  N  SARDQV   V +L+D YK+EEVSITVTGHSLGS+LATLNA+D+     N
Sbjct  179   TENDNSIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMDIVYKGIN  238

Query  849   ------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
                   N    +TA +FASP VGNEGFKK F  L ++  LRV N  D VP +P       
Sbjct  239   KPTGTANKSFPVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENANDPVPKLP----PND  294

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGC  508
              ++P   Y  VG    I+ + S ++K   +N    H L +YLHG+ G QG KG F     
Sbjct  295   ILIPQHRYYHVGESLPIDTTLSPFLKTSDVNP---HDLNVYLHGVAGTQGSKGGFNLDYP  351

Query  507   FDIPQVNK-YGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTW  388
              D   +NK   G+ +     +P  WWVE+N GMV QDDGT+
Sbjct  352   LDTALINKTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTY  392



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 174/407 (43%), Positives = 228/407 (56%), Gaps = 56/407 (14%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IAKRWR L+G ++W+GLL PLD DLR+Y+IHYG M  A YD+F     SKYAG S Y++K
Sbjct  35    IAKRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRK  94

Query  1380  SLLEETGLEKANPF-KYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                 + GLEKA+P+ KY +TK+ Y  S         + +  V  +   KESNW GYVAV 
Sbjct  95    DFFAKVGLEKAHPYTKYKVTKFLYATSEIHVPE--AFLLFPVSREGWSKESNWMGYVAVT  152

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
              D+G  + G +                                 N   +H+GW+ +Y S 
Sbjct  153   DDQGTAIFGEKY--------------------------------NQVQIHQGWHSIYMSE  180

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN-  847
             ++ SH N  +ARDQV  E+ RLL+ YK+EEVSI++ GHSLG++LATLNA D+ AN +N  
Sbjct  181   DERSHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRP  240

Query  846   -----TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                      +TAF+FASP+VGN  +KK FS L+++R LRV N  D+VP           I
Sbjct  241   KSRPGKSCPVTAFVFASPRVGNSEYKKLFSRLEDIRVLRVRNLPDVVP-----------I  289

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE--FKPQGC  508
              P + Y +VG +  I+  KS+Y+K    N   +H L  YLHG+ G QG      F+    
Sbjct  290   YPPLGYAEVGDELPIDTRKSQYMKTPG-NFATFHCLESYLHGVAGTQGTSSGDLFRLDVK  348

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEA  367
               I  VNK    LK E   VP  W V KNKGMVQQDDG+WIL DHE 
Sbjct  349   RAIGLVNKSVDGLKDEYM-VPGHWRVLKNKGMVQQDDGSWILLDHET  394



>dbj|BAJ85084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 179/422 (42%), Positives = 231/422 (55%), Gaps = 39/422 (9%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             ++A RWR L+GSD+W+GLLDPLD DLRR +I YG +  A +D F  E  S +AGL  Y++
Sbjct  29    NMASRWRELHGSDSWKGLLDPLDVDLRRSIIAYGELASAAHDGFNLEKRSPHAGLCLYSR  88

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHH------------GGYHVQSVRADAVM  1240
               LL  + +   +P  Y +TK+ Y    TCG                   VQ +      
Sbjct  89    DRLLSASTV--THPEYYKVTKFLYA---TCGGSTVSRLATSVPTVTSALFVQPLGKAEGT  143

Query  1239  KESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRII---FAQDN  1069
               SNW GYVAVAT++G   LGRRDI+VVWRGTE   EW +D     V    +   +A D 
Sbjct  144   PTSNWMGYVAVATEEGVAALGRRDIVVVWRGTENDLEWEQDKDCRQVSAAPVLGRYAHDE  203

Query  1068  --GSLVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSS  895
                + VHRG+  +YTS++ +S  N  SAR+QV  EV RL+  YK E  SITVTGHSLG+S
Sbjct  204   YRNAEVHRGFLSVYTSSDNNSMYNKTSAREQVLEEVGRLMKEYKEEVTSITVTGHSLGAS  263

Query  894   LATLNAVDLAANPF------NNTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNN  733
             LATL A+D+ AN        N     +TA L ASP+VGN+ FK AF    +LRAL V N 
Sbjct  264   LATLTAIDMVANDVNVPPASNQPPCPVTAILLASPRVGNDAFKSAFGSFDHLRALHVANA  323

Query  732   GDLVPMVPFLAVEAGTILPLIAYKDVGV-QFDINASKSEYVKHDKLNVLMWHGLMIYLHG  556
              D+VPM P       ++L L+ Y D       I+  +S YV H    +L  H L +YLHG
Sbjct  324   KDIVPMNP------PSVLLLMQYVDSATATIVIDTDRSPYVVH---KMLTHHVLELYLHG  374

Query  555   IDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDD  376
             + G  G K +F+     D+  VNK   +L  E   VP  WWV   K M +  DG W LDD
Sbjct  375   VAGDHGDKADFQLVVPRDLALVNKTTDLLNDEH-QVPACWWVIHRKCMAKGTDGQWKLDD  433

Query  375   HE  370
              E
Sbjct  434   FE  435



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score =   287 bits (735),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 166/399 (42%), Positives = 219/399 (55%), Gaps = 41/399 (10%)
 Frame = -2

Query  1539  LNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLEETG  1360
             ++GS+ W GLLDPL+ D+RR +I YG +  A  D FI++P S YAG  RY+  S    T 
Sbjct  6     ISGSNQWSGLLDPLNIDVRREVIRYGELAQATSDGFITDPASPYAGACRYSPASFF--TK  63

Query  1359  LEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDKGKEVL  1180
             ++ ++P  Y +T++ Y  +T+      G+  + +   A   ESNW GYVAVATD+G   L
Sbjct  64    VQASDPGAYRVTRFIY--ATSSARLPEGFMARPLPVGAWSTESNWMGYVAVATDRGAAAL  121

Query  1179  GRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMYTSTNQDSH  1009
             GRRDI+V WR T+  +EW  D    +V    I     G     VHRG+  +YTS N  S 
Sbjct  122   GRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYVHRGFLSVYTSKNSTSR  181

Query  1008  LNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTDVLIT  829
              N  SAR+QV  EV  LLD YKNE+ SI++TGHSLG +L+TLNA+DL AN FN       
Sbjct  182   FNRRSAREQVLTEVRALLDTYKNEDCSISITGHSLGGALSTLNAIDLVANGFN-------  234

Query  828   AFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGV  649
                          FKKAF  +  L  LRV N  D+VP          TILP + Y DVGV
Sbjct  235   -------------FKKAFHAMAGLSLLRVRNVPDIVP----------TILPPVIYADVGV  271

Query  648   QFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGEFKPQGCFDIPQVNKYGG  475
             +  ++  KS Y+K +K     WH L  YLHG+ G  G      F  +   D+  +NK   
Sbjct  272   ELLVDTRKSPYLK-EKAGPAQWHNLEGYLHGVAGTHGAGDSAGFGLEVDRDLALINKEED  330

Query  474   MLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHEADHV  358
              L+ ++ PVP  WW E NKGMV+   G W+L DHE D  
Sbjct  331   ALR-DEYPVPAMWWAENNKGMVKNATGHWVLHDHEQDEC  368



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/404 (41%), Positives = 236/404 (58%), Gaps = 32/404 (8%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSF--ISEPTSKYAGLSRY  1390
             SIA RWR L+   +W+GLL+PLD DLRR +I+YG    A+ ++F   S  ++   G SRY
Sbjct  11    SIADRWRELSSEKSWKGLLNPLDIDLRRSIINYGDRATAIGNAFNNTSLRSTNCCGFSRY  70

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A +    +TG++  NP+KY +T + Y          G    + +  D    ES W  YVA
Sbjct  71    APRDFFSKTGIQTRNPYKYQVTDFIY----------GEVDAKILILDD--SESTWSAYVA  118

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             VAT++GK +LGRRDI+V WRGT    EW++DF   ++    IF  D   + H+G++ +YT
Sbjct  119   VATNEGKALLGRRDIVVSWRGTLLSVEWLKDFDAELISAPEIFRNDVAKM-HKGFHSLYT  177

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             + +  S  +  SARDQV A V +L++ YK+EE+SITVTGHSLG+++ATLNA+D+     N
Sbjct  178   AKDDKSTYSKTSARDQVLAAVSKLVEQYKDEEISITVTGHSLGAAIATLNALDIVVKGCN  237

Query  849   NTD------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
              T         +TA +FASP+VG+  FKK     ++L  LRV N  D+VP +P       
Sbjct  238   KTTGEQNKAFPVTAIVFASPRVGDANFKKLCEGQEDLHVLRVTNERDIVPNLPL------  291

Query  687   TILPLIAYKDVGVQFDINASKSEYVKH-DKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
              + P  ++K VG +  I+  KS YVK  D L    +H L +Y+HG+ G QG +G F  + 
Sbjct  292   DMPPYFSFKHVGEELRIDTRKSPYVKSMDDLG--DFHNLELYIHGVAGTQGSEGGFNLEV  349

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWW-VEKNKGMVQQDDGTWIL  382
               DI  VNK    LK ++  +P  WW +E NKGMV  DDG W L
Sbjct  350   DRDIALVNKDLDGLK-DEYKIPAGWWGIEDNKGMVLGDDGRWKL  392



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 218/379 (58%), Gaps = 18/379 (5%)
 Frame = -2

Query  1491  DLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKSLLEETGLEKANPFKYTITKYFY  1312
             DLRRYLIHYG M  A YD+FIS+  S YAG  RY  K +     L  ANPFKY   KY Y
Sbjct  2     DLRRYLIHYGEMAQATYDNFISDVRSDYAGDYRYPMKKMFSGVDLNIANPFKYRAVKYVY  61

Query  1311  TPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRS  1132
               S         + V+S+       + NW GYVAVATD+GK +LGRRDI++ WRGT    
Sbjct  62    ATSKVELPQ--SFMVKSLAKQPWSSQCNWIGYVAVATDEGKAMLGRRDIVIAWRGTIQPI  119

Query  1131  EWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLD  952
             EW++DF+ P++    I   D    VH+G+  +Y + +  S  +  SAR+QV  EV RL+ 
Sbjct  120   EWVKDFQAPLISASNILKWDKDPRVHQGFLSLYNTADFVSAYSKTSAREQVIEEVKRLMQ  179

Query  951   LYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTD-----VLITAFLFASPKVGNEGF  787
              +K+EE S+TVTGHSLG++LATLNA+D+AAN FN  D       +TAF+FASP+VG+  F
Sbjct  180   EFKHEETSLTVTGHSLGAALATLNAIDIAANGFNIGDESKERSPVTAFVFASPRVGDRNF  239

Query  786   KKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDINASKSEYVKH  607
             K+    ++NL  L++ N  DLVP+ P    E+G       Y DVG +  +N   S +V  
Sbjct  240   KELSESVENLHILKIKNLNDLVPLTP--PKESG-------YADVGKELLLNTLISPFVNR  290

Query  606   DKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVE  427
                  L WH L  YLHG+ G QG K  F  +   DI  +NK    L+ +   +P  W   
Sbjct  291   PG-GPLSWHNLEAYLHGVAGTQGDKPVFHLEVKRDIALLNKEISNLQPDYL-IPPAWRCP  348

Query  426   KNKGMVQQDDGTWILDDHE  370
             +N GMV+  DG+W L D E
Sbjct  349   RNTGMVKMKDGSWELRDQE  367



>gb|EMT04701.1| Lipase [Aegilops tauschii]
Length=373

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 209/353 (59%), Gaps = 21/353 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             + A RW+ L+G  +WEGLL PLD +LRR +I YG M  A YD+F  E  S +AG SR+  
Sbjct  15    TAAARWKELHGERSWEGLLRPLDLELRRTVIWYGEMAQATYDAFNYEKHSPHAGHSRFGS  74

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
             K   E   L   +   Y IT++ Y   +   A    + V+S    +  KESNW GYVAVA
Sbjct  75    KRFFEHVML-PGHAAAYRITRFLYATCSAPAAPAATF-VRSCHPQSRSKESNWIGYVAVA  132

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS--LVHRGWYEMYT  1030
             TD GK  LGRRD++VVWRGT    EWI+D    MV P+ I  +  G+  +V RGW+ +YT
Sbjct  133   TDAGKATLGRRDVVVVWRGTIQALEWIKDLEFAMVHPKGILGEVTGAEAMVDRGWFSIYT  192

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             ST+Q S  N  SAR QV AEV +L+D YK+EEVSITVTGHSLG++LATL+A D+A N +N
Sbjct  193   STDQASTHNKVSARKQVLAEVRKLVDTYKDEEVSITVTGHSLGAALATLSAFDIAENGYN  252

Query  849   NTDVL---ITAFLFASPKVGNEGFKKAF--SHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
              T      +TAF FA P+VG  GFK+ F  +    LR LRV N  D+VP  P L      
Sbjct  253   CTPAAAFPVTAFAFACPRVGGAGFKRRFNTATAAGLRVLRVCNARDIVPRYPGL------  306

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGE  526
                   Y DVGV+  I+ S S Y+K    +  +WH L  YLHG+ G     G+
Sbjct  307   -----PYHDVGVELAIDTSASPYLKAPG-DENVWHNLECYLHGVAGAPTASGQ  353



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/440 (40%), Positives = 238/440 (54%), Gaps = 61/440 (14%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + SI+ RWR L+G+ +W GLLDPLD+DLR  +I YG +  A YD F +E  S +AG   Y
Sbjct  5     LGSISNRWRELHGASSWAGLLDPLDADLRASVIAYGELAEATYDGFNTERRSPHAGACVY  64

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYH--------------------  1270
                 LL   G + ++P  Y +TK+ Y    TCG                           
Sbjct  65    GHADLL--AGADVSSPGNYAVTKFLYA---TCGITQLASTSTTRESTSASRLAKAFLVLP  119

Query  1269  VQSVRADAVMKESNWGGYVAVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRI------  1108
             V  ++ +   +ESNW GYVAVATD G   LGRRDI+V WRGT    EW+ D         
Sbjct  120   VPELKEEPWCRESNWMGYVAVATDDGVAALGRRDIVVAWRGTLESLEWVNDLDFLPASAA  179

Query  1107  PMVKPRIIFAQDNG-SLVHRGWYEMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEV  931
             P++ P    A+++G ++VH G+  +YT++++DS  N  SARDQV  EV RL++L+K E  
Sbjct  180   PVLGPA---AEEHGNAVVHHGFLTVYTASDEDSKYNKTSARDQVLEEVKRLMELHKGEVT  236

Query  930   SITVTGHSLGSSLATLNAVDLAANPFNNTDVL-----------ITAFLFASPKVGNEGFK  784
             SIT+TGHSLG+SLA LNAVD+ +N  N                +TA +FA P VGN+ FK
Sbjct  237   SITLTGHSLGASLAILNAVDIVSNGLNTPSTSSSSSSQLPPCPVTAIVFACPHVGNDDFK  296

Query  783   KAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVG-VQFDINASKSEYVKH  607
              AF+   +LRAL V+N  D+VP+            P I Y DV      I+ S+S Y++ 
Sbjct  297   SAFASFSDLRALHVINARDIVPL-----------YPPIGYVDVATAALRIDTSRSPYLRS  345

Query  606   DKLNVLMWHGLMIYLHGIDGFQGPKGE-FKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWV  430
                    WH L  YLHG+ G QG +G  F+ +   D+  VNK    LK ++ PVP  WWV
Sbjct  346   PG-TPQTWHNLECYLHGVAGEQGGQGRGFRLEVDRDVALVNKGSDALK-DEYPVPANWWV  403

Query  429   EKNKGMVQQDDGTWILDDHE  370
               NKGMV+   G W L D E
Sbjct  404   VSNKGMVRGAGGHWKLKDFE  423



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 237/405 (59%), Gaps = 27/405 (7%)
 Frame = -2

Query  1557  AKRWRVLNG--SDN--WEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             A+RWR L+G   DN  W GLLDPLD DLRR ++ YG M  A YD+F  E +S +AGLSR+
Sbjct  12    ARRWRELHGVGGDNSGWAGLLDPLDLDLRRTVLRYGEMAQATYDAFNRERSSPHAGLSRF  71

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             A+    +   L  A+   Y +T++ Y  S+   A    + ++SV      +ESNW GYVA
Sbjct  72    ARARFFDRVRL-PAHAAAYRVTRFLYATSSV--ALPDAFMLRSVSRSRRCRESNWIGYVA  128

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS---LVHRGWYE  1039
             VATD+GK  LGRRD++VVWRGT  + EW +D   PMV  + +      +   +VHRGW  
Sbjct  129   VATDEGKAALGRRDVVVVWRGTMQKLEWADDLEFPMVSTKGLLGDGQAACDAMVHRGWLS  188

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             MYTS +  S  N +SAR Q  +EV RL+D Y +EE SITV GHSLG++LATLNA D+AAN
Sbjct  189   MYTSIDPASSHNQDSARHQALSEVRRLVDAYSDEERSITVVGHSLGAALATLNAFDIAAN  248

Query  858   PFN----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
              +N         +TAF FASP+VG  GFKK F  +  LR LRV N  D+VP         
Sbjct  249   GYNVATGAAACPVTAFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPK--------  300

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
                 P++ Y DVG +  I+  +S Y++        WH L +YLHG+ G +G +G F+   
Sbjct  301   ---YPIVFYHDVGAELAIDTGESPYLRSPGRE-HTWHNLEVYLHGVAGTRGARGGFELAV  356

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDD  376
               D+  VNK   +L  +   VP  WWV  NKGMV+  DG W L D
Sbjct  357   ARDVALVNKLYDVLW-DDYGVPPGWWVPLNKGMVEGADGRWSLMD  400



>ref|XP_002892328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68587.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/358 (44%), Positives = 211/358 (59%), Gaps = 26/358 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E I KRW+VL+G + W+GLLDPLD DLRRY+IHYG M    YD+F  +  SKYAG   Y
Sbjct  2     VEGIPKRWKVLSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSKYAGDCYY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
             +K  L   TG  KANPF+Y +TKY Y  +T        + V+S+  DA   ++NW GY+A
Sbjct  62    SKNQLFARTGFLKANPFRYNVTKYIY--ATASIKLPICFIVKSLSKDASRVQTNWMGYIA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD+GK +LGRRDI+V WRGT    EW  DF  P+     +F     +DN   +  GW 
Sbjct  120   VATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVTDPKDNPR-IGSGWL  178

Query  1041  EMYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAA  862
             ++YT+++  S  ++ SA++QV+ E+ RLL+LYKNEE+SIT TGHSLG+ ++ L+A DL  
Sbjct  179   DIYTASDSRSPYDTTSAQEQVQGELKRLLELYKNEEISITFTGHSLGAVMSVLSAADLVY  238

Query  861   NPFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
                N  +       V IT F F SP++G+  FK     L+ L  LR+VN  D+ P     
Sbjct  239   GKKNKVNISLQKKQVPITVFAFGSPRIGDHNFKNIVDSLQPLNILRIVNVPDVAPH----  294

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKG  529
                     PL+ Y ++G   +IN   S Y+K   LN   +H L  YLHGI G Q   G
Sbjct  295   -------YPLLLYAEIGEVLEINTLNSTYLKR-SLNFRNYHNLETYLHGIAGMQDTAG  344



>gb|KHG20660.1| Phospholipase A1-IIgamma -like protein [Gossypium arboreum]
Length=383

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 174/405 (43%), Positives = 224/405 (55%), Gaps = 45/405 (11%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             +IA RWR L+G +NWEGLLDPLD + RRYLIHY     A  D+F     SK   LS Y  
Sbjct  5     AIASRWRELSGENNWEGLLDPLDLEFRRYLIHYLQRAAAASDAFNGTKASKGYALSLYPP  64

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                    GLEK NP++Y +T + Y  ++                     E  + GYVAVA
Sbjct  65    DEYFARVGLEKGNPYRYKVTNFIYAATSD-------------------DEVAYFGYVAVA  105

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSL-VHRGWYEMYTS  1027
             TD+GK VLGRRDILV WRGT T SEW+ D  I     + +F    GS+ VH G+Y  Y +
Sbjct  106   TDEGKVVLGRRDILVSWRGTITISEWVSDANIFRTSAKDLFG--TGSVKVHTGFYNTYMN  163

Query  1026  TNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN-  850
             +N +S     SAR Q    V  L+D Y+NEEVSITVTGHSLG++LATLNA+D+A N FN 
Sbjct  164   SNANSPYTKTSARQQACKAVKELVDKYQNEEVSITVTGHSLGAALATLNAMDIAHNGFNK  223

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                  N   ++T FL ASP+VGN  FK     L+N   LR+VN  D VP VPF       
Sbjct  224   PTDNTNKAFMVTCFLAASPRVGNLAFKGVCDRLENFHILRIVNYKDPVPKVPFGP-----  278

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKG-EFKPQGC  508
                   Y  VG + +I+ +KS Y+K +K+N    H L  Y HGI G Q  +  + + +  
Sbjct  279   -----KYFHVGEELEIDTTKSPYLK-EKINP---HNLEGYQHGIAGMQKDRDFKLEEELD  329

Query  507   FDIPQVNKYGGMLKVEKCPVPTEWWVEK-NKGMVQQDDGTWILDD  376
             FD   +NK    L ++K  +P  WW ++  K MVQ DDG W  +D
Sbjct  330   FDNAVINKSSDGL-LDKYKIPDNWWTQELFKNMVQTDDGHWKFND  373



>ref|NP_001043734.1| Os01g0651800 [Oryza sativa Japonica Group]
 sp|Q8RZ40.1|PLA3_ORYSJ RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB89211.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05648.1| Os01g0651800 [Oryza sativa Japonica Group]
Length=420

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 226/408 (55%), Gaps = 26/408 (6%)
 Frame = -2

Query  1557  AKRWRVLNGS--DNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             A+RWR  +G   D W+GLLDPLD+DLRR +I YG +  A  D+ I +P S +AG SRYA 
Sbjct  21    AQRWRQTSGGGKDRWDGLLDPLDADLRRDIIRYGELAQATSDALIGDPASPFAGASRYAP  80

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              + L +  +  ++P  Y +T++ Y  S+                 A   ESNW GYVAVA
Sbjct  81    DAFLRK--VRASDPDAYRVTRFVYATSSVRLPDAFMPRPAPSAGAAWSGESNWMGYVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMY  1033
              D      GRRDI+V WRGT+   EW  D  I +V    +     G     VHRG+  +Y
Sbjct  139   ADGVAAKAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSVHRGFLSVY  198

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  N  SAR+QV AE+ RLL  YKNE  SIT+TGHSLG++L+TLNA+D+ AN +
Sbjct  199   TSKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNAIDIVANGY  258

Query  852   N-----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
             N        V +TA   ASP+VG++ FK+AF    NL  LRV N  D+VP          
Sbjct  259   NVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTSNLSLLRVRNAPDIVP----------  308

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGEFKPQ  514
             TILP   +KDVG +  ++  +S Y+K+       WH L  YLH + G QG      F   
Sbjct  309   TILPSAFFKDVGAELLVDTRRSPYLKN-PAGPAQWHNLECYLHAVAGTQGAGDGAGFSLV  367

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                D+  VNK    L+ ++  VP  WWVEKNKGMVQ   G W+L DHE
Sbjct  368   VDRDLALVNKEVDALR-DEYQVPAAWWVEKNKGMVQNASGRWVLQDHE  414



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 177/423 (42%), Positives = 234/423 (55%), Gaps = 40/423 (9%)
 Frame = -2

Query  1566  ESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYA  1387
              + A RWR L G+++W GLLDPLD DLRR +I YG ++ A YD F  E  S +AG   Y 
Sbjct  38    SATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLYG  97

Query  1386  KKSLLEETGLEKANPFKYTITKYFYTPST--TCGAHHGGYHVQSVRADAVMKESNWGGYV  1213
             +  LL   G+  A   +Y +T++ Y  S     G+      +   R +A  +ESNW GYV
Sbjct  98    RADLLPGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETR-EAWSRESNWIGYV  154

Query  1212  AVATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGW  1045
             AVATD+G   LGRRD++V WRGT    EW  DF    V    +     A +  ++VH+G+
Sbjct  155   AVATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVLGSAAAANPLAVVHQGF  214

Query  1044  YEMY--------TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLA  889
               +Y        TS N DS  N  SARDQV  EV RL++LYK E  SITV GHSLG++LA
Sbjct  215   LSVYQLSSLTLTTSCNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALA  274

Query  888   TLNAVDLAANPFN-------NTDVLITAFLFASPKVGNEGFKKAF-SHLKNLRALRVVNN  733
             TLNAVD+AAN  N            +TA LFA P VG+  F+ AF    ++LRAL V N 
Sbjct  275   TLNAVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGSFRDLRALHVRNA  334

Query  732   GDLVPMVPFLAVEAGTILPLIAYKDVGVQ-FDINASKSEYVKHDKLNVLMWHGLMIYLHG  556
             GD+VP+VP L           AY DV V    I+ S+S Y++       + H L  YLHG
Sbjct  335   GDVVPLVPPL-----------AYVDVAVAVLPIDTSRSPYLRSPGPAGTL-HNLECYLHG  382

Query  555   IDGFQ-GPKGEFKPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
             + G Q    G F+ +   D+  VNK    L+ ++ PVP  WWV +N+ MV+  +G W+L 
Sbjct  383   VAGKQSSAAGGFRLEVDRDVALVNKGADALR-DEYPVPANWWVPENRWMVRGSEGHWMLK  441

Query  378   DHE  370
             D E
Sbjct  442   DFE  444



>sp|A2WTA0.1|PLA3_ORYSI RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|EAY75196.1| hypothetical protein OsI_03088 [Oryza sativa Indica Group]
Length=420

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 173/408 (42%), Positives = 226/408 (55%), Gaps = 26/408 (6%)
 Frame = -2

Query  1557  AKRWRVLNGS--DNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             A+RWR  +G   D W+GLLDPLD+DLRR +I YG +  A  D+ I +P S +AG SRYA 
Sbjct  21    AQRWRQTSGGGKDRWDGLLDPLDADLRRDIIRYGELAQATSDALIGDPASPFAGASRYAP  80

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              + L +  +  ++P  Y +T++ Y  S+                 A   ESNW GYVAVA
Sbjct  81    DAFLRK--VRASDPDAYRVTRFVYATSSVRLPDAFMPRPAPSAGAAWSGESNWMGYVAVA  138

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMY  1033
              D      GRRDI+V WRGT+   EW  D  I +V    +     G     VHRG+  +Y
Sbjct  139   ADGVAANAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSVHRGFLSVY  198

Query  1032  TSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPF  853
             TS +  S  N  SAR+QV AE+ RLL  YKNE  SIT+TGHSLG++L+TLNA+D+ AN +
Sbjct  199   TSKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNAIDIVANGY  258

Query  852   N-----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAG  688
             N        V +TA   ASP+VG++ FK+AF    NL  LRV N  D+VP          
Sbjct  259   NVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTPNLSLLRVRNAPDIVP----------  308

Query  687   TILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGEFKPQ  514
             TILP   +KDVG +  ++  +S Y+K+       WH L  YLH + G QG      F   
Sbjct  309   TILPSAFFKDVGAELLVDTRRSPYLKN-PAGPAQWHNLECYLHAVAGTQGAGDGAGFSLV  367

Query  513   GCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                D+  VNK    L+ ++  VP  WWVEKNKGMVQ   G W+L DHE
Sbjct  368   VDRDLALVNKEVDALR-DEYQVPAAWWVEKNKGMVQNASGRWVLQDHE  414



>ref|XP_004961148.1| PREDICTED: phospholipase A1-II 6-like [Setaria italica]
Length=409

 Score =   281 bits (718),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 177/410 (43%), Positives = 230/410 (56%), Gaps = 33/410 (8%)
 Frame = -2

Query  1557  AKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKKS  1378
             A+RWR L+G   W+GLLDPLD DLRR ++ YG M  A YD+F  E  S +AGLSR+A+  
Sbjct  11    ARRWRELHGEGGWDGLLDPLDLDLRRTVLRYGEMAQATYDAFNHEALSPHAGLSRFARAR  70

Query  1377  LLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVATD  1198
               +   L   +   Y +T++ Y  S+      G + ++S       +ESNW GYVAVATD
Sbjct  71    FFDRVRL-PGHAAAYRVTRFLYATSSLPVP--GAFILRSASGAGRCRESNWIGYVAVATD  127

Query  1197  KGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG--SLVHRGWYEMYTST  1024
             +GK  LGRRD++V WRGT    EW+ED    MV PR +        ++VHRGW  MYTS 
Sbjct  128   EGKAALGRRDVVVAWRGTVQALEWVEDLEFAMVPPRGLLGDREACDAMVHRGWLSMYTSA  187

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN--  850
             +  S  N +SARDQ   EV RL+D YK+EE+SITVTGHSLG++LATLNA D+AAN +N  
Sbjct  188   DPVSSHNQDSARDQALREVRRLVDTYKDEELSITVTGHSLGAALATLNAFDIAANGYNVA  247

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                       +TAF FA P+VG  GFKK F  +  LR LRV N  D+VP           
Sbjct  248   PAAAGMAACPVTAFAFACPRVGGSGFKKRFDAVSGLRLLRVRNARDIVPR----------  297

Query  684   ILPLIAYKDVGVQFDINASKSEYVK---HDKLNVLMWHGLMIYLH--GIDGFQGPKGEFK  520
               P + Y DVG +  I+   S Y++   H++     WH L +YLH           G F+
Sbjct  298   -YPAVFYHDVGAELAIDTGASPYLRSPGHEQ----TWHNLEVYLHGMAGARGGAGGGGFE  352

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
                  D+  VNK    L+ +   VP  WWV  N+GMV+  DG W L D E
Sbjct  353   LAVARDVALVNKAYDALR-DDHGVPPGWWVPHNRGMVKGSDGRWRLMDCE  401



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 228/405 (56%), Gaps = 24/405 (6%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             + A RWR L+G+++W GLLDPLD DLR+ +I YG +  A  D F  E  S +AG   Y +
Sbjct  27    TTAVRWRELHGNNSWNGLLDPLDIDLRKSVIAYGELAQAAQDGFNHERRSPHAGACLYGR  86

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAV-MKESNWGGYVAV  1207
               LL   G+  A    Y +TK+FY  S                 DA   +ESNW GYVAV
Sbjct  87    SDLLAGVGVAAAG--SYAVTKFFYATSAVPVPESVLLLPLPELGDAAWCRESNWIGYVAV  144

Query  1206  ATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWYE  1039
             ATD+G   LGRRDI+V WRGT T  EW  DF    V    +     A +  ++VH+G+  
Sbjct  145   ATDEGVAELGRRDIVVAWRGTVTDLEWANDFSFTPVSAAPVLGSSAAANPLAMVHQGFLS  204

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YTS+N +S  N  SARDQV  EV RL+ LYK+EE SIT+TGHSLG++LA LNAVD+AAN
Sbjct  205   VYTSSNANSKYNKASARDQVFEEVRRLMQLYKDEETSITITGHSLGAALAVLNAVDIAAN  264

Query  858   PFNNTD----VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEA  691
               N         +TA +FA P VG+  FK AF   ++LRAL V N GD+VP+VP +    
Sbjct  265   GLNAASSQPPCPVTAVVFACPHVGDRSFKAAFDSFEHLRALHVKNAGDVVPIVPPVVYVD  324

Query  690   GTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQG  511
               +L             I+  +S Y+K     V   H L  YLHG+ G QG  G FK + 
Sbjct  325   VGVL-----------LAIDTGRSPYLKKPG-TVQTLHNLECYLHGVAGEQGRAGGFKLEV  372

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDD  376
               D+  VNK    L+ ++ PVP  WWV KNK MV+  DG W L+D
Sbjct  373   DRDVALVNKGVDALE-DEYPVPANWWVPKNKWMVRGADGHWKLED  416



>ref|XP_007025428.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28050.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=381

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 221/404 (55%), Gaps = 46/404 (11%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA RWR L+G  NW+GLL PLD DLRRY+IHY    GA  D F     SK  GLS Y   
Sbjct  5     IASRWRELSGEKNWKGLLHPLDLDLRRYIIHYLQRAGAAGDIFNDNRASKSFGLSLYPPD  64

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
                   GLE  NP+KY +T + Y                     A   +S + G+VAVAT
Sbjct  65    EYFSRAGLEIGNPYKYRVTNFIYG--------------------AADNKSEYFGFVAVAT  104

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTSTN  1021
             D+GK VLGRRDILV WRGT T ++W ED        + +F  D+   VH G+  +YT   
Sbjct  105   DEGKAVLGRRDILVSWRGTVTSADWNEDKNFFPTSAKELFGTDSAQ-VHSGFLSIYTGKL  163

Query  1020  QDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN--  847
              DS  +  SARDQ    V   +D Y+NEEVSITV G+SLG++LATLNA+D+ AN FN   
Sbjct  164   ADSLYSKTSARDQALKAVQDQVDKYQNEEVSITVAGYSLGAALATLNAMDIVANGFNKPT  223

Query  846   ----TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTIL  679
                    ++TAF  ASP+VGN+ F + F+ L++L  LR+VN+ D +P VP          
Sbjct  224   GNSAKSFMVTAFPVASPRVGNQKFLEIFNELEDLHLLRIVNSTDHIPTVPV---------  274

Query  678   PLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK--PQGCF  505
                 Y  VG +  I+ +KS Y+K +       H L +Y HG+ G Q   GEFK   +  F
Sbjct  275   -GFGYTHVGEELGIDTTKSTYLKSNADP----HNLGVYGHGVAGVQ-ENGEFKLEEELDF  328

Query  504   DIPQVNKYGGMLKVEKCPVPTEWW-VEKNKGMVQQDDGTWILDD  376
             D   VNK+G  L ++K   P EWW  EK KGMVQ DDG W   D
Sbjct  329   DNATVNKHGDCL-LDKYKTPIEWWNNEKFKGMVQIDDGHWKFVD  371



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   280 bits (716),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 175/447 (39%), Positives = 228/447 (51%), Gaps = 63/447 (14%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             + ++A RWR L+G ++W+GLLDPLD  LR  +I YG M+ A YD+F +E  S + G   Y
Sbjct  38    LGTVASRWRELHGENSWKGLLDPLDPHLRSSIISYGEMVQAAYDAFNTERRSPHCGACFY  97

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
               + LL   G+   +   Y +TK+ Y  S+                D   +ESNW GYVA
Sbjct  98    GYEDLLAGVGVPH-HGNNYEVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVA  156

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIF----AQDNGSLVHRGWY  1042
             VATD+G   LGRRDI+V WRGT    EW+ D     V    +     +Q   ++VH G+ 
Sbjct  157   VATDEGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAGPVLGSAASQHRLAVVHHGFL  216

Query  1041  EMYTSTNQDSHLNSNSARDQ----------------------------------------  982
              MYTS+N+ S     SARDQ                                        
Sbjct  217   SMYTSSNKSSEFTKTSARDQRGLVCGRLSLRPYARLLAHTQSWQLPCVSAGYMVTAIALL  276

Query  981   VRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNNTD-----VLITAFLF  817
             V  EV RL++LYKNEEVSITV GHSLG+S+ATLNAVDL ++  N  +       +TA +F
Sbjct  277   VVKEVRRLVELYKNEEVSITVCGHSLGASVATLNAVDLVSSGINKPEGSTKSFPVTAIVF  336

Query  816   ASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTILPLIAYKDVGVQFDI  637
             ASP VG   F+ AF+   +L+AL V N GD+VPM P L            Y DV V+  I
Sbjct  337   ASPHVGCRFFRSAFNSFPDLKALHVQNAGDVVPMYPPL-----------GYVDVAVELTI  385

Query  636   NASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFKPQGCFDIPQVNKYGGMLKVEK  457
                +S Y++     V   H L  YLHG+ G QG  G FK +   DI  VNK    L  E 
Sbjct  386   RTIRSPYIR-KPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDRDIALVNKGADALTDEH  444

Query  456   CPVPTEWWVEKNKGMVQQDDGTWILDD  376
              PVP  WWV ++K MV+ +DG W L D
Sbjct  445   -PVPACWWVPRHKFMVKGEDGRWTLQD  470



>gb|KDP21071.1| hypothetical protein JCGZ_21542 [Jatropha curcas]
Length=407

 Score =   276 bits (707),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 167/413 (40%), Positives = 240/413 (58%), Gaps = 34/413 (8%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             M  IA  W+VL+G +NW+GLLDP+D +LR YLI+ G +  A   +      S    LSRY
Sbjct  1     MAGIASNWKVLSGENNWDGLLDPIDDNLRHYLINNGFLTAAAPAALNDVKQSPGYALSRY  60

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
               ++   E G+E+ NPFKY +T +FY  S       G + +  + A        + G+VA
Sbjct  61    PPENYFSEAGIEQGNPFKYQVTDFFYGRSE---FDFGDWTIAGLSA--------YFGFVA  109

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYT  1030
             V TD+GK V GRRDI+V WRGT    EW +DF         +F  D  + VH G++ +YT
Sbjct  110   VTTDEGKIVTGRRDIVVCWRGTSFTIEWFKDFDHIFTSGSDLFP-DTDAKVHNGFHSVYT  168

Query  1029  STNQDSHLNSNSARDQVRAEVCRL--LDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             ++  DS  N  SAR+QV A   R    D+   E+VSIT+TGHSLGS+LATLNA+D+A N 
Sbjct  169   TSKSDSTYNKRSAREQVLAAARRNGDKDVALKEDVSITITGHSLGSALATLNAMDIAFNG  228

Query  855   FN-----NTDVLITAFLFASPKVGNEGFKKAFSHLKN---LRALRVVNNGDLVPMVPFLA  700
             +N     +T   +TAF+FASP+VGN+ F+  F+ L++   L  LR+ N  D+VP +P   
Sbjct  229   YNKPSGSDTGYPVTAFVFASPRVGNKEFQDVFNGLQDAGTLHLLRIRNYNDIVPELPPKI  288

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
             ++         Y+DVGV+  ++ +KS Y+K + +     H L +Y+HG+ G+QG + +FK
Sbjct  289   LD-------FTYEDVGVELYLDTTKSPYIKGESITEA--HDLNLYMHGVAGYQGNE-DFK  338

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEK-NKGMVQQDDGTWILDDHEAD  364
                  DI  +NKY  +LK +   VP  WW     +GM+Q DDGTW L+D+  D
Sbjct  339   LVINLDIALLNKYNDLLK-DSYGVPPNWWSNVFRQGMIQFDDGTWKLNDYVPD  390



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 186/411 (45%), Positives = 232/411 (56%), Gaps = 29/411 (7%)
 Frame = -2

Query  1560  IAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             IA RWR L+G D+W GLLDPLD DLR  ++ YG ++ A YDSF  E  S +AG   Y   
Sbjct  10    IADRWRELHGQDSWNGLLDPLDLDLRSSILSYGELVQATYDSFNRERRSPHAGACVYGHG  69

Query  1380  SLLEETGLEKANPFKYTITKYFY-TPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
              LL   G   A    Y +TK+ Y T             + S+   A  +ESNW GYVAVA
Sbjct  70    DLLAAAGASAAG--SYAVTKFVYATSGLPVPEAFLLLPLPSLLPPAWSRESNWMGYVAVA  127

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFR---IPMVKPRIIFAQDNG-SLVHRGWYEM  1036
             TD+G   LGRRDI+V WRGT    EW+ DF    +P        A  N  ++VHRG+  +
Sbjct  128   TDEGVAALGRRDIVVAWRGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAIVHRGFLSV  187

Query  1035  YTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANP  856
             YTS+N+DS  N  SARDQV  EV RL++LYK+E  SITV GHSLG+SLATLNAVD+ AN 
Sbjct  188   YTSSNKDSKYNKASARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLNAVDIVANG  247

Query  855   FN---------NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFL  703
              N              +TA +FASP+VG+  FK AF+   +LRAL V N GD+VPM P L
Sbjct  248   ANCPPASSSSSQPPCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGDVVPMYPPL  307

Query  702   AVEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEF  523
                         Y DV V+  I+ S+S Y++     +   H L  YLHG+ G QG  G F
Sbjct  308   -----------GYVDVAVKLRISTSRSPYLRSPG-TIETLHNLECYLHGVAGEQGSAGGF  355

Query  522   KPQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
             K +   D+   NK    LK +K PVP  WWV KN+ MV+  DG W L D E
Sbjct  356   KLEVDRDVALANKGVDALK-DKYPVPPRWWVSKNRCMVKDADGHWALHDFE  405



>ref|XP_007025427.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28049.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=382

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 173/404 (43%), Positives = 222/404 (55%), Gaps = 43/404 (11%)
 Frame = -2

Query  1563  SIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAK  1384
             SIA RWR L+G  NWEGLL PLD DLRRY+IHY    GA  D F ++  SK  GLS Y  
Sbjct  4     SIASRWRELSGEKNWEGLLHPLDLDLRRYIIHYLQRAGAAGDLFNNKKASKSYGLSLYPP  63

Query  1383  KSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVA  1204
                    GLE  NP+KY +T + Y    T                    +S + G+VAVA
Sbjct  64    DEYFSRAGLEIGNPYKYRVTNFIYGTVGTS-------------------QSEYFGFVAVA  104

Query  1203  TDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGSLVHRGWYEMYTST  1024
             TD+GK VLGRRDILV WRG+ TR++W E+        + +F  D    VH G+  +Y   
Sbjct  105   TDEGKAVLGRRDILVSWRGSMTRADWSENIDFVPTSAKELFGTDLAQ-VHSGFLFIYAGK  163

Query  1023  NQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFNN-  847
               DS  N  SARDQ    V   +D Y+NE+VSITVTGHSLG++LATLNA+D+ AN FN  
Sbjct  164   MADSLYNKTSARDQALKAVQEQVDKYQNEDVSITVTGHSLGAALATLNAMDIVANSFNKP  223

Query  846   -----TDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGTI  682
                     ++TAF  ASP+VGN  F + F  LK+L  LR+VN+ D VP VP         
Sbjct  224   TGNSAKSSMVTAFPVASPRVGNLKFMEIFDELKDLHLLRIVNSIDPVPNVPI--------  275

Query  681   LPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQ-GPKGEFKPQGCF  505
                  Y  VG +  I+ +KS Y+K +    +  H L +Y HG+ G Q   + + + +  F
Sbjct  276   --GFDYTHVGEELGIDTTKSTYLKSN----VHPHNLDVYGHGVAGVQENGEFKLEEELEF  329

Query  504   DIPQVNKYGGMLKVEKCPVPTEWW-VEKNKGMVQQDDGTWILDD  376
             D   VNK G  L +++  +P EWW  EK KGMVQ DDG W   D
Sbjct  330   DNAVVNKTGDCL-LDEYKIPIEWWNNEKFKGMVQMDDGHWKFVD  372



>emb|CDY24728.1| BnaC04g13330D [Brassica napus]
Length=408

 Score =   276 bits (705),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 173/407 (43%), Positives = 233/407 (57%), Gaps = 30/407 (7%)
 Frame = -2

Query  1569  MESIAKRWRVLNGSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRY  1390
             +E IAKRW+ L+G+  W+ LLDPLD DLRRY++HYG M+   Y +F     SKY G S Y
Sbjct  2     VEDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNYGRRSKYVGDSCY  61

Query  1389  AKKSLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVA  1210
              K+ L   TG  K NPF+Y +TK+ Y  S+        + + S   +A  KESNW GYVA
Sbjct  62    TKEELFARTGYLKDNPFRYEVTKFIYGTSSIKLPE--CFMINSWSREAWNKESNWLGYVA  119

Query  1209  VATDKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNGS---LVHRGWYE  1039
             VATD+ KE+LGRRDI+V WRGT    EW  DF  P+     +F + + S    +  GW  
Sbjct  120   VATDECKELLGRRDIVVAWRGTIQLYEWANDFDFPLESAISVFPRADPSDPPRIASGWLS  179

Query  1038  MYTSTNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAAN  859
             +YT+ +  S  +  SAR+QV+ E+ RLL+LYK+EEVSIT+TGHSLG+ L+ L+A D   N
Sbjct  180   LYTTADPRSRFDKTSAREQVQGELKRLLELYKHEEVSITLTGHSLGAVLSILSATDFLHN  239

Query  858   PFNNTD-------VLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLA  700
              +  T          +T F F SP+VG+  FK     LK L  LRV N  DL+P      
Sbjct  240   EWPKTTPRLEDRLSCVTVFAFGSPRVGDRNFKTLVESLKKLNILRVANVPDLIPHY----  295

Query  699   VEAGTILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGPKGEFK  520
                    PL  + DVG +  IN  K+EY+K   L++  +H L  YL G++G Q  + E K
Sbjct  296   -------PLFRFTDVGEELHINTLKAEYLKRS-LSLAHFHNLKAYLQGVEGTQHNQSELK  347

Query  519   PQGCFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILD  379
                   + Q+ K G     +K  VP + WV +NKGM +  DGTWIL+
Sbjct  348   ------LEQLVKNGLDALEDKYLVPGDSWVLENKGMDKTHDGTWILN  388



>ref|XP_006644445.1| PREDICTED: phospholipase A1-II 3-like [Oryza brachyantha]
Length=426

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 172/407 (42%), Positives = 221/407 (54%), Gaps = 25/407 (6%)
 Frame = -2

Query  1557  AKRWRVLN-GSDNWEGLLDPLDSDLRRYLIHYGSMIGAVYDSFISEPTSKYAGLSRYAKK  1381
             A+RWR  + G D W GLLDPLD+ LRR LI YG +  A  D+ I +P S  AG SRYA  
Sbjct  28    AQRWREASVGRDKWNGLLDPLDAGLRRDLIRYGELAQATSDALIGDPASPLAGASRYAPD  87

Query  1380  SLLEETGLEKANPFKYTITKYFYTPSTTCGAHHGGYHVQSVRADAVMKESNWGGYVAVAT  1201
             + L +  +  ++P  Y +T++ Y  S+                 A   ESNW GYVAVA 
Sbjct  88    AFLRK--VRASDPDAYRVTRFVYATSSIRLPDAFMARPAPPLGAAWSGESNWMGYVAVAA  145

Query  1200  DKGKEVLGRRDILVVWRGTETRSEWIEDFRIPMVKPRIIFAQDNG---SLVHRGWYEMYT  1030
             D      GRRDI+V WRGT+   EW  D  I +V    I     G     VHRG+  +YT
Sbjct  146   DGVAAAAGRRDIVVAWRGTKRAVEWANDLDITLVPADGIIGPGPGWSQPSVHRGFLSVYT  205

Query  1029  STNQDSHLNSNSARDQVRAEVCRLLDLYKNEEVSITVTGHSLGSSLATLNAVDLAANPFN  850
             S +  S  N  SAR+QV AE+ RLL  YKNE  SIT+TGHSLG++L+TLNAVD+ AN +N
Sbjct  206   SKSFSSRFNKLSAREQVLAEIARLLRAYKNENCSITITGHSLGAALSTLNAVDIVANGYN  265

Query  849   -----NTDVLITAFLFASPKVGNEGFKKAFSHLKNLRALRVVNNGDLVPMVPFLAVEAGT  685
                     V +TA   ASP+VG++ FK+AF  +  +  LRV N  D+VP          T
Sbjct  266   VRGPSRVPVPVTAIALASPRVGDDQFKRAFDSMAGVSLLRVRNAPDIVP----------T  315

Query  684   ILPLIAYKDVGVQFDINASKSEYVKHDKLNVLMWHGLMIYLHGIDGFQGP--KGEFKPQG  511
             ILP   +KDVG +  ++  +S Y+K        WH L  YLH + G QG      F    
Sbjct  316   ILPSAFFKDVGAELLVDTRRSPYLKSPA-GPAQWHNLECYLHAVAGTQGAGDGAGFSLAV  374

Query  510   CFDIPQVNKYGGMLKVEKCPVPTEWWVEKNKGMVQQDDGTWILDDHE  370
               D+  VNK    L+ ++  VP  WW EKNKGMVQ   G W+L DHE
Sbjct  375   DRDVALVNKEVDALR-DEYQVPAAWWGEKNKGMVQNASGRWVLQDHE  420



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4770789340872