BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78037_g1_i1 len=969 path=[1:0-946 1007:947-968]

Length=969
                                                                      Score     E

ref|XP_010312805.1|  PREDICTED: uncharacterized protein LOC104644498  73.9    2e-12   
ref|XP_009767994.1|  PREDICTED: uncharacterized protein LOC104219056  69.3    1e-10   
ref|XP_006364962.1|  PREDICTED: uncharacterized protein LOC102589309  66.6    9e-10   
ref|XP_009601251.1|  PREDICTED: uncharacterized protein LOC104096574  61.2    7e-08   
ref|XP_007141113.1|  hypothetical protein PHAVU_008G168400g           57.4    2e-06   
ref|XP_006396010.1|  hypothetical protein EUTSA_v10004990mg           52.8    6e-05   
emb|CDP19550.1|  unnamed protein product                              52.0    1e-04   
ref|XP_003543781.1|  PREDICTED: uncharacterized protein LOC100806174  51.2    3e-04   
gb|KHN26050.1|  hypothetical protein glysoja_025148                   51.2    3e-04   
ref|XP_010461365.1|  PREDICTED: uncharacterized protein LOC104742...  50.1    4e-04   
ref|XP_010461364.1|  PREDICTED: uncharacterized protein LOC104742...  49.7    5e-04   



>ref|XP_010312805.1| PREDICTED: uncharacterized protein LOC104644498 [Solanum lycopersicum]
Length=183

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 93/179 (52%), Gaps = 27/179 (15%)
 Frame = +2

Query  341  HQRTTFLLPMLCRLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRRN------  502
            H  T F LPMLC+LSIKDV K+       S +S +   P+SPKVSCIGQVKR N      
Sbjct  19   HGSTAFFLPMLCKLSIKDV-KLQNSKPPSSANSSTHTEPTSPKVSCIGQVKRNNRVTGFP  77

Query  503  ------SKIHAGLFISSSKNHTKLNSFFSGKNLNAGDGEYSCSRELLMRRNRSTAREVKK  664
                  S       ++S   + KL   FSGKN   GD +   S+ ++         EV  
Sbjct  78   TPYKSTSSTAITRPVNSKVKYMKLRKLFSGKNFTPGDRKSDRSKVIV---------EVN-  127

Query  665  VISELDpp-lpvvkqpppggqvkSLWSRRSGSGASLKTLEIHYTNYLPNNNQIIPPTTL  838
             ++ELDPP   V K  P       LW RRSG G++LK+L+I     LPN+N ++ PTT+
Sbjct  128  -VNELDPPLPVVKKVNPVPATDGGLWKRRSG-GSALKSLQIQQIQ-LPNHNTLLQPTTV  183



>ref|XP_009767994.1| PREDICTED: uncharacterized protein LOC104219056 [Nicotiana sylvestris]
Length=206

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 99/186 (53%), Gaps = 28/186 (15%)
 Frame = +2

Query  353  TFLLPMLCRLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRRNSKI-------  511
            TF  P+LC+LSIKDV     Q    + S  + + PSSPKVSC+GQVKR N  I       
Sbjct  25   TFFFPILCKLSIKDVK---LQNPYSNSSGDNLNEPSSPKVSCMGQVKRNNKVIGFPTPYR  81

Query  512  --HAGLFISSSKN----HTKLNSFFSGKNLNAGDG-EYSCSRELLMRRNR-STAREVKKV  667
               +   +S   N    +TKL   FSGKN  AG+  E   S  + +  +R ST  +  K+
Sbjct  82   PTSSSTALSGPVNPKVKYTKLKKLFSGKNFTAGNNRELKTSVTVTVGGSRKSTINDKGKI  141

Query  668  I---------SELDpplpvvkqpppggqvkSLWSRRSGSGASLKTLEIHYTNYLPNNNQI  820
            I         SELDPPLPVVK+  P  +   LW RRSG G  L +L+I    +LP +N +
Sbjct  142  IKGAVEVINVSELDPPLPVVKKVKPPPEDGGLWKRRSG-GIKLTSLQIQPQIHLPTHNNL  200

Query  821  IPPTTL  838
            + PTT+
Sbjct  201  LQPTTV  206



>ref|XP_006364962.1| PREDICTED: uncharacterized protein LOC102589309 [Solanum tuberosum]
Length=193

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 93/182 (51%), Gaps = 23/182 (13%)
 Frame = +2

Query  341  HQRTTFLLPMLCRLSIKDV--NKVVKQCKDRspssiskdnpsspKVSCIGQVKRRN----  502
            H  ++F LPMLC+LSIKDV              ++ +   P+SPKVSC+GQVKR N    
Sbjct  19   HGSSSFFLPMLCKLSIKDVKLQNSKPPSSANPSTNTTHTEPTSPKVSCMGQVKRNNRVTG  78

Query  503  -------SKIHAGLFISSSKNHTKLNSFFSGKNLN-AGDGEYSCSRELLMRRNRSTAREV  658
                   +       ++S   + KL   FSGKN   AG+G    S      R++     V
Sbjct  79   FPTPYRPTSTAITRPVNSKVKYMKLKKLFSGKNFTPAGNGGDRKS-----DRSKINGVAV  133

Query  659  KKV-ISELDpp-lpvvkqpppggqvkSLWSRRSGSGASLKTLEIHYTNYLPNNNQIIPPT  832
             +V +SELDPP   V K  P       LW RRSG G++LK+L+I     LPN+N ++ PT
Sbjct  134  VEVNVSELDPPLPVVKKVNPVPAADGGLWKRRSG-GSALKSLQIQQIQ-LPNHNTLLQPT  191

Query  833  TL  838
            T+
Sbjct  192  TV  193



>ref|XP_009601251.1| PREDICTED: uncharacterized protein LOC104096574 [Nicotiana tomentosiformis]
Length=184

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 23/174 (13%)
 Frame = +2

Query  353  TFLLPMLCRLSIKDV---NKVVKQCKDRspssiskdnpsspKVSCIGQVKRRNSKIHAGL  523
            +F  P+LC+LSIKDV   N       D        + PSSPKVSC+GQVKR N  I    
Sbjct  22   SFFFPILCKLSIKDVKLPNPSSSSSGDN------LNEPSSPKVSCMGQVKRNNKVIGFPT  75

Query  524  FIS--SSKNHTKLNSFFSGKNLNAGDG-EYSCSRELLMRRNR-STAREVKKVI-----SE  676
              +  S+  + KL   FS KN  AG+  +   S  + +  +R ST  +  K+I     SE
Sbjct  76   TTTALSAPLNPKLKKLFSRKNFTAGNNRQLKTSVTVTVGGSRKSTINDKGKIIEVINLSE  135

Query  677  LDpplpvvkqpppggqvkSLWSRRSGSGASLKTLEIHYTNYLPNNNQIIPPTTL  838
            LDPPLPVVK+  P  +   LW RRSG G +L +L+I+    LP +N ++ PTT+
Sbjct  136  LDPPLPVVKKVKPPPEDGGLWKRRSG-GVALTSLQIN----LPTHNNLLQPTTV  184



>ref|XP_007141113.1| hypothetical protein PHAVU_008G168400g [Phaseolus vulgaris]
 gb|ESW13107.1| hypothetical protein PHAVU_008G168400g [Phaseolus vulgaris]
Length=207

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 97/202 (48%), Gaps = 43/202 (21%)
 Frame = +2

Query  305  PQQLYRRRYSSFHQRTTFLLPMLC-RLSIKDVNKVVKQCKDRspssiskdnpsspKVSCI  481
            P   +       H+RTTF LPMLC R SIKDVN  + QC+D+       ++P SP++ C+
Sbjct  9    PHHYFYHHNLHIHRRTTF-LPMLCSRPSIKDVN--LPQCRDQ--PGSFSNDPLSPRIGCM  63

Query  482  GQVKRRNSKIHAGLFISSSKNHT----------KLNSFFSGKNLNAGD------------  595
            GQVKR N  +  GL  + S  +T          KL   FSGKNL +              
Sbjct  64   GQVKRHNKIV--GLLTTKSNTNTNIISPGVKYAKLKKLFSGKNLGSTTTTVAAPTVSTCG  121

Query  596  ----GEYSCSRELLMRRNRSTARE--VKKVISELD---pplpvvkqpppggqvkSLWSRR  748
                G  + +      R+R    E  V   I  +D   P +  V++P    QV SLW RR
Sbjct  122  ARPRGTVNSANVSRSHRHRCKRNENSVPISIENMDLPLPVIKRVQKPEEERQVDSLWKRR  181

Query  749  SGSGASLKTL---EIHYTNYLP  805
            SG GA+LK+L   +IH++ + P
Sbjct  182  SG-GAALKSLQLQQIHHSRHHP  202



>ref|XP_006396010.1| hypothetical protein EUTSA_v10004990mg [Eutrema salsugineum]
 gb|ESQ33296.1| hypothetical protein EUTSA_v10004990mg [Eutrema salsugineum]
Length=181

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 82/174 (47%), Gaps = 23/174 (13%)
 Frame = +2

Query  314  LYRRRYSSFH-QRTTFLLPMLC-RLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQ  487
            +   R++S H QR TFL PMLC R SIK+V    K  ++       + +P SPK+SCIGQ
Sbjct  1    MMETRHNSVHFQRHTFL-PMLCSRPSIKNVTIPAKSNQE-----DHQTDPLSPKISCIGQ  54

Query  488  VKRRNSKIHAGLFISSS------KNHTKLNSFFSGKNLNAGDGEYSCSRELLMR-RNRST  646
            VKR N  +      SSS        + KL   FSGKNL       S ++    R +N   
Sbjct  55   VKRSNKIVGFPTTTSSSITPAAHHRYFKLKRLFSGKNLTFAAPTTSTTKSSRERIKNEEF  114

Query  647  AREVKKVI--SELD-----pplpvvkqpppggqvkSLWSRRSGSGA-SLKTLEI  784
              E+  +I  +ELD                    ++LW RRSG G   L++L+I
Sbjct  115  DNEIIALIDVAELDPPLPVVKKKNHGGDGGDKAAENLWKRRSGGGGYQLRSLQI  168



>emb|CDP19550.1| unnamed protein product [Coffea canephora]
Length=199

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 92/197 (47%), Gaps = 41/197 (21%)
 Frame = +2

Query  335  SFHQRTTFLLPMLCRLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRRNSKI-  511
            SF+ + +FL P+LCR+SIKDV   +++ KDR  S    D+PSSPKVSC+G+VK+ N  I 
Sbjct  15   SFYNKNSFL-PLLCRVSIKDVK--LREYKDR--SCSFSDDPSSPKVSCMGKVKKTNRLIG  69

Query  512  ------------------------HAGLFISSSKNHTKLNSFFSGKN----LNAGDGEYS  607
                                    H G F      +TKL   FSGKN    L A     +
Sbjct  70   FSTPYRLTAATATTATTTAKTNTNHQGHF-----KYTKLRRLFSGKNLITSLPATTSSSN  124

Query  608  CSRELLMRRNRSTAREVKKVISELDpplpvvkqpppggqvkSLWSRRSGSGASLKTLEIH  787
             +     + N          ISELD P   V +        +LW RRSG G +LK+L+I 
Sbjct  125  SNNTRSSKINNDDGGIDHVNISELD-PPLPVIKKVQQPCEVNLWKRRSG-GPALKSLQIE  182

Query  788  YTNYLPNNNQIIPPTTL  838
              +   NN+  +P  T+
Sbjct  183  QIHVPRNNHLPLPAQTV  199



>ref|XP_003543781.1| PREDICTED: uncharacterized protein LOC100806174 [Glycine max]
Length=209

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 99/191 (52%), Gaps = 41/191 (21%)
 Frame = +2

Query  338  FHQRTTFLLPMLC-RLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRRN----  502
             H R+TF LPMLC R SIKDV+  + Q +D  P     ++P SP++ C+GQVKR N    
Sbjct  20   IHHRSTF-LPMLCSRPSIKDVS--LPQWRD--PPGSFSNDPLSPRIGCMGQVKRHNKIVG  74

Query  503  -----SKIHAGLFISSSKNHTKLNSFFSGKNL-----NAGDGEYSCSRELLMR-------  631
                 S     + IS S  ++KL   FSGKNL     NA     + S     R       
Sbjct  75   LLTTKSNTANNISISPSVKYSKLKKLFSGKNLGTNTINAATAPTASSCGSRPRGTVNSTN  134

Query  632  -----RNRSTARE--VKKVISELDpplpv---vkqpppggqvkSLWSRRSGSGASLKTL-  778
                 ++RS+  E  V   I  +DPPLPV   V++P    QV +LW RRSG GA+LK+L 
Sbjct  135  VPRNHKHRSSRNENVVPISIENMDPPLPVIKRVQKPEEERQVDNLWKRRSG-GAALKSLQ  193

Query  779  --EIHYTNYLP  805
              +IH++ + P
Sbjct  194  LQQIHHSRHHP  204



>gb|KHN26050.1| hypothetical protein glysoja_025148 [Glycine soja]
Length=209

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 99/191 (52%), Gaps = 41/191 (21%)
 Frame = +2

Query  338  FHQRTTFLLPMLC-RLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRRN----  502
             H R+TF LPMLC R SIKDV+  + Q +D  P     ++P SP++ C+GQVKR N    
Sbjct  20   IHHRSTF-LPMLCSRPSIKDVS--LPQWRD--PPGSFSNDPLSPRIGCMGQVKRHNKIVG  74

Query  503  -----SKIHAGLFISSSKNHTKLNSFFSGKNL-----NAGDGEYSCSRELLMR-------  631
                 S     + IS S  ++KL   FSGKNL     NA     + S     R       
Sbjct  75   LLTTKSNTANNISISPSVKYSKLKKLFSGKNLGTSTINAATAPTASSCGSRPRGTVNSTN  134

Query  632  -----RNRSTARE--VKKVISELDpplpv---vkqpppggqvkSLWSRRSGSGASLKTL-  778
                 ++RS+  E  V   I  +DPPLPV   V++P    QV +LW RRSG GA+LK+L 
Sbjct  135  VPRNHKHRSSRNENVVPISIENMDPPLPVIKRVQKPEEERQVDNLWKRRSG-GAALKSLQ  193

Query  779  --EIHYTNYLP  805
              +IH++ + P
Sbjct  194  LQQIHHSRHHP  204



>ref|XP_010461365.1| PREDICTED: uncharacterized protein LOC104742096 isoform X2 [Camelina 
sativa]
Length=177

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 87/171 (51%), Gaps = 23/171 (13%)
 Frame = +2

Query  323  RRYSSFHQRTTFLLPMLC-RLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRR  499
            R+ S   QR TFL PMLC R SIK+V         +      + +P SPK+SCIGQVKR 
Sbjct  5    RQNSVQFQRPTFL-PMLCSRPSIKNVT-----VPSKLHQEDHQTDPLSPKISCIGQVKRS  58

Query  500  NSKI-----HAGLFISSSKNHT--KLNSFFSGKNLNAGDGEYSCSRELLMRRNRSTAREV  658
            N  +      +   I+ + +H   KL   FSGKNL       + S +    R R    + 
Sbjct  59   NKIVGYPTTSSSSSITPASHHRYFKLKRLFSGKNLTF-SAPTTTSTKTSRGRIRKEEFDN  117

Query  659  KKV----ISELDpplpvvkqp----ppggqvkSLWSRRSGSGASLKTLEIH  787
            KK+    +++LDPPLPVVK+           ++LW RRSG G  L++L+I 
Sbjct  118  KKIAVIDVAQLDPPLPVVKKKLDGGAGDKAAENLWKRRSGGGCQLRSLQIQ  168



>ref|XP_010461364.1| PREDICTED: uncharacterized protein LOC104742096 isoform X1 [Camelina 
sativa]
Length=180

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 80/171 (47%), Gaps = 23/171 (13%)
 Frame = +2

Query  323  RRYSSFHQRTTFLLPMLC-RLSIKDVNKVVKQCKDRspssiskdnpsspKVSCIGQVKRR  499
            R+ S   QR TFL PMLC R SIK+V         +      + +P SPK+SCIGQVKR 
Sbjct  5    RQNSVQFQRPTFL-PMLCSRPSIKNVT-----VPSKLHQEDHQTDPLSPKISCIGQVKRS  58

Query  500  NSKI-----HAGLFISSSKNHT--KLNSFFSGKNLNAGDGEYSCSRELLMRRNRSTAREV  658
            N  +      +   I+ + +H   KL   FSGKNL       + S +    R R    + 
Sbjct  59   NKIVGYPTTSSSSSITPASHHRYFKLKRLFSGKNLTF-SAPTTTSTKTSRGRIRKEEFDN  117

Query  659  KKV----ISELD----pplpvvkqpppggqvkSLWSRRSGSGASLKTLEIH  787
            KK+    +++LD         +         ++LW RRSG G  L++L+I 
Sbjct  118  KKIAVIDVAQLDPPLPVVKKKLDGGAGDKAAENLWKRRSGGGCQLRSLQIQ  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2108914979916