BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78030_g1_i1 len=278 path=[256:0-277]

Length=278
                                                                      Score     E

ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         73.9    7e-13   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      72.4    2e-12   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1   70.1    1e-11   
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2   70.1    2e-11   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   70.1    2e-11   
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  69.7    2e-11   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease              69.7    2e-11   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3       69.7    2e-11   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       68.2    6e-11   
ref|XP_009600483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  65.5    5e-10   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  65.1    8e-10   
emb|CDP07365.1|  unnamed protein product                              64.3    1e-09   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       64.3    1e-09   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        63.5    3e-09   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         62.8    5e-09   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like         62.0    8e-09   
ref|XP_009780475.1|  PREDICTED: subtilisin-like protease SBT5.3       59.3    9e-09   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  61.6    1e-08   
gb|KHG24601.1|  Cucumisin                                             61.6    1e-08   
ref|XP_002893091.1|  subtilase                                        61.6    1e-08   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                 61.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65424.1|  subtilisin-like serine protease                       61.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                    61.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                  60.8    2e-08   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...  60.8    2e-08   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  60.5    2e-08   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...  60.1    4e-08   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...  60.1    4e-08   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      60.1    4e-08   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg           60.1    4e-08   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3       60.1    4e-08   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...  59.7    5e-08   
ref|NP_001236511.1|  subtilisin-type protease precursor               59.3    6e-08   
gb|KHN09070.1|  Subtilisin-like protease                              59.3    6e-08   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                     59.3    6e-08   Glycine max [soybeans]
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g           59.3    7e-08   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...  58.9    8e-08   Vitis vinifera
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like         58.9    8e-08   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        58.9    8e-08   
emb|CBI19918.3|  unnamed protein product                              58.9    9e-08   
emb|CDP16605.1|  unnamed protein product                              58.9    9e-08   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg           58.5    1e-07   
emb|CDY44210.1|  BnaC05g15670D                                        58.5    1e-07   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  58.5    1e-07   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       58.5    1e-07   
emb|CDY70447.1|  BnaAnng33720D                                        57.4    1e-07   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  58.2    1e-07   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease              58.2    2e-07   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3       58.2    2e-07   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like         57.0    4e-07   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease              57.0    5e-07   
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                 56.6    5e-07   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 56.2    7e-07   
gb|EAZ45152.1|  hypothetical protein OsJ_29790                        54.7    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           56.2    7e-07   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...  56.2    8e-07   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...  56.2    8e-07   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g           55.5    1e-06   
gb|KEH30495.1|  subtilisin-like serine protease                       55.5    1e-06   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              55.5    1e-06   
emb|CDO96926.1|  unnamed protein product                              55.5    1e-06   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like         55.1    2e-06   
dbj|BAJ53097.1|  JHL20J20.3                                           55.1    2e-06   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like         55.1    2e-06   
gb|KDP36888.1|  hypothetical protein JCGZ_08179                       55.1    2e-06   
gb|KEH34337.1|  subtilisin-like serine protease                       54.7    2e-06   
gb|EYU17578.1|  hypothetical protein MIMGU_mgv1a0038491mg             54.3    2e-06   
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3       54.3    3e-06   
ref|NP_001175897.1|  Os09g0482660                                     53.5    4e-06   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease              53.9    5e-06   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease              53.5    5e-06   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        53.5    6e-06   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        53.5    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         53.5    7e-06   
ref|XP_003603807.1|  Subtilisin-type protease                         53.1    8e-06   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         53.1    8e-06   
ref|XP_002510578.1|  Cucumisin precursor, putative                    52.8    8e-06   Ricinus communis
ref|XP_003603196.1|  Subtilisin-type protease                         53.1    8e-06   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  52.8    9e-06   
ref|XP_007226628.1|  hypothetical protein PRUPE_ppa022764mg           52.8    9e-06   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g           52.8    1e-05   Populus trichocarpa [western balsam poplar]
emb|CAN75239.1|  hypothetical protein VITISV_014205                   52.4    1e-05   Vitis vinifera
ref|NP_001238252.1|  subtilisin-type protease precursor               52.4    1e-05   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like         52.4    1e-05   
emb|CDY63158.1|  BnaCnng41540D                                        48.5    1e-05   
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like         52.4    1e-05   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like         52.4    2e-05   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg           52.4    2e-05   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                 52.4    2e-05   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        52.0    2e-05   
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease              52.0    2e-05   
emb|CDP10007.1|  unnamed protein product                              52.0    2e-05   
gb|AEW09204.1|  hypothetical protein CL4686Contig1_05                 48.5    2e-05   
ref|XP_010477248.1|  PREDICTED: CO(2)-response secreted protease      52.0    2e-05   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like         51.6    2e-05   
ref|XP_010095549.1|  Subtilisin-like protease                         51.6    2e-05   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease              51.6    3e-05   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like         51.6    3e-05   
ref|XP_010229422.1|  PREDICTED: CO(2)-response secreted protease-...  51.2    3e-05   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative    50.8    4e-05   Ricinus communis
ref|XP_010090327.1|  Subtilisin-like protease                         50.8    4e-05   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like         50.8    4e-05   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g           50.8    5e-05   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like         50.8    5e-05   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg           50.8    5e-05   
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g           50.8    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_003603805.1|  Subtilisin-like protease                         48.1    5e-05   
ref|XP_002310134.2|  subtilase family protein                         50.4    6e-05   Populus trichocarpa [western balsam poplar]
emb|CBI35855.3|  unnamed protein product                              50.8    6e-05   
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg              48.9    7e-05   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              50.4    7e-05   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease              50.4    7e-05   
ref|XP_010028715.1|  PREDICTED: subtilisin-like protease              50.1    9e-05   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease              50.1    9e-05   
emb|CBI37888.3|  unnamed protein product                              50.1    9e-05   
ref|XP_002971846.1|  hypothetical protein SELMODRAFT_412516           50.1    1e-04   
ref|XP_002972374.1|  hypothetical protein SELMODRAFT_413072           50.1    1e-04   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg              50.1    1e-04   
ref|XP_002317663.1|  subtilase family protein                         49.7    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease              49.7    1e-04   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg          49.7    1e-04   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg              49.7    1e-04   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g           49.7    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  49.7    1e-04   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease              49.3    1e-04   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease              49.3    1e-04   
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease              49.3    1e-04   
gb|ABK93620.1|  unknown                                               45.8    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease              49.3    1e-04   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g           49.3    2e-04   
ref|XP_003623810.1|  Subtilisin-like protease                         49.3    2e-04   
ref|XP_003523496.1|  PREDICTED: subtilisin-like protease-like         49.3    2e-04   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease              49.3    2e-04   
ref|NP_001234288.1|  SBT2 protein precursor                           49.3    2e-04   
gb|AES80028.2|  subtilisin-like serine protease                       49.3    2e-04   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050        49.3    2e-04   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              48.9    2e-04   
ref|XP_010498446.1|  PREDICTED: CO(2)-response secreted protease-...  48.9    2e-04   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1   48.9    2e-04   
gb|EPS66412.1|  hypothetical protein M569_08368                       46.6    2e-04   
ref|XP_002979023.1|  hypothetical protein SELMODRAFT_177291           48.9    2e-04   
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease              48.9    2e-04   
ref|XP_007135314.1|  hypothetical protein PHAVU_010G118900g           46.2    2e-04   
emb|CDP02570.1|  unnamed protein product                              48.9    2e-04   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like         48.9    2e-04   
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5       48.5    2e-04   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease              48.5    2e-04   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease              48.5    3e-04   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease              48.5    3e-04   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  48.5    3e-04   
ref|XP_002510884.1|  Cucumisin precursor, putative                    48.5    3e-04   Ricinus communis
ref|XP_009103352.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  48.5    3e-04   
ref|XP_010498447.1|  PREDICTED: CO(2)-response secreted protease-...  48.5    3e-04   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease              48.5    3e-04   
gb|KEH19205.1|  subtilisin-like serine protease                       48.5    3e-04   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like         48.5    3e-04   
emb|CDY01388.1|  BnaA07g11610D                                        48.1    3e-04   
gb|KHN15704.1|  Subtilisin-like protease                              48.1    3e-04   
ref|XP_007038510.1|  Subtilase 1.3                                    48.1    3e-04   
ref|XP_002965274.1|  hypothetical protein SELMODRAFT_406544           48.1    3e-04   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like         48.1    3e-04   
ref|XP_002986601.1|  hypothetical protein SELMODRAFT_425502           48.1    3e-04   
gb|AAF79898.1|AC022472_7  Contains similarity to p69c gene from L...  48.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564106.1|  subtilisin-like serine endopeptidase family pro...  48.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533857.1|  Cucumisin precursor, putative                    48.1    4e-04   Ricinus communis
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg              48.1    4e-04   
gb|KHN13888.1|  Subtilisin-like protease                              48.1    4e-04   
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative    48.1    4e-04   Ricinus communis
ref|XP_002893090.1|  predicted protein                                48.1    4e-04   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              48.1    4e-04   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like         48.1    4e-04   
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2   48.1    4e-04   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1   48.1    4e-04   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g           48.1    4e-04   
ref|XP_002864127.1|  subtilase family protein                         47.8    4e-04   
gb|EMT05539.1|  Subtilisin-like protease                              47.8    4e-04   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              47.8    5e-04   
emb|CAN75240.1|  hypothetical protein VITISV_014207                   47.8    5e-04   Vitis vinifera
ref|XP_002978893.1|  hypothetical protein SELMODRAFT_110049           47.8    5e-04   
ref|XP_002982832.1|  hypothetical protein SELMODRAFT_234125           47.8    5e-04   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease              47.8    5e-04   
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like         47.8    6e-04   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg              47.4    6e-04   
emb|CDP09846.1|  unnamed protein product                              47.4    6e-04   
emb|CDY68972.1|  BnaAnng29000D                                        44.7    6e-04   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease              47.4    7e-04   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease              47.4    7e-04   
ref|XP_009119746.1|  PREDICTED: subtilisin-like protease              47.4    7e-04   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease              47.4    7e-04   Vitis vinifera
ref|XP_002518939.1|  Cucumisin precursor, putative                    47.4    7e-04   Ricinus communis
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease              47.4    7e-04   Vitis vinifera
gb|KDP28707.1|  hypothetical protein JCGZ_14478                       47.4    7e-04   
ref|XP_002981864.1|  hypothetical protein SELMODRAFT_115574           47.0    8e-04   
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661            47.0    8e-04   
ref|XP_006304500.1|  hypothetical protein CARUB_v10011271mg           47.0    8e-04   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g           47.0    8e-04   
emb|CBI33725.3|  unnamed protein product                              47.0    8e-04   
gb|KHN12354.1|  Subtilisin-like protease                              44.7    8e-04   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease              47.0    8e-04   
ref|XP_002523602.1|  Cucumisin precursor, putative                    47.0    9e-04   Ricinus communis
ref|XP_002518937.1|  Cucumisin precursor, putative                    47.0    9e-04   Ricinus communis
ref|XP_007220237.1|  hypothetical protein PRUPE_ppa001918mg           47.0    9e-04   
ref|XP_011044970.1|  PREDICTED: subtilisin-like protease SBT5.3       47.0    0.001   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like         47.0    0.001   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease              47.0    0.001   
gb|KHN40225.1|  Subtilisin-like protease                              47.0    0.001   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              47.0    0.001   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease              47.0    0.001   



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKLVFTN  KKLSY V+F ASS  + ++FGSITWT+GKYKVRSP VV
Sbjct  719  PNKLVFTNNSKKLSYEVSFKASSKPKEDLFGSITWTNGKYKVRSPFVV  766



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKLVFTN  KKLSY ++F ASS  + ++FGSITWT+GKYKVRSP V+
Sbjct  719  PNKLVFTNNSKKLSYEMSFKASSKPKEDLFGSITWTNGKYKVRSPFVI  766



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KL FTN  KKLSY V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  735  PSKLEFTNNSKKLSYEVSFRASSTTKEDLFGSITWTNGKYKVRSPFVV  782



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KL FTN  KKLSY V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  709  PSKLEFTNNSKKLSYEVSFRASSTTKEDLFGSITWTNGKYKVRSPFVV  756



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FTN+ KKLSY V+F ASS+ + ++FGSITWT+GKYKVRSP VV+
Sbjct  736  PSKLEFTNKNKKLSYEVSFRASSTTKEDMFGSITWTNGKYKVRSPFVVS  784



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FTN+ KKLSY V+F ASS+ + ++FGSITWT+GKYKVRSP VV+
Sbjct  710  PSKLEFTNKNKKLSYEVSFRASSTTKEDMFGSITWTNGKYKVRSPFVVS  758



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKLVFTN  KKLSY V+F  SS  + ++FGSITW +GKYKVRSP VV
Sbjct  718  PNKLVFTNNSKKLSYEVSFRTSSKPKGDLFGSITWINGKYKVRSPFVV  765



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKLVFTN  KKL+Y V+F +SS    ++FGSITWT+GKYKVRSP VV
Sbjct  718  PNKLVFTNNSKKLNYEVSFKSSSKPVGDLFGSITWTNGKYKVRSPFVV  765



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL FTN+ KK+SY V+F ASS+ + ++FGSITWT+GKYKVRSP VV
Sbjct  718  PTKLEFTNKRKKVSYDVSFKASSTSKEDLFGSITWTNGKYKVRSPFVV  765



>ref|XP_009600483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3 
[Nicotiana tomentosiformis]
Length=616

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT++VKKLSY +TF A+S LET +FGSITWT+G+YKVRSP VV
Sbjct  569  PITLKFTSRVKKLSYQLTFKATS-LETELFGSITWTNGRYKVRSPFVV  615



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            PNKL FT  VKKLS+ VTFT S+S   ++FGSITW++ KYKVRSP VV+ 
Sbjct  680  PNKLQFTKNVKKLSFQVTFTLSTSSVEDLFGSITWSNEKYKVRSPFVVSA  729



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            PNKL FT   KKLSY V F  S ++  ++FGSI+WT+GKY+VRSP VV+
Sbjct  713  PNKLQFTKNDKKLSYEVAFKPSGAVNGDLFGSISWTNGKYRVRSPFVVS  761



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KL F  + KKLSY V+F ASS  + ++FGSITWT+GKYKVRSP VV
Sbjct  718  PSKLEFNYKSKKLSYEVSFKASSPSKEDLFGSITWTNGKYKVRSPFVV  765



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FT+  KKLSY VTF A+S  E   FGSITW SGKYKVRSP VV+
Sbjct  719  PSKLKFTSSTKKLSYQVTFKATSR-EREFFGSITWASGKYKVRSPFVVS  766



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P+KL F   +KKLS+ V F+++S+LE ++FGSITW++GK+ VRSP V+ +
Sbjct  719  PDKLQFKKSIKKLSFKVVFSSTSTLEEDLFGSITWSNGKHSVRSPFVLAI  768



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL FT   KKLSY V F   +SL  ++FGSITW++GKY VRSP V+
Sbjct  720  PNKLQFTKSSKKLSYQVIFAPKASLRKDLFGSITWSNGKYIVRSPFVL  767



>ref|XP_009780475.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=235

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT++VKKLSY VTF A+SS E  +FG ITWT+G YKVRSP VV
Sbjct  142  PKTLKFTSRVKKLSYQVTFKATSS-ERELFGLITWTNGWYKVRSPFVV  188



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FT  +KKLSY V F++  SS E ++FGSITW+ G YKVRSP VV+
Sbjct  727  PSKLQFTKNIKKLSYQVIFSSGNSSTEGDLFGSITWSDGTYKVRSPFVVS  776



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL FT    K SY V+F+A++ L+ ++FGSI W++GKYKVRSP  V
Sbjct  715  PNKLQFTKNGDKSSYEVSFSAANPLKEDVFGSIAWSNGKYKVRSPFAV  762



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  675  PEKLQFTKDGEKLTYQVIVSATASLKQDVFGALTWSTAKYKVRSPIVISSE  725



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  675  PEKLQFTKDGEKLTYQVIVSATASLKQDVFGALTWSNAKYKVRSPIVISSE  725



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  714  PEKLQFTKDGEKLTYQVIVSATASLKQDVFGALTWSNAKYKVRSPIVISSE  764



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  714  PEKLQFTKDGEKLTYQVIVSATASLKQDVFGALTWSNAKYKVRSPIVISSE  764



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  718  PEKLQFTKDGEKLTYQVIVSATASLKKDVFGALTWSNAKYKVRSPIVISSE  768



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  714  PEKLQFTKNGEKLTYQVIVSATASLKQDVFGALTWSNAKYKVRSPIVISSE  764



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFT--ASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT  +KK+SY  TF+  ASS ++ + FGSITWT+GKYKV++P+VV+ +
Sbjct  728  PEKLRFTKNIKKISYQATFSSSASSPVKGDSFGSITWTNGKYKVKTPLVVSSD  780



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL  ++FG++TW++ KYKVRSPIV++ E
Sbjct  729  PEKLQFTKNGEKLTYQVIVSATASLTQDVFGALTWSNAKYKVRSPIVISSE  779



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++SL  ++FG++TW++ KYKVRSPIV++ E
Sbjct  752  PEKLQFTKNGEKLTYQVIVSATASLTQDVFGALTWSNAKYKVRSPIVISSE  802



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P++L FT   KKL Y VTF+ASSS  + ++FG+ITW S KYKVRSPIVV
Sbjct  710  PSELKFTVDTKKLDYQVTFSASSSSAKRDLFGAITWKSKKYKVRSPIVV  758



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  ++++SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  711  PEKLQFTKDGEKLTYQVIVSSAASLKQDVFGALTWSNAKYKVRSPIVISSE  761



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FT  +KKLSY V F+A +SS + ++ GSITW+ G YKVRSP+VV+
Sbjct  728  PSKLQFTKNIKKLSYQVIFSAVNSSTKGDLLGSITWSDGTYKVRSPLVVS  777



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P KL FT+  KKLSY VTF A S  E   FGSITW++GKYKVRSP V +
Sbjct  715  PKKLKFTSDKKKLSYQVTFKAMSR-EKEFFGSITWSNGKYKVRSPFVAS  762



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL FT   KKLSY V F+++ +SL+ ++FGSITW++GKY VRSP V+
Sbjct  716  PNKLRFTKSSKKLSYRVIFSSTLTSLKEDLFGSITWSNGKYMVRSPFVL  764



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL FT   KKLSY V F+++ +SL+ ++FGSITW++GKY VRSP V+
Sbjct  716  PNKLRFTKSSKKLSYRVIFSSTLTSLKEDLFGSITWSNGKYMVRSPFVL  764



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL FT   KKLSY V F+++ +SL+ ++FGSITW++GKY VRSP V+
Sbjct  716  PNKLRFTKSSKKLSYRVIFSSTLTSLKEDLFGSITWSNGKYMVRSPFVL  764



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL FT   KKLSY V F+ + +SL+ ++FGSITW++GKY VRSP V+
Sbjct  718  PNKLQFTKSSKKLSYQVIFSPTLTSLKEDLFGSITWSNGKYMVRSPFVL  766



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFT--ASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P+ L FT   KKLSY V F+   SSS++  +FGSITWT+GK+KVRSP VV+ +
Sbjct  716  PDTLKFTKNSKKLSYQVIFSSNGSSSVKGAVFGSITWTNGKHKVRSPFVVSSD  768



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSL-ETNIFGSITWTSGKYKVRSPIVVNV  151
            P+KL+F+   +KLSY V F+A++ + + ++FGS+TW++G+YKVRSP VV++
Sbjct  729  PDKLIFSKDNQKLSYQVVFSATTPVPKEDMFGSLTWSNGQYKVRSPFVVSI  779



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+ L FT+  KKLS+ VTF A+S  E   FGSITWT+GKYKVRSP VV+
Sbjct  716  PSTLKFTSSTKKLSFQVTFKATSR-EREYFGSITWTNGKYKVRSPFVVS  763



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFT--ASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P+ L FT   KKLSY V F+   SSS++  +FGSITWT+GK+KVRSP VV+ +
Sbjct  691  PDTLKFTKNSKKLSYQVIFSSNGSSSVKGAVFGSITWTNGKHKVRSPFVVSSD  743



>emb|CDP16605.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPIVV  145
            P KL FT  ++KLSY VTF   +S E    ++FGSITWTSG YKVR P VV
Sbjct  586  PKKLQFTKNIRKLSYQVTFRHDNSTEFINGDVFGSITWTSGNYKVRIPYVV  636



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y V  +A++S + ++FG++TW++ KYKVRSPIV++ E
Sbjct  715  PEKLQFTKDGEKLTYQVIVSATASPKQDVFGALTWSNAKYKVRSPIVISSE  765



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y VT +A+  SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  716  PEKLQFTKDGEKLTYQVTVSAADDSLKKDVFGALTWSNAKYKVRSPIVISSE  767



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE*G  160
            P+KL FTN  +K SY V+F++++ L+ ++FG +TW++ KYKVRSP  V+ E G
Sbjct  682  PDKLQFTNNGQKSSYQVSFSSANPLKEDVFGFLTWSNEKYKVRSPFAVSSESG  734



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL F    +K SY V  +  SS++ ++FGSITWT+G+YKVRSPIVV+
Sbjct  713  PSKLKFEKTGQKQSYQVVLSLQSSVKEDLFGSITWTNGQYKVRSPIVVS  761



>emb|CDY70447.1| BnaAnng33720D, partial [Brassica napus]
Length=318

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y VT +A   SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  262  PEKLQFTKDGEKLTYQVTVSAGDGSLKKDVFGALTWSNAKYKVRSPIVISSE  313



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE*G  160
            P+KL FTN  +K SY V+F++++ L+ ++FG +TW++ KYKVRSP  V+ E G
Sbjct  708  PDKLQFTNNGQKSSYQVSFSSANPLKEDVFGFLTWSNEKYKVRSPFAVSSESG  760



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL FT   +KL+Y VT +A   SL+ ++FG++TW++ KYKVRSPIV++ E
Sbjct  716  PEKLQFTKDGEKLTYQVTVSAGDGSLKKDVFGALTWSNAKYKVRSPIVISSE  767



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FT  +KKLSY V F+A +SS + ++ GSITW+ G YKVRSP VV+
Sbjct  745  PSKLQFTKNIKKLSYQVIFSAVNSSTKGDLLGSITWSDGTYKVRSPSVVS  794



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KL FT   KKL Y V F+++ +SL+ ++FGSITW++GKY VRSP V+
Sbjct  720  PDKLQFTKSSKKLGYQVIFSSTLTSLKEDLFGSITWSNGKYMVRSPFVL  768



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P+KL F+   +KL Y V F+ + SS + ++FGS+TWT+ KYKVRSP VV+V
Sbjct  744  PDKLXFSKNNQKLXYQVVFSPTTSSPKEDMFGSVTWTNAKYKVRSPFVVDV  794



>gb|KDO84931.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=606

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRS  133
            P +L FT   +KLSY VTFT++ S L+ ++FGSITW++GKYKVRS
Sbjct  550  PEELQFTKSGQKLSYQVTFTSALSPLKEDVFGSITWSNGKYKVRS  594



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRS  133
            P +L FT   +KLSY VTFT++ S L+ ++FGSITW++GKYKVRS
Sbjct  717  PEELQFTKSGQKLSYQVTFTSALSPLKEDVFGSITWSNGKYKVRS  761



>gb|EAZ45152.1| hypothetical protein OsJ_29790 [Oryza sativa Japonica Group]
Length=249

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSL---ETNIFGSITWTSGKYKVRSPIVVNV  151
            P KL FT  VKKL + V+F+  ++    + ++FGSITW+ GK+ VRSP VV +
Sbjct  197  PGKLEFTKSVKKLGFQVSFSGKNAAAAAKGDLFGSITWSDGKHTVRSPFVVTI  249



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRS  133
            P +L FT   +KLSY VTFT++ S L+ ++FGSITW++GKYKVRS
Sbjct  731  PEELQFTKSGQKLSYQVTFTSALSPLKEDVFGSITWSNGKYKVRS  775



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PN L FT   KKL++ VTF  ++  + ++FGSITW++ KYKVRSP VV
Sbjct  707  PNTLKFTRDNKKLTFQVTFQQTTKSQEDLFGSITWSNEKYKVRSPFVV  754



>ref|XP_011074702.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Sesamum 
indicum]
Length=733

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PN L FT   KKL++ VTF  ++  + ++FGSITW++ KYKVRSP VV
Sbjct  678  PNTLKFTRDNKKLTFQVTFQQTTKSQEDLFGSITWSNEKYKVRSPFVV  725



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KL FT   K LSY V F+A + LE ++FGSITW++ KY VR P V+
Sbjct  719  PDKLQFTESSKTLSYQVIFSALTPLEKDLFGSITWSNDKYTVRIPFVL  766



>gb|KEH30495.1| subtilisin-like serine protease [Medicago truncatula]
Length=773

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P+KLVFT  VKK SY VT TA +          +FGS+TWT GK+ VRSPIVV
Sbjct  715  PSKLVFTEGVKKRSYVVTVTADTRNMKMDPSGAVFGSLTWTDGKHVVRSPIVV  767



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P+KL F+   +KLSY V F+++ SS + ++FGS+TWT+GK KVRSP VV++
Sbjct  726  PDKLEFSKNNQKLSYQVVFSSTTSSPKGDMFGSLTWTNGKNKVRSPFVVSI  776



>emb|CDO96926.1| unnamed protein product [Coffea canephora]
Length=775

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P+KLVFT +V+KLSY VT TA S          +FGS++W  GK+ VRSPIVV
Sbjct  717  PSKLVFTEKVRKLSYFVTVTADSKNLVIGDSGAVFGSLSWVDGKHVVRSPIVV  769



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE-TNIFGSITWTSGKYKVRSPIVV  145
            P KL F+   KKLSY V F+++S+L+  ++FGSITW++GK+ VRSP V+
Sbjct  726  PEKLQFSKNSKKLSYQVIFSSTSTLKKEDLFGSITWSNGKHSVRSPFVL  774



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P +L FT   ++LSY + F A+S+LE N+FG ITW++GK+ VR+PIV+
Sbjct  705  PVRLQFTKNGQRLSYHLLFNATSTLE-NVFGDITWSNGKFNVRTPIVM  751



>ref|XP_004505786.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P++LVF+  VKK SY VT TA +     S    IFGS++WT GK+ VRSPIVV
Sbjct  718  PSRLVFSEDVKKRSYVVTVTADTRNLKMSPSGAIFGSLSWTDGKHVVRSPIVV  770



>gb|KDP36888.1| hypothetical protein JCGZ_08179 [Jatropha curcas]
Length=705

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P +L FT   ++LSY + F A+S+LE N+FG ITW++GK+ VR+PIV+
Sbjct  654  PVRLQFTKNGQRLSYHLLFNATSTLE-NVFGDITWSNGKFNVRTPIVM  700



>gb|KEH34337.1| subtilisin-like serine protease [Medicago truncatula]
Length=733

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P KL FT + KK SY V F+++ +SL+ ++FG ITW SGKY VRSP V+ V
Sbjct  683  PEKLQFTKRSKKQSYQVIFSSNLTSLKEDLFGFITWRSGKYSVRSPFVLTV  733



>gb|EYU17578.1| hypothetical protein MIMGU_mgv1a0038491mg, partial [Erythranthe 
guttata]
Length=501

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKLVFT  V+KLS+ V FT    S   + FGSITW++ K++VRSP VV
Sbjct  444  PNKLVFTKNVEKLSFRVIFTLGVDSDYQDFFGSITWSNEKHRVRSPFVV  492



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI-FGSITWTSGKYKVRSPIVVNVE  154
            PN LVF ++ KK+++TVT T +  + T   FGS+TWT G++KVRSP+ V  E
Sbjct  713  PNVLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGEHKVRSPLSVRTE  764



>ref|NP_001175897.1| Os09g0482660 [Oryza sativa Japonica Group]
 dbj|BAH94625.1| Os09g0482660, partial [Oryza sativa Japonica Group]
Length=523

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA---SSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P KL FT  VKKL + V+F+    +++ + ++FGSITW+ GK+ VRSP VV +
Sbjct  471  PGKLEFTKSVKKLGFQVSFSGKNAAAAAKGDLFGSITWSDGKHTVRSPFVVTI  523



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            PNKL F+    KLSY V F+A+ +S++ ++FGSITW+ G ++VRSP  V
Sbjct  725  PNKLHFSKNTTKLSYQVIFSATKASVKGDLFGSITWSDGIHRVRSPFAV  773



>ref|XP_009593174.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P+KLVF+ +V+KLSY VT T  S +L  N    +FGS++W  GK+ VRSPIVV
Sbjct  716  PDKLVFSEKVRKLSYYVTITVDSKNLVLNDSGAVFGSLSWIDGKHVVRSPIVV  768



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL F    +K SY V FT + S     FGSITWT+GK++VRSP VV  E
Sbjct  723  PEKLKFAKNYEKQSYQVVFTPTVSTMKRGFGSITWTNGKHRVRSPFVVTSE  773



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA---SSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P KL FT  VKKL + V+F+    +++ + ++FGSITW+ GK+ VRSP VV +
Sbjct  758  PGKLEFTKSVKKLGFQVSFSGKNAAAAAKGDLFGSITWSDGKHTVRSPFVVTI  810



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KL F    +K SY V FT + S     FGSITWT+GK++VRSP VV  E
Sbjct  718  PEKLKFAKNYEKQSYQVVFTPTVSTMKRGFGSITWTNGKHRVRSPFVVTSE  768



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL FT    ++SY V F+  +SL+ ++FGSITW + KY VRSP V+
Sbjct  717  PEKLQFTKSSNRISYQVIFSNLTSLKEDLFGSITWRNDKYSVRSPFVI  764



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS---SSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FT  V+KL + VTF+ S   ++ + ++ GSITW+ GK+ VRSP VV+
Sbjct  754  PSKLEFTESVQKLGFQVTFSVSGKNAAAQADLSGSITWSDGKHTVRSPFVVS  805



>ref|XP_002510578.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52765.1| Cucumisin precursor, putative [Ricinus communis]
Length=578

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITWTSGKYKVRSPIVV  145
            P  L FT   +KLSYT  F A S L+ + +FG+ITWT+GK+KVR P VV
Sbjct  524  PTPLQFTKNGQKLSYTAYFKALSVLDDDDVFGAITWTNGKFKVRIPFVV  572



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL FT   KK SY   F+ + +SL+ ++FGSITW++GKY VRSP V+
Sbjct  713  PEKLQFTKSNKKQSYQAIFSTTLTSLKEDLFGSITWSNGKYSVRSPFVL  761



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA---SSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL FT   +K +Y VT +A   SS  + ++F SITW++GKYKVRSPIVV
Sbjct  708  PEKLRFTKDGEKSTYQVTVSAASASSPPKKDVFSSITWSNGKYKVRSPIVV  758



>ref|XP_007226628.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
 gb|EMJ27827.1| hypothetical protein PRUPE_ppa022764mg [Prunus persica]
Length=722

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIV  142
            P+KL F+   +KLSY V F+++ SS + ++FGS+TWT+GK KVRSP V
Sbjct  670  PDKLEFSKNNQKLSYQVVFSSTTSSPKGDMFGSLTWTNGKNKVRSPFV  717



>ref|XP_002313716.1| hypothetical protein POPTR_0009s13590g [Populus trichocarpa]
 gb|EEE87671.1| hypothetical protein POPTR_0009s13590g [Populus trichocarpa]
Length=773

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P KLVFT  VKK S+ VT TA +          +FGSI+W+ GK+ VRSPIVV
Sbjct  715  PRKLVFTEAVKKRSFIVTITADTRNLIMGDSGAVFGSISWSDGKHVVRSPIVV  767



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KLVFT + +  SY VTFT+  +    +FGSI WT G ++VRSP+ V
Sbjct  711  PSKLVFTEKNQVASYEVTFTSVGASLMTVFGSIEWTDGSHRVRSPVAV  758



>ref|NP_001238252.1| subtilisin-type protease precursor [Glycine max]
 gb|AAG38994.1|AF160513_1 subtilisin-type protease precursor [Glycine max]
 emb|CAB87246.1| putative pre-pro-subtilisin [Glycine max]
 emb|CAB87247.1| putative subtilisin precursor [Glycine max]
Length=770

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT  +KK SY +TF   +SL+ ++FGSITW++ KY VR P V+
Sbjct  721  PYNLEFTTSIKKQSYNITFRPKTSLKKDLFGSITWSNDKYMVRIPFVL  768



>ref|XP_004496644.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L FT + +KLSY VTF A++ L    FG + W  G +KVRSPIV+
Sbjct  733  PDTLNFTRKYEKLSYKVTFKATTRLSEPEFGGLVWKDGVHKVRSPIVI  780



>emb|CDY63158.1| BnaCnng41540D [Brassica napus]
Length=56

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P ++ F     KLSY V F++S+S L+ + FGS+TW++G ++VRSP VV
Sbjct  2    PRRVHFKEIGDKLSYQVKFSSSTSTLKEDAFGSVTWSNGMHRVRSPFVV  50



>ref|XP_004308418.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=743

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KLVF    +KLSY V+F   S+   + FGS+ W S KY+VRSPI V
Sbjct  693  PRKLVFKKMGEKLSYKVSFVGMSATTNSSFGSLVWVSEKYRVRSPIAV  740



>ref|XP_006486757.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=779

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P++LVFT  VKK S+ VT TA S +L  N     FGSI+W+ GK++VRSP+VV
Sbjct  721  PSRLVFTEGVKKSSFVVTVTADSKNLVLNDSGAAFGSISWSDGKHEVRSPLVV  773



>ref|XP_006422621.1| hypothetical protein CICLE_v10027859mg [Citrus clementina]
 gb|ESR35861.1| hypothetical protein CICLE_v10027859mg [Citrus clementina]
 gb|KDO68022.1| hypothetical protein CISIN_1g004010mg [Citrus sinensis]
Length=779

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P++LVFT  VKK S+ VT TA S +L  N     FGSI+W+ GK++VRSP+VV
Sbjct  721  PSRLVFTEGVKKSSFVVTVTADSKNLVLNDSGAAFGSISWSDGKHEVRSPLVV  773



>gb|KDO68023.1| hypothetical protein CISIN_1g004010mg [Citrus sinensis]
Length=764

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P++LVFT  VKK S+ VT TA S +L  N     FGSI+W+ GK++VRSP+VV
Sbjct  706  PSRLVFTEGVKKSSFVVTVTADSKNLVLNDSGAAFGSISWSDGKHEVRSPLVV  758



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P++L FT   K LSY VTF +S SS++ + FGSITW++GK+ V++  VV+V
Sbjct  733  PDRLQFTETSKSLSYQVTFASSGSSIKKDAFGSITWSNGKHSVKTTFVVSV  783



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P  L FT+ V+ LSY +TFT S+S+    FGSI WT G + VRSPI V  E
Sbjct  714  PTTLAFTSTVQTLSYDITFT-STSIGPPSFGSIEWTDGSHHVRSPIAVQWE  763



>emb|CDP10007.1| unnamed protein product [Coffea canephora]
Length=744

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P  L F+   +KLSY +TFT  S  ET   GS+TWTS KY VRSPI    E
Sbjct  689  PRILSFSKVNQKLSYDITFTPLSPYETPSDGSLTWTSAKYSVRSPIAAQPE  739



>gb|AEW09204.1| hypothetical protein CL4686Contig1_05, partial [Pinus radiata]
 gb|AFG57997.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG57998.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG57999.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58000.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58001.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58002.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58003.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58004.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58005.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58006.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58007.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58008.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58009.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58010.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58011.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58012.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58013.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
 gb|AFG58014.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda]
Length=69

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITWTSGKYKVRSPIVVNV  151
            P++L F+    K++Y+V FTAS +      FGSITW  G + VR+P  VN+
Sbjct  18   PSQLAFSGTSDKITYSVMFTASGNASKGYAFGSITWADGTHNVRTPFAVNI  68



>ref|XP_010477248.1| PREDICTED: CO(2)-response secreted protease [Camelina sativa]
Length=776

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTF--TASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P +L F     KLSY V F  T SS+L+ ++FGSITW++G Y VRSP VV
Sbjct  722  PRRLHFRKIGDKLSYQVIFSSTTSSTLKEDVFGSITWSNGMYSVRSPFVV  771



>ref|XP_003538985.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVVN  148
            P++LVF+  VKK SY VT    +          +FGS+TWT GK+ VRSPIVV+
Sbjct  712  PSRLVFSEAVKKRSYAVTVAGDTRNLKMGQSGAVFGSLTWTDGKHVVRSPIVVS  765



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P+KL FT   +KLSY   F+ SS      FG+I WT+GKYKV  P V+N E
Sbjct  618  PDKLRFTKNNQKLSYQAIFSRSSKSNKASFGTILWTNGKYKVHIPFVLNNE  668



>ref|XP_011076276.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KL FT   KK++Y +TFT  S      FGSI W  G ++VRSP+V+
Sbjct  728  PSKLDFTGNRKKMTYKITFTTKSRQSAPEFGSIIWKDGVHRVRSPVVI  775



>ref|XP_004496643.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=780

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L FT + +KLSY VTF A+S      FG + W  G+++VRSPIV+
Sbjct  732  PDTLNFTRKYEKLSYKVTFKATSRQSNPEFGGLVWKDGEHEVRSPIVI  779



>ref|XP_010229422.1| PREDICTED: CO(2)-response secreted protease-like [Brachypodium 
distachyon]
Length=521

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P++L FT  VKKL + VTF++ S++ +  + GSITW+ GK+ VRSP VV+
Sbjct  471  PSELQFTKSVKKLGFQVTFSSNSTAAKGTLSGSITWSDGKHTVRSPFVVS  520



>ref|XP_002511772.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF50441.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=744

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA---SSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L F N  +KLSY VTF       S E++ FGS+ W SGKYKV+SPI V
Sbjct  691  PKILRFRNSGEKLSYKVTFIGLKERDSRESHSFGSLVWVSGKYKVKSPIAV  741



>ref|XP_010090327.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB39297.1| Subtilisin-like protease [Morus notabilis]
Length=778

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SL---ETNI-FGSITWTSGKYKVRSPIVV  145
            P KLVFT  VKK S+ VT TA + SL   E+   FGS++WT GK+ VRSPIVV
Sbjct  720  PAKLVFTEAVKKQSFVVTVTADARSLVLGESGANFGSLSWTDGKHVVRSPIVV  772



>ref|XP_003540860.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P++LVF+  VKK SY VT    +          +FGS+TWT GK+ VRSPIVV
Sbjct  715  PSRLVFSEAVKKRSYVVTVAGDTRKLKMGPSGAVFGSLTWTDGKHVVRSPIVV  767



>ref|XP_007131701.1| hypothetical protein PHAVU_011G034700g [Phaseolus vulgaris]
 gb|ESW03695.1| hypothetical protein PHAVU_011G034700g [Phaseolus vulgaris]
Length=775

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P++LVF+  VKK SY VT    +          +FGS+TWT GK+ VRSPIVV
Sbjct  717  PSRLVFSEAVKKQSYVVTVVGDTRNMKMGQSGAVFGSLTWTDGKHVVRSPIVV  769



>ref|XP_006490276.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO65327.1| hypothetical protein CISIN_1g044578mg [Citrus sinensis]
Length=769

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL FT + +KLSY +TFT  S      FG + W  G +KVRSPIV+
Sbjct  716  PQKLHFTKKYQKLSYKITFTTKSPETIPEFGGLIWKDGVHKVRSPIVI  763



>ref|XP_006421788.1| hypothetical protein CICLE_v10004381mg [Citrus clementina]
 gb|ESR35028.1| hypothetical protein CICLE_v10004381mg [Citrus clementina]
Length=769

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL FT + +KLSY +TFT  S      FG + W  G +KVRSPIV+
Sbjct  716  PQKLHFTKKYQKLSYKITFTTKSPETIPEFGGLIWKDGVHKVRSPIVI  763



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITWTSGKYKVRSPIVVNVE  154
            PN L F ++ KK+++TVT T +  + T   FGSITWT G + VRSP+ V  E
Sbjct  689  PNVLAFNHKTKKITFTVTVTTAHQVNTGYFFGSITWTDGVHTVRSPLSVRTE  740



>ref|XP_003603805.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES74056.1| subtilisin-like serine endopeptidase-like protein [Medicago truncatula]
Length=164

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVN  148
            P KL FT   KK+SY V F+ +   L  ++FGSITW + KY VRSP V++
Sbjct  114  PEKLQFTKSSKKISYQVIFSYTLIPLNDDLFGSITWRNDKYSVRSPFVLS  163



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITW--TSGKYKVRSPIVV  145
            P KLVF  + +KLSYT+T     SLE + I GS++W    GKY VRSPIV 
Sbjct  702  PQKLVFKKEHEKLSYTLTLEGPKSLEEDVIHGSLSWVHDGGKYVVRSPIVA  752



>emb|CBI35855.3| unnamed protein product [Vitis vinifera]
Length=1791

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2     PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
             P+KLVFT + +  SY VTFT+  +     FGSI WT G ++VRSP+ V
Sbjct  1115  PSKLVFTEKNQVASYEVTFTSVGASLMTEFGSIEWTDGSHRVRSPVAV  1162



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPI  139
            P+KLVF N   KL YTVTF +   ++   T+ FGSITW + +++VRSP+
Sbjct  169  PSKLVFGNVGDKLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQVRSPV  217



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+KLVFT + +  SY VTFT+  +     FGSI WT G ++VRSP+ V
Sbjct  731  PSKLVFTEKNQVASYEVTFTSVGASLMTEFGSIEWTDGSHRVRSPVAV  778



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P++L FT++ +KLSY V F   S  +   FGS+ W  G +KVRSPIV+
Sbjct  718  PSRLNFTSKHQKLSYKVIFETKSRQKAPEFGSLIWKDGAHKVRSPIVI  765



>ref|XP_010028715.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW55509.1| hypothetical protein EUGRSUZ_I01402 [Eucalyptus grandis]
Length=771

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P KLVFT  VKK SY VT TA + +LE +     FGS+ W+ GK+ VRSPI +
Sbjct  713  PAKLVFTEAVKKQSYVVTVTADTRNLELDDSGAAFGSLAWSDGKHMVRSPIAI  765



>ref|XP_010646965.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=774

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P KLVF+ ++KK S+ VT +A S  +E      +FGS++W+ GK+ VRSPIVV
Sbjct  716  PAKLVFSEKMKKQSFVVTVSADSRKIEMGESGAVFGSLSWSDGKHVVRSPIVV  768



>emb|CBI37888.3| unnamed protein product [Vitis vinifera]
Length=795

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P KLVF+ ++KK S+ VT +A S  +E      +FGS++W+ GK+ VRSPIVV
Sbjct  737  PAKLVFSEKMKKQSFVVTVSADSRKIEMGESGAVFGSLSWSDGKHVVRSPIVV  789



>ref|XP_002971846.1| hypothetical protein SELMODRAFT_412516 [Selaginella moellendorffii]
 gb|EFJ26763.1| hypothetical protein SELMODRAFT_412516 [Selaginella moellendorffii]
Length=757

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P++L FT  ++K+S+TV+ +     +  +FG++ W+ GK+ VRSPI VN 
Sbjct  703  PSELQFTRPLQKISFTVSLSVQQRSQDFVFGALVWSDGKHFVRSPIAVNA  752



>ref|XP_002972374.1| hypothetical protein SELMODRAFT_413072 [Selaginella moellendorffii]
 gb|EFJ26460.1| hypothetical protein SELMODRAFT_413072 [Selaginella moellendorffii]
Length=757

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P++L FT  ++K+S+TV+ +     +  +FG++ W+ GK+ VRSPI VN 
Sbjct  703  PSELQFTRPLQKISFTVSLSVQQRSQDFVFGALVWSDGKHFVRSPIAVNA  752



>gb|EYU25025.1| hypothetical protein MIMGU_mgv1a001588mg [Erythranthe guttata]
Length=789

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGK-YKVRSPIVV  145
            P +L FT +VKK++Y +TFTA S      FGSI W  G  ++VRSP+V+
Sbjct  735  PARLDFTAKVKKITYKITFTARSRQTAPEFGSIIWKDGGVHRVRSPVVI  783



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI-FGSITWTSGKYKVRSPIVVNVE  154
            PN LVF ++ KK+++TVT T +  + T   FGS+TWT G + VRSP+ V  E
Sbjct  713  PNVLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGVHIVRSPLSVRTE  764



>ref|XP_009789823.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNI----FGSITWTSGKYKVRSPIVV  145
            P+KLVF+ +V+KLSY VT T  S +L  N     FGS++W  G + VRSPIVV
Sbjct  716  PDKLVFSEKVRKLSYYVTITVDSKNLVLNDSGAEFGSLSWIDGNHVVRSPIVV  768



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT   +KLSY +TFT  S   T  FG + W  G ++VRSPIVV
Sbjct  727  PRTLKFTRANQKLSYKITFTTKSRQATPEFGGLVWKDGVHRVRSPIVV  774



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPI  139
            P+KLVF N  +KL YTVTF +   ++   T+ FGSITW + +++VRSP+
Sbjct  714  PSKLVFGNVGEKLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQVRSPV  762



>ref|XP_002305511.2| hypothetical protein POPTR_0004s17960g [Populus trichocarpa]
 gb|EEE86022.2| hypothetical protein POPTR_0004s17960g [Populus trichocarpa]
Length=773

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS---LETN--IFGSITWTSGKYKVRSPIVV  145
            P KLVFT  VKK S+ VT TA++    L+ +  +FGSI+W+ GK+ VRSPI+V
Sbjct  715  PPKLVFTEAVKKQSFIVTITANTRNLMLDDSGAVFGSISWSDGKHVVRSPILV  767



>ref|XP_011046353.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Populus 
euphratica]
Length=777

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P KL+FT  VKK S+ VT TA++          +FGSI W+ GK+ VRSPIVV
Sbjct  719  PRKLMFTEAVKKRSFIVTITANARNLIMGDSGAVFGSIAWSDGKHVVRSPIVV  771



>ref|XP_004231026.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=772

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P KL F+ +++KLSY VT T  S +L  N    +FGS++W  GK+ VRSPIVV
Sbjct  714  PAKLGFSEKIRKLSYYVTITVDSKNLVLNDSGAVFGSLSWVDGKHVVRSPIVV  766



>ref|XP_011088593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=791

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS---LETN--IFGSITWTSGKYKVRSPIVV  145
            P KLVF+  V++L Y VT T  S    L+ +  +FGS++W  GK+ VRSPIVV
Sbjct  733  PGKLVFSETVRRLGYYVTITIDSKHLVLDDSGAVFGSLSWVDGKHVVRSPIVV  785



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L FT+ V+ LSY +TFT S+S   + FGSI W+ G + VRSPI +
Sbjct  712  PSTLTFTSTVQTLSYDITFT-STSRGASSFGSIEWSDGNHHVRSPIAI  758



>gb|ABK93620.1| unknown [Populus trichocarpa]
Length=65

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE-TNIFGSITWTSGKYKVRSPIV  142
            P  L F  + +K SYTVTFTA+S    TN F  + W+ GK+ VRSPI 
Sbjct  14   PESLSFAKEYEKKSYTVTFTATSMPSGTNSFAHLEWSDGKHVVRSPIA  61



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT++ +KL+Y +TFT  S      FG++ W+ G +KVRSPIV+
Sbjct  729  PKTLQFTSKHRKLAYKITFTTKSRQSMPEFGNLIWSDGIHKVRSPIVI  776



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSY VTFT  S      FG + W  G +KVRSPIV+
Sbjct  725  PETLSFTKKYQKLSYKVTFTTQSRQTEPEFGGLVWKDGVHKVRSPIVL  772



>ref|XP_003623810.1| Subtilisin-like protease [Medicago truncatula]
Length=786

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPIVV  145
            P KL F    +KLSY VTF A        ++ FGSI W SGKYKVRSPI V
Sbjct  733  PRKLKFEKFGQKLSYKVTFLAVGKARVTGSSSFGSIIWVSGKYKVRSPIAV  783



>ref|XP_003523496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P++LVF+  VKK S+ VT TA   +LE      +FGS++WT GK+ VRSP+VV
Sbjct  719  PSQLVFSEAVKKRSFVVTVTADGRNLELGQAGAVFGSLSWTDGKHVVRSPMVV  771



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT   +KLSY +TFT  S   T  FG + W  G ++VRSPIV+
Sbjct  788  PRTLKFTRANQKLSYKITFTTKSRQATPEFGGLVWKDGVHRVRSPIVI  835



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P +L FT++ +KLSY VTF   S  +   FGS+ W  G +KVRSPI +
Sbjct  722  PERLNFTSKNQKLSYKVTFKTVSRQKAPEFGSLIWKDGTHKVRSPIAI  769



>gb|AES80028.2| subtilisin-like serine protease [Medicago truncatula]
Length=774

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPIVV  145
            P KL F    +KLSY VTF A        ++ FGSI W SGKYKVRSPI V
Sbjct  721  PRKLKFEKFGQKLSYKVTFLAVGKARVTGSSSFGSIIWVSGKYKVRSPIAV  771



>ref|XP_006857985.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
 gb|ERN19452.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
Length=786

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSY V FT+ S   +   G++ WT G +KVRSPIV+
Sbjct  733  PRTLNFTEKYQKLSYEVIFTSKSQQTSPALGALVWTDGIHKVRSPIVL  780



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLET-NIFGSITWTSGKYKVRSPIVVN  148
            P  LVFT   ++ SYTVTFTA S+  T N+FG I W+ GK+ V SP+ ++
Sbjct  717  PETLVFTRVNEQKSYTVTFTAPSTPSTTNVFGRIEWSDGKHVVGSPVAIS  766



>ref|XP_010498446.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Camelina 
sativa]
Length=666

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTF--TASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P +L F     KLSY V F  T SS+++ + FGSITW++G Y VRSP VV
Sbjct  612  PRRLHFRKIGDKLSYQVIFSSTTSSTIKEDAFGSITWSNGMYNVRSPFVV  661



>ref|XP_010482516.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010482517.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=779

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT++ +KLSYTVTFT    ++   FG + W S  +KVRSP+++
Sbjct  726  PKTLSFTSKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPVII  773



>gb|EPS66412.1| hypothetical protein M569_08368, partial [Genlisea aurea]
Length=174

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETNIFGSITWTSG-KYKVRSPIVV  145
            P+ L F   + KL++ V+FT  + ++  +IFGSITW+SG KY VRSP VV
Sbjct  121  PSVLEFAKGIDKLTFQVSFTGLNVAVGEDIFGSITWSSGNKYSVRSPFVV  170



>ref|XP_002979023.1| hypothetical protein SELMODRAFT_177291 [Selaginella moellendorffii]
 gb|EFJ19980.1| hypothetical protein SELMODRAFT_177291 [Selaginella moellendorffii]
Length=705

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 3/53 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS---SLETNIFGSITWTSGKYKVRSPIVVNV  151
            P+ L F + V KLSY +TF A+    S+    FGSITW+ G + VRSPI V V
Sbjct  647  PDNLHFNSSVTKLSYEITFEAAQIVRSVGHYAFGSITWSDGVHYVRSPISVQV  699



>ref|XP_011043530.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=757

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI-FGSITW--TSGKYKVRSPIVV  145
            P KLVF  + +KLSYT+T     SL+ +I  GS++W    GKY VRSPIV 
Sbjct  702  PQKLVFNKEHEKLSYTLTLEGPKSLKEDIVHGSLSWVHDGGKYVVRSPIVA  752



>ref|XP_007135314.1| hypothetical protein PHAVU_010G118900g, partial [Phaseolus vulgaris]
 gb|ESW07308.1| hypothetical protein PHAVU_010G118900g, partial [Phaseolus vulgaris]
Length=152

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 5/54 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTF----TASSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            P  LVF  + +KLSYT+      T     E + FG +TWT+GKY VRSPIVV +
Sbjct  95   PELLVFKEKYEKLSYTLRIEGPRTKKEEKEVD-FGHLTWTNGKYVVRSPIVVTI  147



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVN  148
            P+ L FT   +K SYTVTF+A+S    TN FG I W+ GK+ V SP+V++
Sbjct  729  PDTLTFTKAYEKKSYTVTFSATSMPSNTNEFGRIEWSDGKHVVGSPVVIS  778



>ref|XP_004292169.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-----LETNIFGSITWTSGKYKVRSPIVV  145
            P+KLVFT  VKK SY VT     S         +FGS+ W+ GK+ VRSPIVV
Sbjct  711  PSKLVFTEAVKKRSYLVTVAVDRSNLVLGESGGVFGSLYWSDGKHVVRSPIVV  763



>ref|XP_010528996.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=756

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITWTSGKYKVRSPIVVNVE  154
            P  LVF +Q KK+SYTV+ + S  + T  +FGS+TWT G + V  P+ V  +
Sbjct  699  PETLVFNSQTKKVSYTVSVSTSHKVNTGYLFGSLTWTDGTHNVAIPVSVRTK  750



>ref|XP_010266807.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=779

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS----LETNI-FGSITWTSGKYKVRSPIVVN  148
            P KLVF+  VKK S+ VT TA++      E+ I +GS++W+ GK+ VRSPIVV+
Sbjct  721  PTKLVFSESVKKQSFVVTVTANTRNLVLGESGIVYGSLSWSDGKHVVRSPIVVS  774



>ref|XP_008439131.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=807

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSY +TF     L    FG + W  G +KVRSPIV+
Sbjct  754  PESLNFTRRYEKLSYRITFVTKKRLSMPEFGGLIWKDGSHKVRSPIVM  801



>ref|XP_010442681.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=779

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSYTVTFT    ++   FG + W S  +KVRSPI++
Sbjct  726  PKTLNFTTKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPIII  773



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSL-ETNIFGSITWTSGKYKVRSPIVVNVE*GS  163
            PNKL F  +   LSY +TFT  +   E+  FGSI W+ G + VRSPI V+ + GS
Sbjct  712  PNKLEFNKEKTTLSYEITFTKINGFKESASFGSIQWSDGIHNVRSPIAVSFKTGS  766



>ref|XP_002510884.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51486.1| Cucumisin precursor, putative [Ricinus communis]
Length=775

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSY +TFTA S      FG + W  G +KVRSPIV+
Sbjct  722  PKTLKFTAKNQKLSYRITFTAKSRQIMPEFGGLVWKDGVHKVRSPIVL  769



>ref|XP_009103352.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
 ref|XP_009103353.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=784

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P  L F N    L Y V F++S+S L+ + FGSITW++G Y+VRSP VV
Sbjct  730  PRSLHFKNIGDTLRYQVIFSSSTSTLKEDAFGSITWSNGMYRVRSPFVV  778



>ref|XP_010498447.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Camelina 
sativa]
Length=642

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTF--TASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P +L F     KLSY V F  T SS+++ + FGSITW++G Y VRSP VV
Sbjct  588  PRRLHFRKIGDKLSYQVIFSSTTSSTIKEDAFGSITWSNGMYNVRSPFVV  637



>ref|XP_009789180.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=779

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P++L FT++ +KLSY V F   S L+   FGS+ W  G +KVRS IV+
Sbjct  726  PSRLNFTSKHQKLSYKVIFETKSRLKAPEFGSLIWKDGTHKVRSTIVI  773



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            PNKLVF+  V++++Y V+F+ + +     FGS+TW  G++ VR+   V VE
Sbjct  716  PNKLVFSESVQRITYKVSFSGNKARGGYNFGSLTWLDGRHYVRTLFAVKVE  766



>ref|XP_006359680.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=772

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETN----IFGSITWTSGKYKVRSPIVV  145
            P KL F+ +++KLSY VT T  S +L  N    +FGS++W  GK+ VRSPIVV
Sbjct  714  PAKLGFSEKIRKLSYYVTITVDSKNLVLNDSGAVFGSLSWVDGKHVVRSPIVV  766



>emb|CDY01388.1| BnaA07g11610D [Brassica napus]
Length=777

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P  L F N    L Y V F++S+S L+ + FGSITW++G Y+VRSP VV
Sbjct  723  PRSLHFKNIGDTLRYQVIFSSSTSTLKEDAFGSITWSNGMYRVRSPFVV  771



>gb|KHN15704.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L FT + +KLSY +T T  S      FG + W  G +KVRSPIV+
Sbjct  688  PDTLSFTRKYQKLSYKITLTTQSRQTEPEFGGLVWKDGVHKVRSPIVI  735



>ref|XP_007038510.1| Subtilase 1.3 [Theobroma cacao]
 gb|EOY23011.1| Subtilase 1.3 [Theobroma cacao]
Length=778

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSY +TFT  S      FG + W  G +KVRSPIV+
Sbjct  725  PKSLNFTRKNQKLSYKITFTTKSPQTVPEFGGLVWKDGVHKVRSPIVI  772



>ref|XP_002965274.1| hypothetical protein SELMODRAFT_406544 [Selaginella moellendorffii]
 gb|EFJ34112.1| hypothetical protein SELMODRAFT_406544 [Selaginella moellendorffii]
Length=690

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 5/55 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TN--IFGSITWTSGKYKVRSPIVVNV  151
            P +L F NQ +KLS+ VT + SSS E   +N   F S+TW  GK+ VRSPI V +
Sbjct  635  PQELKFLNQGEKLSFNVTISLSSSKEPIASNPWAFSSLTWDDGKHSVRSPIAVAI  689



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L FT + +KLSY +T T  S      FG + W  G +KVRSPIV+
Sbjct  728  PDTLSFTRKYQKLSYKITLTTQSRQTEPEFGGLVWKDGVHKVRSPIVI  775



>ref|XP_002986601.1| hypothetical protein SELMODRAFT_425502 [Selaginella moellendorffii]
 gb|EFJ12458.1| hypothetical protein SELMODRAFT_425502 [Selaginella moellendorffii]
Length=581

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 5/55 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TN--IFGSITWTSGKYKVRSPIVVNV  151
            P +L F NQ +KLS+ VT + SSS E   +N   F S+TW  GK+ VRSPI V +
Sbjct  526  PQELKFLNQGEKLSFNVTISLSSSKEPIASNPWAFSSLTWDDGKHSVRSPIAVAI  580



>gb|AAF79898.1|AC022472_7 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082 [Arabidopsis 
thaliana]
Length=779

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P +L F     KLSY V F+++++ L+ + FGSITW++G Y VRSP VV
Sbjct  721  PRRLHFRKIGDKLSYQVIFSSTTTILKDDAFGSITWSNGMYNVRSPFVV  769



>ref|NP_564106.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AEE29944.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=780

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P +L F     KLSY V F+++++ L+ + FGSITW++G Y VRSP VV
Sbjct  722  PRRLHFRKIGDKLSYQVIFSSTTTILKDDAFGSITWSNGMYNVRSPFVV  770



>ref|XP_002533857.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF28521.1| Cucumisin precursor, putative [Ricinus communis]
Length=753

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETN----IFGSITWTSGKYKVRSPIVV  145
            P+KLVF   VKK S+ VT TA + +L  +    +FGS+TW+ G + VRSPIVV
Sbjct  695  PSKLVFNQAVKKRSFVVTLTADTRNLMVDDSGALFGSVTWSEGMHVVRSPIVV  747



>gb|EYU37942.1| hypothetical protein MIMGU_mgv1a001727mg [Erythranthe guttata]
Length=768

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS---LETN--IFGSITWTSGKYKVRSPIVV  145
            P KLVF+   ++L Y VT T  S    L+ +  +FGSI+W  GK+ VRSPIVV
Sbjct  710  PEKLVFSESSRRLGYYVTVTIDSKNLVLDDSGAVFGSISWVDGKHVVRSPIVV  762



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPIVV  145
            P KL F    +KLSY VTF +        T+ FGS+ W SGKYKVRSP+ V
Sbjct  685  PRKLKFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLVWVSGKYKVRSPMAV  735



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPIV  142
            P KLVF N   KL YTVTF A   +     N FGSI W + +++VRSP+ 
Sbjct  712  PTKLVFRNVGDKLRYTVTFVAKKGIRKAARNGFGSIVWRNAEHQVRSPVA  761



>ref|XP_002893090.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69349.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS--LETNIFGSITWTSGKYKVRSPIVV  145
            P +L F     KLSY V F++++S  L+ + FGSITW++G Y VRSP VV
Sbjct  720  PRRLHFRKIGDKLSYQVIFSSTTSTILKDDAFGSITWSNGMYNVRSPFVV  769



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS--SLETNIFGSITWTSGKYKVRSPIVVN  148
            P  L F+   +K SYTVTFTA S  S  TN+FG I W+ GK+ V SP+ ++
Sbjct  721  PETLSFSQMNEKKSYTVTFTAPSMSSSTTNVFGRIEWSDGKHVVGSPLAIS  771



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            PNKLVF+ +V++L+Y V+F A  +     FGS+TW  G++ V +   V VE
Sbjct  719  PNKLVFSERVQRLTYKVSFYAKEAHGGYNFGSLTWLDGRHYVHTVFAVKVE  769



>ref|XP_010443674.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
 ref|XP_010443682.1| PREDICTED: subtilisin-like protease isoform X3 [Camelina sativa]
Length=779

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSYTVTFT    ++   FG + W S  +KVRSP+++
Sbjct  726  PKTLNFTTKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPVII  773



>ref|XP_010443668.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=779

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSYTVTFT    ++   FG + W S  +KVRSP+++
Sbjct  726  PKTLNFTTKHQKLSYTVTFTTRMRMKRPEFGGLVWKSTTHKVRSPVII  773



>ref|XP_007137352.1| hypothetical protein PHAVU_009G120000g [Phaseolus vulgaris]
 gb|ESW09346.1| hypothetical protein PHAVU_009G120000g [Phaseolus vulgaris]
Length=780

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS-----LETNIFGSITWTSGKYKVRSPIVV  145
            P++LVF+  VKK S+ VT T  +          +FGS++WT GK+ VRSPIVV
Sbjct  722  PSRLVFSEAVKKRSFVVTVTGVAGNMVLGEAGAVFGSLSWTDGKHVVRSPIVV  774



>ref|XP_002864127.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40386.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT++ +KLSYTVTF     L+   FG + W S  +KVRSP+++
Sbjct  687  PKTLNFTSKHQKLSYTVTFRTRMRLKRPEFGGLVWKSSTHKVRSPVII  734



>gb|EMT05539.1| Subtilisin-like protease [Aegilops tauschii]
Length=604

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P+KL FT+ VKKL++ VTF+  ++  +  + GSITW+ GK+ V SP  V+
Sbjct  553  PSKLQFTSSVKKLAFQVTFSGKNTGAKAALTGSITWSDGKHTVHSPFAVS  602



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLET-NIFGSITWTSGKYKVRSPIVVN  148
            P  LVFT   ++ SYTVTFTA S   T N++G I W+ GK+ V SP+ ++
Sbjct  717  PETLVFTRANEQKSYTVTFTAPSMPSTTNVYGRIEWSDGKHVVGSPVAIS  766



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KLVF+ + +  SY V+FT+  S   + FGSI W+ G + VRSP+ V
Sbjct  522  PKKLVFSKENQTASYEVSFTSVESYIGSRFGSIEWSDGTHIVRSPVAV  569



>ref|XP_002978893.1| hypothetical protein SELMODRAFT_110049, partial [Selaginella 
moellendorffii]
 gb|EFJ19850.1| hypothetical protein SELMODRAFT_110049, partial [Selaginella 
moellendorffii]
Length=710

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 3/53 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS---SLETNIFGSITWTSGKYKVRSPIVVNV  151
            P+ L F + V KLSY +TF A+    S+    FGSITW+ G + VRSPI V V
Sbjct  652  PDILHFNSSVTKLSYEITFEAAQIVRSVGHYAFGSITWSDGVHYVRSPISVQV  704



>ref|XP_002982832.1| hypothetical protein SELMODRAFT_234125 [Selaginella moellendorffii]
 gb|EFJ16077.1| hypothetical protein SELMODRAFT_234125 [Selaginella moellendorffii]
Length=687

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI--FGSITWTSGKYKVRSPIVV  145
            P+ L F++  +KLSYT+T TA +SL  ++  FGSITW +  + VRSPI V
Sbjct  628  PSSLEFSSTGQKLSYTITATAKNSLPVSMWSFGSITWIASSHTVRSPIAV  677



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFT---ASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL F +  ++LSY V+F       +L+   FGS+ W SGKY VRSPIVV
Sbjct  711  PEKLSFGSLGEQLSYKVSFVSLGGKEALDKFSFGSLVWISGKYAVRSPIVV  761



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004167887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=766

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFT---ASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KL F +  ++LSY V F       +L+T  FGS+ W SGKY VRSPI V
Sbjct  713  PEKLSFGSLGEQLSYQVRFVSLGGKEALDTFSFGSLVWISGKYAVRSPIAV  763



>gb|EYU40429.1| hypothetical protein MIMGU_mgv1a001733mg [Erythranthe guttata]
Length=767

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-----SLETNIFGSITWTSGKYKVRSPIVV  145
            P KLVF+  V++L Y VT T             +FGS+TW  GK+ VRSP++V
Sbjct  709  PRKLVFSETVRRLGYYVTITVDCKSLVFGDSGAVFGSVTWVDGKHVVRSPVLV  761



>emb|CDP09846.1| unnamed protein product [Coffea canephora]
Length=729

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFT--ASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PN L F+   +KL+Y VTF+  ASS+  T   GS+ WTS KY VRSPIV 
Sbjct  672  PNTLSFSEVNQKLTYEVTFSLLASSANNTVSQGSLAWTSAKYSVRSPIVA  721



>emb|CDY68972.1| BnaAnng29000D, partial [Brassica napus]
Length=98

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKK-LSYTVTFTASSS-LETNIFGSITWTSGKYKVRSPIVV  145
            P  L F  ++   LSY   F++S+S L+ + FGSITW++G Y+VRSP VV
Sbjct  43   PTSLHFKKKIGDTLSYQGIFSSSTSTLKEDAFGSITWSNGMYRVRSPFVV  92



>ref|XP_011001975.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS---LETN--IFGSITWTSGKYKVRSPIVV  145
            P KLVFT  VKK S+ VT TA++    L+ +  +FGSI+W+ GK+ VRS I+V
Sbjct  715  PPKLVFTEAVKKQSFIVTITANTRNLMLDDSGAVFGSISWSDGKHVVRSSILV  767



>ref|XP_011001974.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS---LETN--IFGSITWTSGKYKVRSPIVV  145
            P KLVFT  VKK S+ VT TA++    L+ +  +FGSI+W+ GK+ VRS I+V
Sbjct  715  PPKLVFTEAVKKQSFIVTITANTRNLMLDDSGAVFGSISWSDGKHVVRSSILV  767



>ref|XP_009119746.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=768

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI-FGSITWTSGKYKVRSPIVVNVE  154
            P  L F    ++LSYTVTF A +S +++  FG++ W S K+KVRSPI V  E
Sbjct  717  PKVLKFQKVRERLSYTVTFVAEASRDSSSSFGALVWISDKHKVRSPIAVTWE  768



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P KLVF+ + +  SY V+FT+  S   + FGSI W+ G + VRSP+ V
Sbjct  714  PKKLVFSKENQTASYEVSFTSVESYIGSRFGSIEWSDGTHIVRSPVAV  761



>ref|XP_002518939.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43472.1| Cucumisin precursor, putative [Ricinus communis]
Length=752

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI-FGSITWTSGKYKVRSPIVV  145
            P  L+F +  K LS+ VTF +S  +E +  FGS+TW+ G++ VRSPI V
Sbjct  694  PKVLIFNSTTKNLSFKVTFFSSDKVEGDYRFGSLTWSDGQHFVRSPIAV  742



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVN  148
            P  L F+   +K S+ VTFTA+S    TNIFG I W+ GK+ V SPIVV+
Sbjct  716  PGSLSFSELNEKKSFKVTFTATSMPSNTNIFGRIEWSDGKHVVGSPIVVS  765



>gb|KDP28707.1| hypothetical protein JCGZ_14478 [Jatropha curcas]
Length=739

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA---SSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P  L F    ++LSY VTF +     + E++ FGS+ W SGKYKVRSPI ++
Sbjct  686  PKILSFRKLREELSYNVTFVSLGVRDTRESHSFGSLVWVSGKYKVRSPIAIS  737



>ref|XP_002981864.1| hypothetical protein SELMODRAFT_115574, partial [Selaginella 
moellendorffii]
 gb|EFJ16957.1| hypothetical protein SELMODRAFT_115574, partial [Selaginella 
moellendorffii]
Length=725

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI--FGSITWTSGKYKVRSPIVV  145
            P+ L F++  +KLSYT+T TA +SL  ++  FGSITW +  + VRSPI +
Sbjct  666  PSSLEFSSTGQKLSYTITATAKNSLPVSMWSFGSITWIASSHTVRSPIAI  715



>ref|XP_002972619.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
 gb|EFJ26705.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
Length=747

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTAS-SSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L F++  +K S+T+TFTA  SS    +FG  +W+ GK++VRSPIVV
Sbjct  678  PSILKFSSTGEKKSFTLTFTAERSSKGAYVFGDFSWSDGKHQVRSPIVV  726



>ref|XP_006304500.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
 gb|EOA37398.1| hypothetical protein CARUB_v10011271mg [Capsella rubella]
Length=781

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTF--TASSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P +L F     KL+Y V F  T SS+L+ + FGS+TW++G + VRSP VV+
Sbjct  722  PRRLHFRKIGDKLNYQVIFSSTTSSTLKEDAFGSVTWSNGMFSVRSPFVVS  772



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLE---TNIFGSITWTSGKYKVRSPIVV  145
            P KL F    +KLSY VTF A+   +   T+ FGS+ W S +YKVRSPI +
Sbjct  717  PRKLKFEKLGQKLSYNVTFFATGGPKVGGTSSFGSLIWVSDRYKVRSPIAI  767



>emb|CBI33725.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASS-SLETNIFGSITWTSGKYKVRSPIVVN  148
            P  L F+   +K S+ VTFTA+S    TNIFG I W+ GK+ V SPIVV+
Sbjct  534  PGSLSFSELNEKKSFKVTFTATSMPSNTNIFGRIEWSDGKHVVGSPIVVS  583



>gb|KHN12354.1| Subtilisin-like protease [Glycine soja]
Length=148

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNI-FGSITWTSGKYKVRSPIVV  145
            P  L F + V+ L+++V+F ++     +  FGS+TWT GKY VR+PI V
Sbjct  94   PQTLSFNSDVRILNFSVSFLSTQKFHGDYKFGSLTWTDGKYFVRTPIAV  142



>ref|XP_010061844.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW90792.1| hypothetical protein EUGRSUZ_A02859 [Eucalyptus grandis]
Length=780

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P+ L FT + +KL+Y +TFT  +   +  FG + W  G +KVRSPIVV
Sbjct  727  PSTLKFTQRHQKLTYKMTFTTMARRNSPEFGGLVWKDGVHKVRSPIVV  774



>ref|XP_002523602.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38797.1| Cucumisin precursor, putative [Ricinus communis]
Length=665

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITW--TSGKYKVRSPIVV  145
            P KLVF  Q +KLSY +T     S++ + + GS++W    GKY VRSPIV 
Sbjct  605  PKKLVFNKQYEKLSYKLTLEGPKSMKEDVVHGSLSWVHDEGKYVVRSPIVA  655



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITWTSGKYKVRSPIVVNVE  154
            P+ LVF+ + KK+++TVT TA++ + T   FGS++WT+G + V SP+ V  +
Sbjct  718  PDSLVFSRKTKKITFTVTVTAANQVNTGYYFGSLSWTNGVHTVASPMSVRTD  769



>ref|XP_007220237.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
 gb|EMJ21436.1| hypothetical protein PRUPE_ppa001918mg [Prunus persica]
Length=741

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNVE  154
            P KLVF   V+++S+ V+F    +     FGSITW  G++ VR+   VNVE
Sbjct  691  PEKLVFAEGVRRVSFQVSFYGKEAPRGYNFGSITWFDGRHSVRTVFSVNVE  741



>ref|XP_011044970.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=727

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETN-IFGSITWTSGKYKVRSPIVVNV  151
            P  L FT   +KLS+ + F    + + N +FG++TW++G +KVRSPI +NV
Sbjct  674  PATLKFTKTAEKLSFKIDFKPLKTSDGNFVFGALTWSNGIHKVRSPIALNV  724



>ref|XP_004287692.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=763

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVVNV  151
            PN+LVFT+  +K+S+TV F   +  +   FG ++W SG+ +V SP+VV V
Sbjct  705  PNRLVFTSLGQKISFTVNFKVVAPSKGYTFGFLSWMSGRSRVTSPLVVQV  754



>ref|XP_010246830.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=776

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 5/54 (9%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSS---LETN--IFGSITWTSGKYKVRSPIVVN  148
            P KLVF+  VKK ++ VT TA++    L+ +  ++GS++W+ GK+ VRSPIVV+
Sbjct  718  PVKLVFSEMVKKQNFVVTVTANTRNMVLDDSGIVYGSLSWSDGKHVVRSPIVVS  771



>gb|KHN40225.1| Subtilisin-like protease [Glycine soja]
Length=739

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            PN L F N  ++ S+ +T   +   ET  FG ITW+ GK +VRSPIVV
Sbjct  687  PNVLKFDNIGEEKSFKLTVEVTRPGETTAFGGITWSDGKRQVRSPIVV  734



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTA-SSSLETNIFGSITWTSGKYKVRSPIVVN  148
            P  L FT   +K SYTV+FTA S S  T++FG I W+ GK+ V SP+ ++
Sbjct  703  PETLSFTQINEKKSYTVSFTAPSKSSATDVFGRIEWSDGKHVVSSPVAIS  752



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    PNKLVFTNQVKKLSYTVTFTASSSLETNIFGSITWTSGKYKVRSPIVV  145
            P  L FT + +KLSYTVTF     ++   FG + W S  +KVRSP+++
Sbjct  722  PKTLNFTTKHQKLSYTVTFRTKLRMKRPEFGGLLWKSATHKVRSPVII  769



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527397234000