BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78028_g1_i1 len=1014 path=[992:0-1013]

Length=1014
                                                                      Score     E

gb|EYU20444.1|  hypothetical protein MIMGU_mgv1a012577mg                330   5e-109   
ref|XP_009612974.1|  PREDICTED: aquaporin TIP4-1                        322   5e-106   
ref|XP_011081801.1|  PREDICTED: aquaporin TIP4-1                        321   2e-105   
ref|XP_009804441.1|  PREDICTED: aquaporin TIP4-1                        319   9e-105   
ref|NP_001289841.1|  aquaporin TIP4-1                                   313   3e-102   
ref|XP_006450671.1|  hypothetical protein CICLE_v10009294mg             310   4e-101   
ref|XP_006476050.1|  PREDICTED: aquaporin TIP4-1-like                   310   5e-101   
gb|AES58620.2|  major intrinsic protein (MIP) family transporter        309   1e-100   
gb|AFK33796.1|  unknown                                                 309   1e-100   
gb|AFK39772.1|  unknown                                                 308   2e-100   
ref|NP_180152.1|  aquaporin TIP4-1                                      302   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526110.1|  PREDICTED: aquaporin TIP4-1                        302   4e-98    
ref|XP_002516539.1|  tonoplast intrinsic protein, putative              302   4e-98    Ricinus communis
emb|CDP16197.1|  unnamed protein product                                301   7e-98    
ref|XP_004498471.1|  PREDICTED: aquaporin TIP4-1-like                   301   7e-98    
tpg|DAA33872.1|  TPA: aquaporin TIP4;1                                  301   1e-97    
gb|KDP34186.1|  hypothetical protein JCGZ_07757                         301   1e-97    
gb|KHG13169.1|  Aquaporin TIP4-1 -like protein                          300   2e-97    
gb|ACV60358.1|  putative tonoplast intrinsic protein                    300   3e-97    Camellia sinensis [black tea]
gb|AIA82918.1|  AQPTIP                                                  300   4e-97    
ref|XP_006408801.1|  hypothetical protein EUTSA_v10002084mg             299   6e-97    
ref|XP_010429588.1|  PREDICTED: aquaporin TIP4-1                        299   6e-97    
ref|XP_010417358.1|  PREDICTED: aquaporin TIP4-1-like isoform X1        299   9e-97    
ref|XP_011070446.1|  PREDICTED: aquaporin TIP4-1-like                   300   9e-97    
ref|XP_006294868.1|  hypothetical protein CARUB_v10023921mg             298   2e-96    
ref|XP_002309548.1|  aquaporin TIP4.1 family protein                    298   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_002878889.1|  TIP4_1                                             296   1e-95    
ref|XP_003522708.1|  PREDICTED: aquaporin TIP4-1                        295   2e-95    
ref|XP_007012110.1|  Tonoplast intrinsic protein 4,1                    295   2e-95    
ref|XP_010249612.1|  PREDICTED: aquaporin TIP4-1                        295   2e-95    
ref|XP_009140699.1|  PREDICTED: aquaporin TIP4-1                        295   4e-95    
ref|XP_011019624.1|  PREDICTED: aquaporin TIP4-1                        295   4e-95    
gb|KHN10202.1|  Aquaporin TIP4-1                                        294   6e-95    
emb|CDX77009.1|  BnaC04g38040D                                          294   7e-95    
gb|ACU19038.1|  unknown                                                 293   2e-94    Glycine max [soybeans]
gb|KFK32564.1|  hypothetical protein AALP_AA6G259500                    292   3e-94    
ref|XP_010102384.1|  Aquaporin TIP4-1                                   292   4e-94    
ref|XP_007137210.1|  hypothetical protein PHAVU_009G108800g             291   5e-94    
ref|XP_006581008.1|  PREDICTED: uncharacterized protein LOC100793...    290   2e-93    
ref|NP_001242569.1|  uncharacterized protein LOC100793258               289   7e-93    
gb|AES58629.2|  tonoplast intrinsic protein                             288   1e-92    
gb|EPS71324.1|  hypothetical protein M569_03434                         282   2e-90    
ref|XP_010049101.1|  PREDICTED: aquaporin TIP4-1                        278   1e-88    
ref|XP_007226030.1|  hypothetical protein PRUPE_ppa010453mg             278   1e-88    
gb|ABR17761.1|  unknown                                                 273   7e-87    Picea sitchensis
ref|XP_004291186.1|  PREDICTED: aquaporin TIP4-1-like                   273   1e-86    
emb|CAN66944.1|  hypothetical protein VITISV_020091                     272   4e-86    Vitis vinifera
ref|XP_003588378.1|  Tonoplast intrinsic protein                        270   9e-86    
ref|XP_002283964.1|  PREDICTED: aquaporin TIP4-1                        272   1e-85    Vitis vinifera
ref|XP_008445019.1|  PREDICTED: aquaporin TIP4-1                        270   1e-85    
ref|XP_004164037.1|  PREDICTED: aquaporin TIP4-1-like                   270   2e-85    
ref|XP_004150285.1|  PREDICTED: aquaporin TIP4-1-like                   270   3e-85    
ref|XP_003588369.1|  Aquaporin TIP4-1                                   268   3e-85    
ref|XP_010917707.1|  PREDICTED: probable aquaporin TIP4-3               264   8e-83    
ref|XP_006833429.1|  hypothetical protein AMTR_s00109p00145020          263   9e-83    
ref|XP_008801471.1|  PREDICTED: probable aquaporin TIP4-3               263   1e-82    
ref|XP_008220070.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    261   7e-82    
ref|XP_008393878.1|  PREDICTED: aquaporin TIP4-1                        259   3e-81    
ref|XP_009346073.1|  PREDICTED: aquaporin TIP4-1-like                   258   5e-81    
ref|XP_010088608.1|  Aquaporin TIP4-1                                   254   3e-79    
ref|XP_009367463.1|  PREDICTED: aquaporin TIP4-1-like                   253   5e-79    
gb|ACN40807.1|  unknown                                                 253   7e-79    Picea sitchensis
ref|XP_010668288.1|  PREDICTED: aquaporin TIP4-1                        246   3e-76    
ref|XP_009381045.1|  PREDICTED: probable aquaporin TIP4-3               245   6e-76    
ref|XP_008801470.1|  PREDICTED: probable aquaporin TIP4-3               243   5e-75    
ref|XP_010254460.1|  PREDICTED: aquaporin TIP4-1-like                   241   2e-74    
gb|ACJ84885.1|  unknown                                                 231   1e-70    Medicago truncatula
ref|XP_004967395.1|  PREDICTED: aquaporin TIP4-4-like                   229   9e-70    
ref|XP_010917694.1|  PREDICTED: aquaporin TIP4-4-like isoform X2        224   1e-67    
emb|CDM81281.1|  unnamed protein product                                223   4e-67    
ref|XP_010917689.1|  PREDICTED: aquaporin TIP4-4-like isoform X1        223   4e-67    
gb|ACG39579.1|  aquaporin TIP4.1                                        218   2e-65    Zea mays [maize]
ref|NP_001105641.1|  aquaporin TIP4-4                                   216   1e-64    Zea mays [maize]
gb|ACF84391.1|  unknown                                                 216   2e-64    Zea mays [maize]
ref|XP_004249473.1|  PREDICTED: aquaporin TIP1-1                        216   2e-64    
ref|XP_003566010.1|  PREDICTED: probable aquaporin TIP4-3               216   3e-64    
ref|NP_001054979.1|  Os05g0231700                                       215   5e-64    Oryza sativa Japonica Group [Japonica rice]
gb|EMT16436.1|  Aquaporin TIP4-4                                        214   6e-64    
tpg|DAA52750.1|  TPA: aquaporin TIP4-4                                  216   6e-64    
ref|XP_006339093.1|  PREDICTED: aquaporin TIP1-1-like                   214   8e-64    
gb|ACU19274.1|  unknown                                                 214   9e-64    Glycine max [soybeans]
gb|AGQ46837.1|  aquaporin-like protein                                  214   9e-64    
ref|XP_008365156.1|  PREDICTED: aquaporin TIP4-1-like                   213   2e-63    
ref|XP_009141610.1|  PREDICTED: aquaporin TIP1-1                        213   3e-63    
ref|XP_010521513.1|  PREDICTED: aquaporin TIP2-1-like                   213   3e-63    
gb|ACP28878.1|  tonoplast intrinsic protein                             213   3e-63    Gossypium hirsutum [American cotton]
gb|AGD98715.1|  aquaporin protein 12                                    212   4e-63    
gb|ACI95283.1|  tonoplast intrinsic protein                             212   4e-63    Sinapis arvensis [charlock mustard]
ref|XP_003568717.1|  PREDICTED: probable aquaporin TIP4-1               212   5e-63    
ref|XP_006584589.1|  PREDICTED: uncharacterized protein LOC100803...    212   5e-63    
ref|XP_006582836.1|  PREDICTED: uncharacterized protein LOC100306...    212   6e-63    
gb|AAB51393.2|  tonoplast intrinsic protein bobTIP26-1                  212   6e-63    Brassica oleracea var. botrytis [cauliflower]
gb|KFK36559.1|  hypothetical protein AALP_AA4G139100                    212   6e-63    
ref|XP_009793775.1|  PREDICTED: aquaporin TIP2-1-like                   212   7e-63    
gb|AAN05780.1|  tonoplast intrinsic protein bobTIP26-2                  212   7e-63    Brassica oleracea var. botrytis [cauliflower]
ref|XP_002457071.1|  hypothetical protein SORBIDRAFT_03g000790          211   1e-62    Sorghum bicolor [broomcorn]
gb|KDP37268.1|  hypothetical protein JCGZ_06324                         211   1e-62    
ref|XP_009799741.1|  PREDICTED: aquaporin TIP1-1                        211   1e-62    
ref|XP_007027468.1|  Aquaporin TIP1,6                                   211   1e-62    
tpg|DAA33870.1|  TPA: aquaporin TIP1;8                                  211   1e-62    
gb|EPS60922.1|  hypothetical protein M569_13880                         211   2e-62    
gb|AAD31848.1|AF133532_1  water channel protein MipK                    211   2e-62    Mesembryanthemum crystallinum
dbj|BAD90702.1|  tonoplast intrinsic protein 1;1                        211   2e-62    Mimosa pudica [sensitive-plant]
ref|XP_003543633.1|  PREDICTED: aquaporin TIP2-1                        210   2e-62    
ref|XP_009617954.1|  PREDICTED: aquaporin TIP1-1                        210   3e-62    
ref|XP_002519456.1|  tonoplast intrinsic protein, putative              210   3e-62    Ricinus communis
tpg|DAA33869.1|  TPA: aquaporin TIP1;6                                  211   4e-62    
ref|NP_001267926.1|  aquaporin-like                                     210   4e-62    
ref|XP_004494087.1|  PREDICTED: probable aquaporin TIP-type-like        210   4e-62    
emb|CDY53270.1|  BnaCnng24720D                                          209   5e-62    
ref|NP_001240119.1|  uncharacterized protein LOC100817754               209   6e-62    
ref|XP_006428460.1|  hypothetical protein CICLE_v10012553mg             209   6e-62    
emb|CAE53881.1|  aquaporin                                              209   6e-62    Ricinus communis
ref|XP_003597702.1|  Aquaporin                                          209   6e-62    
emb|CAN69323.1|  hypothetical protein VITISV_032929                     209   6e-62    Vitis vinifera
ref|NP_001042500.1|  Os01g0232000                                       209   7e-62    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA33867.1|  TPA: aquaporin TIP1;4                                  209   8e-62    
gb|AFH36344.1|  aquaporin TIP2;2                                        209   8e-62    
gb|AFH36343.1|  aquaporin TIP2;1                                        209   9e-62    
gb|KHM98732.1|  Aquaporin TIP2-1                                        209   9e-62    
ref|XP_006838208.1|  hypothetical protein AMTR_s00106p00151600          209   9e-62    
ref|NP_001237401.1|  uncharacterized protein LOC100306092               209   1e-61    
gb|KHN21988.1|  Aquaporin TIP1-3                                        209   1e-61    
emb|CAB45653.1|  putative tonoplast intrinsic protein                   208   1e-61    Pisum sativum [garden pea]
ref|NP_001242707.1|  uncharacterized protein LOC100777419               208   1e-61    
ref|NP_181221.1|  aquaporin TIP1-1                                      208   2e-61    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65100.1|  putative aquaporin (tonoplast intrinsic protein g...    208   2e-61    Arabidopsis thaliana [mouse-ear cress]
gb|AAG44945.1|AF290618_1  putative delta TIP                            207   2e-61    Nicotiana glauca [glaucous tobacco]
gb|KHG11211.1|  Aquaporin TIP1-3 -like protein                          207   3e-61    
ref|XP_011004925.1|  PREDICTED: aquaporin TIP2-1                        207   3e-61    
ref|XP_010505228.1|  PREDICTED: aquaporin TIP1-1                        207   3e-61    
ref|XP_002879627.1|  tonoplast intrinsic protein gamma                  207   3e-61    
ref|XP_004516306.1|  PREDICTED: aquaporin TIP2-1-like                   207   3e-61    
gb|EMS56264.1|  putative aquaporin TIP4-1                               207   3e-61    
ref|XP_009617337.1|  PREDICTED: aquaporin TIP2-1                        207   4e-61    
gb|KHG14163.1|  Aquaporin TIP1-3 -like protein                          207   4e-61    
ref|XP_006294859.1|  hypothetical protein CARUB_v10023912mg             207   5e-61    
ref|XP_006410854.1|  hypothetical protein EUTSA_v10017134mg             207   5e-61    
ref|XP_009786545.1|  PREDICTED: aquaporin TIP2-1-like                   207   6e-61    
emb|CDY30146.1|  BnaC05g37160D                                          207   6e-61    
gb|KHN32099.1|  Aquaporin TIP1-1                                        207   6e-61    
emb|CAB55837.1|  delta tonoplast intrinsic protein                      206   7e-61    Spinacia oleracea
ref|XP_010556519.1|  PREDICTED: aquaporin TIP1-1                        206   8e-61    
ref|XP_009614306.1|  PREDICTED: aquaporin TIP2-1-like                   206   9e-61    
ref|XP_008228469.1|  PREDICTED: aquaporin TIP2-1                        206   9e-61    
ref|XP_010267262.1|  PREDICTED: aquaporin TIP1-1                        206   1e-60    
ref|XP_010322694.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    206   1e-60    
gb|AAB67881.1|  membrane channel protein                                206   1e-60    Solanum tuberosum [potatoes]
ref|XP_002515999.1|  tonoplast intrinsic protein, putative              206   1e-60    Ricinus communis
gb|EYU21481.1|  hypothetical protein MIMGU_mgv1a010922mg                207   1e-60    
emb|CDX97733.1|  BnaA05g23460D                                          206   1e-60    
dbj|BAA31452.1|  delta-VM23                                             206   1e-60    Raphanus sativus
ref|XP_002439483.1|  hypothetical protein SORBIDRAFT_09g007940          208   2e-60    Sorghum bicolor [broomcorn]
dbj|BAI66438.1|  tonoplast intrinsic protein                            206   2e-60    Hordeum vulgare subsp. vulgare [barley]
ref|XP_009146158.1|  PREDICTED: aquaporin TIP2-1                        206   2e-60    
dbj|BAO18637.1|  tonoplast intrinsic protein 2;5                        206   2e-60    
emb|CAA06335.1|  aquaporin-like protein                                 205   2e-60    Picea abies
ref|XP_002303300.1|  delta-tonoplast intrinsic family protein           205   2e-60    Populus trichocarpa [western balsam poplar]
dbj|BAD90703.1|  tonoplast intrinsic protein 1;2                        205   3e-60    Mimosa pudica [sensitive-plant]
ref|XP_011088796.1|  PREDICTED: aquaporin TIP1-1-like                   205   3e-60    
sp|Q9FY14.1|TIP1_MEDTR  RecName: Full=Probable aquaporin TIP-type...    205   3e-60    Medicago truncatula
gb|ACG46456.1|  aquaporin TIP4.1                                        205   3e-60    Zea mays [maize]
gb|AAB53329.1|  Rb7                                                     205   3e-60    Solanum lycopersicum
gb|ACF79343.1|  unknown                                                 205   3e-60    Zea mays [maize]
ref|NP_001274703.1|  TIP protein                                        204   4e-60    
ref|XP_004302879.1|  PREDICTED: aquaporin TIP2-1-like                   204   4e-60    
emb|CDY20190.1|  BnaA01g28120D                                          204   4e-60    
ref|XP_002298233.1|  delta-tonoplast intrinsic family protein           204   4e-60    Populus trichocarpa [western balsam poplar]
ref|XP_010243206.1|  PREDICTED: aquaporin TIP1-1-like                   204   4e-60    
emb|CDY63821.1|  BnaC01g44580D                                          204   5e-60    
gb|EPS72940.1|  hypothetical protein M569_01821                         204   5e-60    
dbj|BAJ89588.1|  predicted protein                                      204   5e-60    
emb|CDX82410.1|  BnaA03g34110D                                          204   5e-60    
emb|CAA38633.1|  possible membrane channel protein                      204   5e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188245.1|  aquaporin TIP2-1                                      204   6e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105034.1|  aquaporin TIP4-2                                   204   6e-60    Zea mays [maize]
tpg|DAA33868.1|  TPA: aquaporin TIP1;5                                  204   6e-60    
dbj|BAD90704.1|  tonoplast intrinsic protein 2;1                        204   7e-60    Mimosa pudica [sensitive-plant]
ref|XP_010254028.1|  PREDICTED: aquaporin TIP2-1                        204   8e-60    
ref|XP_010062508.1|  PREDICTED: aquaporin TIP2-1                        204   8e-60    
ref|XP_010691368.1|  PREDICTED: aquaporin TIP2-1                        204   8e-60    
ref|XP_011089965.1|  PREDICTED: aquaporin TIP1-1-like                   204   8e-60    
ref|XP_006356145.1|  PREDICTED: aquaporin TIP2-1-like                   204   8e-60    
ref|XP_010915908.1|  PREDICTED: probable aquaporin TIP2-2               204   8e-60    
ref|XP_009781180.1|  PREDICTED: aquaporin TIP2-1-like                   204   8e-60    
gb|ABK94373.1|  unknown                                                 204   9e-60    Populus trichocarpa [western balsam poplar]
emb|CDX75873.1|  BnaC03g39560D                                          204   9e-60    
ref|XP_011080630.1|  PREDICTED: aquaporin TIP2-1                        203   9e-60    
ref|XP_007024239.1|  Delta tonoplast integral protein                   203   1e-59    
gb|ADU25490.1|  tonoplastic intrinsic protein                           204   1e-59    
gb|KDP29188.1|  hypothetical protein JCGZ_16577                         204   1e-59    
ref|XP_006837956.1|  hypothetical protein AMTR_s00102p00061000          203   1e-59    
ref|XP_007215863.1|  hypothetical protein PRUPE_ppa010472mg             203   1e-59    
ref|XP_006298401.1|  hypothetical protein CARUB_v10014472mg             203   1e-59    
ref|XP_008656321.1|  PREDICTED: aquaporin TIP4-2                        205   1e-59    
sp|P24422.2|TIP2_TOBAC  RecName: Full=Probable aquaporin TIP-type...    203   1e-59    Nicotiana tabacum [American tobacco]
ref|XP_009611581.1|  PREDICTED: aquaporin TIP2-1-like                   203   1e-59    
ref|NP_001289845.1|  aquaporin TIP2-1                                   203   1e-59    
ref|XP_009758381.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     203   2e-59    
ref|XP_002531118.1|  tonoplast intrinsic protein, putative              203   2e-59    Ricinus communis
ref|XP_010098813.1|  Aquaporin TIP1-1                                   203   2e-59    
ref|XP_009615916.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      203   2e-59    
ref|XP_010037134.1|  PREDICTED: aquaporin TIP1-1                        203   2e-59    
ref|XP_009135480.1|  PREDICTED: aquaporin TIP2-1-like                   202   2e-59    
gb|ACN33980.1|  unknown                                                 202   3e-59    Zea mays [maize]
ref|XP_010545684.1|  PREDICTED: aquaporin TIP2-1                        202   3e-59    
gb|KDP44188.1|  hypothetical protein JCGZ_05655                         202   3e-59    
ref|XP_008342659.1|  PREDICTED: aquaporin TIP2-1                        202   4e-59    
ref|XP_011027129.1|  PREDICTED: aquaporin TIP1-3-like                   202   4e-59    
ref|XP_007016527.1|  Tonoplast intrinsic protein 1,3                    202   4e-59    
ref|NP_001238026.1|  nodulin-26                                         202   5e-59    
gb|KHN30200.1|  Aquaporin TIP1-3                                        202   5e-59    
gb|ADB93067.1|  aquaporin                                               202   5e-59    
ref|XP_006381378.1|  gamma-tonoplast intrinsic protein 2                202   5e-59    
ref|XP_002274538.1|  PREDICTED: aquaporin TIP1-1                        202   6e-59    Vitis vinifera
dbj|BAI66435.1|  tonoplast intrinsic protein                            201   6e-59    Hordeum vulgare subsp. vulgare [barley]
gb|ABK96489.1|  unknown                                                 201   6e-59    Populus trichocarpa x Populus deltoides
ref|XP_009377878.1|  PREDICTED: aquaporin TIP2-1                        201   6e-59    
gb|AGD98716.1|  aquaporin protein 13                                    201   7e-59    
gb|AAL38357.1|  delta tonoplast intrinsic protein                       201   7e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258877.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      201   8e-59    
gb|ABK21457.1|  unknown                                                 201   8e-59    Picea sitchensis
ref|XP_006465649.1|  PREDICTED: aquaporin TIP2-1-like                   201   8e-59    
emb|CAA65186.1|  aquaporin                                              201   9e-59    Helianthus annuus
ref|XP_006426918.1|  hypothetical protein CICLE_v10026351mg             201   9e-59    
gb|EMT15368.1|  Aquaporin TIP4-3                                        201   9e-59    
gb|ABK22530.1|  unknown                                                 201   9e-59    Picea sitchensis
ref|XP_009402735.1|  PREDICTED: probable aquaporin TIP4-3               201   1e-58    
gb|EAY73151.1|  hypothetical protein OsI_01024                          201   1e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_009353577.1|  PREDICTED: aquaporin TIP2-1                        201   1e-58    
ref|XP_002311146.1|  Gamma-tonoplast intrinsic protein 3                201   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_007162793.1|  hypothetical protein PHAVU_001G181100g             201   1e-58    
ref|XP_009761134.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     201   1e-58    
emb|CDM82810.1|  unnamed protein product                                201   1e-58    
ref|XP_009397029.1|  PREDICTED: probable aquaporin TIP1-1               201   1e-58    
ref|XP_010465638.1|  PREDICTED: aquaporin TIP2-1                        201   2e-58    
ref|XP_002316308.1|  Gamma-tonoplast intrinsic protein 3                201   2e-58    Populus trichocarpa [western balsam poplar]
gb|AAG44946.1|AF290619_1  putative gamma TIP                            200   2e-58    Nicotiana glauca [glaucous tobacco]
ref|XP_011004488.1|  PREDICTED: aquaporin TIP1-1-like                   200   2e-58    
dbj|BAP33940.1|  tonoplast intrinsic protein                            200   2e-58    
ref|XP_010504014.1|  PREDICTED: aquaporin TIP2-1-like                   200   2e-58    
gb|ADE76384.1|  unknown                                                 200   2e-58    
ref|XP_010487476.1|  PREDICTED: aquaporin TIP2-1-like                   200   2e-58    
gb|ABD65120.1|  Tonoplast intrinsic protein, putative                   200   3e-58    Brassica oleracea
ref|NP_001105033.1|  aquaporin TIP4-1                                   200   3e-58    Zea mays [maize]
ref|XP_008380900.1|  PREDICTED: aquaporin TIP2-1-like                   200   3e-58    
gb|AFK36325.1|  unknown                                                 199   3e-58    
ref|XP_010933649.1|  PREDICTED: probable aquaporin TIP2-1               199   3e-58    
ref|XP_009800738.1|  PREDICTED: probable aquaporin TIP1-1               199   4e-58    
sp|P42067.2|TIP1_MEDSA  RecName: Full=Probable aquaporin TIP-type...    199   4e-58    Medicago sativa [alfalfa]
ref|XP_006406857.1|  hypothetical protein EUTSA_v10021303mg             200   4e-58    
gb|AHW81522.1|  ECFP-tagged gamma TIP                                   206   4e-58    
ref|XP_002322910.1|  gamma-tonoplast intrinsic protein 2                199   4e-58    Populus trichocarpa [western balsam poplar]
gb|AHA84270.1|  nodulin-26                                              199   5e-58    
gb|ABK26146.1|  unknown                                                 199   5e-58    Picea sitchensis
ref|XP_003554937.1|  PREDICTED: aquaporin TIP2-1-like                   199   5e-58    
gb|ABB76813.1|  tonoplast intrinsic protein                             199   5e-58    Olea europaea
ref|XP_002523724.1|  tonoplast intrinsic protein, putative              199   6e-58    Ricinus communis
gb|ADE34289.1|  aquaporin TIP2;3                                        199   6e-58    
ref|XP_009604878.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     199   7e-58    
ref|XP_011022886.1|  PREDICTED: aquaporin TIP1-3                        199   7e-58    
gb|KHG26174.1|  Aquaporin TIP2-1 -like protein                          199   7e-58    
gb|ADE34283.1|  aquaporin TIP1;7                                        199   8e-58    
gb|AAC39480.1|  aquaporin                                               199   8e-58    Vernicia fordii [tung oil tree]
ref|XP_007209517.1|  hypothetical protein PRUPE_ppa010475mg             199   8e-58    
ref|XP_009401846.1|  PREDICTED: probable aquaporin TIP1-1               199   8e-58    
ref|XP_003626979.1|  Aquaporin TIP2-1                                   198   9e-58    
emb|CDP08994.1|  unnamed protein product                                198   1e-57    
ref|XP_009384464.1|  PREDICTED: probable aquaporin TIP2-1               198   1e-57    
ref|XP_007135655.1|  hypothetical protein PHAVU_010G147100g             198   1e-57    
gb|KDP29873.1|  hypothetical protein JCGZ_18448                         198   1e-57    
ref|XP_011018806.1|  PREDICTED: aquaporin TIP1-1                        198   1e-57    
ref|XP_004299427.1|  PREDICTED: aquaporin TIP2-3-like                   198   1e-57    
ref|XP_009144590.1|  PREDICTED: probable aquaporin TIP2-2               198   1e-57    
gb|ABI96816.1|  tonoplast intrinsic protein                             198   1e-57    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010502579.1|  PREDICTED: aquaporin TIP1-2                        198   1e-57    
emb|CAA65187.1|  aquaporin                                              198   1e-57    Helianthus annuus
gb|AFK35772.1|  unknown                                                 198   1e-57    
gb|KHG06645.1|  putative aquaporin TIP1-2                               198   2e-57    
gb|KDP43963.1|  hypothetical protein JCGZ_05430                         198   2e-57    
ref|XP_008343557.1|  PREDICTED: aquaporin TIP1-3                        198   2e-57    
ref|XP_010098111.1|  Aquaporin TIP2-1                                   198   2e-57    
ref|XP_011001477.1|  PREDICTED: probable aquaporin TIP-type             198   2e-57    
ref|XP_009114826.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    198   2e-57    
gb|ACX37451.1|  tonoplast intrinsic protein                             198   2e-57    
gb|AAB04557.1|  delta-tonoplast intrinsic protein                       197   2e-57    
gb|ABR68795.1|  aquaporin gamma-TIP                                     198   2e-57    
sp|P33560.1|TIP_ANTMA  RecName: Full=Probable aquaporin TIP-type;...    197   2e-57    
dbj|BAJ94863.1|  predicted protein                                      197   2e-57    
ref|XP_010096653.1|  Aquaporin TIP1-3                                   197   2e-57    
ref|XP_002277904.2|  PREDICTED: probable aquaporin TIP-type             197   2e-57    
ref|NP_001104907.1|  aquaporin TIP2-3                                   197   2e-57    
ref|XP_006359462.1|  PREDICTED: aquaporin TIP2-1-like                   197   2e-57    
ref|XP_010434682.1|  PREDICTED: probable aquaporin TIP2-2               197   2e-57    
ref|XP_011077300.1|  PREDICTED: aquaporin TIP1-1                        197   3e-57    
ref|XP_007039804.1|  Tonoplast intrinsic protein 2,3                    197   3e-57    
gb|AAF90121.1|AF254799_1  tonoplast intrinsic protein 1                 197   3e-57    
gb|KFK38977.1|  hypothetical protein AALP_AA3G184100                    197   3e-57    
gb|AHI54565.1|  tonoplastic intrinsic protein                           197   3e-57    
ref|XP_008351935.1|  PREDICTED: probable aquaporin TIP-type alpha       197   3e-57    
gb|AFK48554.1|  unknown                                                 197   3e-57    
ref|XP_010033163.1|  PREDICTED: aquaporin TIP1-3-like                   197   3e-57    
emb|CAA65185.1|  aquaporin                                              197   4e-57    
ref|XP_009411359.1|  PREDICTED: probable aquaporin TIP1-1               197   4e-57    
gb|ACD12709.1|  water channel protein                                   197   4e-57    
ref|XP_002531978.1|  tonoplast intrinsic protein, putative              197   4e-57    
ref|XP_008796116.1|  PREDICTED: aquaporin TIP2-3                        197   4e-57    
ref|XP_002882988.1|  delta tonoplast intrinsic protein                  197   4e-57    
ref|XP_010440021.1|  PREDICTED: probable aquaporin TIP2-2               197   4e-57    
ref|XP_004304478.1|  PREDICTED: aquaporin TIP1-1-like                   197   4e-57    
ref|XP_010425366.1|  PREDICTED: aquaporin TIP1-2-like                   197   5e-57    
ref|XP_006284410.1|  hypothetical protein CARUB_v10005581mg             197   5e-57    
gb|AFU51578.1|  aquaporin                                               197   5e-57    
gb|AFK47280.1|  unknown                                                 196   5e-57    
ref|XP_007150651.1|  hypothetical protein PHAVU_005G170300g             196   5e-57    
ref|XP_006369013.1|  aquaporin TIP2.3 family protein                    196   6e-57    
ref|XP_009613493.1|  PREDICTED: probable aquaporin TIP1-1               196   6e-57    
gb|AAD10494.1|  gamma-type tonoplast intrinsic protein                  196   6e-57    
dbj|BAF95576.1|  tonoplast intrinsic protein                            196   6e-57    
emb|CAB39758.1|  major intrinsic protein                                196   6e-57    
gb|AFQ23566.1|  aquaporin TIP1                                          196   6e-57    
gb|ACG44020.1|  aquaporin TIP2.1                                        196   6e-57    
ref|XP_011000304.1|  PREDICTED: probable aquaporin TIP1-2               196   7e-57    
gb|EMS68352.1|  Aquaporin TIP2-3                                        196   7e-57    
gb|AEZ52401.1|  aquaporin                                               196   7e-57    
gb|AAF82790.1|AF275315_1  water-selective transport intrinsic mem...    196   8e-57    
ref|XP_010479718.1|  PREDICTED: aquaporin TIP2-1-like                   196   8e-57    
gb|AAO86710.1|  tonoplast water channel                                 196   9e-57    
ref|NP_001234103.1|  aquaporin-like                                     196   9e-57    
ref|XP_007202475.1|  hypothetical protein PRUPE_ppa010365mg             196   9e-57    
dbj|BAP33938.1|  aquaporin                                              196   9e-57    
emb|CDP09981.1|  unnamed protein product                                196   9e-57    
ref|XP_010449630.1|  PREDICTED: probable aquaporin TIP2-2               196   1e-56    
gb|AFH36342.1|  aquaporin TIP1                                          196   1e-56    
ref|XP_009337569.1|  PREDICTED: aquaporin TIP1-3                        196   1e-56    
ref|XP_008238465.1|  PREDICTED: probable aquaporin TIP-type             196   1e-56    
emb|CAA56553.1|  gamma-TIP-like protein                                 196   1e-56    
gb|AEI83501.1|  Major intrinsic protein                                 196   1e-56    
ref|XP_009382161.1|  PREDICTED: probable aquaporin TIP1-1               196   1e-56    
dbj|BAD04010.1|  tonoplast intrinsic protein                            196   1e-56    
ref|XP_010253312.1|  PREDICTED: aquaporin TIP1-3-like                   196   1e-56    
ref|XP_010441462.1|  PREDICTED: aquaporin TIP2-3-like                   196   1e-56    
dbj|BAL41683.1|  tonoplast intrinsic protein                            196   1e-56    
gb|AFK41698.1|  unknown                                                 195   1e-56    
gb|KHG09483.1|  putative aquaporin TIP-type                             196   1e-56    
ref|XP_003517415.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      195   1e-56    
ref|XP_003580281.1|  PREDICTED: probable aquaporin TIP2-1               195   1e-56    
ref|XP_002961672.1|  hypothetical protein SELMODRAFT_165030             195   1e-56    
ref|XP_010500811.1|  PREDICTED: aquaporin TIP2-1-like                   196   1e-56    
ref|XP_004976439.1|  PREDICTED: aquaporin TIP2-3-like                   195   1e-56    
ref|XP_009419322.1|  PREDICTED: probable aquaporin TIP2-2               195   1e-56    
ref|NP_193465.1|  tonoplast intrinsic protein 2;2                       195   2e-56    
ref|XP_002299893.1|  nodulin-26 family protein                          195   2e-56    
ref|XP_006347203.1|  PREDICTED: aquaporin TIP1-1-like                   195   2e-56    
ref|XP_010514297.1|  PREDICTED: aquaporin TIP1-2-like                   195   2e-56    
tpg|DAA33871.1|  TPA: aquaporin TIP2;2                                  195   2e-56    
ref|XP_011010727.1|  PREDICTED: aquaporin TIP1-1-like                   195   2e-56    
emb|CDY47816.1|  BnaC06g05270D                                          195   2e-56    
gb|AFK34456.1|  unknown                                                 195   2e-56    
ref|XP_002876978.1|  hypothetical protein ARALYDRAFT_484417             195   2e-56    
ref|XP_002870110.1|  DELTA-TIP2/TIP2_2                                  195   2e-56    
ref|XP_006653651.1|  PREDICTED: aquaporin TIP2-3-like                   195   2e-56    
emb|CAA65184.1|  aquaporin                                              195   2e-56    
ref|XP_002314201.1|  nodulin-26 family protein                          195   2e-56    
ref|XP_002863344.1|  AtTIP2_3                                           195   2e-56    
gb|EMT08777.1|  Putative aquaporin TIP4-1                               199   3e-56    
gb|AFJ44205.1|  tonoplast intrinsic protein 2                           194   3e-56    
ref|NP_001237062.1|  uncharacterized protein LOC100527509               194   3e-56    
gb|EYU18933.1|  hypothetical protein MIMGU_mgv1a012390mg                194   3e-56    
ref|XP_008437066.1|  PREDICTED: probable aquaporin TIP2-2               194   3e-56    
ref|XP_006282082.1|  hypothetical protein CARUB_v10028328mg             194   3e-56    
ref|XP_006647629.1|  PREDICTED: probable aquaporin TIP2-1-like          194   4e-56    
ref|XP_010933183.1|  PREDICTED: probable aquaporin TIP1-1               194   4e-56    
ref|XP_007009482.1|  Tonoplast intrinsic protein 1,3                    194   4e-56    
ref|NP_189283.1|  aquaporin TIP1-2                                      194   4e-56    
gb|ABA56492.1|  putative tonoplast intrinsic protein                    194   4e-56    
ref|XP_010481328.1|  PREDICTED: aquaporin TIP2-3                        194   4e-56    
ref|XP_006414242.1|  hypothetical protein EUTSA_v10026069mg             194   4e-56    
gb|EYU24713.1|  hypothetical protein MIMGU_mgv1a012474mg                194   5e-56    
emb|CDO98003.1|  unnamed protein product                                194   5e-56    
ref|XP_008648279.1|  PREDICTED: aquaporin TIP4-1 isoform X1             195   5e-56    
ref|XP_002314305.2|  nodulin-26 family protein                          194   5e-56    
ref|NP_001047632.1|  Os02g0658100                                       194   5e-56    
ref|XP_003606614.1|  Aquaporin TIP1-1                                   194   6e-56    
ref|XP_011041956.1|  PREDICTED: probable aquaporin TIP1-2               194   6e-56    
gb|AIK66518.1|  putative aquaporin                                      194   6e-56    
ref|XP_002284411.1|  PREDICTED: aquaporin TIP1-1                        194   6e-56    
gb|EPS67611.1|  aquaporin-like protein                                  194   7e-56    
tpg|DAA53302.1|  TPA: aquaporin TIP4-3                                  193   8e-56    
ref|XP_009128968.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    193   8e-56    
gb|ABK22410.1|  unknown                                                 194   8e-56    
ref|XP_004505892.1|  PREDICTED: aquaporin TIP1-3-like                   193   8e-56    
gb|AHJ09607.1|  aquaporin protein 26                                    194   9e-56    
ref|XP_006833430.1|  hypothetical protein AMTR_s00109p00145780          193   9e-56    
ref|XP_008462177.1|  PREDICTED: aquaporin TIP2-1                        193   1e-55    
gb|ACJ53709.1|  tonoplast intrinsic protein 1-2                         193   1e-55    
gb|AAL49753.1|AF452015_1  aquaporin-like protein                        193   1e-55    
ref|NP_001105035.1|  aquaporin TIP4-3                                   193   1e-55    
ref|XP_009382435.1|  PREDICTED: probable aquaporin TIP2-1               193   1e-55    
ref|XP_010031004.1|  PREDICTED: aquaporin TIP1-3-like                   193   1e-55    
ref|XP_004141759.1|  PREDICTED: aquaporin TIP2-1-like                   193   1e-55    
dbj|BAA19129.1|  unnamed protein product                                193   1e-55    
ref|XP_003565529.1|  PREDICTED: probable aquaporin TIP4-2               193   2e-55    
ref|XP_006656054.1|  PREDICTED: probable aquaporin TIP2-2-like          192   2e-55    
ref|NP_001174036.1|  Os04g0550950                                       192   2e-55    
ref|XP_009129499.1|  PREDICTED: aquaporin TIP1-2                        192   2e-55    
gb|AJA04408.1|  tonoplast intrinsic protein                             192   2e-55    
ref|XP_011089824.1|  PREDICTED: aquaporin TIP1-3-like                   192   2e-55    
ref|XP_003570028.1|  PREDICTED: probable aquaporin TIP2-1               192   2e-55    
emb|CDX77768.1|  BnaC07g20220D                                          192   2e-55    
ref|XP_008669054.1|  PREDICTED: aquaporin TIP2-3-like                   192   2e-55    
emb|CDY59296.1|  BnaA06g40020D                                          192   2e-55    
ref|XP_006304972.1|  hypothetical protein CARUB_v10011466mg             192   2e-55    
ref|XP_002303357.2|  aquaporin TIP2.3 family protein                    192   2e-55    
ref|XP_004953349.1|  PREDICTED: aquaporin TIP2-1-like                   192   2e-55    
gb|KFK33580.1|  hypothetical protein AALP_AA5G032300                    192   3e-55    
ref|XP_010422715.1|  PREDICTED: aquaporin TIP1-3-like                   192   3e-55    
ref|XP_004137844.1|  PREDICTED: aquaporin TIP1-1-like                   192   3e-55    
dbj|BAP47432.1|  tonoplast intrinsic protein                            192   3e-55    
ref|XP_007210530.1|  hypothetical protein PRUPE_ppa010285mg             192   3e-55    
ref|XP_010540050.1|  PREDICTED: probable aquaporin TIP3-2               192   3e-55    
ref|XP_008442728.1|  PREDICTED: aquaporin TIP1-1-like                   192   3e-55    
ref|XP_002525663.1|  tonoplast intrinsic protein, putative              192   3e-55    
ref|XP_010911210.1|  PREDICTED: probable aquaporin TIP1-1               192   3e-55    
gb|ABP35520.1|  tonoplast intrinsic protein                             192   3e-55    
ref|XP_007218847.1|  hypothetical protein PRUPE_ppa010364mg             192   3e-55    
gb|AAC62397.1|  gamma tonoplast intrinsic protein 2                     192   3e-55    
ref|XP_004299448.1|  PREDICTED: probable aquaporin TIP3-2-like          192   3e-55    
sp|Q5Z6F0.1|TIP22_ORYSJ  RecName: Full=Probable aquaporin TIP2-2;...    192   4e-55    
ref|XP_009416494.1|  PREDICTED: probable aquaporin TIP4-3               192   4e-55    
gb|KDP39884.1|  hypothetical protein JCGZ_03415                         192   4e-55    
ref|XP_010696310.1|  PREDICTED: probable aquaporin TIP1-2               192   4e-55    
ref|XP_008788358.1|  PREDICTED: probable aquaporin TIP1-1               196   4e-55    
ref|XP_006286822.1|  hypothetical protein CARUB_v10003767mg             192   4e-55    
ref|XP_006392950.1|  hypothetical protein EUTSA_v10011730mg             192   5e-55    
ref|XP_004143284.1|  PREDICTED: aquaporin TIP1-1-like                   191   5e-55    
ref|XP_011031897.1|  PREDICTED: probable aquaporin TIP2-2               191   5e-55    
ref|XP_010462056.1|  PREDICTED: aquaporin TIP2-1-like                   192   5e-55    
gb|EAZ00793.1|  hypothetical protein OsI_22823                          191   5e-55    
ref|XP_010494978.1|  PREDICTED: aquaporin TIP2-3-like                   191   5e-55    
ref|XP_007132109.1|  hypothetical protein PHAVU_011G067200g             191   5e-55    
ref|XP_009346282.1|  PREDICTED: probable aquaporin TIP-type             191   5e-55    
ref|XP_010554597.1|  PREDICTED: aquaporin TIP1-3                        191   6e-55    
gb|ACY74345.1|  aquaporin-like protein                                  191   6e-55    
ref|XP_003558815.1|  PREDICTED: aquaporin TIP1-1                        191   6e-55    
ref|XP_002448289.1|  hypothetical protein SORBIDRAFT_06g024590          191   6e-55    
ref|XP_008801219.1|  PREDICTED: probable aquaporin TIP1-1               191   6e-55    
ref|XP_009624595.1|  PREDICTED: aquaporin TIP1-3                        191   6e-55    
ref|XP_006436063.1|  hypothetical protein CICLE_v10032534mg             191   6e-55    
gb|KFK31373.1|  hypothetical protein AALP_AA6G103900                    191   7e-55    
emb|CDY67380.1|  BnaAnng24130D                                          190   7e-55    
ref|XP_004967393.1|  PREDICTED: aquaporin TIP4-3-like isoform X2        191   7e-55    
ref|XP_004967394.1|  PREDICTED: aquaporin TIP4-3-like                   191   7e-55    
gb|AAD39372.1|AF118381_1  tonoplast intrinsic protein                   191   8e-55    
ref|XP_009592994.1|  PREDICTED: probable aquaporin TIP1-1               191   8e-55    
ref|XP_006398438.1|  hypothetical protein EUTSA_v10001007mg             191   9e-55    
gb|EMT13970.1|  Aquaporin TIP2-3                                        191   9e-55    
ref|XP_004168293.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    191   9e-55    
gb|AFU51579.1|  aquaporin                                               191   1e-54    
ref|XP_006424746.1|  hypothetical protein CICLE_v10029134mg             191   1e-54    
gb|ABD65010.1|  tonoplast intrinsic protein, putative                   191   1e-54    
ref|XP_008373770.1|  PREDICTED: probable aquaporin TIP-type             191   1e-54    
gb|KFK35805.1|  hypothetical protein AALP_AA4G039000                    191   1e-54    
emb|CDX96453.1|  BnaA07g30640D                                          191   1e-54    
emb|CDP00041.1|  unnamed protein product                                191   1e-54    
ref|XP_004965462.1|  PREDICTED: probable aquaporin TIP2-2-like          190   1e-54    
ref|NP_001284655.1|  aquaporin TIP1-1                                   190   1e-54    
ref|NP_199556.1|  aquaporin TIP2-3                                      190   1e-54    
emb|CDX83623.1|  BnaC07g23630D                                          190   1e-54    
ref|XP_009780564.1|  PREDICTED: aquaporin TIP1-3                        190   1e-54    
ref|XP_002962158.1|  hypothetical protein SELMODRAFT_165035             190   1e-54    
dbj|BAA12711.1|  VM23                                                   190   1e-54    
ref|XP_008240429.1|  PREDICTED: probable aquaporin TIP3-2               190   1e-54    
gb|ACI95284.1|  tonoplast intrinsic protein                             190   2e-54    
ref|XP_010043596.1|  PREDICTED: aquaporin TIP1-3-like                   190   2e-54    
ref|XP_010428353.1|  PREDICTED: aquaporin TIP1-3                        190   2e-54    
gb|ABD64981.1|  tonoplast intrinsic protein, putative                   190   2e-54    
ref|XP_002452808.1|  hypothetical protein SORBIDRAFT_04g032900          190   2e-54    
ref|XP_008233574.1|  PREDICTED: aquaporin TIP1-3                        190   2e-54    
gb|KFK41757.1|  hypothetical protein AALP_AA2G168300                    191   2e-54    
gb|KEH21895.1|  tonoplast intrinsic protein                             190   2e-54    
dbj|BAL41684.1|  tonoplast intrinsic protein                            190   2e-54    
ref|XP_009101423.1|  PREDICTED: aquaporin TIP2-3                        190   2e-54    
gb|AFQ98316.1|  MIP6                                                    190   2e-54    
ref|XP_006848638.1|  hypothetical protein AMTR_s00171p00047680          190   2e-54    
ref|XP_010527951.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    189   2e-54    
ref|XP_004241485.1|  PREDICTED: probable aquaporin TIP3-2               190   2e-54    
ref|XP_010471374.1|  PREDICTED: aquaporin TIP3-1                        190   2e-54    
ref|NP_001105030.1|  aquaporin TIP2-1                                   189   2e-54    
ref|XP_006440295.1|  hypothetical protein CICLE_v10021867mg             189   2e-54    
ref|XP_006395549.1|  hypothetical protein EUTSA_v10004806mg             190   3e-54    
gb|KDP46476.1|  hypothetical protein JCGZ_08448                         190   3e-54    
ref|XP_006343095.1|  PREDICTED: aquaporin TIP2-1-like                   189   3e-54    
gb|AGD98709.1|  aquaporin protein 6                                     189   3e-54    
ref|XP_010428229.1|  PREDICTED: aquaporin TIP3-1-like                   190   3e-54    
ref|XP_010529962.1|  PREDICTED: probable aquaporin TIP2-2 isoform X1    189   3e-54    
ref|XP_009380577.1|  PREDICTED: probable aquaporin TIP2-2               189   3e-54    
emb|CDY11123.1|  BnaC06g23750D                                          190   3e-54    
ref|XP_010112915.1|  Aquaporin TIP1-3                                   189   3e-54    
dbj|BAB12722.1|  gamma tonoplast intrinsic protein                      189   4e-54    



>gb|EYU20444.1| hypothetical protein MIMGU_mgv1a012577mg [Erythranthe guttata]
Length=246

 Score =   330 bits (846),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EA Q DC++ALIVEFI TFLFVF GVG+AMA D+L G+ALVGLFFVAMAHALV
Sbjct  3    IAVGHYREAYQPDCLKALIVEFITTFLFVFAGVGSAMAADKLNGDALVGLFFVAMAHALV  62

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            V VMISAGLRISGAHLNPAVTLGLL GGHITVIRS LY IDQLLASVAACALL+++TGGL
Sbjct  63   VGVMISAGLRISGAHLNPAVTLGLLAGGHITVIRSILYWIDQLLASVAACALLSFVTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LASGVG  QGV+MEIILTFSLLFTVYATIVDPKKGNL+GLGPLLTGLVVGANIM
Sbjct  123  TTPIHSLASGVGSIQGVVMEIILTFSLLFTVYATIVDPKKGNLEGLGPLLTGLVVGANIM  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE FFIVRTHVP++ 
Sbjct  183  AGGPFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFFIVRTHVPLSG  242

Query  872  QEAF  883
            +E+F
Sbjct  243  EESF  246



>ref|XP_009612974.1| PREDICTED: aquaporin TIP4-1 [Nicotiana tomentosiformis]
 emb|CAB40742.1| aquaglyceroporin [Nicotiana tabacum]
Length=247

 Score =   322 bits (826),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EA+Q DCIQALIVEFICTFLFVF GVG+AMA ++L G+ LV LFFVAMAHALV
Sbjct  4    IAVGSSREAIQPDCIQALIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAV ISAG RISG HLNPAVTLGL MGGHITV RS LY IDQLLASVAACALL YLT GL
Sbjct  64   VAVTISAGFRISGGHLNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLTAGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLA+GV YGQG+IME+ILTFSLLFTVY TIVDPKKG L+G+GPLLTGLVVGANIM
Sbjct  124  ETPVHTLANGVSYGQGIIMEVILTFSLLFTVYTTIVDPKKGILEGMGPLLTGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPA VSG WTDHWVYWVGPLIGGGLAGFI E FFIVRTHVP+ +
Sbjct  184  AGGPFSGASMNPARSFGPAFVSGIWTDHWVYWVGPLIGGGLAGFICENFFIVRTHVPLPS  243

Query  872  QEAF  883
             E+F
Sbjct  244  DESF  247



>ref|XP_011081801.1| PREDICTED: aquaporin TIP4-1 [Sesamum indicum]
Length=247

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA   DC+QAL+VEFI TFLFVF GVGAAMA+D+L GNALVGLFFVAMAHALV
Sbjct  4    IALGSLREAFLPDCLQALVVEFISTFLFVFAGVGAAMASDKLNGNALVGLFFVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG RISG HLNPAVT+GL  GGHITVIRS LY IDQLLASVAACALL+Y+TGGL
Sbjct  64   VAVMISAGFRISGGHLNPAVTIGLCAGGHITVIRSILYWIDQLLASVAACALLSYVTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LAS VGY QGVIMEI+LTFSLLFTVYATIVDPKKGNLDGLGPLLTGLVVGANIM
Sbjct  124  TTPIHSLASTVGYAQGVIMEIVLTFSLLFTVYATIVDPKKGNLDGLGPLLTGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGG+AGFIYE FFIVR+HVP++ 
Sbjct  184  AGGPFSGASMNPARSFGPALVSRDWTDHWVYWVGPLIGGGVAGFIYENFFIVRSHVPLSG  243

Query  872  QEAF  883
             E+F
Sbjct  244  DESF  247



>ref|XP_009804441.1| PREDICTED: aquaporin TIP4-1 [Nicotiana sylvestris]
Length=247

 Score =   319 bits (818),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+GN  EA+Q DCIQALIVEFI TFLFVF GVG+AMA ++L G+ LV LFFVAMAHALV
Sbjct  4    IAVGNSREAIQPDCIQALIVEFIVTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAV ISAG RISG HLNPAVTLGL MGGHITV RS LY IDQLLASVAACALL Y+T GL
Sbjct  64   VAVTISAGFRISGGHLNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYVTAGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLA+GV Y QG+IME+ILTFSLLFTVY TIVDPKKG L+G+GPLLTGLVVGANIM
Sbjct  124  ETPVHTLANGVSYSQGIIMEVILTFSLLFTVYTTIVDPKKGVLEGMGPLLTGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPA VSG WTDHWVYWVGPLIGGGLAGFI E FFIVRTHVP+ +
Sbjct  184  AGGPFSGASMNPARSFGPAFVSGIWTDHWVYWVGPLIGGGLAGFICENFFIVRTHVPLPS  243

Query  872  QEAF  883
             E+F
Sbjct  244  DESF  247



>ref|NP_001289841.1| aquaporin TIP4-1 [Solanum lycopersicum]
 dbj|BAO18640.1| tonoplast intrinsic protein 4;1 [Solanum lycopersicum]
Length=247

 Score =   313 bits (801),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EA+Q DCIQALIVEFICTFLFVF GVG+AMA ++L G+ LV LFFVAMAHALV
Sbjct  4    IAVGSSREAIQPDCIQALIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAV ISAG RISG HLNPAVTLGL MGGHITV RS LY IDQLLASVAACALL YLT G+
Sbjct  64   VAVTISAGFRISGGHLNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLTDGM  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLA+G+ Y QG+IME+ILTFSLLFTVY T+VDPKKG L+G+GPLLTGLVVGANIM
Sbjct  124  ITPVHTLANGMSYWQGLIMEVILTFSLLFTVYTTLVDPKKGILEGMGPLLTGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPA VSG WTDHWVYW+GP IGGGLAGFI E FFIVR+HVP+  
Sbjct  184  AGGPFSGASMNPARSFGPAFVSGIWTDHWVYWIGPFIGGGLAGFICENFFIVRSHVPLPN  243

Query  872  QEAF  883
            +E F
Sbjct  244  EETF  247



>ref|XP_006450671.1| hypothetical protein CICLE_v10009294mg [Citrus clementina]
 gb|ESR63911.1| hypothetical protein CICLE_v10009294mg [Citrus clementina]
Length=247

 Score =   310 bits (794),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 216/243 (89%), Gaps = 1/243 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCI+AL+VEFI TFLFVF GVG+AMA D+L GNALVGLFFVA+AHA V
Sbjct  4    IALGSHREATQPDCIKALVVEFITTFLFVFVGVGSAMAADKLVGNALVGLFFVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT  RS LY IDQLLAS AAC LL+YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITFFRSILYWIDQLLASSAACFLLSYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            +TP HTLASGVGY QG+I EIILTFSLLFTVYATIVDPKKG++DGLGPLLTG VVGANI+
Sbjct  123  STPVHTLASGVGYFQGIIWEIILTFSLLFTVYATIVDPKKGSIDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVSG+WTDHWVYWVGPLIGGGLAGFIYE FFIVR+HVPI  
Sbjct  183  AGGPFSGASMNPARSFGPALVSGDWTDHWVYWVGPLIGGGLAGFIYEQFFIVRSHVPIPY  242

Query  872  QEA  880
            +EA
Sbjct  243  EEA  245



>ref|XP_006476050.1| PREDICTED: aquaporin TIP4-1-like [Citrus sinensis]
 gb|KDO79802.1| hypothetical protein CISIN_1g025864mg [Citrus sinensis]
Length=247

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 216/243 (89%), Gaps = 1/243 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCI+AL+VEFI TFLFVF GVG+AMA D+L GNALVGLFFVA+AHA V
Sbjct  4    IALGSHREATQPDCIKALVVEFITTFLFVFVGVGSAMAADKLVGNALVGLFFVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT  RS LY IDQLLAS AAC LL+YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITFFRSILYWIDQLLASSAACFLLSYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            +TP HTLASGVGY QG+I EIILTFSLLFTVYATIVDPKKG++DGLGPLLTG VVGANI+
Sbjct  123  STPVHTLASGVGYFQGIIWEIILTFSLLFTVYATIVDPKKGSIDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVSG+WTDHWVYWVGPLIGGGLAGFIYE FFIVR+HVPI  
Sbjct  183  AGGPFSGASMNPARSFGPALVSGDWTDHWVYWVGPLIGGGLAGFIYEHFFIVRSHVPIPY  242

Query  872  QEA  880
            +EA
Sbjct  243  EEA  245



>gb|AES58620.2| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=247

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCIQALIVEFI TFLFVF GVG+AM  D+L G+ALVGLFFVA+AHALV
Sbjct  4    IALGTTREATQPDCIQALIVEFIATFLFVFAGVGSAMTADKLSGDALVGLFFVAIAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL+GGHIT++RS LY IDQL+AS AAC LL YL+GGL
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLVGGHITIVRSILYWIDQLIASAAACYLLHYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTPAHTLASGVGY QGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  TTPAHTLASGVGYTQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FS ASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE FFI R HVP+A 
Sbjct  183  AGGAFSAASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFFINRDHVPLAV  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>gb|AFK33796.1| unknown [Medicago truncatula]
Length=249

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCIQALIVEFI TFLFVF GVG+AM  D+L G+ALVGLFFVA+AHALV
Sbjct  4    IALGTTREATQPDCIQALIVEFIATFLFVFAGVGSAMTADKLSGDALVGLFFVAIAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL+GGHIT++RS LY IDQL+AS AAC LL YL+GGL
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLVGGHITIVRSILYWIDQLIASAAACYLLHYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTPAHTLASGVGY QGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  TTPAHTLASGVGYTQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FS ASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE FFI R HVP+A 
Sbjct  183  AGGAFSAASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFFINRDHVPLAV  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>gb|AFK39772.1| unknown [Medicago truncatula]
Length=247

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCIQALIVEFI TFLFVF GVG+AM  D+L G+ALVGLFFVA+AHALV
Sbjct  4    IALGTTREATQPDCIQALIVEFIATFLFVFAGVGSAMTADKLSGDALVGLFFVAIAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL GGHIT++RS LY IDQL+AS AAC LL YL+GGL
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLAGGHITIVRSILYWIDQLIASAAACYLLHYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTPAHTLASGVGY QGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  TTPAHTLASGVGYTQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FS ASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE FFI R HVP+A 
Sbjct  183  AGGAFSAASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFFINRDHVPLAV  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|NP_180152.1| aquaporin TIP4-1 [Arabidopsis thaliana]
 sp|O82316.1|TIP41_ARATH RecName: Full=Aquaporin TIP4-1; AltName: Full=Epsilon-tonoplast 
intrinsic protein; Short=Epsilon-TIP; AltName: Full=Tonoplast 
intrinsic protein 4-1; Short=AtTIP4;1; Contains: RecName: 
Full=Aquaporin TIP4-1, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAC42249.1| putative aquaporin (tonoplast intrinsic protein) [Arabidopsis 
thaliana]
 gb|AAT06454.1| At2g25810 [Arabidopsis thaliana]
 dbj|BAE98355.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC07755.1| aquaporin TIP4-1 [Arabidopsis thaliana]
Length=249

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG+ SEA + DCI+ALIVEFI TFLFVF GVG+AMATD L GN LVGLF VA+AHA V
Sbjct  4    IELGHHSEAAKPDCIKALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL+GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGV Y QG+I EIILTFSLLFTVYATIVDPKKG+LDG GPLLTG VVGANI+
Sbjct  123  GTPVHTLASGVSYTQGIIWEIILTFSLLFTVYATIVDPKKGSLDGFGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R HVP+A 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRPHVPVAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_010526110.1| PREDICTED: aquaporin TIP4-1 [Tarenaya hassleriana]
Length=246

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCI+AL+VEF+ TFLFVF GVG+AMA D L GN LVGLF VAMAHALV
Sbjct  4    IALGSRGEAAQPDCIKALVVEFVTTFLFVFAGVGSAMAADSLVGNTLVGLFMVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT+ RSFLY IDQLLAS AAC LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITLFRSFLYWIDQLLASSAACFLLNYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLA+GVGY QG+I EIILTFSLLFTVYATIVDPKKG++DGLGPLLTG VVGANI+
Sbjct  123  GTPVHTLANGVGYTQGIIWEIILTFSLLFTVYATIVDPKKGSIDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSG WTDHWVYWVGPLIGGGLAGFIYE FFI R+HV IA 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGVWTDHWVYWVGPLIGGGLAGFIYENFFIDRSHVLIAR  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_002516539.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF45880.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=247

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA QSDCI+ALIVEFI TFLFVF GVG+AMA ++L G++LVGLFFVAMAH LV
Sbjct  4    IALGTRREATQSDCIKALIVEFITTFLFVFAGVGSAMAANKLLGDSLVGLFFVAMAHTLV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHITV+RS LY IDQLLAS AAC LL YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLAGGHITVVRSILYWIDQLLASSAACFLLNYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGY QG++ EI+LTFSLLFTVYATIVDPKKG++DGLGP LTG VVGANI+
Sbjct  123  ATPVHTLASGVGYVQGIVWEIVLTFSLLFTVYATIVDPKKGSIDGLGPTLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE FFI+R+H P+  
Sbjct  183  AGGPFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFIIRSHRPLPN  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>emb|CDP16197.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALGNG EA+Q D  QAL+VEFI TFLFVF GVG+AM  D+L G+ L GLFFVA+AH LV
Sbjct  4    IALGNGREAIQPDVFQALVVEFIVTFLFVFAGVGSAMTADKLSGSPLTGLFFVALAHTLV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG RISG HLNPAVTLGL +GGHITV+RS LY IDQ LAS AACALL YLTGGL
Sbjct  64   VAVMISAGFRISGGHLNPAVTLGLCVGGHITVVRSILYWIDQCLASAAACALLKYLTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP HTLASGV   QGVIMEIILTFSLLFTVYATIVDPKKGNLDGLGPLLTGLVVGANIM
Sbjct  124  TTPPHTLASGVDCTQGVIMEIILTFSLLFTVYATIVDPKKGNLDGLGPLLTGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
             GG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGF+YE FFIVR+HVP++ 
Sbjct  184  VGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFVYENFFIVRSHVPLSN  243

Query  872  QEAF  883
             E F
Sbjct  244  DETF  247



>ref|XP_004498471.1| PREDICTED: aquaporin TIP4-1-like [Cicer arietinum]
Length=247

 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCIQALIVEFI TFLFVF GVG+AM  D+L G+ALVGLFFVA+AHALV
Sbjct  4    IALGTTREATQPDCIQALIVEFIATFLFVFAGVGSAMTADKLSGDALVGLFFVAIAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL GGHITV RS LY IDQL+AS AA  LL YL+GGL
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLAGGHITVFRSILYWIDQLIASAAASYLLYYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTPAHTLASG+GY QGV+ EI+LTFSLLFTVYAT+VDPKKG L+GLGP L G VVGANI+
Sbjct  123  TTPAHTLASGIGYTQGVVWEIVLTFSLLFTVYATMVDPKKGALNGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FS ASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE FFI R HVP+  
Sbjct  183  AGGAFSAASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFFINRDHVPLVV  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>tpg|DAA33872.1| TPA_inf: aquaporin TIP4;1 [Gossypium hirsutum]
 tpg|DAA33873.1| TPA_inf: aquaporin TIP4;2 [Gossypium hirsutum]
Length=246

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCI+AL+VEFI TFLFVF GVGAAMA D+   NALVGLF VA+AHALV
Sbjct  4    IALGTSQEAAQPDCIKALVVEFITTFLFVFVGVGAAMAADESGANALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            V VMISAG  ISG HLNPAVTLGLL GGHITV+R+ LY IDQLLAS AAC LL YLTGGL
Sbjct  64   VGVMISAG-HISGGHLNPAVTLGLLFGGHITVVRAILYWIDQLLASSAACILLKYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+G+ QGVI EIILTF+LLFTVYATIVDPKKG++DGLGP+LTG VVGANI+
Sbjct  123  NTPVHTLASGMGFLQGVIWEIILTFALLFTVYATIVDPKKGSIDGLGPMLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAG+IYE FFIVRTHV +  
Sbjct  183  AGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGYIYENFFIVRTHVLLPQ  242

Query  872  QEAF  883
             EAF
Sbjct  243  NEAF  246



>gb|KDP34186.1| hypothetical protein JCGZ_07757 [Jatropha curcas]
Length=247

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCI+ALIVEFI TFLFVF GVG+AMA D+L G  LVGLFFVA+AHALV
Sbjct  4    IALGSRREATQPDCIKALIVEFITTFLFVFAGVGSAMAADKLVGGPLVGLFFVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT++RS LY IDQLLAS AAC LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITLVRSILYWIDQLLASSAACLLLNYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGY QGV+ EIILTFSLLFTVYATIVDPKKG +DGLGP LTG VVGANI+
Sbjct  123  ATPVHTLASGVGYLQGVVWEIILTFSLLFTVYATIVDPKKGAIDGLGPTLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE FFI+R+H+PI  
Sbjct  183  AGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFIIRSHIPIPI  242

Query  872  QE  877
             E
Sbjct  243  VE  244



>gb|KHG13169.1| Aquaporin TIP4-1 -like protein [Gossypium arboreum]
Length=246

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCI+AL+VEFI TFLFVF GVGAAMA D+   NALVGLF VA+AHALV
Sbjct  4    IALGTSLEAAQPDCIKALVVEFITTFLFVFVGVGAAMAADESGANALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            V VMISAG  ISG HLNPAVTLGLL GGHITV+R+ LY IDQLLAS AAC LL YLTGGL
Sbjct  64   VGVMISAG-HISGGHLNPAVTLGLLFGGHITVVRAILYWIDQLLASSAACILLKYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+G+ QGVI EIILTF+LLFTVYATIVDPKKG++DGLGP+LTG VVGANI+
Sbjct  123  NTPVHTLASGMGFLQGVIWEIILTFALLFTVYATIVDPKKGSIDGLGPMLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAG+IYE FFIVRTHV +  
Sbjct  183  AGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGYIYENFFIVRTHVLLPQ  242

Query  872  QEAF  883
             EAF
Sbjct  243  NEAF  246



>gb|ACV60358.1| putative tonoplast intrinsic protein [Camellia sinensis]
Length=248

 Score =   300 bits (768),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG G EA Q DCI ALIVEFICTFLFVF GVG+AMA D+L G++LVGLFFVAMAHALV
Sbjct  4    IALGTGREATQIDCIHALIVEFICTFLFVFAGVGSAMAADKLGGDSLVGLFFVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG RISG HLNPAVTLGL +GGHITV RS LY IDQLLAS AACALL YLTGGL
Sbjct  64   VAVMISAGFRISGGHLNPAVTLGLCVGGHITVFRSILYWIDQLLASAAACALLKYLTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QGVIMEIILTFSLLF+VYA  VDPKKG LDGLGPLL GLVVGANIM
Sbjct  124  ATPVHTLASGMDYSQGVIMEIILTFSLLFSVYALCVDPKKGFLDGLGPLLVGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAG IYE FFIVR+HVP+  
Sbjct  184  AGGPFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGLIYENFFIVRSHVPLPR  243

Query  872  QE  877
            ++
Sbjct  244  ED  245



>gb|AIA82918.1| AQPTIP [Gentiana rigescens]
Length=250

 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 212/242 (88%), Gaps = 3/242 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA+Q DCIQAL+VEFICTFLF+F GVGAA+  D+L G+AL GLF VA+AHALV
Sbjct  4    IALGSFQEAIQPDCIQALVVEFICTFLFIFAGVGAAITADKLVGSALTGLFMVAIAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG RISG HLNPAVT+GL +GG+ITV+RS LY IDQLLASVAAC LL YLTGGL
Sbjct  64   VAVMISAGFRISGGHLNPAVTIGLCLGGNITVVRSILYWIDQLLASVAACFLLKYLTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            T P H LASG+ YGQG+IMEI+LTFSLLF+VYAT VDPKKG+LDGLGPLL GLVVGANI+
Sbjct  124  TPPIHQLASGIDYGQGIIMEIVLTFSLLFSVYATCVDPKKGSLDGLGPLLVGLVVGANIL  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGGSFSG SMNPARSFGPALV+G+WTDHWVYWVGPLIGGGLAGFIYE FFIVR   P+  
Sbjct  184  AGGSFSGGSMNPARSFGPALVAGDWTDHWVYWVGPLIGGGLAGFIYENFFIVR---PVVG  240

Query  872  QE  877
             E
Sbjct  241  HE  242



>ref|XP_006408801.1| hypothetical protein EUTSA_v10002084mg [Eutrema salsugineum]
 gb|ESQ50254.1| hypothetical protein EUTSA_v10002084mg [Eutrema salsugineum]
Length=249

 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LGN  EA Q DCI+ALIVEFI TF FVF GVG+AMATD L GN LVGLF VA+AHA V
Sbjct  4    INLGNHGEAAQPDCIKALIVEFITTFFFVFAGVGSAMATDSLVGNTLVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVT+GLL GGHITV R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTIGLLFGGHITVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QG+I EIILTFSLLFTVYATIVDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  GTPVHTLASGISYTQGIIWEIILTFSLLFTVYATIVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE F I R  VP+  
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFLIDRPQVPVTD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_010429588.1| PREDICTED: aquaporin TIP4-1 [Camelina sativa]
 ref|XP_010472601.1| PREDICTED: aquaporin TIP4-1 [Camelina sativa]
Length=250

 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG+ +EA++ DCI+ALIVEFI TFLFVF GVG+AM TD L GN LVGLF VA+AHALV
Sbjct  4    IDLGSHNEAVEPDCIKALIVEFITTFLFVFAGVGSAMTTDSLVGNTLVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            V VMISAG  ISG HLNP+VTLGLL+GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VGVMISAG-HISGGHLNPSVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGV Y QG+I EIILTFSLLFTVYAT+VDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  ATPVHTLASGVSYTQGIIWEIILTFSLLFTVYATMVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R HVP+A 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRPHVPVAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_010417358.1| PREDICTED: aquaporin TIP4-1-like isoform X1 [Camelina sativa]
 ref|XP_010417359.1| PREDICTED: aquaporin TIP4-1-like isoform X2 [Camelina sativa]
Length=250

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG+ +EA++ DCI+ALIVEFI TFLFVF GVG+AM TD L GN LVGLF VA+AHALV
Sbjct  4    IDLGSHNEAVEPDCIKALIVEFITTFLFVFAGVGSAMTTDSLVGNTLVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            V VMISAG  ISG HLNP+VTLGLL+GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VGVMISAG-HISGGHLNPSVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGV Y QG+I EI+LTFSLLFTVYAT+VDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  ATPVHTLASGVSYTQGIIWEIVLTFSLLFTVYATMVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R HVP+A 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRPHVPVAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_011070446.1| PREDICTED: aquaporin TIP4-1-like [Sesamum indicum]
Length=278

 Score =   300 bits (768),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 200/244 (82%), Gaps = 26/244 (11%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EALQ DC+QALIVEFICTFLFVF GVG+AMAT                     
Sbjct  61   IAIGSFREALQPDCLQALIVEFICTFLFVFAGVGSAMAT---------------------  99

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
                 +AG RISG HLNPAVTLGL +GGHITV+RS LY IDQLLASVAACALL+YLTGGL
Sbjct  100  -----AAGFRISGGHLNPAVTLGLCVGGHITVVRSILYWIDQLLASVAACALLSYLTGGL  154

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LASGVG  QGVIMEI+LTFSLLFTVY TIVDPKKG +DGLGPLLTGLVVGANIM
Sbjct  155  TTPIHSLASGVGVTQGVIMEIVLTFSLLFTVYTTIVDPKKGIIDGLGPLLTGLVVGANIM  214

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVSG+W+DHWVYWVGPLIGGGLAGFIYE FFIVR+H+P++ 
Sbjct  215  AGGPFSGASMNPARSFGPALVSGDWSDHWVYWVGPLIGGGLAGFIYENFFIVRSHLPLSG  274

Query  872  QEAF  883
             +AF
Sbjct  275  DDAF  278



>ref|XP_006294868.1| hypothetical protein CARUB_v10023921mg [Capsella rubella]
 gb|EOA27766.1| hypothetical protein CARUB_v10023921mg [Capsella rubella]
Length=249

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG+ +EA + DCI+ALIVEFI TFLFVF GVG+AMATD L GN LVGLF VA+AHA V
Sbjct  4    IELGHHNEAAKPDCIKALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL+GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QG+I EIILTFSLLFTVYAT+VDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  ATPVHTLASGMSYTQGIIWEIILTFSLLFTVYATMVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R +VPIA 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRPNVPIAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_002309548.1| aquaporin TIP4.1 family protein [Populus trichocarpa]
 gb|EEE93071.1| aquaporin TIP4.1 family protein [Populus trichocarpa]
Length=247

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 212/242 (88%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DC++AL+VEF+ TFLFVF GVG+AMA D+L G+AL+GLF VA+AHA V
Sbjct  4    IALGSRHEAAQPDCLKALVVEFVTTFLFVFAGVGSAMAADKLTGDALLGLFVVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVT+GLL GGHITV+RS LY IDQLLAS AAC LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTIGLLFGGHITVVRSILYWIDQLLASTAACFLLKYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QGV+ EI+LTFSLLFTVYATIVDPKKG++DGLGP+LTG VVGANI+
Sbjct  123  ATPVHTLASGMDYLQGVVWEIVLTFSLLFTVYATIVDPKKGSIDGLGPMLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE FFI R+H P+ +
Sbjct  183  AGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFITRSHRPLPS  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>ref|XP_002878889.1| TIP4_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55148.1| TIP4_1 [Arabidopsis lyrata subsp. lyrata]
Length=249

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG+ SEA +  CI+ALIVEFI TFLFVF GVG+AMATD L GN LVGLF VA+AHALV
Sbjct  4    IELGHHSEAAKPGCIKALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL+GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLA GV Y QG+I EIILTFSLLFTVYAT+VDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  ATPVHTLAIGVSYTQGIIWEIILTFSLLFTVYATMVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R HVP+A 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRPHVPVAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_003522708.1| PREDICTED: aquaporin TIP4-1 [Glycine max]
Length=246

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCIQALIVEFI TFLFVF GVG++M  D+L G+ALVGLF VA+AHALV
Sbjct  4    IALGSTREATQPDCIQALIVEFIATFLFVFVGVGSSMVVDKLGGDALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL GGHIT+ RS LY IDQL+A+  A  LL YL+GG 
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLAGGHITIFRSMLYWIDQLVAAATASYLLYYLSGGQ  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGYGQGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  ATPVHTLASGVGYGQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG++S ASMNPARSFGPALV+GNWTDHWVYWVGPLIGGGLAG+IYETFFI R+HVP+  
Sbjct  183  AGGAYSAASMNPARSFGPALVAGNWTDHWVYWVGPLIGGGLAGYIYETFFIDRSHVPLPR  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_007012110.1| Tonoplast intrinsic protein 4,1 [Theobroma cacao]
 gb|EOY29729.1| Tonoplast intrinsic protein 4,1 [Theobroma cacao]
Length=247

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 209/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q+DCI+AL+VEF+ TFLFVF GVG +MA  +L+ N LV LF VA+AHALV
Sbjct  4    IALGTSREAAQTDCIKALVVEFVTTFLFVFVGVGTSMAAGELEANTLVSLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            V VMISAG  ISG HLNPAVTLGLL GGHITV+RS LY IDQLLAS AAC LL YLTGGL
Sbjct  64   VGVMISAG-HISGGHLNPAVTLGLLFGGHITVVRSILYWIDQLLASSAACILLKYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP H+LASGVG+ QGVI E++LTFSLLFTVYATIVDPKKG++DGLGP+LTG VVGANI+
Sbjct  123  NTPIHSLASGVGFLQGVIWEVVLTFSLLFTVYATIVDPKKGSIDGLGPMLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE FFIVRTH P+  
Sbjct  183  AGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYEYFFIVRTHAPLPH  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>ref|XP_010249612.1| PREDICTED: aquaporin TIP4-1 [Nelumbo nucifera]
Length=248

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA  +DC++AL+ EFICTFLFVF GVGAAM +D++ G +LVGLF VA+AHALV
Sbjct  4    IALGTAREATDTDCLKALVAEFICTFLFVFAGVGAAMTSDKMLGGSLVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAGLR SG HLNPAVT+GL  GGHIT+ RS LY IDQLLAS  AC LL YLTGGL
Sbjct  64   VAVMISAGLRTSGGHLNPAVTIGLAAGGHITIFRSILYWIDQLLASSLACILLKYLTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TPAHTL SGV   QG++MEIILTFSLLFTVYATIVDPKKG+LDGLGPLLTGLVVGANI+
Sbjct  124  ETPAHTLGSGVSPLQGLVMEIILTFSLLFTVYATIVDPKKGSLDGLGPLLTGLVVGANIL  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPALVSG WTDHWVYWVGPL+GG LAGF+YE FFIVR+HVP+ +
Sbjct  184  AGGLFSGASMNPARSFGPALVSGIWTDHWVYWVGPLLGGALAGFLYENFFIVRSHVPLPS  243

Query  872  QE  877
            ++
Sbjct  244  ED  245



>ref|XP_009140699.1| PREDICTED: aquaporin TIP4-1 [Brassica rapa]
Length=249

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LGN  EA Q DCI+ALIVEFI TF FVF GVG+AMATD L GN LVGL  VA+AHALV
Sbjct  4    IDLGNHREAAQPDCIKALIVEFITTFFFVFAGVGSAMATDSLVGNTLVGLLAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVT+GLL GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTIGLLFGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QG+I EIILTFSLLFTVYAT+VDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  GTPVHTLASGISYTQGIIWEIILTFSLLFTVYATMVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R+  P+A 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRSDAPLAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|XP_011019624.1| PREDICTED: aquaporin TIP4-1 [Populus euphratica]
Length=247

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 212/242 (88%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DC++AL+VEF+ TFLFVF GVG+AMA D+L G+AL+GLF VA+AHALV
Sbjct  4    IALGSRHEAAQPDCLKALVVEFVTTFLFVFAGVGSAMAADKLTGDALLGLFVVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVT+GLL GGHITV+RS LY IDQLLAS AAC LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTIGLLFGGHITVVRSILYWIDQLLASTAACLLLKYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QG++ E +LTFSLLFTVYATIVDPKKG++DGLGP+LTG VVGANI+
Sbjct  123  ATPVHTLASGMDYLQGIVWESVLTFSLLFTVYATIVDPKKGSIDGLGPMLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE FFI R+H P+ +
Sbjct  183  AGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFITRSHRPLPS  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>gb|KHN10202.1| Aquaporin TIP4-1 [Glycine soja]
Length=246

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCIQALIVEFI TFLFVF GVG++M  D+L G+ALVGLF VA+AHALV
Sbjct  4    IALGSTREATQPDCIQALIVEFIATFLFVFVGVGSSMVVDKLGGDALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL GGHIT+ RS LY IDQL+A+  A  LL YL+GG 
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLAGGHITIFRSMLYWIDQLVAAATASYLLYYLSGGQ  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGYGQGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  ATPVHTLASGVGYGQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG++S ASMNPARSFGPALV+GNWTDHWVYWVGPLIGGGLAG+IYETFFI R+HVP+  
Sbjct  183  AGGAYSAASMNPARSFGPALVAGNWTDHWVYWVGPLIGGGLAGYIYETFFIDRSHVPLPR  242

Query  872  QE  877
             +
Sbjct  243  DQ  244



>emb|CDX77009.1| BnaC04g38040D [Brassica napus]
Length=249

 Score =   294 bits (752),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 208/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LGN  EA Q +CI+ALIVEFI TF FVF GVG+AMATD L GN LVGL  VA+AHALV
Sbjct  4    IDLGNHREAAQPECIKALIVEFITTFFFVFAGVGSAMATDSLVGNTLVGLLAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVT+GLL GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTIGLLFGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QG++ EIILTFSLLFTVYAT+VDPKKG+LDGLGPLLTG VVGANI+
Sbjct  123  GTPVHTLASGISYTQGIVWEIILTFSLLFTVYATMVDPKKGSLDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R+ VP+A 
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENVLIDRSDVPLAD  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>gb|ACU19038.1| unknown [Glycine max]
Length=246

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 204/242 (84%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCIQALIVEFI TFLFVF GVG++M  D+L G+ALVGLF VA+AHALV
Sbjct  4    IALGSTREATQPDCIQALIVEFIATFLFVFVGVGSSMVVDKLGGDALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL GGHIT+ RS LY IDQL+A+  A  LL YL+GG 
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLAGGHITIFRSMLYWIDQLVAAATASYLLYYLSGGQ  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGYGQGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  ATPVHTLASGVGYGQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG++  ASMNPARSFGPALV+GNWTDHWVYWVGPLIGGGLAG+IYETFFI R+HVP+  
Sbjct  183  AGGAYFAASMNPARSFGPALVAGNWTDHWVYWVGPLIGGGLAGYIYETFFIDRSHVPLPR  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>gb|KFK32564.1| hypothetical protein AALP_AA6G259500 [Arabis alpina]
Length=251

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 190/235 (81%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LGN +EA Q DCI+ALIVEFI TF FVF GVG+AMATD L GN LVGLF VA+AHA V
Sbjct  4    IDLGNHAEAAQPDCIKALIVEFITTFFFVFAGVGSAMATDTLVGNTLVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL+GGHI+V R+FLY IDQLLAS AAC LL+YLTGG+
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLLGGHISVFRAFLYWIDQLLASTAACFLLSYLTGGM  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASG+ Y QG+I EIILTFSLLFTVYAT+VDPKKG LDGLGPLLTG VVGANI+
Sbjct  123  ATPVHTLASGMSYTQGIIWEIILTFSLLFTVYATMVDPKKGALDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            AGG+FSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE   I R H
Sbjct  183  AGGAFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENLLIDRPH  237



>ref|XP_010102384.1| Aquaporin TIP4-1 [Morus notabilis]
 gb|EXB93369.1| Aquaporin TIP4-1 [Morus notabilis]
Length=250

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCI+ALIVEFI TFLFVF GVG A+  D+L G ALVGLF VA+AHALV
Sbjct  4    IALGTTREAAQPDCIRALIVEFIVTFLFVFAGVGTAITADKLGGGALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAV ISAG  ISG HLNPAVT+GLL GGHITV RS LY IDQLLAS  AC LL YLTGGL
Sbjct  64   VAVTISAG-HISGGHLNPAVTIGLLAGGHITVFRSLLYWIDQLLASSLACFLLQYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            +TP H+LASGVGY QGVI EIILTFSLLFTVYAT+VDPK+G LDGLGP+LTG VVGANI+
Sbjct  123  STPIHSLASGVGYFQGVIWEIILTFSLLFTVYATMVDPKRGALDGLGPMLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGGSFSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE FFI+R+HV I T
Sbjct  183  AGGSFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYENFFIIRSHVRIPT  242

Query  872  QE  877
             +
Sbjct  243  HD  244



>ref|XP_007137210.1| hypothetical protein PHAVU_009G108800g [Phaseolus vulgaris]
 gb|ESW09204.1| hypothetical protein PHAVU_009G108800g [Phaseolus vulgaris]
Length=246

 Score =   291 bits (746),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 182/244 (75%), Positives = 205/244 (84%), Gaps = 1/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA + DCIQAL+VEFI TFLFVF GV ++M T++L G+ALVGLF VA+AHALV
Sbjct  4    IALGSAREATRPDCIQALVVEFIATFLFVFVGVASSMLTEKLGGDALVGLFVVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVT+GLL GGHITV RS LY IDQL+AS AA  LL +L+GG 
Sbjct  64   VAVMISAA-HISGGHLNPAVTIGLLAGGHITVFRSILYWIDQLVASAAASYLLYFLSGGQ  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLA+G+GYGQGVI EI+LTFSLL TVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  KTPVHTLAAGIGYGQGVIWEIVLTFSLLLTVYATMVDPKKGPLAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG++S ASMNPARSFGPALV+GNWTDHWVYWVGPLIGGGLAGFIYETFFI R+H P+  
Sbjct  183  AGGAYSAASMNPARSFGPALVTGNWTDHWVYWVGPLIGGGLAGFIYETFFIDRSHAPLPR  242

Query  872  QEAF  883
             E F
Sbjct  243  DEEF  246



>ref|XP_006581008.1| PREDICTED: uncharacterized protein LOC100793258 isoform X1 [Glycine 
max]
 gb|KHN18178.1| Aquaporin TIP4-1 [Glycine soja]
Length=246

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 205/242 (85%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCIQALIVEFI TFLFVF GV ++M  D+L G+ALVGLF VA+AHALV
Sbjct  4    IALGSTREATQPDCIQALIVEFIATFLFVFVGVASSMVVDKLGGDALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL GGHIT+ RS LY IDQL+A+ AA  LL YL+GG 
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLAGGHITIFRSLLYWIDQLVAAAAASYLLYYLSGGQ  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGYGQGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  ATPVHTLASGVGYGQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG++S ASMNPARSFGPALV+GNWTDHWVYWVGPLIGGGLAGFIYETFFI R+HVP+  
Sbjct  183  AGGAYSAASMNPARSFGPALVTGNWTDHWVYWVGPLIGGGLAGFIYETFFIDRSHVPLPR  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>ref|NP_001242569.1| uncharacterized protein LOC100793258 [Glycine max]
 gb|ACU18235.1| unknown [Glycine max]
Length=246

 Score =   289 bits (739),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 204/242 (84%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG+  EA Q DCIQALIVEFI TFLFVF GV ++M  D+L G+ALVGLF VA+AHALV
Sbjct  4    IALGSTREATQPDCIQALIVEFIATFLFVFVGVASSMVVDKLGGDALVGLFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPA TLGLL GGHIT+ RS LY IDQL+A+ AA  LL YL+GG 
Sbjct  64   VAVMISAA-HISGGHLNPAATLGLLAGGHITIFRSLLYWIDQLVAAAAASYLLYYLSGGQ  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGYGQGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  ATPVHTLASGVGYGQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG++S ASMNPARSFGPALV+GNWTDHWVYWVGPLIGGGLAGFIYETFFI R+HVP+  
Sbjct  183  AGGAYSAASMNPARSFGPALVTGNWTDHWVYWVGPLIGGGLAGFIYETFFIDRSHVPLPR  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>gb|AES58629.2| tonoplast intrinsic protein [Medicago truncatula]
Length=247

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 202/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG   EA Q +CIQALIVEFI TFLFVF GV + MA D+L G+ LVGLFFVAMA+ L+
Sbjct  4    ITLGTTQEAAQPNCIQALIVEFIVTFLFVFAGVASKMAADKLSGDGLVGLFFVAMANVLL  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  +SG HLNPAVT GLL+GGHITV+RS LY IDQL+AS  AC LL YLTGGL
Sbjct  64   VAVMISAG-HVSGGHLNPAVTFGLLVGGHITVVRSILYWIDQLIASAGACYLLHYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP HTL SGVG  QGV+ EI+LTFSLLFTVYAT+VDPKKG   GLGP+L G VVGANI+
Sbjct  123  TTPVHTLKSGVGCTQGVVWEIVLTFSLLFTVYATMVDPKKGGFAGLGPILIGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+F+GASMNPARSFGPALVSGNWTD W++WVGPLIGGGLAGFIYE FFI RTHVP+  
Sbjct  183  AGGAFAGASMNPARSFGPALVSGNWTDQWIFWVGPLIGGGLAGFIYENFFINRTHVPLLV  242

Query  872  QE  877
             E
Sbjct  243  DE  244



>gb|EPS71324.1| hypothetical protein M569_03434, partial [Genlisea aurea]
Length=242

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 214/239 (90%), Gaps = 1/239 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+G EA Q DC+ ALIVEF+ TFLFVF GVGAAMA D+L G+ LVGLFFVA+AHA V
Sbjct  4    IAIGSGREAFQLDCVHALIVEFVSTFLFVFAGVGAAMAADKLNGDPLVGLFFVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG RISG HLNPAVTLGLL+GGHIT+ RS LY IDQLLA+VAA ALL+Y+TGGL
Sbjct  64   VAVMISAGFRISGGHLNPAVTLGLLVGGHITLFRSVLYWIDQLLAAVAASALLSYVTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+L +GVG  QG+I+EI+LTFSLLFTVYATIVDPKKGNLDGLGPLLTGLVVGANIM
Sbjct  124  TTPVHSLGAGVGPTQGLILEIVLTFSLLFTVYATIVDPKKGNLDGLGPLLTGLVVGANIM  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THVPI  865
            AGG FSGASMNPARSFGPALV+GNW DHW+YWVGPL+GG LAGFIYE FFIVR +HVP+
Sbjct  184  AGGPFSGASMNPARSFGPALVTGNWADHWIYWVGPLVGGALAGFIYENFFIVRSSHVPL  242



>ref|XP_010049101.1| PREDICTED: aquaporin TIP4-1 [Eucalyptus grandis]
 gb|KCW81557.1| hypothetical protein EUGRSUZ_C02914 [Eucalyptus grandis]
Length=243

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 197/235 (84%), Gaps = 1/235 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALGN  EA + DC++AL++EF+ TFLFVF GVG+AMA ++L  +A VGLF VAMAHALV
Sbjct  4    IALGNSREATEPDCLKALVIEFVATFLFVFAGVGSAMAAERLAADAFVGLFGVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHITV+RS LY+IDQLLAS AA  LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITVVRSVLYMIDQLLASAAASFLLQYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTL SG+ Y QG+I EI+LTFSLLF VYATIVDP+K +    GP+L GLVVGANI+
Sbjct  123  ATPVHTLGSGMTYLQGIIWEIVLTFSLLFAVYATIVDPRKSSQGAQGPILVGLVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            AGG+FSGASMNPARSFGPAL S +WTDHWVYWVGPL+GGGLAG +YE FFI R+H
Sbjct  183  AGGAFSGASMNPARSFGPALASWDWTDHWVYWVGPLVGGGLAGLVYENFFICRSH  237



>ref|XP_007226030.1| hypothetical protein PRUPE_ppa010453mg [Prunus persica]
 gb|EMJ27229.1| hypothetical protein PRUPE_ppa010453mg [Prunus persica]
Length=249

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 208/244 (85%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG  SEA   +  +AL+VEFI TFLFVF GVG+AMATD+L+ +ALV LF  A+ HALV
Sbjct  4    IALGTTSEAALPELWRALVVEFITTFLFVFAGVGSAMATDKLEADALVALFATAVTHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL+GGHITV RS LY IDQLLA+ AAC LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLVGGHITVFRSLLYWIDQLLAAAAACYLLEYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LASGVGY QGVI EIILTFSLLFTVYATIVDPKKG L+GLGP LTG VVGANI+
Sbjct  123  TTPIHSLASGVGYLQGVIWEIILTFSLLFTVYATIVDPKKGALNGLGPTLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR--THVPI  865
            AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAG IYE FFI R  TH+PI
Sbjct  183  AGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGCIYENFFIFRPTTHLPI  242

Query  866  ATQE  877
             T+E
Sbjct  243  PTEE  246



>gb|ABR17761.1| unknown [Picea sitchensis]
Length=248

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 190/244 (78%), Gaps = 2/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQ--GNALVGlffvamaha  325
            IALG+  EA + DC++A+  E ICTFLFVF GVG+AMA +Q+     +  GL  VA+AHA
Sbjct  4    IALGDRDEAARPDCVRAVFAELICTFLFVFAGVGSAMAMEQMSVPAKSPAGLTVVALAHA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
              V  MISAG  ISG HLNPAVTLGL +GGHIT+IRS LY I QLLASV AC LL +LTG
Sbjct  64   FAVFAMISAGFNISGGHLNPAVTLGLAVGGHITLIRSLLYWIAQLLASVLACFLLNFLTG  123

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            GL TP HTL+SG+ Y QGVIMEI+LTFSLLFTVYAT VDPKKG++    PL  GLVVGAN
Sbjct  124  GLATPVHTLSSGMTYFQGVIMEIVLTFSLLFTVYATAVDPKKGSVGITAPLCVGLVVGAN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPI  865
            I+AGG FSGASMNPARSFGPALV+G W DHWVYWVGPL+GGGLAGF+YE  FI  TH P+
Sbjct  184  ILAGGPFSGASMNPARSFGPALVTGIWKDHWVYWVGPLVGGGLAGFLYENIFIYETHTPL  243

Query  866  ATQE  877
               E
Sbjct  244  PDVE  247



>ref|XP_004291186.1| PREDICTED: aquaporin TIP4-1-like [Fragaria vesca subsp. vesca]
Length=248

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 182/245 (74%), Positives = 206/245 (84%), Gaps = 5/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G+ SEA + +  +ALIVEF+ TFLF+F GVG+AMATD+L  +  V LFF+A+ HALV
Sbjct  4    IAFGSTSEAAKPEVWRALIVEFVTTFLFIFAGVGSAMATDKLGADTTVALFFIAITHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT+ RS LY IDQLLA+ A+C LL YLTGGL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLAGGHITLFRSVLYWIDQLLAAAASCYLLKYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LASGVG+ QGVI EIILTFSLLFTVYAT+VDPKKG+LDGLGP LTG VVGANI+
Sbjct  123  TTPIHSLASGVGFSQGVIWEIILTFSLLFTVYATMVDPKKGSLDGLGPTLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH----V  859
            AGG+FSGASMNPARSFGPALVS +WTDHWVYWVGPLIGGGLAGFIYE+FFI R      +
Sbjct  183  AGGAFSGASMNPARSFGPALVSWDWTDHWVYWVGPLIGGGLAGFIYESFFIERPRSYQPI  242

Query  860  PIATQ  874
            P+A  
Sbjct  243  PVADD  247



>emb|CAN66944.1| hypothetical protein VITISV_020091 [Vitis vinifera]
 emb|CBI20864.3| unnamed protein product [Vitis vinifera]
 gb|AIK66519.1| putative aquaporin [Vitis vinifera]
Length=253

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 203/243 (84%), Gaps = 1/243 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            +ALG+G E  Q DCI+AL++EFI TFLFVF GVG+AMAT++L+G++L  LFFVAMAHALV
Sbjct  4    MALGSGREFAQPDCIRALVMEFIVTFLFVFAGVGSAMATEKLKGDSLDSLFFVAMAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVM+SA L+ISG HLNPAVTLGL +GGHITV+RS LY IDQ LAS  AC LL +LTGG 
Sbjct  64   VAVMVSAALQISGGHLNPAVTLGLCVGGHITVVRSVLYFIDQCLASTVACILLKFLTGGR  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldg-lgplltglvvgANI  688
             TP HTLASGVG  QGV++E ILTFSLLFTVYA IV  +K      LGP++TGLVVGAN+
Sbjct  124  ATPVHTLASGVGCLQGVMLEFILTFSLLFTVYANIVSAQKSAHIDGLGPMITGLVVGANV  183

Query  689  MAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIA  868
            MAGG+FSGASMNPARSFGPALVS +WT+HWVYWVGPL+GG +AGF+YE FFI R H+ + 
Sbjct  184  MAGGAFSGASMNPARSFGPALVSWDWTNHWVYWVGPLVGGAVAGFVYENFFINRPHLRLP  243

Query  869  TQE  877
            T++
Sbjct  244  TRD  246



>ref|XP_003588378.1| Tonoplast intrinsic protein [Medicago truncatula]
Length=238

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 188/245 (77%), Gaps = 16/245 (7%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL---QGNALVGlffvamah  322
            I LG   EA Q +CIQALIVEFI TFLFVF GV + MA D       N L+         
Sbjct  4    ITLGTTQEAAQPNCIQALIVEFIVTFLFVFAGVASKMAWDYFLLAMANVLL---------  54

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               VAVMISAG  +SG HLNPAVT GLL+GGHITV+RS LY IDQL+AS  AC LL YLT
Sbjct  55   ---VAVMISAG-HVSGGHLNPAVTFGLLVGGHITVVRSILYWIDQLIASAGACYLLHYLT  110

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTTP HTL SGVG  QGV+ EI+LTFSLLFTVYAT+VDPKKG   GLGP+L G VVGA
Sbjct  111  GGLTTPVHTLKSGVGCTQGVVWEIVLTFSLLFTVYATMVDPKKGGFAGLGPILIGFVVGA  170

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F+GASMNPARSFGPALVSGNWTD W++WVGPLIGGGLAGFIYE FFI RTHVP
Sbjct  171  NILAGGAFAGASMNPARSFGPALVSGNWTDQWIFWVGPLIGGGLAGFIYENFFINRTHVP  230

Query  863  IATQE  877
            +   E
Sbjct  231  LLVDE  235



>ref|XP_002283964.1| PREDICTED: aquaporin TIP4-1 [Vitis vinifera]
Length=301

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 203/243 (84%), Gaps = 1/243 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            +ALG+G E  Q DCI+AL++EFI TFLFVF GVG+AMAT++L+G++L  LFFVAMAHALV
Sbjct  52   MALGSGREFAQPDCIRALVMEFIVTFLFVFAGVGSAMATEKLKGDSLDSLFFVAMAHALV  111

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVM+SA L+ISG HLNPAVTLGL +GGHITV+RS LY IDQ LAS  AC LL +LTGG 
Sbjct  112  VAVMVSAALQISGGHLNPAVTLGLCVGGHITVVRSVLYFIDQCLASTVACILLKFLTGGR  171

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldg-lgplltglvvgANI  688
             TP HTLASGVG  QGV++E ILTFSLLFTVYA IV  +K      LGP++TGLVVGAN+
Sbjct  172  ATPVHTLASGVGCLQGVMLEFILTFSLLFTVYANIVSAQKSAHIDGLGPMITGLVVGANV  231

Query  689  MAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIA  868
            MAGG+FSGASMNPARSFGPALVS +WT+HWVYWVGPL+GG +AGF+YE FFI R H+ + 
Sbjct  232  MAGGAFSGASMNPARSFGPALVSWDWTNHWVYWVGPLVGGAVAGFVYENFFINRPHLRLP  291

Query  869  TQE  877
            T++
Sbjct  292  TRD  294



>ref|XP_008445019.1| PREDICTED: aquaporin TIP4-1 [Cucumis melo]
Length=247

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EA Q DCI+ALIVEFI TFLFVF GVG+AMA + L  NALVGLF VA+AHA V
Sbjct  4    IAIGSIGEAYQPDCIRALIVEFIVTFLFVFAGVGSAMAANALLANALVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMIS G  ISG HLNPAVTLGLL GGHITV+RS LY I QLLA+ AA  LLTYLTGGL
Sbjct  64   VAVMISTG-HISGGHLNPAVTLGLLFGGHITVVRSALYWIVQLLAASAASFLLTYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGY QGVI EIILTFSLLFTVY TIVDPKKG LDGLGPLLTG VVGANI+
Sbjct  123  VTPIHTLASGVGYLQGVIWEIILTFSLLFTVYGTIVDPKKGALDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALV+G+WTDHWVYWVGPLIGGGLAGFIYE F I R+HVP+  
Sbjct  183  AGGAFSGASMNPARSFGPALVAGDWTDHWVYWVGPLIGGGLAGFIYENFLIQRSHVPLPR  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>ref|XP_004164037.1| PREDICTED: aquaporin TIP4-1-like [Cucumis sativus]
Length=247

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EA Q DCI+ALIVEFI TFLFVF GVG+AMA + L  NALVGLF VA+AHA V
Sbjct  4    IAIGSIHEASQPDCIRALIVEFIVTFLFVFAGVGSAMAANALLANALVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMIS G  ISG HLNPAVTLGLL GGHITV+RS LY I QLLA+ AA  LLTYLTGGL
Sbjct  64   VAVMISTG-HISGGHLNPAVTLGLLFGGHITVVRSALYWIIQLLAASAASFLLTYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGY QGVI EIILTFSLLFTVY TIVDPKKG LDGLGPLLTG VVGANI+
Sbjct  123  VTPIHTLASGVGYLQGVIWEIILTFSLLFTVYGTIVDPKKGALDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALV+G+WTDHWVYWVGPLIGGGLAGFIYE F I R+HVP+  
Sbjct  183  AGGAFSGASMNPARSFGPALVAGDWTDHWVYWVGPLIGGGLAGFIYENFLIQRSHVPLPR  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>ref|XP_004150285.1| PREDICTED: aquaporin TIP4-1-like [Cucumis sativus]
 gb|KGN62821.1| Tonoplast intrinsic protein [Cucumis sativus]
Length=247

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 207/242 (86%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  EA Q DCI+ALIVEFI TFLFVF GVG+AMA + L  NALVGLF VA+AHA V
Sbjct  4    IAIGSIHEASQPDCIRALIVEFIVTFLFVFAGVGSAMAANALLANALVGLFAVAVAHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMIS G  ISG HLNPAVTLGLL GGHITV+RS LY I QLLA+ AA  LLTYLTGGL
Sbjct  64   VAVMISTG-HISGGHLNPAVTLGLLFGGHITVVRSALYWIIQLLAASAASFLLTYLTGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP HTLASGVGY QGVI EIILTFSLLFTVY TIVDPKKG LDGLGPLLTG VVGANI+
Sbjct  123  VTPIHTLASGVGYLQGVIWEIILTFSLLFTVYGTIVDPKKGALDGLGPLLTGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FSGASMNPARSFGPALV+G+WTDHWVYWVGPLIGGGLAGFIYE F I R+HVP+  
Sbjct  183  AGGAFSGASMNPARSFGPALVAGDWTDHWVYWVGPLIGGGLAGFIYENFLIQRSHVPLPR  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>ref|XP_003588369.1| Aquaporin TIP4-1 [Medicago truncatula]
Length=214

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 177/242 (73%), Gaps = 34/242 (14%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCIQALIVEFI TFLFVF GVG+AM  D+L G+ALVG           
Sbjct  4    IALGTTREATQPDCIQALIVEFIATFLFVFAGVGSAMTADKLSGDALVG-----------  52

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
                                   L   GHIT++RS LY IDQL+AS AAC LL YL+GGL
Sbjct  53   -----------------------LFFVGHITIVRSILYWIDQLIASAAACYLLHYLSGGL  89

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTPAHTLASGVGY QGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  90   TTPAHTLASGVGYTQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  149

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+FS ASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE FFI R HVP+A 
Sbjct  150  AGGAFSAASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYENFFINRDHVPLAV  209

Query  872  QE  877
             E
Sbjct  210  DE  211



>ref|XP_010917707.1| PREDICTED: probable aquaporin TIP4-3 [Elaeis guineensis]
Length=274

 Score =   264 bits (674),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 198/246 (80%), Gaps = 2/246 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            IALG+  E  + DCI+A++ E + TFLFVF GVGAAM   ++ G  + ++GL  VA+AHA
Sbjct  29   IALGSRQEVAEPDCIRAVLAEIVLTFLFVFAGVGAAMTAGKMAGGTDTIMGLTAVAVAHA  88

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVMISAGL ISG HLNPAVTLGL +GGHIT+ RS LY+I QLL S  AC LL YLTG
Sbjct  89   LVVAVMISAGLHISGGHLNPAVTLGLAVGGHITLFRSILYIIAQLLGSSLACLLLKYLTG  148

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            G+ TP H LA+G+G  QGVIMEI+LTFSLLF+VYATIVDPKKG + GLGPLL GLVVGAN
Sbjct  149  GMDTPIHALAAGMGAVQGVIMEIVLTFSLLFSVYATIVDPKKGIIAGLGPLLVGLVVGAN  208

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPI  865
            I+AGG FSGASMNPARSFGPAL S +WTDHWVYWVGPLIGG LAGFIYE  F++RTH P+
Sbjct  209  ILAGGPFSGASMNPARSFGPALASWDWTDHWVYWVGPLIGGPLAGFIYEHVFLIRTHEPL  268

Query  866  ATQEAF  883
               + F
Sbjct  269  PRDDGF  274



>ref|XP_006833429.1| hypothetical protein AMTR_s00109p00145020 [Amborella trichopoda]
 gb|ERM98707.1| hypothetical protein AMTR_s00109p00145020 [Amborella trichopoda]
Length=250

 Score =   263 bits (672),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 199/247 (81%), Gaps = 3/247 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            IALG+  EA Q DC++A++ E +CTFLFVF GVGAAMAT  L G  N++V L  VA+AHA
Sbjct  4    IALGSRQEASQPDCVRAVLAELVCTFLFVFAGVGAAMATGTLNGGSNSIVALTAVAIAHA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVMISAGL  SG HLNPAVT+GLL+GGHITV RS LY I QL+ S  AC LL YLTG
Sbjct  64   LVVAVMISAGLATSGGHLNPAVTIGLLVGGHITVFRSILYWIAQLIGSSFACVLLKYLTG  123

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            GL TP H L++GV   QG+IMEI+LTFSLLF+VYAT+VDPKKG LDGLGP+L G VVGAN
Sbjct  124  GLETPIHNLSNGVSSLQGLIMEIVLTFSLLFSVYATMVDPKKGKLDGLGPMLVGFVVGAN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPI  865
            I+AGG +SGASMNPARSFGPAL S +W++HW+YWVGPL+GG LAG +YE  FI+RTH P+
Sbjct  184  ILAGGPYSGASMNPARSFGPALASWDWSNHWIYWVGPLVGGALAGLVYENIFIIRTHEPL  243

Query  866  AT-QEAF  883
                EAF
Sbjct  244  PRDDEAF  250



>ref|XP_008801471.1| PREDICTED: probable aquaporin TIP4-3 [Phoenix dactylifera]
Length=249

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 198/246 (80%), Gaps = 2/246 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNA--LVGlffvamaha  325
            IALG+  EA + DCI+A++ E + TFLFVF GVGAAM   ++ G A  ++GL  VA+AHA
Sbjct  4    IALGSRQEAAEPDCIRAVLAEVVLTFLFVFAGVGAAMTAGKMAGGADTIMGLTAVAVAHA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVMISAGL ISG HLNPAVTLGL +GGHIT+ RS LY+I Q+L S  AC LL YLTG
Sbjct  64   LVVAVMISAGLHISGGHLNPAVTLGLAVGGHITLFRSILYIIAQMLGSSLACLLLKYLTG  123

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            G+ TP H LA+G+G  QGVIMEI+LTFSLLF+VY TIVDP+KG + GLGPLL GLVVGAN
Sbjct  124  GMDTPIHALAAGIGAVQGVIMEIVLTFSLLFSVYGTIVDPRKGIIAGLGPLLVGLVVGAN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPI  865
            I+AGG FSGASMNPARSFGPAL S +WTDHW+YWVGPLIGG LAGFIY+  FI+RTH P+
Sbjct  184  ILAGGPFSGASMNPARSFGPALASWDWTDHWIYWVGPLIGGPLAGFIYDHLFIIRTHEPL  243

Query  866  ATQEAF  883
               + F
Sbjct  244  PRDDGF  249



>ref|XP_008220070.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP4-1 [Prunus mume]
Length=246

 Score =   261 bits (666),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 176/246 (72%), Positives = 196/246 (80%), Gaps = 10/246 (4%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA   +  +AL+VEFI TFLFVF GVG+AMATD+L  +ALV LF +A+ HALV
Sbjct  4    IALGTICEAALPELWRALVVEFITTFLFVFAGVGSAMATDKLDADALVSLFAIAVTHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVI--RSFLYLIDQLLASVAACAlltyltg  505
            VAVMISAG  ISG HLNPAVTLGLL+GGHITV+  R   + I  ++     C L+  L  
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLVGGHITVLPARVPHWWIGHVI-----CHLIXLLMF  117

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
              TTP H+LASGVGY QGVI EIILTFSLLFTVYATIVDPKKG L+GLGP LTG VVGAN
Sbjct  118  WQTTPIHSLASGVGYFQGVIWEIILTFSLLFTVYATIVDPKKGALNGLGPTLTGFVVGAN  177

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR--THV  859
            I+AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAGFIYE FFI R  TH+
Sbjct  178  ILAGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGFIYENFFIFRPTTHL  237

Query  860  PIATQE  877
            PI T+E
Sbjct  238  PIPTEE  243



>ref|XP_008393878.1| PREDICTED: aquaporin TIP4-1 [Malus domestica]
Length=248

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 198/244 (81%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   E    +   AL+VEFI TFLFVF GV +AMATD+L  +ALVGLF VA+ HALV
Sbjct  4    IALGTTGEGALPEVWXALVVEFITTFLFVFAGVASAMATDKLAADALVGLFAVAVTHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT+ RS LY IDQL  + AA   L     GL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITLFRSILYWIDQL-LAAAAACYLLEYLSGL  121

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LASGVGY +GVI EI+LTFSLLFTVYATIVD K+G+L+GLGP LTG VVGANI+
Sbjct  122  TTPIHSLASGVGYLEGVIWEIVLTFSLLFTVYATIVD-KRGSLNGLGPTLTGFVVGANIL  180

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPIA  868
            AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAGFIYE FFI+ +TH+PI 
Sbjct  181  AGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGFIYENFFIIGQTHLPIP  240

Query  869  TQEA  880
            T EA
Sbjct  241  TXEA  244



>ref|XP_009346073.1| PREDICTED: aquaporin TIP4-1-like [Pyrus x bretschneideri]
Length=249

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 185/243 (76%), Positives = 205/243 (84%), Gaps = 3/243 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            I LG   EA   +  +AL+VEFI TFLFVF GVG+AM TD+L+ +ALV LF VA+AHALV
Sbjct  4    ITLGTTGEAALPEVWRALVVEFITTFLFVFAGVGSAMGTDKLEADALVALFAVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMIS G  ISG HLNPAVTLGLL GGHIT+ RS LY IDQLLA+ AAC LL YL+GGL
Sbjct  64   VAVMISGG-HISGGHLNPAVTLGLLCGGHITLFRSVLYWIDQLLAAAAACYLLEYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+LASGVGY QGVI EI+LTFSLLFTVYATIVD K+G+L GLGP LTG VVGANI+
Sbjct  123  TTPIHSLASGVGYLQGVIWEIVLTFSLLFTVYATIVD-KRGSLYGLGPTLTGFVVGANIL  181

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPIA  868
            AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAGFIYE FFI+ +TH+PI 
Sbjct  182  AGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGFIYENFFIIEQTHLPIP  241

Query  869  TQE  877
            T E
Sbjct  242  TVE  244



>ref|XP_010088608.1| Aquaporin TIP4-1 [Morus notabilis]
 gb|EXC36042.1| Aquaporin TIP4-1 [Morus notabilis]
Length=247

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCI+AL+VEFI TFLFV   V A +A ++L   A+VGL  VA+  AL 
Sbjct  4    IALGTSGEATQPDCIRALVVEFISTFLFVSASVAATVAAEKLAAGAMVGLIAVAVTQALF  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VA ++ A   ISG HLNPAVTLGLL GGHITV+RS LY IDQLLAS AAC L+ YL+GGL
Sbjct  64   VAAVVPAA-HISGGHLNPAVTLGLLAGGHITVVRSLLYWIDQLLASSAACFLVQYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
              P H+L SGVG+ QGV+ EI+LTFSLLFTVY  IVDP +G +DGLGP LTG +VGAN +
Sbjct  123  RIPVHSLGSGVGHFQGVLWEIVLTFSLLFTVYGAIVDPNRGAVDGLGPTLTGFLVGANTI  182

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG+F+GASMNPARSFGPAL+S NWT+HWVYWVGPLIGGGL G IY+  FIV++HV I+T
Sbjct  183  AGGAFTGASMNPARSFGPALISWNWTNHWVYWVGPLIGGGLCGLIYQNCFIVKSHVRIST  242

Query  872  QE  877
            +E
Sbjct  243  EE  244



>ref|XP_009367463.1| PREDICTED: aquaporin TIP4-1-like [Pyrus x bretschneideri]
Length=248

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 175/243 (72%), Positives = 197/243 (81%), Gaps = 4/243 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   E    +  +AL+VEFI TFLFVF GV +AMATD+L  +ALVGLF VA+ HALV
Sbjct  4    IALGTTGEGALPEVWRALVVEFITTFLFVFAGVASAMATDKLAAHALVGLFAVAVTHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISAG  ISG HLNPAVTLGLL GGHIT+  S LY IDQL  + AA   L     GL
Sbjct  64   VAVMISAG-HISGGHLNPAVTLGLLFGGHITLXXSILYWIDQL-LAAAAACYLLEYLSGL  121

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H+L+SGVGY +GVI EI+LTFSLLFT+YATIVD K+G+L+GLGP LTG VVGANI+
Sbjct  122  TTPIHSLSSGVGYLEGVIWEIVLTFSLLFTIYATIVD-KRGSLNGLGPTLTGFVVGANIL  180

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPIA  868
            AGG+FSGASMNPARSFGPALVS NWTDHWVYWVGPLIGGGLAGFIYE FFI+ +TH+PI 
Sbjct  181  AGGAFSGASMNPARSFGPALVSWNWTDHWVYWVGPLIGGGLAGFIYENFFIIGQTHLPIP  240

Query  869  TQE  877
            T E
Sbjct  241  TVE  243



>gb|ACN40807.1| unknown [Picea sitchensis]
Length=250

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 181/243 (74%), Gaps = 5/243 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL-QGNALV---Glffvama  319
            IA+G   EA Q+D I+A + E +CTFLFVF GVG+A+  D+L + +AL    GL  +A+ 
Sbjct  4    IAVGRVEEATQADSIRATVAELVCTFLFVFAGVGSALTVDKLSESSALTPGAGLVIIALT  63

Query  320  halvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyl  499
            H   V  M+SAG  ISG HLNPAVTLGL +GGHIT++RS LY I QLL S  AC LL ++
Sbjct  64   HTFAVYAMVSAGFHISGGHLNPAVTLGLAVGGHITLLRSILYWIAQLLGSTLACFLLEFI  123

Query  500  tgglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKK-gnldglgplltglvv  676
            TGG+  P HTLA G GY +GV+ME++LTFSLLFTVYAT+VDPK+      + PL   LVV
Sbjct  124  TGGMGIPVHTLAGGTGYIEGVVMEMVLTFSLLFTVYATVVDPKRGSMGVLMAPLCVALVV  183

Query  677  gANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            GANIMAGG FSGASMNPARSFGPA V   W DHWVYWVGPL+GGGLAG +YE FFI+RT+
Sbjct  184  GANIMAGGPFSGASMNPARSFGPAFVMWEWRDHWVYWVGPLVGGGLAGALYENFFIIRTY  243

Query  857  VPI  865
             P+
Sbjct  244  EPL  246



>ref|XP_010668288.1| PREDICTED: aquaporin TIP4-1 [Beta vulgaris subsp. vulgaris]
Length=247

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 187/244 (77%), Gaps = 0/244 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q +CI+AL+VEFICTFLFVF GVG+AMA D+     LVGL FV   HA V
Sbjct  4    IALGTSREATQPECIKALVVEFICTFLFVFAGVGSAMAADKAGATTLVGLLFVGTTHAFV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMI+AG  ISG HLNPAVTLGL MGGHIT+IRS LY I Q  AS  AC  L Y+TGGL
Sbjct  64   VAVMIAAGFNISGGHLNPAVTLGLAMGGHITLIRSLLYWIIQCFASALACLSLNYVTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTP H L  GV   QG++ME+ILTFSLLFT+Y TIVDPKKG L   G  LTGLVVGANI 
Sbjct  124  TTPIHCLPKGVDPLQGLVMEVILTFSLLFTIYTTIVDPKKGPLQTQGIFLTGLVVGANIF  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            AGG FSGASMNPARSFGPAL+S NW DHW+YWVGPLIGGGL G I + FF+ ++HVP++ 
Sbjct  184  AGGLFSGASMNPARSFGPALISWNWADHWIYWVGPLIGGGLGGLICDNFFMFKSHVPLSR  243

Query  872  QEAF  883
             E F
Sbjct  244  DEDF  247



>ref|XP_009381045.1| PREDICTED: probable aquaporin TIP4-3 [Musa acuminata subsp. malaccensis]
Length=249

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 202/243 (83%), Gaps = 1/243 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL-QGNALVGlffvamahal  328
            IALGN  EA +  CI+A++ E + TFLFVF GVGAAMA +++  G++++GL  VA+AHAL
Sbjct  4    IALGNHHEAAEPGCIRAVLAEVVLTFLFVFAGVGAAMAAEKMVGGDSIMGLTAVAVAHAL  63

Query  329  vvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgg  508
            VVAVMISAGL ISG HLNPAVTLGL +GGH+TV+RS LY++ QLL S  AC LL YLTGG
Sbjct  64   VVAVMISAGLHISGGHLNPAVTLGLAVGGHVTVVRSLLYVVAQLLGSTLACLLLKYLTGG  123

Query  509  lttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANI  688
            L TP HTLA+G+G  QGVIMEI+LTFSLLF+VYAT+VDPKKG + GLGPLL GLVVGANI
Sbjct  124  LDTPVHTLAAGMGAVQGVIMEIVLTFSLLFSVYATMVDPKKGIIAGLGPLLVGLVVGANI  183

Query  689  MAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIA  868
            +AGG FSGASMNPARSFGPAL + NWTDHW+YWVGPL GGGLAG +YE  F+V THVP+ 
Sbjct  184  LAGGPFSGASMNPARSFGPALAAWNWTDHWIYWVGPLAGGGLAGLVYEHLFMVSTHVPLP  243

Query  869  TQE  877
             ++
Sbjct  244  RED  246



>ref|XP_008801470.1| PREDICTED: probable aquaporin TIP4-3 [Phoenix dactylifera]
Length=254

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 191/246 (78%), Gaps = 2/246 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            IA+G+  EA Q DC++A++ E I TFLFVF GVGAAMA +++ G  +A+VGL  VA+AHA
Sbjct  4    IAVGSREEATQPDCVRAVVAETILTFLFVFVGVGAAMAAEKMAGGKDAIVGLMAVAVAHA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            L+VAVM +AGL ISG HLNPAVT+G+ +GG IT++RS LY+  QLL S  AC LL  +TG
Sbjct  64   LMVAVMTAAGLHISGGHLNPAVTVGMAVGGRITLVRSILYITAQLLGSSMACLLLKRITG  123

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            G+ TP H+LA+G+   QGVIMEI+LTFS LF+VYATIVDP+KG + GLGPL  GLVVGAN
Sbjct  124  GMDTPIHSLAAGMVAIQGVIMEIVLTFSFLFSVYATIVDPRKGIIAGLGPLFVGLVVGAN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPI  865
            I+A G F+GASMNPARSFGPAL S NWT+HWVYWVGPL G  LA F+YE  F+ RT  P+
Sbjct  184  ILACGPFTGASMNPARSFGPALASHNWTNHWVYWVGPLFGSLLASFVYEHLFMARTDEPL  243

Query  866  ATQEAF  883
               + +
Sbjct  244  YRDQEY  249



>ref|XP_010254460.1| PREDICTED: aquaporin TIP4-1-like [Nelumbo nucifera]
Length=252

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 184/230 (80%), Gaps = 0/230 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G   EA  + C+++L+ EFIC+FLFVFTGVGAAM  D++ G+ L+GL  VA+AHALV
Sbjct  4    IAFGTTREATDTGCLKSLVAEFICSFLFVFTGVGAAMTADRMVGSPLLGLLVVAVAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
             AVMISAGL  S  +L+PAVTLGL++ GHITV RS LY I QLLAS  AC LL YLTGGL
Sbjct  64   TAVMISAGLSNSAGNLSPAVTLGLVVSGHITVFRSILYWIVQLLASSLACILLKYLTGGL  123

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
              P  TL SGV   QGVIME+++TFSLLF VYATI+DPKKG+LDGLGPLL GLVVGANI+
Sbjct  124  DIPVQTLGSGVSPVQGVIMEMVITFSLLFVVYATILDPKKGSLDGLGPLLIGLVVGANIL  183

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFF  841
            A   FSGASMNPARSFGP LV+GNWT HWVYWVGPL+G  LAGF+Y+ FF
Sbjct  184  AAAPFSGASMNPARSFGPVLVTGNWTHHWVYWVGPLLGAVLAGFLYDNFF  233



>gb|ACJ84885.1| unknown [Medicago truncatula]
Length=227

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 175/202 (87%), Gaps = 1/202 (0%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IALG   EA Q DCIQALIVEFI TFLFVF GVG+AM  D+L G+ALVGLFFVA+AHALV
Sbjct  4    IALGTTREATQPDCIQALIVEFIATFLFVFAGVGSAMTADKLSGDALVGLFFVAIAHALV  63

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAVMISA   ISG HLNPAVTLGLL+GGHIT++RS LY IDQL+AS AAC LL YL+GGL
Sbjct  64   VAVMISAA-HISGGHLNPAVTLGLLVGGHITIVRSILYWIDQLIASAAACYLLHYLSGGL  122

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
            TTPAHTLASGVGY QGV+ EI+LTFSLLFTVYAT+VDPKKG L GLGP L G VVGANI+
Sbjct  123  TTPAHTLASGVGYTQGVVWEIVLTFSLLFTVYATMVDPKKGALAGLGPTLVGFVVGANIL  182

Query  692  AGGSFSGASMNPARSFGPALVS  757
            AGG+FS ASMNPARSFGPALVS
Sbjct  183  AGGAFSAASMNPARSFGPALVS  204



>ref|XP_004967395.1| PREDICTED: aquaporin TIP4-4-like [Setaria italica]
Length=250

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 188/244 (77%), Gaps = 4/244 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNA--LVGlffvamahal  328
            ALG+  EA  + C++A++ E I TFLFVF GVG+AMAT +L G A  + GL  VA+AH L
Sbjct  5    ALGHHREAADAGCVRAVLAELILTFLFVFAGVGSAMATGKLGGGADSVAGLTAVALAHTL  64

Query  329  vvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgg  508
            VVAVMISAGL +SG H+NPAVTLGL + G IT+ RS LY++ QLL SVAAC LL +L GG
Sbjct  65   VVAVMISAGLHVSGGHINPAVTLGLAVTGRITLFRSALYVVAQLLGSVAACLLLAFLAGG  124

Query  509  lttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANI  688
              TP H LA+GVG  QGV+ME++LTFSLLF VYAT+VDP++  + G+GPLL GLVVGAN+
Sbjct  125  AATPVHALAAGVGTLQGVLMEVVLTFSLLFAVYATVVDPRR-TVGGMGPLLVGLVVGANV  183

Query  689  MAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THVPI  865
            +AGG FSGASMNPARSFGPAL +G W DHWVYWVGPLIGG LAG +Y+  F+ +  H P+
Sbjct  184  LAGGPFSGASMNPARSFGPALAAGVWADHWVYWVGPLIGGPLAGLVYDGLFMAQGGHEPL  243

Query  866  ATQE  877
               E
Sbjct  244  PRDE  247



>ref|XP_010917694.1| PREDICTED: aquaporin TIP4-4-like isoform X2 [Elaeis guineensis]
Length=241

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 181/233 (78%), Gaps = 2/233 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            IA+G+  E  + DCI+A++ E I TFLFVF  VGAAM  +++ G  +A+VGL  VA+ +A
Sbjct  4    IAVGSREEVREPDCIRAVLAETILTFLFVFICVGAAMTAEKMTGGKDAIVGLMAVAVTNA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVMI+AGL ISG HLNPAVT G+ +GG IT+ RS LY+  QLL S  AC LL Y+TG
Sbjct  64   LVVAVMIAAGLHISGGHLNPAVTAGMALGGRITLFRSILYVAAQLLGSSVACFLLKYITG  123

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            G+ TP H+L +G+   QGVIME +LTF+LLF+VYATI+DP+KG + GLGPL  GLVVGAN
Sbjct  124  GMDTPVHSLGAGMVAVQGVIMETVLTFALLFSVYATILDPRKGIVAGLGPLFVGLVVGAN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI  844
            I+A G F+GASMNPARSFGPAL S NWT+HWVYWVGP+IG  LA F+YE  F+
Sbjct  184  ILACGPFTGASMNPARSFGPALASQNWTNHWVYWVGPMIGSLLATFVYEHLFM  236



>emb|CDM81281.1| unnamed protein product [Triticum aestivum]
Length=251

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 172/235 (73%), Gaps = 4/235 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNA--LVGlffvamahal  328
            ALG+ SE  ++ C++A++ E + TFLFVF+GVG+ MA  +L G A  ++GL  VA+AHA+
Sbjct  5    ALGHHSEVTEAGCVRAVLAEAVLTFLFVFSGVGSVMAAGRLAGGADTIMGLTAVALAHAM  64

Query  329  vvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAllt-yltg  505
             VAVM+SAGL +SG H+NPAVTL L  GGHIT+ RS LY++ QLL S  AC LL     G
Sbjct  65   AVAVMVSAGLHVSGGHINPAVTLSLAAGGHITLFRSALYVLAQLLGSSLACLLLAFLTGG  124

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
             +T P H LA+GVG  QGV+ E +LTFSLLFTVYAT+VDP++   +    L+  +V  AN
Sbjct  125  AVTMPVHALAAGVGAPQGVLWEAVLTFSLLFTVYATVVDPRRSVGNLGPLLVGLVVG-AN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR  850
            ++AGG FSGASMNPARSFGPAL S NW   WVYWVGP++GG LAG +YE  F+VR
Sbjct  184  VLAGGPFSGASMNPARSFGPALASANWASQWVYWVGPMVGGLLAGLVYEGLFMVR  238



>ref|XP_010917689.1| PREDICTED: aquaporin TIP4-4-like isoform X1 [Elaeis guineensis]
Length=257

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 181/233 (78%), Gaps = 2/233 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            IA+G+  E  + DCI+A++ E I TFLFVF  VGAAM  +++ G  +A+VGL  VA+ +A
Sbjct  4    IAVGSREEVREPDCIRAVLAETILTFLFVFICVGAAMTAEKMTGGKDAIVGLMAVAVTNA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVMI+AGL ISG HLNPAVT G+ +GG IT+ RS LY+  QLL S  AC LL Y+TG
Sbjct  64   LVVAVMIAAGLHISGGHLNPAVTAGMALGGRITLFRSILYVAAQLLGSSVACFLLKYITG  123

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            G+ TP H+L +G+   QGVIME +LTF+LLF+VYATI+DP+KG + GLGPL  GLVVGAN
Sbjct  124  GMDTPVHSLGAGMVAVQGVIMETVLTFALLFSVYATILDPRKGIVAGLGPLFVGLVVGAN  183

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI  844
            I+A G F+GASMNPARSFGPAL S NWT+HWVYWVGP+IG  LA F+YE  F+
Sbjct  184  ILACGPFTGASMNPARSFGPALASQNWTNHWVYWVGPMIGSLLATFVYEHLFM  236



>gb|ACG39579.1| aquaporin TIP4.1 [Zea mays]
Length=252

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 175/246 (71%), Gaps = 6/246 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamaha  325
            ALG+  EA  + C++A++ EFI TFLFVF GVG+AMAT +L G   + +VGL  VA+AH 
Sbjct  5    ALGHHREASDAGCVRAVLAEFILTFLFVFAGVGSAMATGKLAGGGGDTVVGLTAVALAHT  64

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVM+SAGL +SG H+NPAVTLGL   G IT+ RS LY+  QLL S  AC LL +L  
Sbjct  65   LVVAVMVSAGLHVSGGHINPAVTLGLAATGRITLFRSALYVAAQLLGSTLACLLLAFLAV  124

Query  506  glt-tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
              +  P H L +GVG  +GV+ME +LTFSLLF VYAT+VDP++        L+  +V  A
Sbjct  125  AGSGVPVHALGAGVGALRGVLMEAVLTFSLLFAVYATVVDPRRAVGGMGPLLVGLVVG-A  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            N++AGG FSGASMNPARSFGPALV+G W DHWVYWVGPLIGG LAG +Y+  F+ +  H 
Sbjct  184  NVLAGGPFSGASMNPARSFGPALVAGVWADHWVYWVGPLIGGPLAGLVYDGLFMAQGGHE  243

Query  860  PIATQE  877
            P+   +
Sbjct  244  PLPRDD  249



>ref|NP_001105641.1| aquaporin TIP4-4 [Zea mays]
 sp|Q9ATL3.1|TIP44_MAIZE RecName: Full=Aquaporin TIP4-4; AltName: Full=Tonoplast intrinsic 
protein 4-4; AltName: Full=ZmTIP4-4; AltName: Full=ZmTIP4;4 
[Zea mays]
 gb|AAK26775.1| tonoplast membrane integral protein ZmTIP4-4 [Zea mays]
Length=252

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 174/246 (71%), Gaps = 6/246 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamaha  325
            ALG+  EA  + C++A++ E I TFLFVF GVG+AMAT +L G   + +VGL  VA+AH 
Sbjct  5    ALGHHREASDAGCVRAVLAELILTFLFVFAGVGSAMATGKLAGGGGDTVVGLTAVALAHT  64

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVM+SAGL +SG H+NPAVTLGL   G IT+ RS LY+  QLL S  AC LL +L  
Sbjct  65   LVVAVMVSAGLHVSGGHINPAVTLGLAATGRITLFRSALYVAAQLLGSTLACLLLAFLAV  124

Query  506  glt-tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
              +  P H L +GVG  +GV+ME +LTFSLLF VYAT+VDP++        L+  +V  A
Sbjct  125  ADSGVPVHALGAGVGALRGVLMEAVLTFSLLFAVYATVVDPRRAVGGMGPLLVGLVVG-A  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            N++AGG FSGASMNPARSFGPALV+G W DHWVYWVGPLIGG LAG +Y+  F+ +  H 
Sbjct  184  NVLAGGPFSGASMNPARSFGPALVAGVWADHWVYWVGPLIGGPLAGLVYDGLFMAQGGHE  243

Query  860  PIATQE  877
            P+   +
Sbjct  244  PLPRDD  249



>gb|ACF84391.1| unknown [Zea mays]
Length=252

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 174/246 (71%), Gaps = 6/246 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamaha  325
            ALG+  EA  + C++A++ E I TFLFVF GVG+AMAT +L G   + +VGL  VA+AH 
Sbjct  5    ALGHYREASDAGCVRAVLAELILTFLFVFAGVGSAMATGKLAGGGGDTVVGLTAVALAHT  64

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVM+SAGL +SG H+NPAVTLGL   G IT+ RS LY+  QLL S  AC LL +L  
Sbjct  65   LVVAVMVSAGLHVSGGHINPAVTLGLAATGRITLFRSALYVAAQLLGSTLACLLLAFLAV  124

Query  506  glt-tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
              +  P H L +GVG  +GV+ME +LTFSLLF VYAT+VDP++        L+  +V  A
Sbjct  125  ADSGVPVHALGAGVGALRGVLMEAVLTFSLLFAVYATVVDPRRAVGGMGPLLVGLVVG-A  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            N++AGG FSGASMNPARSFGPALV+G W DHWVYWVGPLIGG LAG +Y+  F+ +  H 
Sbjct  184  NVLAGGPFSGASMNPARSFGPALVAGVWADHWVYWVGPLIGGPLAGLVYDGLFMAQGGHE  243

Query  860  PIATQE  877
            P+   +
Sbjct  244  PLPRDD  249



>ref|XP_004249473.1| PREDICTED: aquaporin TIP1-1 [Solanum lycopersicum]
Length=248

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ +A  +L G   N   GL   A+AH
Sbjct  6    IAIGRREEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG+   A +L++GVG G  +++EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGMEIGAFSLSNGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+F GASMNPA SFGPALVS  W++HWVYWVGPLIGGGLAG IYE FFI +TH P
Sbjct  186  NILVGGAFDGASMNPAVSFGPALVSWAWSNHWVYWVGPLIGGGLAGLIYEFFFINQTHEP  245

Query  863  I  865
            +
Sbjct  246  L  246



>ref|XP_003566010.1| PREDICTED: probable aquaporin TIP4-3 [Brachypodium distachyon]
Length=254

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 172/250 (69%), Gaps = 8/250 (3%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNA--LVGlffvamaha  325
            +ALG+  EA +  C +A++ E + TFLFVF+GV +AMA  +L G A  ++GL  VA AHA
Sbjct  4    LALGHLREAAEPGCARAVLAEAVLTFLFVFSGVASAMAAGKLGGGADTIMGLTAVASAHA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAllt----  493
            + VAVM+SAGL +SG H+NPAVTLGL  GGHIT+ RS LY+  QLL S  AC LL+    
Sbjct  64   MAVAVMVSAGLHVSGGHINPAVTLGLAAGGHITLFRSALYVPAQLLGSSLACLLLSFLSG  123

Query  494  yltgglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglv  673
               G    P H LA+GVG  QG++ E  LTFSLLF VYAT+VDP +   +    L+  +V
Sbjct  124  SGAGAPPIPVHALAAGVGAAQGLLWEATLTFSLLFAVYATVVDPARTVGNLGPLLVGLVV  183

Query  674  vgANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT  853
              AN +AGG FSGASMNPARSFGPALV+G W  HWVYWVGP+IGG LAG +Y+  F+VR 
Sbjct  184  G-ANALAGGPFSGASMNPARSFGPALVTGEWAGHWVYWVGPMIGGLLAGLVYDGVFMVRP  242

Query  854  -HVPIATQEA  880
             H  + T +A
Sbjct  243  GHQQLPTDDA  252



>ref|NP_001054979.1| Os05g0231700 [Oryza sativa Japonica Group]
 sp|Q75GA5.1|TIP41_ORYSJ RecName: Full=Probable aquaporin TIP4-1; AltName: Full=Tonoplast 
intrinsic protein 4-1; Short=OsTIP4;1 [Oryza sativa Japonica 
Group]
 gb|AAS98488.1| putative tonoplast membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF16893.1| Os05g0231700 [Oryza sativa Japonica Group]
 gb|EAY97140.1| hypothetical protein OsI_19062 [Oryza sativa Indica Group]
 dbj|BAG93018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62899.1| hypothetical protein OsJ_17704 [Oryza sativa Japonica Group]
Length=251

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 178/236 (75%), Gaps = 6/236 (3%)
 Frame = +2

Query  173  EALQSDCIQALIVEFICTFLFVFTGVGAAMA--TDQLQGNAL--VGlffvamahalvvav  340
            E + + C++A++ E + TF+FVFTGV A MA    ++ G A+    L  VA+A AL   V
Sbjct  12   EVVDAGCVRAVLAELVLTFVFVFTGVAATMAAGVPEVAGAAMPMAALAGVAIATALAAGV  71

Query  341  mISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgglttP  520
            +++AG  +SG HLNPAVT+ LL  GHIT  RS LY+  QLLAS  AC LL YLTGG+ TP
Sbjct  72   LVTAGFHVSGGHLNPAVTVALLARGHITAFRSALYVAAQLLASSLACILLRYLTGGMATP  131

Query  521  AHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIMAGG  700
             HTL SG+G  QG++MEIILTFSLLF VYATI+DP+  ++ G GPLLTGL+VGAN +AGG
Sbjct  132  VHTLGSGIGPMQGLVMEIILTFSLLFVVYATILDPRS-SVPGFGPLLTGLIVGANTIAGG  190

Query  701  SFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            +FSGASMNPARSFGPAL +G WT HW+YW+GPLIGG LAG +YE+ F+V RTH P+
Sbjct  191  NFSGASMNPARSFGPALATGVWTHHWIYWLGPLIGGPLAGLVYESLFLVKRTHEPL  246



>gb|EMT16436.1| Aquaporin TIP4-4 [Aegilops tauschii]
Length=246

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 164/235 (70%), Gaps = 7/235 (3%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNA--LVGlffvamahal  328
            ALG+ SEA ++ C++A++ E + TFLFVF+GVG+ MA  +L G    ++GL   A  H  
Sbjct  5    ALGHHSEATEAGCVRAVLAEAVLTFLFVFSGVGSVMAAGRLAGGGGQVIGLTGGAGGHRA  64

Query  329  vvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgg  508
             VAVM+SAGL +SG H+NPAVTL L  GGHIT+ RS LY++ QLL S  AC       G 
Sbjct  65   GVAVMVSAGLHVSGGHINPAVTLSLAAGGHITLFRSALYVLAQLLGSSLAC----LTGGA  120

Query  509  lttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANI  688
             T P H LA+GVG  QGV+   +LTFSLLFTVYAT+VDP++   +    L+  +V  AN+
Sbjct  121  GTMPVHALAAGVGAPQGVLWGAVLTFSLLFTVYATVVDPRRSVGNLGPLLVALVVG-ANV  179

Query  689  MAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT  853
            +AGG FSGASMNPARSFGPAL SGNW   WVYWVGP+IGG LAG  YE  F+VR+
Sbjct  180  LAGGPFSGASMNPARSFGPALASGNWASQWVYWVGPMIGGSLAGLAYEGLFMVRS  234



>tpg|DAA52750.1| TPA: aquaporin TIP4-4 [Zea mays]
Length=287

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 174/246 (71%), Gaps = 6/246 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamaha  325
            ALG+  EA  + C++A++ E I TFLFVF GVG+AMAT +L G   + +VGL  VA+AH 
Sbjct  40   ALGHHREASDAGCVRAVLAELILTFLFVFAGVGSAMATGKLAGGGGDTVVGLTAVALAHT  99

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVM+SAGL +SG H+NPAVTLGL   G IT+ RS LY+  QLL S  AC LL +L  
Sbjct  100  LVVAVMVSAGLHVSGGHINPAVTLGLAATGRITLFRSALYVAAQLLGSTLACLLLAFLAV  159

Query  506  glt-tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
              +  P H L +GVG  +GV+ME +LTFSLLF VYAT+VDP++        L+  +V  A
Sbjct  160  ADSGVPVHALGAGVGALRGVLMEAVLTFSLLFAVYATVVDPRRAVGGMGPLLVGLVVG-A  218

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            N++AGG FSGASMNPARSFGPALV+G W DHWVYWVGPLIGG LAG +Y+  F+ +  H 
Sbjct  219  NVLAGGPFSGASMNPARSFGPALVAGVWADHWVYWVGPLIGGPLAGLVYDGLFMAQGGHE  278

Query  860  PIATQE  877
            P+   +
Sbjct  279  PLPRDD  284



>ref|XP_006339093.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=248

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 169/241 (70%), Gaps = 3/241 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ +A  +L G   N   GL   A+AH
Sbjct  6    IAIGRTEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG+   A +L+ GVG G  +++EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGMEIGAFSLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+F GASMNPA SFGPA+VS  W +HWVYWVGPLIGGGLAG IYE FFI +TH P
Sbjct  186  NILVGGAFDGASMNPAVSFGPAVVSWTWNNHWVYWVGPLIGGGLAGLIYEFFFINQTHEP  245

Query  863  I  865
            +
Sbjct  246  L  246



>gb|ACU19274.1| unknown [Glycine max]
Length=247

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 172/244 (70%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+ ++++    I+A I EFI T LFVF GVG+AMA  +L  +A +   GL  VA+ H
Sbjct  4    IAFGSFNDSVSFASIKAYIAEFISTLLFVFAGVGSAMAYAKLASDAALDPTGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++  F Y I QLL S+ A +LL    
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGFFYWIAQLLGSIVA-SLLLKFV  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G  TP H++A+G+G G+GV+ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  TGYDTPIHSVAAGIGAGEGVVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G F G SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAGFIY   FI   H P
Sbjct  183  NILAAGPFFGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGFIYTYAFIPTNHAP  242

Query  863  IATQ  874
            +AT+
Sbjct  243  LATE  246



>gb|AGQ46837.1| aquaporin-like protein [Chimonanthus praecox]
Length=248

 Score =   214 bits (545),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSSAALDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHITV+    Y I QL+ ++ AC LL  +T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITVLTGIFYWIAQLVGAIVACFLLKAVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            G +  P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GNMAIPTHNVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++TD+W+YWVGPLIGGGLAG IY   FI   HVP
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFTDNWIYWVGPLIGGGLAGLIYGNVFISSEHVP  243

Query  863  IATQ  874
            ++  
Sbjct  244  VSND  247



>ref|XP_008365156.1| PREDICTED: aquaporin TIP4-1-like [Malus domestica]
Length=237

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 172/205 (84%), Gaps = 3/205 (1%)
 Frame = +2

Query  266  TDQLQGNALVGlffvamahalvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLY  445
            +D+L+G+ LV LF VA+ HALVVAVMIS G  ISG HLNPAVTLGLL GGHIT+ RS LY
Sbjct  30   SDKLEGDTLVALFAVAVTHALVVAVMISGG-HISGGHLNPAVTLGLLCGGHITLFRSVLY  88

Query  446  LIDQLLASVAACAlltyltgglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDP  625
             IDQLLA+ AAC LL YL+GGL TP H+LASGVGY QGVI EI+LTF L FTVYATIVD 
Sbjct  89   WIDQLLAAAAACYLLEYLSGGLXTPIHSLASGVGYLQGVIWEIVLTFXLXFTVYATIVD-  147

Query  626  KKgnldglgplltglvvgANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIG  805
            K G+L GLGP LT  VVGANI+AGG+FSGASMNPARSFGPALV  NWTDHWVYWVGPLIG
Sbjct  148  KSGSLYGLGPTLTXFVVGANILAGGAFSGASMNPARSFGPALVXWNWTDHWVYWVGPLIG  207

Query  806  GGLAGFIYETFFIV-RTHVPIATQE  877
            GGLAGFIYE FFI+ +TH+PI T E
Sbjct  208  GGLAGFIYENFFIIEQTHLPIPTVE  232



>ref|XP_009141610.1| PREDICTED: aquaporin TIP1-1 [Brassica rapa]
Length=251

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 172/245 (70%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+ +EA + D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGSPNEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG    ++ EI++TF L++TVYAT VDPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS +W +HWVYW GPL+GGGLAG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_010521513.1| PREDICTED: aquaporin TIP2-1-like [Tarenaya hassleriana]
Length=248

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 176/244 (72%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A +++ GNA +   GL  +A+ H
Sbjct  4    IAFGRLDDSFSLASLKAYLAEFISTLLFVFAGVGSAIAFNKVTGNAALDPAGLVAIALCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V ++ G  ISG H+NPAVT GL +GG IT++ S  Y I QLL SVAAC LL  +T
Sbjct  64   GLALFVAVAVGANISGGHVNPAVTFGLALGGQITILTSIFYWIAQLLGSVAACFLLKAVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL+TP H++A GVG   GV+MEII+TF+L++TVYAT  DPK+G+L  + P+  GL+VGA
Sbjct  124  GGLSTPTHSVAEGVGALGGVVMEIIVTFALVYTVYATAADPKRGSLGTIAPIAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG+++ HWVYWVGPLIGGGLAG +Y + F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFSGHWVYWVGPLIGGGLAGLVYSSVFMSSEHAP  243

Query  863  IATQ  874
            +++ 
Sbjct  244  LSSD  247



>gb|ACP28878.1| tonoplast intrinsic protein [Gossypium hirsutum]
 tpg|DAA33866.1| TPA_inf: aquaporin TIP1;3 [Gossypium hirsutum]
 gb|KHG01699.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            G L  PA  L+SGVG    ++ EI++TF L++TVYAT VDPKKG+L  + PL  G +VGA
Sbjct  126  GDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPLAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS  W +HW+YWVGPLIGGGLAG IYE  FI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEFIFISNTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>gb|AGD98715.1| aquaporin protein 12 [Camellia sinensis]
Length=248

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 173/244 (71%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   ++     I++ + EFI T LFVF GVG+A+A D++  +A +   GL  VA+ H
Sbjct  4    IAIGRFDDSFSMGSIKSYVAEFISTLLFVFAGVGSAIAYDKVTSDAALDPSGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG ITV+    Y I QL+ S+ AC LL ++T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITVLTGJFYWIAQLVGSIVACYLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  QGV+ME+I+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAIPTHSVAAGVGAVQGVVMEMIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYPNVFMQHQHAP  243

Query  863  IATQ  874
            +++ 
Sbjct  244  LSSD  247



>gb|ACI95283.1| tonoplast intrinsic protein [Sinapis arvensis]
Length=251

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 171/245 (70%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGRPEEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG    ++ EI++TF L++TVYAT VDPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS +W++HWVYW GPL+GGGLAG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWSWSNHWVYWAGPLVGGGLAGLIYEIFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_003568717.1| PREDICTED: probable aquaporin TIP4-1 [Brachypodium distachyon]
Length=252

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 177/239 (74%), Gaps = 6/239 (3%)
 Frame = +2

Query  164  NGSEALQSDCIQALIVEFICTFLFVFTGVGAAMA--TDQLQGNAL--VGlffvamahalv  331
            +  + + + C++A++ E + TFLFVFTGV A MA    ++ G A+    L  VA+A AL 
Sbjct  10   DERDVVDAGCVRAVLGELVLTFLFVFTGVAAVMAAGVPEVPGAAMPMATLAGVALAQALA  69

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
              V+++AG  +SG HLNPAVTL LL  GHI+  R+ LY+  QLLAS  AC LL YLTGG 
Sbjct  70   AGVLVTAGFHVSGGHLNPAVTLALLARGHISAFRAVLYVAAQLLASSLACILLRYLTGGQ  129

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP H L +G+G  QG++MEII TFSLLF VYATI+DP+   + G GP+LTGL+VGAN +
Sbjct  130  ATPVHALGAGIGPMQGLVMEIIFTFSLLFVVYATILDPRT-TVPGYGPMLTGLIVGANTL  188

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            AGG+FSGASMNPARSFGPAL +G WT+HWVYWVGPL+GG LAGF+YE+ F+V RTH P+
Sbjct  189  AGGNFSGASMNPARSFGPALATGVWTNHWVYWVGPLVGGPLAGFVYESLFLVKRTHEPL  247



>ref|XP_006584589.1| PREDICTED: uncharacterized protein LOC100803901 isoform X1 [Glycine 
max]
 gb|KHN05348.1| Aquaporin TIP2-1 [Glycine soja]
Length=248

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EF  T LFVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSLTSIKAYIAEFHSTLLFVFAGVGSAIAYGKLTSDAALDPAGLLAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++  F Y I QLL S+ AC LL Y+T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGFFYWIAQLLGSIVACFLLNYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H++ASGVG  +GV+ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLPTPIHSVASGVGAVEGVVTEIIITFGLVYTVYATAADPKKGSLGIIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYGNVFIRSDHAP  243

Query  863  IATQ  874
            ++++
Sbjct  244  LSSE  247



>ref|XP_006582836.1| PREDICTED: uncharacterized protein LOC100306092 isoform X1 [Glycine 
max]
 gb|KHN04227.1| Aquaporin TIP2-1 [Glycine soja]
Length=248

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EF  T LFVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGRLDDSFSLTSIKAYIAEFHSTLLFVFAGVGSAIAYGKLTSDAALDPAGLLAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++  F Y I QLL S+ AC LL Y+T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGFFYWIAQLLGSIVACFLLNYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H++ASGVG  +GV+ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLPTPIHSVASGVGAVEGVVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYGNVFIRSDHAP  243

Query  863  IATQ  874
            ++++
Sbjct  244  LSSE  247



>gb|AAB51393.2| tonoplast intrinsic protein bobTIP26-1 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 170/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGRPDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG    ++ EI++TF L++TVYAT VDPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS +W +HWVYW GPL+GGGLAG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLVGGGLAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTAD  250



>gb|KFK36559.1| hypothetical protein AALP_AA4G139100 [Arabis alpina]
Length=251

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 169/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPDEATRPDALRAALAEFISTMIFVFAGSGSGMAFNKLTDNGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL   T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLLLKVAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT VDPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAVDPKAGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS +WT+HWVYW GPL+GGGLAG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWDWTNHWVYWAGPLVGGGLAGLIYELFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_009793775.1| PREDICTED: aquaporin TIP2-1-like [Nicotiana sylvestris]
Length=248

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSLGSIKAYIAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVTLGL +GG ITV+    Y I QL+ + AA  LL  +T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTLGLALGGQITVLTGLFYWIAQLMGATAASYLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHSVAAGVGAAEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+  HW+YW+GPL+GGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGNFAGHWIYWIGPLVGGGLAGLIYSNVFMNHDHAP  243

Query  863  IATQ  874
            ++T 
Sbjct  244  LSTD  247



>gb|AAN05780.1| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 170/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRTDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG    ++ EI++TF L++TVYAT VDPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS +W +HWVYW GPLIGGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_002457071.1| hypothetical protein SORBIDRAFT_03g000790 [Sorghum bicolor]
 gb|EES02191.1| hypothetical protein SORBIDRAFT_03g000790 [Sorghum bicolor]
Length=252

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 175/249 (70%), Gaps = 7/249 (3%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamaha  325
            ALG+  E   + C++A++ E I TFLFVF GVG+AMAT +L G   + +VGL  VA+AH 
Sbjct  5    ALGHHREVSDAGCVRAVLAELILTFLFVFAGVGSAMATGKLAGGGGDTVVGLTAVALAHT  64

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
            LVVAVM+SAGL +SG H+NPAVTLGL   G IT+ RS LY+  QLL S  AC LL +LT 
Sbjct  65   LVVAVMVSAGLHVSGGHINPAVTLGLAATGRITLFRSALYVAAQLLGSALACLLLAFLTA  124

Query  506  glt--tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvg  679
            G     P H L  GVG  +GV+ME++LTFSLLF VYAT+VDP++        L+  +V  
Sbjct  125  GGGGGVPVHALGDGVGALRGVLMEVVLTFSLLFAVYATVVDPRRAVGSMGPLLVGLVVG-  183

Query  680  ANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-H  856
            AN++AGG FSGASMNPARSFGPALV+G W DHWVYWVGPLIGG LAG +Y+  F+ +  H
Sbjct  184  ANVLAGGPFSGASMNPARSFGPALVAGVWADHWVYWVGPLIGGLLAGLVYDGLFMAQAGH  243

Query  857  VPIATQEAF  883
             P+   + F
Sbjct  244  EPLPRDDHF  252



>gb|KDP37268.1| hypothetical protein JCGZ_06324 [Jatropha curcas]
Length=248

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A ++L GNA +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAYNKLTGNAALDPAGLVAIAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVACLLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H+LA+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLETPTHSLAAGVGAIEGVVMEIIVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   +I   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNLYINNDHAP  243

Query  863  IATQ  874
            ++  
Sbjct  244  LSND  247



>ref|XP_009799741.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
 ref|XP_009765894.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
Length=248

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 168/241 (70%), Gaps = 3/241 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ +A  +L G   N   GL   A+AH
Sbjct  6    IAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACFLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL      L+ GVG G  +++EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLEIGTFGLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPA+VS +W +HWVYW GPLIGGGLAG IYE FFI +TH P
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWSWNNHWVYWAGPLIGGGLAGLIYEFFFINQTHEP  245

Query  863  I  865
            +
Sbjct  246  L  246



>ref|XP_007027468.1| Aquaporin TIP1,6 [Theobroma cacao]
 gb|EOY07970.1| Aquaporin TIP1,6 [Theobroma cacao]
Length=251

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 164/238 (69%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNAL---VGlffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G++MA ++L  N      GL   ++A+
Sbjct  6    IAVGRPEEAAHPDALKAALAEFISTLIFVFAGSGSSMAYNKLTDNGASTPAGLVAASLAY  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL+ PA  L+SGVG     + EI++TF L++TVYAT VDPKKG++  + PL  GL+VGA
Sbjct  126  NGLSIPAFGLSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGSVGVIAPLAIGLIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+F GASMNPA SFGPALVS  W +HWVYW GPLIGGG+AG +YE FFI  TH
Sbjct  186  NILAGGAFEGASMNPAVSFGPALVSWTWKNHWVYWAGPLIGGGIAGLVYEFFFISHTH  243



>tpg|DAA33870.1| TPA_inf: aquaporin TIP1;8 [Gossypium hirsutum]
Length=251

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 163/245 (67%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            I +G   EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IPVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            G L  PA  L+SGVG    ++ EI++TF L++TVYAT VDPKKG+L  + PL  G + GA
Sbjct  126  GDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPLAIGFIEGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS  W +HW+YWVGPLIGGGLAG IYE  FI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWDNHWIYWVGPLIGGGLAGLIYEFIFISNTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>gb|EPS60922.1| hypothetical protein M569_13880, partial [Genlisea aurea]
Length=247

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A+GN  E      ++A + EFI TF+FVF G G+ +A +++ G A     GL   A+ H
Sbjct  6    VAIGNAHEIQHPGALKAALAEFISTFVFVFAGSGSGVAYNKITGGAPASPAGLIAAAIGH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT GL +GG+IT+ R  LY++ QLL SVA  A+L++ T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGLFVGGNITLFRGLLYVVAQLLGSVAGAAVLSFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA T+++GV     +I+EI+LTF L++TVYAT VDPKKG +  L PL  G +VGA
Sbjct  126  GGLEIPAFTVSAGVSVWSALILEIVLTFGLVYTVYATAVDPKKGEIGILAPLAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+FSGASMNPA +FGP++VSG WTDHW+YW+GPL+GG +AG +YE FFI  TH P
Sbjct  186  NILVGGAFSGASMNPAVAFGPSVVSGVWTDHWIYWLGPLLGGAVAGVVYEVFFISHTHEP  245

Query  863  I  865
            +
Sbjct  246  L  246



>gb|AAD31848.1|AF133532_1 water channel protein MipK [Mesembryanthemum crystallinum]
Length=248

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 171/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G   ++     I+A I EFI T LFVF GVG+ +A ++L  +A +   GL  VA+ H
Sbjct  4    LAFGRFDDSFSWASIKAYIAEFISTLLFVFAGVGSCIAFNKLTADAALSPSGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT GL +GG IT++   LY I QL  SVA C LL   T
Sbjct  64   AFALFVAVSVGANISGGHVNPAVTFGLAVGGQITILTGVLYWIAQLAGSVAGCFLLKAAT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTTP H++ASGVG  + V+MEII+TF+L++TVYAT VDPK+G++  + P+  G +VGA
Sbjct  124  GGLTTPIHSVASGVGAIEAVVMEIIITFALVYTVYATAVDPKRGSVGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPAL SG++ DHWVYWVGPLIGGGLAG  Y   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPALASGDFHDHWVYWVGPLIGGGLAGLTYSNVFMHHEHAP  243

Query  863  IATQ  874
            ++++
Sbjct  244  LSSE  247



>dbj|BAD90702.1| tonoplast intrinsic protein 1;1 [Mimosa pudica]
Length=251

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 171/245 (70%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAIGRPEEATHPDTLKAGLAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLISAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++ G  ISG H+NPAVT G  +GG+I+++R  +Y I QLL SV AC LL ++T
Sbjct  66   AFALFVAVAVGANISGGHVNPAVTFGAFIGGNISLLRGIVYWIAQLLGSVVACLLLKFVT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTTPA  L+SGVG    V+ EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  126  GGLTTPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYWVGPLIGGGLAG IYE  FI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWVGPLIGGGLAGVIYEVIFISHTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_003543633.1| PREDICTED: aquaporin TIP2-1 [Glycine max]
 gb|KHN32635.1| Aquaporin TIP2-1 [Glycine soja]
Length=247

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 171/244 (70%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+ ++++    I+A I EFI T LFVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGSFNDSVSFASIKAYIAEFISTLLFVFAGVGSAIAYAKLTSDAALDPTGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++    Y I QLL S+ A +LL    
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGLFYWIAQLLGSIVA-SLLLKFV  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G  TP H++A+G+G G+GV+ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  TGYDTPIHSVAAGIGAGEGVVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYTYAFIPTNHAP  242

Query  863  IATQ  874
            +AT+
Sbjct  243  LATE  246



>ref|XP_009617954.1| PREDICTED: aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=248

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 168/241 (70%), Gaps = 3/241 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG---NALVGlffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ +A  +L G   N   GL   A+AH
Sbjct  6    IAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL   A  L+ GVG G  +++EI++TF L++TVYAT VDP KG+L  + P+  G +VGA
Sbjct  126  GGLEIGAFGLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPNKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPA+VS +W +HWVYW GPLIGGGLAG +YE FFI +TH P
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWSWANHWVYWAGPLIGGGLAGLVYEFFFINQTHEP  245

Query  863  I  865
            +
Sbjct  246  L  246



>ref|XP_002519456.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF42870.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=251

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 170/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+  EA Q D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGAATPSGLVAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A  L+SGVG     + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYW GPL+GGGLAG +YE FFI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEFFFIHSTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>tpg|DAA33869.1| TPA_inf: aquaporin TIP1;6 [Gossypium hirsutum]
Length=284

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 179/271 (66%), Gaps = 12/271 (4%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA Q D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V +S G  ISG H+NPAVT G  +GG+I+++R  LY I QLL S  AC LL + T
Sbjct  66   GLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
              +T PA  L+SGVG    V+ EI++TF L++TVYAT +DPKKG+L  + PL  G +VGA
Sbjct  126  SDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAIDPKKGDLGVIAPLAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +W +HW+YW+GPLIGGGLAG IYE  FI ++H  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWDNHWIYWLGPLIGGGLAGLIYEFPFINQSHEQ  245

Query  863  IATQEAF*AFLSTFNYVSPLSALRSMVYVFP  955
            +   +    +   FN++     +++  + FP
Sbjct  246  LPPTD----YWKQFNFI-----MKNGFFPFP  267



>ref|NP_001267926.1| aquaporin-like [Vitis vinifera]
 gb|ABH09330.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 167/245 (68%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A   EFICT +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAIGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G   SG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANTSGGHVNPAVTSGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G+TT A +L+SGV      + EI++TF L++TVYAT +DPKKGNL  + P+  G +VGA
Sbjct  126  NGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS  WT+HWVYW GPLIGGGLAG +YE FFI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYEVFFISHTHEQ  245

Query  863  IATQE  877
            + + +
Sbjct  246  LPSTD  250



>ref|XP_004494087.1| PREDICTED: probable aquaporin TIP-type-like [Cicer arietinum]
Length=250

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 174/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+GN  EA   D ++A + EFI TF+FVF G G+++A ++L  +      GL   A+AH
Sbjct  6    IAIGNPQEATHPDTLKAGLAEFISTFIFVFAGSGSSIAYNKLTNDGAATPSGLISAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  +Y+I QLL S+ A +LL    
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVA-SLLLVFA  124

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL+ PA +L++GVG G  +++EI+LTF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  125  TGLSVPAFSLSAGVGVGPALVLEIVLTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+F+GASMNPA SFGPA+VS +W++HW+YW GPLIGGGLAG IYE  FI  TH  
Sbjct  185  NILVGGAFTGASMNPAVSFGPAVVSWSWSNHWIYWAGPLIGGGLAGLIYEVVFISHTHEQ  244

Query  863  IATQE  877
            + T +
Sbjct  245  LPTTD  249



>emb|CDY53270.1| BnaCnng24720D [Brassica napus]
Length=251

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 170/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQ---GNALVGlffvamah  322
            IA+G   EA + D ++A + EFI T +FVF G G+ MA ++L    G    GL   A+AH
Sbjct  6    IAVGRADEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGGTTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG    ++ EI++TF L++TVYAT VDPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            +I+AGG+FSGASMNPA +FGPA+VS +W +HWVYW GPLIGGG+AG IYE FFI  TH  
Sbjct  186  DILAGGAFSGASMNPAVAFGPAVVSWSWNNHWVYWAGPLIGGGVAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|NP_001240119.1| uncharacterized protein LOC100817754 [Glycine max]
 gb|ACU23209.1| unknown [Glycine max]
Length=247

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 169/244 (69%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+ +++     I+A I EFI T LFVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGSFNDSFSLASIKAYIAEFISTLLFVFAGVGSAIAYAKLTSDAALDPTGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++    Y I QLL S+ A +LL    
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGLFYWIAQLLGSIVA-SLLLKFV  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G  TP H++A+GVG G+GV+ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  TGYDTPIHSVAAGVGAGEGVVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYTYAFIPTQHAP  242

Query  863  IATQ  874
            +AT 
Sbjct  243  LATD  246



>ref|XP_006428460.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 ref|XP_006493539.1| PREDICTED: aquaporin TIP1-1-like [Citrus sinensis]
 gb|ESR41700.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 gb|KDO40803.1| hypothetical protein CISIN_1g025548mg [Citrus sinensis]
Length=251

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 171/245 (70%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQ---GNALVGlffvamah  322
            IA+G+  EA   D ++A + EFI T +FVF G G+ MA ++L     N   GL   ++AH
Sbjct  6    IAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVAASVAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++ G  ISG H+NPAVT G  +GG+I+++R  LY I QLL S  AC LL ++T
Sbjct  66   AFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G TT A  L+SGVG    V+ EI++TF L++TVYAT +DPKKG+L  + P+  G +VGA
Sbjct  126  NGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYWVGPLIGGGLAG +YE FFI ++H  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQ  245

Query  863  IATQE  877
            + T E
Sbjct  246  LPTTE  250



>emb|CAE53881.1| aquaporin [Ricinus communis]
Length=251

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 170/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+  EA Q D ++A + EFI T +FVF G G+ MA ++L  N +    GL   A+AH
Sbjct  6    IAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGVATPSGLVAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY   QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A  L+SGVG     + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYW GPL+GGGLAG +YE FFI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEFFFIHSTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_003597702.1| Aquaporin [Medicago truncatula]
 gb|AES67953.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=249

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 171/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A + EFI T +FVF GVG+A+A  +L   A +   GL  VA+ H
Sbjct  5    IAFGRFDDSFSVSSIRAYVAEFISTLIFVFAGVGSAIAYAKLTSGAALDPAGLVAVAVCH  64

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL Y T
Sbjct  65   GFALFVAVSVGANISGGHVNPAVTFGLAIGGQITILTGIFYWIAQLLGSIVACFLLKYAT  124

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H++ASGVG G+GV+ EII+TF L++TVYAT  DPKKG+L  + P+  GL+VGA
Sbjct  125  GGLTIPIHSVASGVGAGEGVVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGLIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA++SG++ ++W+YWVGPLIGGGLAG IY   F+   HVP
Sbjct  185  NILAAGPFSGGSMNPARSFGPAVLSGDYHNNWIYWVGPLIGGGLAGVIYSYVFMPSDHVP  244

Query  863  IATQ  874
            +A+ 
Sbjct  245  LASD  248



>emb|CAN69323.1| hypothetical protein VITISV_032929 [Vitis vinifera]
Length=251

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 166/245 (68%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA G   EA + D ++A   EFICT +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAFGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGXHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G+TT A +L+SGV      + EI++TF L++TVYAT +DPKKGNL  + P+  G +VGA
Sbjct  126  NGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS  WT+HWVYW GPLIGGGLAG +YE  FI  TH  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYEVVFISHTHEQ  245

Query  863  IATQE  877
            + + +
Sbjct  246  LPSTD  250



>ref|NP_001042500.1| Os01g0232000 [Oryza sativa Japonica Group]
 sp|Q9LWR2.1|TIP43_ORYSJ RecName: Full=Probable aquaporin TIP4-3; AltName: Full=Tonoplast 
intrinsic protein 4-3; Short=OsTIP4;3 [Oryza sativa Japonica 
Group]
 dbj|BAA92991.1| putative tonoplast membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF04414.1| Os01g0232000 [Oryza sativa Japonica Group]
Length=251

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 174/246 (71%), Gaps = 5/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            +ALG+  EA    C++A++ E + TFLFVF+GVG+AMA  +L G  + ++GL  VA AHA
Sbjct  4    LALGHHREATDPGCLRAVVAELLLTFLFVFSGVGSAMAAAKLGGGGDTIMGLTAVAAAHA  63

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLL-ASVAACAlltylt  502
            LVVAVM+SAGL +SG H+NPAVTLGL  GGHIT+ RS LY   QLL +S+A   L     
Sbjct  64   LVVAVMVSAGLHVSGGHINPAVTLGLAAGGHITLFRSALYAAAQLLGSSLACLLLAALTG  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            G    P H  A GVG  + V ME +LTFSLLF VYAT+VD ++  +  LGPLL GLVVGA
Sbjct  124  GEEAVPVHAPAPGVGAARAVAMEAVLTFSLLFAVYATVVD-RRRAVGALGPLLVGLVVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+AGG +SGASMNPARSFGPAL +G W DHW+YWVGPLIGG LAG +YE  F+    H 
Sbjct  183  NILAGGPYSGASMNPARSFGPALAAGEWADHWIYWVGPLIGGPLAGLVYEGLFMGPPGHE  242

Query  860  PIATQE  877
            P+   +
Sbjct  243  PLPRND  248



>tpg|DAA33867.1| TPA_inf: aquaporin TIP1;4 [Gossypium hirsutum]
 gb|KHG03043.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 166/238 (70%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA Q D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V +S G  ISG H+NPAVT G  +GG+I+++R  LY I QLL S  AC LL + T
Sbjct  66   GLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
              +T PA  L+SGVG    V+ EI++TF L++TVYAT +DPKKG+L  + PL  G +VGA
Sbjct  126  SDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAIDPKKGDLGVIAPLAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+F GASMNPA SFGPALVS +W +HW+YW+GPLIGGGLAG IYE  FI ++H
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWDNHWIYWLGPLIGGGLAGLIYEFAFINQSH  243



>gb|AFH36344.1| aquaporin TIP2;2 [Quercus petraea]
Length=251

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 171/245 (70%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G  +EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPAEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G+TT A +L+SGVG     ++EI++TF L++TVYAT +DPKKG+L  + P+  G +VGA
Sbjct  126  NGMTTSAFSLSSGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYW GPLIGGG+AG +YE FFI R+H  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWANHWVYWAGPLIGGGIAGLVYEFFFISRSHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>gb|AFH36343.1| aquaporin TIP2;1 [Quercus petraea]
Length=248

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 168/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   +       ++ I EFI T LFVF GVG+A+A ++L  NA +   GL  +A+ H
Sbjct  4    IAFGRFDDTFSLGSFRSYIAEFISTLLFVFAGVGSAIAYNKLTSNAALDPEGLVAIAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG ITV+    Y I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITVLTGIFYWIAQLLGSIVACFLLKAVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H+LA+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAIPIHSLAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGIIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG +Y   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLVYGNVFMHHEHAP  243

Query  863  IATQ  874
            ++ +
Sbjct  244  LSNE  247



>gb|KHM98732.1| Aquaporin TIP2-1 [Glycine soja]
Length=247

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 169/244 (69%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+ +++     I+A I EFI T LFVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGSFNDSFSLASIKAYIAEFISTLLFVFAGVGSAIAYAKLTSDAALDPTGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++    Y I QLL S+ A +LL    
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGLFYWIAQLLGSIVA-SLLLKFV  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G  TP H++A+G+G G+GV+ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  TGYDTPIHSVAAGIGAGEGVVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYTYAFIPTQHAP  242

Query  863  IATQ  874
            +AT 
Sbjct  243  LATD  246



>ref|XP_006838208.1| hypothetical protein AMTR_s00106p00151600 [Amborella trichopoda]
 gb|ERN00777.1| hypothetical protein AMTR_s00106p00151600 [Amborella trichopoda]
Length=250

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 171/234 (73%), Gaps = 3/234 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++      +A   E+I T LFVF GVG+A++ ++L  NA +   GL  VA+AH
Sbjct  4    IAFGSFGDSFTFTSFKAYFAEYISTLLFVFAGVGSAISYNKLTSNASLDPAGLVAVAVAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++    ISG H+NPAVTLGL +GGHIT++ + LY+  Q+L SV AC LL ++T
Sbjct  64   GFALFVAVAMAANISGGHVNPAVTLGLAVGGHITILTAVLYIAHQVLGSVVACLLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P HTLASG   G+GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTIPTHTLASGTSAGEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI  844
            NI+A G FSG SMNPARSFGPA +SG++TD+WVYWVGPLIGG LAG +Y++ FI
Sbjct  184  NILAAGPFSGGSMNPARSFGPAAISGDFTDNWVYWVGPLIGGALAGLVYDSMFI  237



>ref|NP_001237401.1| uncharacterized protein LOC100306092 [Glycine max]
 gb|ACU14104.1| unknown [Glycine max]
Length=248

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 171/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EF  T LFVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGRLDDSFSLTSIKAYIAEFHSTLLFVFAGVGSAIAYGKLTSDAALDPAGLLAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++  F Y I QLL S+ AC LL Y+T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGFFYWIAQLLGSIVACFLLNYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H++ASGVG  +GV+ EII+TF L++TVYAT   PKKG+L  + P+  G +VGA
Sbjct  124  GGLPTPIHSVASGVGAVEGVVTEIIITFGLVYTVYATAAGPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYGNVFIRSDHAP  243

Query  863  IATQ  874
            ++++
Sbjct  244  LSSE  247



>gb|KHN21988.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 169/244 (69%), Gaps = 6/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+GN SE  Q+D ++A + EFI   +FVF G G+ MA ++L  N      G+   +++H
Sbjct  6    IAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVAASLSH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHI+++R  LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A +L+ GVG    ++ EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT---  853
            NI+AGG+F GASMNPA SFGPA+VSG W +HWVYWVGPLIG  +A  IYETFFI      
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSGTWANHWVYWVGPLIGSAIAAIIYETFFITPNSYE  245

Query  854  HVPI  865
            H+P+
Sbjct  246  HLPV  249



>emb|CAB45653.1| putative tonoplast intrinsic protein [Pisum sativum]
Length=250

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 170/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI TF+FVF G G+ +A ++L  N      GL   ++AH
Sbjct  6    IAIGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTDNGAATPAGLISASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  +Y+I QLL S+ A ALL ++T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
                 PA  L++GVG G  +++EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  126  ASSV-PAFALSAGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+F+GASMNPA SFGPA+VS +W +HW+YW GPLIGGGLAG IYE  FI  TH  
Sbjct  185  NILVGGAFTGASMNPAVSFGPAVVSWSWANHWIYWAGPLIGGGLAGLIYEVLFINSTHEQ  244

Query  863  IATQE  877
            + T +
Sbjct  245  LPTTD  249



>ref|NP_001242707.1| uncharacterized protein LOC100777419 [Glycine max]
 gb|ACU17836.1| unknown [Glycine max]
Length=252

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 169/244 (69%), Gaps = 6/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+GN SE  Q+D ++A + EFI   +FVF G G+ MA ++L  N      G+   +++H
Sbjct  6    IAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVATSLSH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHI+++R  LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A +L+ GVG    ++ EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT---  853
            NI+AGG+F GASMNPA SFGPA+VSG W +HWVYWVGPLIG  +A  IYETFFI      
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSGTWANHWVYWVGPLIGSAIAAIIYETFFITPNSYE  245

Query  854  HVPI  865
            H+P+
Sbjct  246  HLPV  249



>ref|NP_181221.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 sp|P25818.1|TIP11_ARATH RecName: Full=Aquaporin TIP1-1; AltName: Full=Aquaporin TIP; 
AltName: Full=Gamma-tonoplast intrinsic protein; Short=Gamma-TIP; 
AltName: Full=Tonoplast intrinsic protein 1-1; Short=AtTIP1;1; 
AltName: Full=Tonoplast intrinsic protein, root-specific 
RB7; Contains: RecName: Full=Aquaporin TIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAK43987.1|AF370172_1 putative tonoplast intrinsic protein gamma, aquaporin [Arabidopsis 
thaliana]
 emb|CAA45115.1| tonoplast intrinsic protein, gamma-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32806.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAD31569.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
 gb|AAL15240.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC09303.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 prf||1908432B tonoplast intrinsic protein gamma
Length=251

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FV  G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC +L + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS  WT+HWVYW GPL+GGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>gb|AAM65100.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
Length=251

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FV  G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC +L + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS  WT+HWVYW GPL+GGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>gb|AAG44945.1|AF290618_1 putative delta TIP [Nicotiana glauca]
Length=248

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  NA +   GL  VA+ H
Sbjct  4    IAFGRIDDSFSVGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTANAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y+I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVAVGANISGGHVNPAVTFGLALGGQITLLTGLFYIIAQLLGSIVACLLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPTHNVAAGVGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++T++W+YW GPL+GGGLAG  Y   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFTNNWIYWAGPLVGGGLAGLTYSNVFMQHEHAP  243

Query  863  IATQ  874
            +++ 
Sbjct  244  LSSD  247



>gb|KHG11211.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 170/246 (69%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+G+ +EA QSD ++A + EFI   +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGSPAEASQSDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVAASVAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHIT+ RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A +L+SGVG    V+ EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  126  GGLTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYW+GP +G  +A  +YE FFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFVGAAIAAIVYEVFFIAPDTHE  245

Query  860  PIATQE  877
             + T E
Sbjct  246  QLPTTE  251



>ref|XP_011004925.1| PREDICTED: aquaporin TIP2-1 [Populus euphratica]
Length=247

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 167/244 (68%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+AMA ++L G+A +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAMAYNKLTGDAALDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL   T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVACYLLEVAT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  AGLAVPIHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGG+AG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGIAGLIYGNVFITD-HTP  242

Query  863  IATQ  874
            ++  
Sbjct  243  VSRD  246



>ref|XP_010505228.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010509432.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010516909.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
Length=251

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FV  G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC +L + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLILKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS  WT+HWVYW GPL+GGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_002879627.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAA51171.1| tonoplast intrinsic protein gamma (gamma-TIP) [Arabidopsis thaliana]
 gb|EFH55886.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FV  G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC +L + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS  WT+HWVYW GPL+GGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_004516306.1| PREDICTED: aquaporin TIP2-1-like [Cicer arietinum]
Length=248

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T +FVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSFGSIKAYIAEFISTLIFVFAGVGSAIAYGKLTSDAALDPAGLLAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GGHIT++    Y I QLL S+ AC LL ++T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGIFYWIVQLLGSIVACFLLQFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H++A+ VG   G++ EII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLETPTHSVAAEVGPIGGIVTEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSGN+ D+WVYWVGPL+GGGLAG IY+  F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGNFHDNWVYWVGPLVGGGLAGLIYDNVFLRSEHAP  243

Query  863  IATQ  874
            +A+ 
Sbjct  244  LASD  247



>gb|EMS56264.1| putative aquaporin TIP4-1 [Triticum urartu]
Length=256

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 161/244 (66%), Gaps = 24/244 (10%)
 Frame = +2

Query  179  LQSDCIQALIVEFICTFLFVFTGV------------GAAMATDQLQGNALVGlffvamah  322
            + + C++A++ E + TFLFVFTGV            GAAM    L G AL        A 
Sbjct  17   VDAGCVRAVLGELVLTFLFVFTGVAAAMAAGVPELQGAAMPMATLAGVAL--------AQ  68

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            AL   V+++AG  +SG HLNPAVT+ LL  GHIT  R+ LY+  QLLAS  AC LL YL+
Sbjct  69   ALAAGVLVTAGFHVSGGHLNPAVTVALLARGHITAFRAVLYVAAQLLASSLACILLRYLS  128

Query  503  --gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvv  676
                   P HTL +G+G  QG++MEIILTFSLLF VYATI+DP+         L   +V 
Sbjct  129  GGQATPVPVHTLGTGIGPMQGLVMEIILTFSLLFVVYATILDPRTTVPGYGPMLTGLIVG  188

Query  677  gANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RT  853
             AN +AGG+FSGASMNPARSFGPAL +G WT+HWVYWVGPL+GG LAGF+YET F+V +T
Sbjct  189  -ANTIAGGNFSGASMNPARSFGPALATGVWTNHWVYWVGPLVGGPLAGFVYETVFMVTKT  247

Query  854  HVPI  865
            H P+
Sbjct  248  HEPL  251



>ref|XP_009617337.1| PREDICTED: aquaporin TIP2-1 [Nicotiana tomentosiformis]
Length=248

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 167/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSLGSIKAYIAEFISTLLFVFAGVGSAIAYNKLTADAALDPSGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QLL +  A  LL  +T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITLLTGLFYWIAQLLGATVASYLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHSVAAGVGAVEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+  HW+YWVGPL+GGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGNFAGHWIYWVGPLVGGGLAGLIYSNVFMNHDHAP  243

Query  863  IATQ  874
            ++T 
Sbjct  244  LSTD  247



>gb|KHG14163.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 170/246 (69%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+ +EA Q+D ++A + EFI   +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGSAAEAGQADALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAASVAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHIT++RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A  L+SGVG    V+ EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  126  GGLTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYW+GP +G  +A  +YE FFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFVGSAIAAIVYEVFFIAPDTHE  245

Query  860  PIATQE  877
             + T E
Sbjct  246  QLPTSE  251



>ref|XP_006294859.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
 gb|EOA27757.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
Length=251

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FV  G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC +L + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLILKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS  WT+HWVYW GPL+GGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEIFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_006410854.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
 gb|ESQ52307.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
Length=251

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 169/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPEEATKPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QL  SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLAGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA  L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+FSGASMNPA +FGPA+VS +W++HWVYW GPL+GGG+AG IYE FFI  TH  
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWSWSNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_009786545.1| PREDICTED: aquaporin TIP2-1-like [Nicotiana sylvestris]
 gb|AII20185.1| MIP protein [Nicotiana tabacum]
Length=248

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRIDDSFSVGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y+I QLL S+ AC LL  +T
Sbjct  64   GFGLFVAVAVGANISGGHVNPAVTFGLALGGQITILTGLFYIIAQLLGSIVACLLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHNVAAGVGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++T++W+YW GPL+GGGLAG  Y   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFTNNWIYWAGPLVGGGLAGLTYSNVFMQNEHAP  243

Query  863  IATQ  874
            I++ 
Sbjct  244  ISSD  247



>emb|CDY30146.1| BnaC05g37160D [Brassica napus]
Length=248

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 173/244 (71%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y + QLL S AAC LL Y+T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITLITGVFYWVAQLLGSTAACFLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG  Y   F+   HVP
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGITYGNVFMTSEHVP  243

Query  863  IATQ  874
            +A++
Sbjct  244  LASE  247



>gb|KHN32099.1| Aquaporin TIP1-1 [Glycine soja]
Length=252

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 163/234 (70%), Gaps = 3/234 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+GN SE  Q+D ++A + EFI   +FVF G G+ MA ++L  N      G+   +++H
Sbjct  6    IAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVAASLSH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHI+++R  LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL T A +L+ GVG    ++ EI++TF L++TVYAT VDPKKG L  + P+  G +VGA
Sbjct  126  VGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAVDPKKGKLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI  844
            NI+AGG+FSGASMNPA SFGPA+VSG W +HWVYW GPLIG  +A  +YETFFI
Sbjct  186  NILAGGTFSGASMNPAVSFGPAVVSGTWANHWVYWAGPLIGSAIAAVVYETFFI  239



>emb|CAB55837.1| delta tonoplast intrinsic protein [Spinacia oleracea]
Length=247

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T LFVF GVG+ +A  +L  +A +   GL  VA+ H
Sbjct  3    IAFGRFDDSFSWASIKAYIAEFISTLLFVFAGVGSCIAFAKLTEDAALSPSGLVAVAVCH  62

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT GL +GG IT++   LY I Q   SVAAC LL   T
Sbjct  63   AFALFVAVSVGANISGGHVNPAVTFGLALGGQITILTGILYWIAQCAGSVAACLLLKAST  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H++A+GVG  + V+MEII+TF+L++TVYAT VDPKKG++  + P+  G +VGA
Sbjct  123  GGLATPIHSVAAGVGSIEAVVMEIIITFALVYTVYATAVDPKKGSIGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ S +++DHWVYWVGPL+GGGLAG IY   F+   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVASLDFSDHWVYWVGPLVGGGLAGLIYGNVFMQDDHAP  242

Query  863  IATQ  874
            ++ +
Sbjct  243  LSNE  246



>ref|XP_010556519.1| PREDICTED: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=252

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 166/238 (70%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            I++G   EA   D ++A + EFICT +FVF G G+ MA ++L  +      GL   A+AH
Sbjct  6    ISVGRPEEATHPDALRAALAEFICTLIFVFAGSGSGMAFNKLTNDGATTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  PA +L++GVG     + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLAVPAFSLSAGVGTLNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI AGG+F+GASMNPA +FGPA+VS +W  HW+YW GPL+GGG+AG +YE FFI  TH
Sbjct  186  NIFAGGAFTGASMNPAVAFGPAVVSWSWAGHWIYWAGPLVGGGIAGIVYEFFFISNTH  243



>ref|XP_009614306.1| PREDICTED: aquaporin TIP2-1-like [Nicotiana tomentosiformis]
Length=248

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRIDDSFSVGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITLLTGLFYTIAQLLGSIVACLLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPTHNVAAGVGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++T++W+YW GPL+GGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFTNNWIYWAGPLVGGGLAGLIYSNVFMQNEHAP  243

Query  863  IATQ  874
            +++ 
Sbjct  244  LSSD  247



>ref|XP_008228469.1| PREDICTED: aquaporin TIP2-1 [Prunus mume]
Length=248

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 167/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A D+L  NA +   GL  +A+AH
Sbjct  4    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAYDKLTSNAALDPAGLVAIALAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG ITV+    Y I QLL ++ A  +L ++T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITVLTGIFYWIAQLLGAIVAAFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H+LA+GVG  QGVI EII+TF+L++TVYAT  DPKKG L  + P+  G +VGA
Sbjct  124  GGLTIPIHSLAAGVGAIQGVIFEIIITFALVYTVYATAADPKKGALGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   F    H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFFHTEHAP  243

Query  863  IATQ  874
            +  +
Sbjct  244  LVNE  247



>ref|XP_010267262.1| PREDICTED: aquaporin TIP1-1 [Nelumbo nucifera]
Length=252

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 168/247 (68%), Gaps = 3/247 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNAL---VGlffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPEEATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTSNGSSTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A +L+SGV      ++EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS  W +HWVYW GPLIGGGLAG +YE FFI  +H  
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWENHWVYWAGPLIGGGLAGLVYEFFFINHSHEQ  245

Query  863  IATQEAF  883
            + T   +
Sbjct  246  LPTAADY  252



>ref|XP_010322694.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP2-1 [Solanum lycopersicum]
Length=249

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 173/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++L    I+A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAXGRFDDSLNCGSIKAYLAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y + QLL ++ AC LL ++T
Sbjct  64   GFALFVAVSIGANISGGHVNPAVTFGLALGGQITLLTGLFYWVAQLLGAIVACCLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTVPIHGVAAGVGATEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+A G FSG SMNPARSFGPA+VSGN+  +W+YWVGPLIGGGLAG IY   F+    HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGNFAGNWIYWVGPLIGGGLAGLIYSNVFMNYGDHV  243

Query  860  PIATQ  874
            P+++ 
Sbjct  244  PLSSD  248



>gb|AAB67881.1| membrane channel protein [Solanum tuberosum]
Length=250

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 175/247 (71%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++L    ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  +A+AH
Sbjct  4    IAFGSIGDSLSVGSLKAYLAEFIATLLFVFAGVGSAIAYNKLTSDAALDPAGLVAIAVAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S    ISG HLNPAVTLGL +GG+IT +    Y + QLL S  AC LL Y+T
Sbjct  64   AFALFVGVSMAANISGGHLNPAVTLGLAVGGNITTLTGLFYWVAQLLGSTVACLLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGLAVPTHGVAAGMNGAEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+V+G+++ +W+YWVGPLIGGGLAGFIY   FI  +H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWVGPLIGGGLAGFIYGDVFI-GSHTP  242

Query  863  IATQEAF  883
            + T E +
Sbjct  243  LPTSEDY  249



>ref|XP_002515999.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF46419.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=248

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 171/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAYGKLTSDAALDPAGLVAIAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVACFLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H++A+GVG  +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLATPIHSVAAGVGAIEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++TD+W+YWVGPL+GGGLAG IY   ++   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFTDNWIYWVGPLVGGGLAGLIYGNLYMPGDHAP  243

Query  863  IATQ  874
            +++ 
Sbjct  244  LSSD  247



>gb|EYU21481.1| hypothetical protein MIMGU_mgv1a010922mg [Erythranthe guttata]
Length=297

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T LFVF GVG+A+A ++L  ++ +   GL  +A+AH
Sbjct  53   IAFGRFDDSFSFGSIKAYIAEFISTLLFVFAGVGSAIAFNKLTADSALDAPGLVAIAVAH  112

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT GL +GG IT++   LY I QLL +V A  LL+++T
Sbjct  113  AFALFVAVSIGANISGGHVNPAVTFGLAVGGQITILTGLLYWIRQLLGAVVASFLLSFVT  172

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H + +GVG  QGV+MEII+TF+L++TVYAT  DPKKG++  + P+  G +VGA
Sbjct  173  GGLAIPIHGVGAGVGAIQGVVMEIIITFALVYTVYATAADPKKGSIGTIAPIAIGFIVGA  232

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+  HW+YWVGPLIGGGLAG +Y+  F+   H P
Sbjct  233  NILAAGPFSGGSMNPARSFGPAVASGNFAGHWIYWVGPLIGGGLAGIVYDNVFMHHEHAP  292

Query  863  IATQ  874
            +A+ 
Sbjct  293  LASD  296



>emb|CDX97733.1| BnaA05g23460D [Brassica napus]
Length=248

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    LAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y + QLL S AAC LL Y+T
Sbjct  64   GFALFVAVAVGANISGGHVNPAVTFGLAVGGQITLITGVFYWVAQLLGSTAACFLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG  Y   F+   HVP
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGITYGNVFMTSEHVP  243

Query  863  IATQ  874
            +A+ 
Sbjct  244  LASD  247



>dbj|BAA31452.1| delta-VM23 [Raphanus sativus]
Length=248

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y + QLL S AAC LL Y+T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITLITGVFYWVAQLLGSTAACFLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TFSL++TVY T  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGVGAIEGVVMEIIITFSLVYTVYPTAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG  Y   F+   HVP
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGVTYGNVFMTSEHVP  243

Query  863  IATQ  874
            +A++
Sbjct  244  LASE  247



>ref|XP_002439483.1| hypothetical protein SORBIDRAFT_09g007940 [Sorghum bicolor]
 gb|EES17913.1| hypothetical protein SORBIDRAFT_09g007940 [Sorghum bicolor]
Length=314

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 165/230 (72%), Gaps = 6/230 (3%)
 Frame = +2

Query  191  CIQALIVEFICTFLFVFTGVGAAMA----TDQLQGNALVGlffvamahalvvavmISAGL  358
            C++A++ E + TFLFVFTGV AAMA        +   +  L  VA+AHAL   V+++AG 
Sbjct  81   CVRAVLAELVLTFLFVFTGVSAAMAAGSGVKPGEAMPMATLAAVAIAHALAAGVLVTAGF  140

Query  359  RISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgglttPAHTLAS  538
             +SG HLNPAVT+GL++ GHIT +R+ LY+  Q+LAS  AC LL YL+GG+ TP H L +
Sbjct  141  HVSGGHLNPAVTVGLMVRGHITKLRAVLYVAAQVLASSLACILLRYLSGGMVTPVHALGA  200

Query  539  GVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIMAGGSFSGAS  718
            G+   QG++ME+ILTFSLLF  YA I+DP+         L   +V  AN +AGG+FSGAS
Sbjct  201  GISPMQGLVMEVILTFSLLFVTYAMILDPRSQVRTIGPLLTGLIVG-ANSLAGGNFSGAS  259

Query  719  MNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            MNPARSFGPAL SG WT+HW+YW+GPL+GG LAGFIYE+ FIV +TH P+
Sbjct  260  MNPARSFGPALASGVWTNHWIYWIGPLLGGPLAGFIYESLFIVNKTHEPL  309



>dbj|BAI66438.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 160/244 (66%), Gaps = 24/244 (10%)
 Frame = +2

Query  179  LQSDCIQALIVEFICTFLFVFTGV------------GAAMATDQLQGNALVGlffvamah  322
            + + C++A++ E + TFLFVFTGV            GAAM    L G AL        A 
Sbjct  18   VDAGCVRAVLGELVLTFLFVFTGVAAAMAAGVPELPGAAMPMATLAGVAL--------AQ  69

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            AL   V+++AG  +SG HLNPAVT+ LL  GHIT  R+ LY++ QLLAS  AC LL  LT
Sbjct  70   ALAAGVLVTAGFHVSGGHLNPAVTVALLARGHITAFRAVLYVVAQLLASSLACILLRCLT  129

Query  503  --gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvv  676
                   P HTL +G+G  QG++MEIILTFSLLF VYATI+DP+         L   +V 
Sbjct  130  GGQPTPVPVHTLGAGIGPMQGLVMEIILTFSLLFVVYATILDPRTTVPGYGPMLTGLIVG  189

Query  677  gANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RT  853
             AN +AGG+FSGASMNPARSFGPAL +G WT+HW+YWVGPL+GG LAGF+YE  F+V +T
Sbjct  190  -ANTIAGGNFSGASMNPARSFGPALATGVWTNHWIYWVGPLVGGPLAGFVYEMVFMVKKT  248

Query  854  HVPI  865
            H P+
Sbjct  249  HEPL  252



>ref|XP_009146158.1| PREDICTED: aquaporin TIP2-1 [Brassica rapa]
Length=276

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  32   VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  91

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y + QLL S AAC LL Y+T
Sbjct  92   GFALFVAVAVGANISGGHVNPAVTFGLAVGGQITLITGVFYWVAQLLGSTAACFLLKYVT  151

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  152  GGLAVPTHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  211

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG  Y   F+   HVP
Sbjct  212  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGITYGNVFMTSEHVP  271

Query  863  IATQ  874
            +A+ 
Sbjct  272  LASD  275



>dbj|BAO18637.1| tonoplast intrinsic protein 2;5, partial [Solanum lycopersicum]
Length=250

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 173/244 (71%), Gaps = 4/244 (2%)
 Frame = +2

Query  155  ALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamaha  325
            +LG   ++L    I+A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H 
Sbjct  6    SLGRFDDSLNCGSIKAYLAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCHG  65

Query  326  lvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltg  505
              + V +S G  ISG H+NPAVT GL +GG IT++    Y + QLL ++ AC LL ++TG
Sbjct  66   FALFVAVSIGANISGGHVNPAVTFGLALGGQITLLTGLFYWVAQLLGAIVACCLLKFVTG  125

Query  506  glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgAN  685
            GLT P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGAN
Sbjct  126  GLTVPIHGVAAGVGATEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGAN  185

Query  686  IMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHVP  862
            I+A G FSG SMNPARSFGPA+VSGN+  +W+YWVGPLIGGGLAG IY   F+    HVP
Sbjct  186  ILAAGPFSGGSMNPARSFGPAVVSGNFAGNWIYWVGPLIGGGLAGLIYSNVFMNYGDHVP  245

Query  863  IATQ  874
            +++ 
Sbjct  246  LSSD  249



>emb|CAA06335.1| aquaporin-like protein [Picea abies]
Length=252

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 172/246 (70%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A+G   E       +A + E I T +FVF G G+ MA  +L  +A     GL  VA+AH
Sbjct  6    VAIGRPEEVTHPTAFKAALAELISTLIFVFAGEGSGMAFAKLTSDASTTPAGLVAVALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V ++ G  ISG H+NPAVT G L+GGHIT++R  LY I QLL ++ AC LL + T
Sbjct  66   GLGLFVAVAVGANISGGHVNPAVTFGALVGGHITLLRGILYWIAQLLGAIVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL+TP H++ASG+  G+GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  126  GGLSTPIHSVASGMNTGEGVVMEIVITFALIYTVYATAADPKKGDLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSF PA+VSG++TD+WVYWVGPLIGGGLAG +Y   FI    HV
Sbjct  186  NILAAGPFSGGSMNPARSFDPAVVSGDFTDNWVYWVGPLIGGGLAGIVYRGIFIGDDLHV  245

Query  860  PIATQE  877
            P+   +
Sbjct  246  PLPVSD  251



>ref|XP_002303300.1| delta-tonoplast intrinsic family protein [Populus trichocarpa]
 gb|ABK96274.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE78279.1| delta-tonoplast intrinsic family protein [Populus trichocarpa]
Length=247

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 170/240 (71%), Gaps = 4/240 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G  +++     ++A + EFI T LFVF GVG+AMA ++L G+A +   GL  +A+ H
Sbjct  4    IAFGRFNDSFSLGSLKAYLAEFISTLLFVFAGVGSAMAYNKLTGDAALDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVTLGL +GG +T++    Y I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVAVGANISGGHVNPAVTLGLALGGQMTILTGIFYWIAQLLGSIVACYLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   +I   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNLYITD-HSP  242



>dbj|BAD90703.1| tonoplast intrinsic protein 1;2 [Mimosa pudica]
Length=252

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 170/246 (69%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+GN SE  Q+D ++A + EFI   +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAIGNASEFQQADALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGAATPAGLVSASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            AL + V ++ G  ISG H+NPAVT G  +GGHI+++RS LY I QLL  V AC LL + T
Sbjct  66   ALALFVAVAVGANISGGHVNPAVTFGAFVGGHISLLRSILYWIAQLLGCVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L++GVG    V+ EI++TF L++TVYAT VDPKKG++  + P+  G +VGA
Sbjct  126  GGLETSAFALSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYW+GP +G G+A  +YE  FI + TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWANHWVYWLGPFVGAGIAALVYELLFINQNTHE  245

Query  860  PIATQE  877
            P+ T +
Sbjct  246  PLPTTD  251



>ref|XP_011088796.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=255

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 169/242 (70%), Gaps = 4/242 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNAL---VGlffvamah  322
            +A+G+  E  Q   ++A + EFI T +FVF G G+ +A ++L GNA     GL   ++AH
Sbjct  13   VAIGSHDEFRQPGAVKAAVAEFISTLVFVFAGSGSGIAYNKLTGNAPNTPAGLIAASVAH  72

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++ G  ISG H+NPAVT GL +GG+IT+ R  LY+I QLL S+ AC LL++ T
Sbjct  73   AFGLFVAVAIGANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSIVACLLLSFTT  132

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG   PA T+ SGV      + EI++TF L++TVYAT VDPKKG +  + P+  G +VGA
Sbjct  133  GGWAIPAFTV-SGVSVWSAFVFEIVMTFGLVYTVYATAVDPKKGEIGVIAPIAIGFIVGA  191

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG F+GASMNPA +FGPA+VS  WT+HW+YW GPLIGGGLAG +YE FFI  TH P
Sbjct  192  NILAGGVFTGASMNPAVAFGPAVVSFTWTNHWIYWAGPLIGGGLAGVVYEGFFISHTHEP  251

Query  863  IA  868
            ++
Sbjct  252  LS  253



>sp|Q9FY14.1|TIP1_MEDTR RecName: Full=Probable aquaporin TIP-type; AltName: Full=MtAQP1 
[Medicago truncatula]
 emb|CAC01618.1| aquaporin [Medicago truncatula]
 gb|KEH24058.1| tonoplast intrinsic protein [Medicago truncatula]
Length=250

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 170/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI TF+FVF G G+ +A ++L  +      GL   ++AH
Sbjct  6    IAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  +Y+I QLL S+ A ALL ++T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
                 PA  L+ GVG G  +++EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  126  ASSV-PAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+F+GASMNPA SFGPA+VS +W++HWVYW GPLIGGG+AG +YE  FI  TH  
Sbjct  185  NILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQ  244

Query  863  IATQE  877
            + T +
Sbjct  245  LPTTD  249



>gb|ACG46456.1| aquaporin TIP4.1 [Zea mays]
Length=257

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 177/239 (74%), Gaps = 8/239 (3%)
 Frame = +2

Query  170  SEALQSD--CIQALIVEFICTFLFVFTGVGAAMAT----DQLQGNALVGlffvamahalv  331
             EA   D  C++A++ E + TFLFVFTGV A+MA        +   +  L  VA+AHAL 
Sbjct  15   DEAPAPDVGCVRAVLAELVLTFLFVFTGVSASMAAGSGGKPGEAMPMATLAAVAIAHALA  74

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
              V+++AG  +SG HLNPAVT+G+L+ GHIT +R+ LY+  QLLAS  AC LL YL+GG+
Sbjct  75   AGVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLASSLACILLRYLSGGM  134

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP H L +G+   QG++ME+ILTFSLLF  YA I+DP+   +  +GPLLTGL+VGAN +
Sbjct  135  VTPVHALGAGINPMQGLVMEVILTFSLLFVTYAMILDPRS-QVRTIGPLLTGLIVGANSL  193

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            AGG+F+GASMNPARSFGPA+ +G WT+HWVYW+GPL+GG LAGF+YE+ F+V +TH P+
Sbjct  194  AGGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLAGFVYESLFMVNKTHEPL  252



>gb|AAB53329.1| Rb7 [Solanum lycopersicum]
Length=250

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 174/247 (70%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++L    ++A + EFI T LFVF GVG+A+A ++L   A +   GL  +A+AH
Sbjct  4    IAFGSIGDSLSVGSLKAYLAEFIATLLFVFAGVGSAIAFNKLTSGAALDPAGLVAIAVAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S    ISG HLNPAVTLGL +GG+IT++    Y + QLL S  AC LL Y+T
Sbjct  64   AFALFVGVSMAANISGGHLNPAVTLGLAVGGNITILTGLFYWVAQLLGSTVACLLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGLAVPTHGVAAGMSGAEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+V+G+++ +W+YWVGPLIGGGLAGFIY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWVGPLIGGGLAGFIYGDVFI-GCHTP  242

Query  863  IATQEAF  883
            + T E +
Sbjct  243  LPTSEDY  249



>gb|ACF79343.1| unknown [Zea mays]
 gb|ACF85908.1| unknown [Zea mays]
Length=257

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 177/238 (74%), Gaps = 8/238 (3%)
 Frame = +2

Query  173  EALQSD--CIQALIVEFICTFLFVFTGVGAAMAT----DQLQGNALVGlffvamahalvv  334
            EA   D  C++A++ E + TFLFVFTGV A+MA        +   +  L  VA+AHAL  
Sbjct  16   EAPAPDVGCVRAVLAELVLTFLFVFTGVSASMAAGAGGKPGEAMPMATLAAVAIAHALAA  75

Query  335  avmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgglt  514
             V+++AG  +SG HLNPAVT+G+L+ GHIT +R+ LY+  QLLAS  AC LL YL+GG+ 
Sbjct  76   GVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLASSLACILLRYLSGGMV  135

Query  515  tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIMA  694
            TP H L +G+   QG++ME+ILTFSLLF  YA I+DP+   +  +GPLLTGL+VGAN +A
Sbjct  136  TPVHALGAGISPMQGLVMEVILTFSLLFVTYAMILDPRS-QVRTIGPLLTGLIVGANSLA  194

Query  695  GGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            GG+F+GASMNPARSFGPA+ +G WT+HWVYW+GPL+GG LAGF+YE+ F+V +TH P+
Sbjct  195  GGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLAGFVYESLFMVYKTHEPL  252



>ref|NP_001274703.1| TIP protein [Solanum lycopersicum]
 dbj|BAO18636.1| tonoplast intrinsic protein 2;3 [Solanum lycopersicum]
Length=250

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 174/247 (70%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++L    ++A + EFI T LFVF GVG+A+A ++L   A +   GL  +A+AH
Sbjct  4    IAFGSIGDSLSVGSLKAYLAEFIATLLFVFAGVGSAIAFNKLTSGAALDPAGLVAIAVAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S    ISG HLNPAVTLGL +GG+IT++    Y + QLL S  AC LL Y+T
Sbjct  64   AFALFVGVSMAANISGGHLNPAVTLGLAVGGNITILTGLFYWVAQLLGSTVACLLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGLAVPTHGVAAGMSGAEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+V+G+++ +W+YWVGPLIGGGLAGFIY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWVGPLIGGGLAGFIYGDVFI-GCHTP  242

Query  863  IATQEAF  883
            + T E +
Sbjct  243  LPTSEDY  249



>ref|XP_004302879.1| PREDICTED: aquaporin TIP2-1-like [Fragaria vesca subsp. vesca]
Length=248

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A ++L  NA +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAYNKLTSNAALDPAGLVAIAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QL  ++ AC +L ++T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLAGAIVACFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P HT+++GVG  +GV+ EII+TF+L++TVYAT  DPKKG +  + P+  G +VGA
Sbjct  124  GGLTIPIHTVSAGVGAIEGVVFEIIITFALVYTVYATAADPKKGAIGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++TD+W+YWVGPLIGGGLAG IY   +I   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFTDNWIYWVGPLIGGGLAGLIYGNVYIHSEHQP  243

Query  863  IATQ  874
            + ++
Sbjct  244  LVSE  247



>emb|CDY20190.1| BnaA01g28120D [Brassica napus]
Length=249

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 175/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITLITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG +Y   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLVYGNVFMPSSEHV  243

Query  860  PIATQ  874
            P+A++
Sbjct  244  PLASE  248



>ref|XP_002298233.1| delta-tonoplast intrinsic family protein [Populus trichocarpa]
 gb|ABK93015.1| unknown [Populus trichocarpa]
 gb|ABK93867.1| unknown [Populus trichocarpa]
 gb|ABK96510.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE83038.1| delta-tonoplast intrinsic family protein [Populus trichocarpa]
Length=247

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 167/242 (69%), Gaps = 4/242 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+AMA ++L G+A +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAMAYNKLTGDAALDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL   T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVACYLLKVAT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YW GPL+GGG+AG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWAGPLVGGGIAGLIYGNVFITD-HTP  242

Query  863  IA  868
            ++
Sbjct  243  LS  244



>ref|XP_010243206.1| PREDICTED: aquaporin TIP1-1-like [Nelumbo nucifera]
Length=251

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 164/238 (69%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+G   EA   D ++A + EF  T +FVF G G+ MA ++L  N      GL   A++H
Sbjct  6    IAVGRPEEATHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTSNGSATPAGLVAAALSH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT+ R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A +L+SGV      + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYWVGPLIGGGLAG +YE FFI  +H
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWKNHWVYWVGPLIGGGLAGIVYELFFINHSH  243



>emb|CDY63821.1| BnaC01g44580D [Brassica napus]
Length=249

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 175/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITLITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG +Y   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLVYGNVFMPSSEHV  243

Query  860  PIATQ  874
            P+A++
Sbjct  244  PLASE  248



>gb|EPS72940.1| hypothetical protein M569_01821 [Genlisea aurea]
Length=247

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 169/244 (69%), Gaps = 4/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G  S++     I+A I EFI TF+F+F GVG+A+A ++L  +A +   GL  +A+ H
Sbjct  4    IAFGRASDSFSIASIKAYIAEFISTFIFIFAGVGSAIAYNKLSSDAALDPPGLVAIAVGH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            AL + V +S    ISG H+NPAVT GL +GG IT++    Y I QLL + A  ALL    
Sbjct  64   ALALFVTVSIAANISGGHVNPAVTFGLAVGGQITILTGIFYWIAQLLGA-AVGALLIKFA  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G   P H++A+G+G  +GV+ EII+TF L++TVYAT VDPKKG++  + P+  G +VGA
Sbjct  123  TGSPAPTHSVAAGLGAFEGVVFEIIITFGLVYTVYATAVDPKKGSIGTVAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPALVSG+++ HWVYW+GPL+GGGLAG +Y   F+ + H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPALVSGDFSGHWVYWIGPLVGGGLAGVVYTYVFLQQEHAP  242

Query  863  IATQ  874
            + ++
Sbjct  243  LESE  246



>dbj|BAJ89588.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96163.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 159/244 (65%), Gaps = 24/244 (10%)
 Frame = +2

Query  179  LQSDCIQALIVEFICTFLFVFTGV------------GAAMATDQLQGNALVGlffvamah  322
            + + C++ ++ E + TFLFVFTGV            GAAM    L G AL        A 
Sbjct  18   VDTGCVRTVLGELVLTFLFVFTGVAAAMAAGVPELPGAAMPMATLAGVAL--------AQ  69

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            AL   V+++AG  +SG HLNPAVT+ LL  GHIT  R+ LY++ QLLAS  AC LL  LT
Sbjct  70   ALAAGVLVTAGFHVSGGHLNPAVTVALLARGHITAFRAVLYVVAQLLASSLACILLRCLT  129

Query  503  --gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvv  676
                   P HTL +G+G  QG++MEIILTFSLLF VYATI+DP+         L   +V 
Sbjct  130  GGQPTPVPVHTLGAGIGPMQGLVMEIILTFSLLFVVYATILDPRTTVPGYGPMLTGLIVG  189

Query  677  gANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RT  853
             AN +AGG+FSGASMNPARSFGPAL +G WT+HW+YWVGPL+GG LAGF+YE  F+V +T
Sbjct  190  -ANTIAGGNFSGASMNPARSFGPALATGVWTNHWIYWVGPLVGGPLAGFVYEMVFMVKKT  248

Query  854  HVPI  865
            H P+
Sbjct  249  HEPL  252



>emb|CDX82410.1| BnaA03g34110D [Brassica napus]
Length=249

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 174/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    IAFGSFDDSFSLASLKAYLAEFISTLLFVFAGVGSAIAYGKLTSDAALDTSGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITLITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGLGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMSSSEHV  243

Query  860  PIATQ  874
            P+A+ 
Sbjct  244  PLASD  248



>emb|CAA38633.1| possible membrane channel protein [Arabidopsis thaliana]
Length=253

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 164/238 (69%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA + D ++A + EFI T +FV  G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL SV AC +L + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P   L++GVG     + EI++TF L++TVYAT +DPK G+L  + P+  G +VGA
Sbjct  126  GGLAVPPFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+FSGASMNPA +FGPA+VS  WT+HWVYW GPL+GGG+AG IYE FFI  TH
Sbjct  186  NILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTH  243



>ref|NP_188245.1| aquaporin TIP2-1 [Arabidopsis thaliana]
 sp|Q41951.2|TIP21_ARATH RecName: Full=Aquaporin TIP2-1; AltName: Full=Delta-tonoplast 
intrinsic protein; Short=Delta-TIP; AltName: Full=Tonoplast 
intrinsic protein 2-1; Short=AtTIP2;1; Contains: RecName: Full=Aquaporin 
TIP2-1, N-terminally processed [Arabidopsis thaliana]
 gb|AAC49281.1| delta tonoplast integral protein [Arabidopsis thaliana]
 dbj|BAB01264.1| delta tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAM63133.1| delta tonoplast integral protein delta-TIP [Arabidopsis thaliana]
 dbj|BAF01780.1| delta tonoplast integral protein [Arabidopsis thaliana]
 gb|AEE75789.1| aquaporin TIP2-1 [Arabidopsis thaliana]
Length=250

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 175/246 (71%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITVI    Y I QLL S AAC LL Y+T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGLGSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMGSSEHV  243

Query  860  PIATQE  877
            P+A+ +
Sbjct  244  PLASAD  249



>ref|NP_001105034.1| aquaporin TIP4-2 [Zea mays]
 sp|Q9ATL5.1|TIP42_MAIZE RecName: Full=Aquaporin TIP4-2; AltName: Full=Tonoplast intrinsic 
protein 4-2; AltName: Full=ZmTIP4-2; AltName: Full=ZmTIP4;2 
[Zea mays]
 gb|AAK26773.1| tonoplast membrane integral protein ZmTIP4-2 [Zea mays]
Length=257

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 177/239 (74%), Gaps = 8/239 (3%)
 Frame = +2

Query  170  SEALQSD--CIQALIVEFICTFLFVFTGVGAAMAT----DQLQGNALVGlffvamahalv  331
             EA   D  C++A++ E + TFLFVFTGV A+MA        +   +  L  VA+AHAL 
Sbjct  15   DEAPAPDVGCVRAVLAELVLTFLFVFTGVSASMAAGAGGKPGEAMPMATLAAVAIAHALA  74

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
              V+++AG  +SG HLNPAVT+G+L+ GHIT +R+ LY+  QLLAS  AC LL YL+GG+
Sbjct  75   AGVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLASSLACILLRYLSGGM  134

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
             TP H L +G+   QG++ME+ILTFSLLF  YA I+DP+   +  +GPLLTGL+VGAN +
Sbjct  135  VTPVHALGAGIRPMQGLVMEVILTFSLLFVTYAMILDPRS-QVRTIGPLLTGLIVGANSL  193

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            AGG+F+GASMNPARSFGPA+ +G WT+HWVYW+GPL+GG LAGF+YE+ F+V +TH P+
Sbjct  194  AGGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLAGFVYESLFMVNKTHEPL  252



>tpg|DAA33868.1| TPA_inf: aquaporin TIP1;5 [Gossypium hirsutum]
 gb|KHG18573.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=249

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 164/238 (69%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL-QGNALV--Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L  G A    GL   ++AH
Sbjct  6    IAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDGGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  PA  L+SGVG     + EI++TF L++TVYAT VDPK+GNL  + PL  GL+VGA
Sbjct  126  SGLGVPAFGLSSGVGALNAFVFEIVMTFGLVYTVYATAVDPKRGNLGVIAPLAIGLIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYW GPLIGGGLAG +YE  FI +TH
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGGGLAGLVYEFIFINQTH  243



>dbj|BAD90704.1| tonoplast intrinsic protein 2;1 [Mimosa pudica]
Length=250

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 166/247 (67%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G+ +++  +  I+A + EFI T LFVF GVG+A+A   L  +A +    +       
Sbjct  4    IAFGSLNDSFSAASIKAYVAEFIATLLFVFAGVGSAIAYGALTKDAALDPAGLVAVAVAH  63

Query  332  vavm---ISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               +   +S    ISG HLNPAVT GL++GG+ITV+ +  Y I QLL S+ AC LL ++T
Sbjct  64   AFALFVGVSVAANISGGHLNPAVTFGLVIGGNITVLTAIFYWIFQLLGSLVACLLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
               T P H LASGVG  +G++ EI+ TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  SAPTVPVHGLASGVGIFEGIVFEIVATFGLVYTVYATAADPKKGSLGIIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA VSG++T++W+YWVGPLIGGGLAG IY   FI  ++ P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAAVSGDFTNYWIYWVGPLIGGGLAGLIYGDVFI-GSYAP  242

Query  863  IATQEAF  883
            + T E++
Sbjct  243  VPTSESY  249



>ref|XP_010254028.1| PREDICTED: aquaporin TIP2-1 [Nelumbo nucifera]
Length=249

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 169/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  N+ +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSVGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSNSALDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QL+ ++ AC LL  +T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVACFLLKAVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H +A+GVG  +GV+ EI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTIPTHGVAAGVGAFEGVVFEIVITFALVYTVYATAADPKKGSLGIIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++  +W+YWVGPLIGGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFKGNWIYWVGPLIGGGLAGLIYGNVFMSTDHAP  243

Query  863  IATQE  877
            I++ E
Sbjct  244  ISSSE  248



>ref|XP_010062508.1| PREDICTED: aquaporin TIP2-1 [Eucalyptus grandis]
 gb|KCW69650.1| hypothetical protein EUGRSUZ_F03054 [Eucalyptus grandis]
Length=248

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYGKLTSDAALDPSGLVAIAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QL+ ++ AC LL  +T
Sbjct  64   AFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVACLLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H+LA+GVG  +GV+MEII+TF+L++ VYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPVHSLAAGVGAIEGVVMEIIITFALVYCVYATAADPKKGSLGIVAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYGNVFMHSDHAP  243

Query  863  IATQ  874
            +  +
Sbjct  244  LVNE  247



>ref|XP_010691368.1| PREDICTED: aquaporin TIP2-1 [Beta vulgaris subsp. vulgaris]
Length=247

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 167/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T LFVF GVG+ +A  +L   A +   G+  VA+ H
Sbjct  3    IAFGRFDDSFSWASIKAYIAEFISTLLFVFAGVGSCIAFSKLTAGAALSPSGIVAVAVCH  62

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QL  SV AC LL   T
Sbjct  63   AFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLAGSVVACFLLKAST  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTTP H++  G+G  + V+MEI++TF+L++TVYAT VDPKKG++  + P+  G +VGA
Sbjct  123  GGLTTPIHSVPEGLGVMEAVVMEIMITFALVYTVYATAVDPKKGSIGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ DHWVYWVGPL+GGGLAG IY   F+ + H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVASGDFQDHWVYWVGPLVGGGLAGLIYGNVFMQQDHAP  242

Query  863  IATQ  874
            ++ +
Sbjct  243  LSNE  246



>ref|XP_011089965.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=259

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 167/238 (70%), Gaps = 4/238 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNAL---VGlffvamah  322
            +A+GN  E  Q   ++A + EFI T +FVF G G+ MA +++ GNA     GL   A+AH
Sbjct  15   VAIGNTEEFRQPGAVKAAVAEFISTLVFVFAGSGSGMAYNKITGNAPNSPEGLIVAAVAH  74

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++    ISG H+NPAVT GL +GG+IT+ R  LY+I QLL SV AC LLT+ T
Sbjct  75   AFGLFVAVAIAANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSVVACLLLTFTT  134

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TPA +L SGV      + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  135  GGLETPAFSL-SGVSVWSAFVFEIVMTFGLVYTVYATAVDPKKGDLGTIAPIAIGFIVGA  193

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+F+GASMNPA SFGPALVS  WT HWVYW GPLIGG LAG +YE FFI  +H
Sbjct  194  NILAGGAFTGASMNPAVSFGPALVSFTWTHHWVYWAGPLIGGALAGVVYEVFFISHSH  251



>ref|XP_006356145.1| PREDICTED: aquaporin TIP2-1-like [Solanum tuberosum]
Length=249

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 170/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSGGSIKAYVAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y + QLL ++ AC LL ++T
Sbjct  64   GFALFVAVSIGANISGGHVNPAVTFGLALGGQITLLTGLFYWVAQLLGAIVACCLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHGVAAGVGATEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+A G FSG SMNPARSFGPA+ SGN+  +W+YWVGPLIGGGLAG IY   F+    HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGNFAGNWIYWVGPLIGGGLAGLIYSNVFMNYGDHV  243

Query  860  PIATQ  874
            P+++ 
Sbjct  244  PLSSD  248



>ref|XP_010915908.1| PREDICTED: probable aquaporin TIP2-2 [Elaeis guineensis]
Length=248

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 168/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL-QGNAL--VGlffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  G+AL   GL  VA+ H
Sbjct  4    IAFGRCDDSFSVHSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSGSALDPTGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S    ISG H+NPAVT GL +GG IT++   LY I QLL ++   A L  L 
Sbjct  64   GFALFVAVSIAANISGGHVNPAVTFGLALGGQITILTGILYWIAQLLGAIVG-AFLIKLV  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G+ TP H LA+GVG  +GV+MEII TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  TGMATPTHGLAAGVGAIEGVVMEIITTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++TD+W+YWVGPLIGGGLAG +Y   F+   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVASGDFTDNWIYWVGPLIGGGLAGLVYTYAFMCSVHEP  242

Query  863  IATQE  877
            IA+ E
Sbjct  243  IASSE  247



>ref|XP_009781180.1| PREDICTED: aquaporin TIP2-1-like [Nicotiana sylvestris]
Length=248

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IALG   ++  S  I+A I EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IALGRFDDSFSSGSIKAYIAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V ++    ISG H+NPAVT GL +GG IT+I    Y I Q+L ++AA  LL ++T
Sbjct  64   GLALFVAVAIAANISGGHVNPAVTFGLALGGQITIITGLFYWIAQVLGAIAASYLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF+L++TV+AT VDPKKG L  + P+  G +VGA
Sbjct  124  GGLAVPIHGVAAGVGATEGVVMEIIITFALVYTVFATAVDPKKGTLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+  +W+YWVGPL+GGGLAG  Y   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGNFAGNWIYWVGPLVGGGLAGLTYSNVFMNYDHAP  243

Query  863  IATQ  874
            + ++
Sbjct  244  LVSE  247



>gb|ABK94373.1| unknown [Populus trichocarpa]
Length=247

 Score =   204 bits (518),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 167/242 (69%), Gaps = 4/242 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+AMA ++L G+A +   GL  +A+ H
Sbjct  4    IAFGRFDDSFSLGYFKAYLAEFISTLLFVFAGVGSAMAYNKLTGDAALDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL   T
Sbjct  64   GFALFVAVSVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVACYLLKVAT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHSVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YW GPL+GGG+AG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWAGPLVGGGIAGLIYGNVFITD-HTP  242

Query  863  IA  868
            ++
Sbjct  243  LS  244



>emb|CDX75873.1| BnaC03g39560D [Brassica napus]
Length=275

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 174/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  30   IAFGSFDDSFSLASLKAYLAEFISTLLFVFAGVGSAIAYGKLTSDAALDTSGLVAIAVCH  89

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y I QLL S AAC LL ++T
Sbjct  90   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITLITGLFYWIAQLLGSTAACFLLKFVT  149

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  150  GGLAVPTHSVAAGLGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  209

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  210  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMSSSEHV  269

Query  860  PIATQ  874
            P+A+ 
Sbjct  270  PLASD  274



>ref|XP_011080630.1| PREDICTED: aquaporin TIP2-1 [Sesamum indicum]
Length=238

 Score =   203 bits (517),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 169/241 (70%), Gaps = 7/241 (3%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G   ++  +  I+A + EFI T LFVF GVG+A+A ++L  +A +         A +
Sbjct  4    IAFGRFDDSFSAASIKAYVAEFISTLLFVFAGVGSAIAYNKLTSDAAL-------DPAGL  56

Query  332  vavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggl  511
            VAV ++ G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL  +TGGL
Sbjct  57   VAVAVAVGANISGGHVNPAVTFGLAVGGQITILTGLFYWIAQLLGSIVACFLLKVVTGGL  116

Query  512  ttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIM  691
              P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGANI+
Sbjct  117  AIPTHGVAAGVGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANIL  176

Query  692  AGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVPIAT  871
            A G FSG SMNPARSFGPA+ SG+++ +W+YWVGPLIGGGLAG IY   ++ + H P+A+
Sbjct  177  AAGPFSGGSMNPARSFGPAVASGDFSGNWIYWVGPLIGGGLAGLIYSNVYMNQEHAPLAS  236

Query  872  Q  874
            +
Sbjct  237  E  237



>ref|XP_007024239.1| Delta tonoplast integral protein [Theobroma cacao]
 gb|EOY26861.1| Delta tonoplast integral protein [Theobroma cacao]
Length=248

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 167/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPDGLIAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL + G IT++    Y I QLL S+ AC LL  +T
Sbjct  64   GFALFVAVAVGANISGGHVNPAVTFGLALSGQITILTGIFYWIAQLLGSIVACFLLKAVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+GVG  QGV+MEII TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAIPIHSVAAGVGAIQGVVMEIITTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFMQSEHAP  243

Query  863  IATQ  874
            ++  
Sbjct  244  LSND  247



>gb|ADU25490.1| tonoplastic intrinsic protein [Helianthemum almeriense]
Length=252

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 163/237 (69%), Gaps = 3/237 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G  SEA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGGPSEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G TT A  L+SGVG     ++EI++TF L++TVYAT +DPKKGN+  + P+  G +VGA
Sbjct  126  NGQTTSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATALDPKKGNIGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT  853
            NI+AGG+F GASMNPA SFGPALVS NW +HWVYW GPL+GGGLAG +YE  FI  +
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWNWENHWVYWAGPLVGGGLAGLVYEFXFISNS  242



>gb|KDP29188.1| hypothetical protein JCGZ_16577 [Jatropha curcas]
Length=252

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 168/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+  EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A  L+SGVG     + EI++TF L++TVYAT +DPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYW GPL+GGGLAG +YE FFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWAGPLVGGGLAGLVYEFFFIGHNTHE  245

Query  860  PIATQE  877
             + T +
Sbjct  246  QLPTAD  251



>ref|XP_006837956.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
 gb|ERN00525.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
Length=250

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 168/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L  NA     GL   ++AH
Sbjct  6    IAIGRAEEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNASTTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL +V AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGAVVACGLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A  L SGV      + EI++TF L++TVYAT +DPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFGL-SGVSVWNAFVFEIVMTFGLVYTVYATAIDPKKGSLGIIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F+GASMNPA SFGPA+VS +W  HWVYW GPLIGGGLAG IYET FI  TH  
Sbjct  185  NILAGGAFTGASMNPAVSFGPAVVSWSWDSHWVYWAGPLIGGGLAGLIYETVFISHTHEQ  244

Query  863  IATQE  877
            + T +
Sbjct  245  LPTTD  249



>ref|XP_007215863.1| hypothetical protein PRUPE_ppa010472mg [Prunus persica]
 gb|EMJ17062.1| hypothetical protein PRUPE_ppa010472mg [Prunus persica]
Length=248

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 168/244 (69%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  NA +   GL  +A+AH
Sbjct  4    IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSNAALDPAGLVAIAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITV+    Y I QLL ++ A  +L ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITVLTGIFYWIAQLLGAIVAAFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H+LA+GVG  QGVI EII+TF+L++TVYAT  DPKKG L  + P+  G +VGA
Sbjct  124  GGLTIPIHSLAAGVGAIQGVIFEIIITFALVYTVYATAADPKKGALGTIAPMAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   F    H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFFHTEHAP  243

Query  863  IATQ  874
            +  +
Sbjct  244  LVNE  247



>ref|XP_006298401.1| hypothetical protein CARUB_v10014472mg [Capsella rubella]
 gb|EOA31299.1| hypothetical protein CARUB_v10014472mg [Capsella rubella]
Length=250

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 174/246 (71%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITVI    Y I QLL S AAC LL Y+T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++ +G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVGAGLGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMSSSEHV  243

Query  860  PIATQE  877
            P+A+ +
Sbjct  244  PLASAD  249



>ref|XP_008656321.1| PREDICTED: aquaporin TIP4-2 [Zea mays]
 gb|AFW82058.1| aquaporin TIP4-2 [Zea mays]
Length=311

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 177/238 (74%), Gaps = 8/238 (3%)
 Frame = +2

Query  173  EALQSD--CIQALIVEFICTFLFVFTGVGAAMAT----DQLQGNALVGlffvamahalvv  334
            EA   D  C++A++ E + TFLFVFTGV A+MA        +   +  L  VA+AHAL  
Sbjct  70   EAPAPDVGCVRAVLAELVLTFLFVFTGVSASMAAGAGGKPGEAMPMATLAAVAIAHALAA  129

Query  335  avmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgglt  514
             V+++AG  +SG HLNPAVT+G+L+ GHIT +R+ LY+  QLLAS  AC LL YL+GG+ 
Sbjct  130  GVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLASSLACILLRYLSGGMV  189

Query  515  tPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIMA  694
            TP H L +G+   QG++ME+ILTFSLLF  YA I+DP+   +  +GPLLTGL+VGAN +A
Sbjct  190  TPVHALGAGISPMQGLVMEVILTFSLLFVTYAMILDPRS-QVRTIGPLLTGLIVGANSLA  248

Query  695  GGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPI  865
            GG+F+GASMNPARSFGPA+ +G WT+HWVYW+GPL+GG LAGF+YE+ F+V +TH P+
Sbjct  249  GGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLAGFVYESLFMVYKTHEPL  306



>sp|P24422.2|TIP2_TOBAC RecName: Full=Probable aquaporin TIP-type RB7-18C; AltName: Full=RT-TIP; 
AltName: Full=TobRB7; AltName: Full=Tonoplast intrinsic 
protein, root-specific RB7-18C [Nicotiana tabacum]
Length=250

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 166/247 (67%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G+  ++     ++A + EFI T LFVF GVG+A+A ++L  +A +    +       
Sbjct  4    IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAH  63

Query  332  vavm---ISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               +   +S    ISG HLNPAVTLGL +GG+IT++  F Y I QLL S  AC LL Y+T
Sbjct  64   AFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H +A+G+   QGV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGLAVPTHGVAAGLNGFQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+V+G+++ +W+YW GPLIGGGLAGFIY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLAGFIYGDVFI-GCHTP  242

Query  863  IATQEAF  883
            + T E +
Sbjct  243  LPTSEDY  249



>ref|XP_009611581.1| PREDICTED: aquaporin TIP2-1-like [Nicotiana tomentosiformis]
Length=248

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   +++ S  I+A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSVSSGSIKAYVAEFISTLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V ++    ISG H+NPAVT GL +GG IT+I    Y I QLL ++AA  LL ++T
Sbjct  64   GLALFVAVAIAANISGGHVNPAVTFGLALGGQITIITGLFYWIAQLLGAIAASYLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF+L++TV+AT VDPKKG L  + P+  G +VGA
Sbjct  124  GGLAVPIHGVAAGVGATEGVVMEIIITFALVYTVFATAVDPKKGTLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+  +W+YWVGPL+GGGLAG  Y   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGNFAGNWIYWVGPLVGGGLAGLTYSNVFMNYDHAP  243

Query  863  IATQ  874
            + ++
Sbjct  244  LVSE  247



>ref|NP_001289845.1| aquaporin TIP2-1 [Solanum lycopersicum]
 dbj|BAO18634.1| tonoplast intrinsic protein 2;1 [Solanum lycopersicum]
Length=248

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 167/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T LFVF GVG+A+A +++  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSLGSIKAYIAEFISTLLFVFAGVGSAIAYNKVTADAALDPSGLVAVAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++    ISG H+NPAVT GL +GG IT++    Y I QLL ++  C LL  +T
Sbjct  64   GFALFVAVAIAANISGGHVNPAVTFGLALGGQITLLTGLFYWIAQLLGAIVGCYLLKVVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG+  P H +A+GVG  +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGMAVPIHGVAAGVGAAEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSGN+   W+YWVGPL+GGGLAGFIY   F+   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGNFAGIWIYWVGPLVGGGLAGFIYSNVFMNPEHAP  243

Query  863  IATQ  874
            +++ 
Sbjct  244  LSSD  247



>ref|XP_009758381.1| PREDICTED: probable aquaporin TIP-type RB7-18C [Nicotiana sylvestris]
Length=250

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 166/247 (67%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G+  ++     ++A + EFI T LFVF GVG+A+A ++L  +A +    +       
Sbjct  4    IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAH  63

Query  332  vavm---ISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               +   +S    ISG HLNPAVTLGL +GG+IT++  F Y I QLL S  AC LL Y+T
Sbjct  64   AFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H +A+G+   QGV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGLAVPTHGVAAGLNGFQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+V+G+++ +W+YW GPLIGGGLAGFIY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLAGFIYGDVFI-GCHTP  242

Query  863  IATQEAF  883
            + T E +
Sbjct  243  LPTSEDY  249



>ref|XP_002531118.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF31283.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 167/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+ +EA Q D ++A + EFI   +FVF G G+ MA ++L  +      GL   ++AH
Sbjct  6    IAFGSPAEAGQPDALKAALAEFISMLIFVFAGEGSGMAFNKLTSDGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GGHIT IRS LY I QLL SV AC LL + T
Sbjct  66   GFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFIRSILYWIAQLLGSVVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+SGVG    V+ EI++TF L++TVYAT VDPKKGN+  + PL  G +VGA
Sbjct  126  GGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNIGIIAPLAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYW+GP +G G+A  +YETFFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFVGAGIAAIVYETFFISPSTHE  245

Query  860  PIATQE  877
             + + +
Sbjct  246  QLPSAD  251



>ref|XP_010098813.1| Aquaporin TIP1-1 [Morus notabilis]
 gb|EXB75901.1| Aquaporin TIP1-1 [Morus notabilis]
Length=251

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 166/245 (68%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ +A ++L  N      GL   A+AH
Sbjct  6    IAIGGREEATHPDALKAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLISAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  A  LL ++T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVAALLLKFVT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P   L++GVG    V+ EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLAVPTFNLSAGVGVWNAVVFEIVITFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G F GASMNPA SFGPALVS +W++HWVYWVGPLIGGGLAG IYE  FI  +H  
Sbjct  186  NILAAGPFDGASMNPAVSFGPALVSWSWSNHWVYWVGPLIGGGLAGLIYEFVFISHSHEQ  245

Query  863  IATQE  877
            + T +
Sbjct  246  LPTTD  250



>ref|XP_009615916.1| PREDICTED: probable aquaporin TIP-type RB7-5A [Nicotiana tomentosiformis]
 sp|P21653.1|TIP1_TOBAC RecName: Full=Probable aquaporin TIP-type RB7-5A; AltName: Full=RT-TIP; 
AltName: Full=TobRB7; AltName: Full=Tonoplast intrinsic 
protein, root-specific RB7-5A [Nicotiana tabacum]
 emb|CAA38634.1| possible membrane channel protein [Nicotiana tabacum]
 gb|AAB23597.2| root-specific gene regulator [Nicotiana tabacum]
Length=250

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 166/247 (67%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA G+  ++     ++A + EFI T LFVF GVG+A+A ++L  +A +    +       
Sbjct  4    IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAH  63

Query  332  vavm---ISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               +   +S    ISG HLNPAVTLGL +GG+IT++  F Y I QLL S  AC LL Y+T
Sbjct  64   AFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             GL  P H +A+G+   QGV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGLAVPTHGVAAGLNGLQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+V+G+++ +W+YW GPLIGGGLAGFIY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLAGFIYGDVFI-GCHTP  242

Query  863  IATQEAF  883
            + T E +
Sbjct  243  LPTSEDY  249



>ref|XP_010037134.1| PREDICTED: aquaporin TIP1-1 [Eucalyptus grandis]
 gb|KCW48797.1| hypothetical protein EUGRSUZ_K02438 [Eucalyptus grandis]
Length=252

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 167/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   E    D ++A + EF  T +FVF G G+ MA ++L  N      GL   A+AH
Sbjct  6    IAVGRPEETYHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A +L+SGV      ++EI++TF L++TVYAT +DPKKGN+  + P+  G +VGA
Sbjct  126  GGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAIDPKKGNIGIVAPMAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            NI+AGG+F GASMNPA SFGPALVS +W +HWVYW GPLIGGGLAG IYE FFI   +H 
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWAGPLIGGGLAGLIYEVFFIGHSSHE  245

Query  860  PIATQE  877
            P+ T +
Sbjct  246  PLPTTD  251



>ref|XP_009135480.1| PREDICTED: aquaporin TIP2-1-like [Brassica rapa]
Length=249

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 173/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    IAFGSFDDSFSLASLKAYLAEFISTLLFVFAGVGSAIAYGKLTSDAALDTSGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT+I    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITLITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGLGAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ SG ++ HWV+WVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGGFSGHWVFWVGPLIGGGLAGLIYGNVFMSSSEHV  243

Query  860  PIATQ  874
            P+A+ 
Sbjct  244  PLASD  248



>gb|ACN33980.1| unknown [Zea mays]
 gb|AFW77489.1| hypothetical protein ZEAMMB73_386662 [Zea mays]
Length=255

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 181/241 (75%), Gaps = 6/241 (2%)
 Frame = +2

Query  170  SEALQSDCIQALIVEFICTFLFVFTGVGAAMA--TDQLQGNAL--VGlffvamahalvva  337
             E L   C++A++ E + TFLFVFTGV AAMA  +D   G+A+    L  VA+AHAL   
Sbjct  15   DEILDVGCVRAVLAELVLTFLFVFTGVSAAMAAGSDGKPGDAMPMATLAAVAIAHALAAG  74

Query  338  vmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltggltt  517
            V+++AG  +SG HLNPAVT+GL++ GHIT +R+ LY+  QLLAS AAC LL +L+GG+ T
Sbjct  75   VLVTAGFHVSGGHLNPAVTVGLMVRGHITKLRAVLYVAAQLLASSAACVLLRFLSGGMVT  134

Query  518  PAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIMAG  697
            P H L  G+   QG++ME+ILTFSLLF  YA I+DP+   +  +GPLLTGL+VGAN +AG
Sbjct  135  PVHALGRGISPMQGLVMEVILTFSLLFVTYAMILDPRS-QVRAIGPLLTGLIVGANSLAG  193

Query  698  GSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPIATQ  874
            G+F+GASMNPARSFGPAL +G+WT+HWVYW+GPL+GG LAGF+YE+ F+V + H P+   
Sbjct  194  GNFTGASMNPARSFGPALATGDWTNHWVYWIGPLLGGPLAGFVYESLFLVQKMHEPLLNG  253

Query  875  E  877
            E
Sbjct  254  E  254



>ref|XP_010545684.1| PREDICTED: aquaporin TIP2-1 [Tarenaya hassleriana]
Length=248

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 171/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++   + I+A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    IAFGSFDDSFSLNSIKAYLAEFISTLLFVFAGVGSAIAFGKLTSDAPLDAPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITV+    Y I QLL S  AC LL ++T
Sbjct  64   GFGLFVAVAVGANISGGHVNPAVTFGLALGGQITVLTGIFYWIAQLLGSTVACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++ +G+G  +G++MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLAVPIHSVGAGLGAVEGIVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +G+++ H+VYWVGPLIGGGLAG +Y   F+   HVP
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHYVYWVGPLIGGGLAGLVYSNAFMSSQHVP  243

Query  863  IATQ  874
            +A+ 
Sbjct  244  LASD  247



>gb|KDP44188.1| hypothetical protein JCGZ_05655 [Jatropha curcas]
Length=252

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 171/246 (70%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+ +E  Q+D ++A + EFI T +FVF G G+ MA ++L  +      GL   ++AH
Sbjct  6    IAIGSPAEVGQADALKAALAEFISTLIFVFAGEGSGMAFNKLTSDGSTTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GGHIT++RS LY + QLL SV AC LL + T
Sbjct  66   GFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLMRSILYWVGQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+SGV     ++ EI++TF L++TVYAT VDP+KGNL  + P+  G +VGA
Sbjct  126  GGLETSAFALSSGVSSWNALVFEIVMTFGLVYTVYATAVDPRKGNLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            NI+AGG+F GASMNPA SFGPA+VS  W++HWVYW+GP IGGG+A  +YETFFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWSNHWVYWLGPFIGGGIAAVVYETFFISPNTHE  245

Query  860  PIATQE  877
             + + +
Sbjct  246  QLPSAD  251



>ref|XP_008342659.1| PREDICTED: aquaporin TIP2-1 [Malus domestica]
 gb|AEQ29858.1| aquaporin TIP2 [Malus prunifolia]
Length=248

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+AH
Sbjct  4    IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QL+ ++ A  +L ++T
Sbjct  64   GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H+LA+GVG  QGV+ EII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTIPIHSLAAGVGAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFIHSEHAP  243

Query  863  IATQ  874
            +  +
Sbjct  244  LVNE  247



>ref|XP_011027129.1| PREDICTED: aquaporin TIP1-3-like [Populus euphratica]
Length=252

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 167/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   EA   D ++A + EFI   +FVF G G+ MA ++L  NA     GL   A+AH
Sbjct  6    IAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G LMGG+IT++RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGALMGGNITLLRSILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TPA  L+SGVG    ++ EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            NI+AGG+F GASMNPA SFGPA+VS  WT+HWVYW+GP IG  +A  +Y+  FI    H 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAALVYDNIFIGSGGHE  245

Query  860  PIATQE  877
            P+ T +
Sbjct  246  PLPTTD  251



>ref|XP_007016527.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY34146.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 171/246 (70%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+G+ +EA Q+D ++A + EFI   +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAVGSPAEAGQADALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHI+++RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHISLVRSILYWIAQLLGSVVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A +L+SGVG    V+ EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  126  GGLTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYW+GP +G  +A  +YE FFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFVGSAIAAVVYEIFFIAPNTHE  245

Query  860  PIATQE  877
             + + +
Sbjct  246  QLPSAD  251



>ref|NP_001238026.1| nodulin-26 [Glycine max]
 gb|AAA02947.1| nodulin-26 [Glycine max]
Length=255

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 163/239 (68%), Gaps = 4/239 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+GN SE  QSD ++A + EFI   +FVF G G+ MA ++L  N      GL   +++H
Sbjct  6    IAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVAASLSH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHIT+ RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+ GV  G  ++ EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTH  856
            NI+AGG+F GASMNPA SFGPA+VS  W++HWVYWVGP  G  +A  +YE FFI   TH
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWSNHWVYWVGPFAGAAIAAIVYEIFFISPNTH  244



>gb|KHN30200.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 163/239 (68%), Gaps = 4/239 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGN---ALVGlffvamah  322
            IA+GN SE  QSD ++A + EFI   +FVF G G+ MA ++L  N      GL   +++H
Sbjct  6    IAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVAASLSH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHIT+ RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+ GV  G  ++ EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAVDPKKGDLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTH  856
            NI+AGG+F GASMNPA SFGPA+VS  W++HWVYWVGP  G  +A  +YE FFI   TH
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWSNHWVYWVGPFAGAAIAAVVYEIFFISPNTH  244



>gb|ADB93067.1| aquaporin [Jatropha curcas]
Length=252

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 167/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+  EA   D ++A + EFI T +FVF G G+ MA ++L  N      GL   ++AH
Sbjct  6    IAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVAASLAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTT A  L+SGVG     + EI++TF L++TVYAT +DPKKG+L  + P+  G +VGA
Sbjct  126  GGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+AGG+F GASMNPA  FGPALVS +W +HWVYW GPL+GGGLAG +YE FFI   TH 
Sbjct  186  NILAGGAFDGASMNPAVPFGPALVSWSWDNHWVYWAGPLVGGGLAGLVYEFFFIGHNTHE  245

Query  860  PIATQE  877
             + T +
Sbjct  246  QLPTAD  251



>ref|XP_006381378.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93036.1| unknown [Populus trichocarpa]
 gb|ABK93934.1| unknown [Populus trichocarpa]
 gb|ERP59175.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 164/234 (70%), Gaps = 3/234 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQ---GNALVGlffvamah  322
            IA+G+  EA Q D ++A + EFI T +FVF G G+ MA  +L     N   GL   A+AH
Sbjct  6    IAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+SGVG     ++EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI  844
            NI+AGG+F GASMNPA SFGPALVS  WT+HWVYW GPLIGGGLAG IYE FFI
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLIYEFFFI  239



>ref|XP_002274538.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
Length=251

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   E  Q D ++A + EF  T +FVF G G+ MA  +L  +      GL   A+ H
Sbjct  6    IAIGQPQETYQPDALKAALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIAEALGH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V +S    ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   GLGLFVAVSGACNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLLLKFCT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G+TT A  ++SGV      ++EI++TF L++TVYAT +DP+KGN+  + PL  GL+V A
Sbjct  126  HGMTTSAFAISSGVTVWNAFVLEIVMTFGLVYTVYATAIDPRKGNVGIIAPLAIGLIVAA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +WT+HWVYW GPLIGGG+AG +YET FI  TH P
Sbjct  186  NILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGLVYETVFIHHTHEP  245

Query  863  IATQE  877
            +   E
Sbjct  246  LPGSE  250



>dbj|BAI66435.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 171/245 (70%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++  +  I+A + EFI T LFVF GVG+A+A  +L  +  +   GL  +A+AH
Sbjct  4    LAFGSCGDSFSATSIRAYVAEFIATLLFVFAGVGSAIAYGKLTEDGALDPAGLVAIAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++    ISG HLNPAVT GL +GGHIT++    Y + QLL S AAC LL ++T
Sbjct  64   AFALFVGVAIAANISGGHLNPAVTFGLAVGGHITILTGIFYWVAQLLGSAAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G   P H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  HGKAIPTHAVAAGMNEFEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +GN+  +WVYWVGPLIGGGLAGF+Y   FI  ++ P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLIGGGLAGFVYGDVFI-ASYQP  242

Query  863  IATQE  877
            +A Q+
Sbjct  243  VADQD  247



>gb|ABK96489.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 164/234 (70%), Gaps = 3/234 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQ---GNALVGlffvamah  322
            IA+G+  EA Q D ++A + EFI T +FVF G G+ MA  +L     N   GL   A+AH
Sbjct  6    IAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT++R  LY I QLL S  AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+SGVG     ++EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI  844
            NI+AGG+F GASMNPA SFGPALVS  WT+HWVYW GPL+GGGLAG IYE FFI
Sbjct  186  NILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLVGGGLAGLIYEFFFI  239



>ref|XP_009377878.1| PREDICTED: aquaporin TIP2-1 [Pyrus x bretschneideri]
Length=248

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 171/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF GVG+A+A ++L  +A +   GL  VA+AH
Sbjct  4    IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y I QL+ ++ A  +L ++T
Sbjct  64   GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H+LA+GVG  +GV+ EII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTIPIHSLAAGVGAIEGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ D+W+YWVGPLIGGGLAG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVGPLIGGGLAGLIYGNVFIHSEHAP  243

Query  863  IATQ  874
            + ++
Sbjct  244  LVSE  247



>gb|AGD98716.1| aquaporin protein 13 [Camellia sinensis]
 gb|AGD98717.1| aquaporin protein 14 [Camellia sinensis]
Length=251

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 163/238 (68%), Gaps = 3/238 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L G+      G+   A+AH
Sbjct  6    IAVGTREEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTGDGAATPSGVISAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GGHIT++R  LY I QLL S+ AC LL + T
Sbjct  66   AFALFVAVSIGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSIVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G++T A +L+SGV      + EI++TF L++TVYAT +DPKKGNL  + P+  G +VGA
Sbjct  126  NGMSTSAFSLSSGVSVWNAFVFEIVMTFGLVYTVYATALDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            NI+AGG+F GASMNPA SFGPA+VS  W +HWVYW GPLIGGGLAG +YE  F+   H
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWAGPLIGGGLAGLVYELCFMTHGH  243



>gb|AAL38357.1| delta tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAM10184.1| delta tonoplast intrinsic protein [Arabidopsis thaliana]
Length=250

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 174/246 (71%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITVI    Y I QLL S AAC LL Y+T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++A+G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVAAGLGSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGG LAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGELAGLIYGNVFMGSSEHV  243

Query  860  PIATQE  877
            P+A+ +
Sbjct  244  PLASAD  249



>ref|XP_010258877.1| PREDICTED: probable aquaporin TIP-type RB7-5A [Nelumbo nucifera]
Length=250

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 175/247 (71%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            I+LG+ S++     ++  + EFI T LFVF GVG+A++  +L  +A +   GL  +A+AH
Sbjct  4    ISLGSLSDSFAVGSLKTYLAEFIATLLFVFAGVGSAISYSKLTSDASLDPPGLVAIAVAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S    ISG HLNPAVT GL +GG+ITV+   LY + QLL S+ AC LL ++T
Sbjct  64   AFALFVGVSMAANISGGHLNPAVTFGLAIGGNITVLTGILYWVAQLLGSIVACLLLHFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G + P H++ASG+   +GV+MEII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  NGKSIPTHSVASGMSAIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+A G FSG SMNPARSFGPA+VSG+++ +W+YWVGPLIGGGLAG IY   FI   T +
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFSQNWIYWVGPLIGGGLAGLIYGDVFIGSYTSL  243

Query  860  PIATQEA  880
            P++   A
Sbjct  244  PVSEDYA  250



>gb|ABK21457.1| unknown [Picea sitchensis]
 gb|ABK22799.1| unknown [Picea sitchensis]
Length=250

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 174/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G   EA   D  ++ + EFI T LFVF GVG+AMA D+L  +A +   GL  VA+ H
Sbjct  5    VAFGRFDEAFGLDGFKSYLAEFISTLLFVFAGVGSAMAYDKLTSSAALDPAGLVGVAVCH  64

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++    ISG H+NPAVT GL++GG IT+++   Y I QL+ ++ AC LL ++T
Sbjct  65   GFALFVAVAIAANISGGHVNPAVTFGLVLGGQITILKGIFYWIAQLVGAIVACLLLKFVT  124

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTTP H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  125  GGLTTPTHNVAAGMSTIEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+A G FSG SMNPARSFGPA+VSG++T++WVYWVGPL+GGGLAG +Y   FI   +H 
Sbjct  185  NILAAGPFSGGSMNPARSFGPAVVSGDFTNNWVYWVGPLVGGGLAGAVYGGVFIGSHSHA  244

Query  860  PIATQ  874
            P++  
Sbjct  245  PLSQD  249



>ref|XP_006465649.1| PREDICTED: aquaporin TIP2-1-like [Citrus sinensis]
 gb|KDO56968.1| hypothetical protein CISIN_1g025865mg [Citrus sinensis]
Length=247

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 165/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A +++  +A +   GL  +A+ H
Sbjct  3    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICH  62

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ A  LL  +T
Sbjct  63   GFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVT  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  GGLAVPTHNVAAGVGAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+ D+W+YWVGPLIGGGLAG IY   F+   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMHSEHAP  242

Query  863  IATQ  874
            ++  
Sbjct  243  LSND  246



>emb|CAA65186.1| aquaporin [Helianthus annuus]
Length=248

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 173/244 (71%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G+  ++     I++ + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    IAFGSFDDSFSLSSIKSYVAEFISTLLFVFAGVGSAIAFAKLTADADLDPAGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V +S    ISG H+NPAVT GL +GG IT++    Y I Q + S+AAC LL+++T
Sbjct  64   GLALFVAVSIAANISGGHVNPAVTFGLAVGGQITILTGIFYWIAQCIGSIAACYLLSFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  QGV+MEII+TF+L++ VYAT VDPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHAVAAGVGAIQGVVMEIIITFALVYNVYATAVDPKKGDLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +G+++ HW+YWVGPL+GGGLAG IY   FI   H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWIYWVGPLVGGGLAGAIYSNVFISNEHAP  243

Query  863  IATQ  874
            ++++
Sbjct  244  LSSE  247



>ref|XP_006426918.1| hypothetical protein CICLE_v10026351mg [Citrus clementina]
 gb|ESR40158.1| hypothetical protein CICLE_v10026351mg [Citrus clementina]
 gb|KDO37345.1| hypothetical protein CISIN_1g025817mg [Citrus sinensis]
Length=247

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 165/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A +++  +A +   GL  +A+ H
Sbjct  3    IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKMTADAALDPSGLVAIAICH  62

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ A  LL  +T
Sbjct  63   GFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVT  122

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+GVG  +GV+MEII+TF L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  123  GGLAVPTHNVAAGVGAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SGN+ D+W+YWVGPLIGGGLAG IY   F+   H P
Sbjct  183  NILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMHSEHAP  242

Query  863  IATQ  874
            ++  
Sbjct  243  LSND  246



>gb|EMT15368.1| Aquaporin TIP4-3 [Aegilops tauschii]
Length=248

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 176/246 (72%), Gaps = 5/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL---QGNALVGlffvamah  322
            IALG+  EA    C++A++ E + TFLFVF GVG+A+   Q     G+    L  VA+ H
Sbjct  4    IALGHRREASDPGCLRAVLGELVLTFLFVFVGVGSAIVGGQAVAAGGDTSAALIAVALGH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            ALVVAV  +AG  ISGAH+NPAVTL L +GGHIT+IR+  +++ Q+L S  AC LL  LT
Sbjct  64   ALVVAVFATAGFHISGAHMNPAVTLSLAVGGHITLIRAAFFVLAQMLGSSLACILLRALT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H LA+GVG  QGV+ E++ TF+LLFT+YA I+DPK  +  G GPLLTGL+VGA
Sbjct  124  GGLVTPVHALAAGVGPIQGVVAEVVFTFTLLFTIYAAILDPKS-SAPGFGPLLTGLLVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            N +AGG+ +GASMNPARSFGPAL SGNW +HWVYWVGPL GG LA  +YE  F V  TH 
Sbjct  183  NTIAGGALTGASMNPARSFGPALASGNWANHWVYWVGPLAGGPLAVAVYEFIFTVPATHQ  242

Query  860  PIATQE  877
             + T E
Sbjct  243  QLPTVE  248



>gb|ABK22530.1| unknown [Picea sitchensis]
 gb|ABK23739.1| unknown [Picea sitchensis]
 gb|ACN41056.1| unknown [Picea sitchensis]
Length=250

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 174/245 (71%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G   EA   D  ++ + EFI T LFVF GVG+AMA D+L  +A +   GL  VA+ H
Sbjct  5    VAFGRFDEAFGLDGFKSYLAEFISTLLFVFAGVGSAMAYDKLTSSAALDPAGLVGVAICH  64

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++    ISG H+NPAVT GL++GG IT+++   Y I QL+ ++ AC LL ++T
Sbjct  65   GFALFVAVAIAANISGGHVNPAVTFGLVLGGQITILKGIFYWIAQLVGAIVACLLLKFVT  124

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLTTP H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  125  GGLTTPTHNVAAGMSTIEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+A G FSG SMNPARSFGPA+VSG++T++WVYWVGPL+GGGLAG +Y   FI   +H 
Sbjct  185  NILAAGPFSGGSMNPARSFGPAVVSGDFTNNWVYWVGPLVGGGLAGAVYGGVFIGSHSHA  244

Query  860  PIATQ  874
            P++  
Sbjct  245  PLSQD  249



>ref|XP_009402735.1| PREDICTED: probable aquaporin TIP4-3 [Musa acuminata subsp. malaccensis]
Length=254

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 165/239 (69%), Gaps = 4/239 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQG--NALVGlffvamaha  325
            I LG+ +EA++ D ++++  E + TFLFVF GVGA M  +++ G  + ++ +     A  
Sbjct  4    ITLGSRNEAVEPDFVRSVFTELLLTFLFVFAGVGAVMTAEEVAGGEDRIMWVVAAPAAAQ  63

Query  326  lvvavmISA-GLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             ++  MI+A GL +S  HLNPAVT+G   GG++TV+R  LY+I QLL S  AC LL Y+ 
Sbjct  64   AMLVAMITAVGLDVSAGHLNPAVTIGFAAGGYVTVVRCVLYVIAQLLGSSMACLLLKYVA  123

Query  503  g-glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvg  679
                  P H LA+G+   QGVIME + TFS++F +YA I+DPKKG + G  PLL GL VG
Sbjct  124  AGLDVLPVHALAAGMDPLQGVIMEAVFTFSMVFAIYALIMDPKKGAIAGSAPLLIGLTVG  183

Query  680  ANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTH  856
            AN +AGG+FSGASMNPARSFGPAL + +WT+HWVYW+GPL+G GLAGF +   ++  TH
Sbjct  184  ANSLAGGAFSGASMNPARSFGPALANWDWTNHWVYWLGPLVGSGLAGFAHHHLYVAGTH  242



>gb|EAY73151.1| hypothetical protein OsI_01024 [Oryza sativa Indica Group]
Length=261

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 170/256 (66%), Gaps = 15/256 (6%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNAL------------V  295
            +ALG+  EA     ++A++ E + TFLFVF+GVG+AMA   L  + L            +
Sbjct  4    LALGHHREATDPGGLRAVVAELLLTFLFVFSGVGSAMAAGNLPTSFLLLVFLLISIKIDI  63

Query  296  GlffvamahalvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVA  475
             +     AHAL+VAVM+SAGL +SG H+NPAVTLGL  GGHIT+ RS LY   QLL S  
Sbjct  64   VVLASPPAHALLVAVMVSAGLHVSGGHINPAVTLGLAAGGHITLFRSALYAAAQLLGSSL  123

Query  476  ACAlltyltg-glttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglg  652
            AC LL  LTG     P H  A GVG  + V ME +LTFSLLF VYAT+VD ++  +  LG
Sbjct  124  ACLLLVALTGGEEAVPVHAPAPGVGAARAVAMEAVLTFSLLFAVYATVVD-RRRAVGALG  182

Query  653  plltglvvgANIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYE  832
            PLL GLVVGANI+AGG +SGASMNPARSFGPAL +G W DHW+YWVGPLIGG LAG +YE
Sbjct  183  PLLVGLVVGANILAGGPYSGASMNPARSFGPALAAGEWADHWIYWVGPLIGGPLAGLVYE  242

Query  833  TFFI-VRTHVPIATQE  877
              F+    H P+   +
Sbjct  243  GLFMGPPGHEPLPRND  258



>ref|XP_009353577.1| PREDICTED: aquaporin TIP2-1 [Pyrus x bretschneideri]
Length=248

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 172/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     ++A + EFI T LFVF G+G+A+A ++L  +A +   GL  +A+AH
Sbjct  4    IAFGRCDDSFSLGSLKAYLAEFISTLLFVFAGLGSAIAYNKLTSDATLDPAGLVAIAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y + QLL ++ A  +L ++T
Sbjct  64   GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWVAQLLGAIVAAFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H+LA+GVG  +GV+ EII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTIPTHSLAAGVGAIEGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ ++W+YWVGPL+GGGLAG +Y   F+ R H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHNNWIYWVGPLVGGGLAGLVYGNLFMYREHEP  243

Query  863  IATQ  874
            + ++
Sbjct  244  LVSE  247



>ref|XP_002311146.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|EEE88513.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 170/246 (69%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ MA ++L  +A     GL   A+AH
Sbjct  6    IAVGTPGEASHPDSLRAALAEFISTLIFVFAGSGSGMAFNKLTDSASTTPAGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G L+GG+IT++RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLLLKFST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TPA  L+SGVG    V+ EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            NI+AGG+F GASMNPA SFGPA+VS  WT+HWVYW+GP IG G+A  +Y+  FI    H 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAGIAALVYDNIFIGSGGHE  245

Query  860  PIATQE  877
            P+ T +
Sbjct  246  PLPTND  251



>ref|XP_007162793.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
 gb|AFW90515.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54305.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54392.1| nodulin-26 [Phaseolus vulgaris]
 gb|AGV54457.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|AHA84233.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|ESW34787.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
Length=250

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 167/245 (68%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI T +FVF G G+ +A ++L  N      GL   ++AH
Sbjct  6    IAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLISASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT +R  +Y+I QLL SV A +LL    
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVA-SLLLAFV  124

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
               T PA  L++GVG G  +++EI++TF L++TVYAT +DPK+G+L  + P+  G +VGA
Sbjct  125  TSSTVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGSLGTIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+FSGA+MNPA +FGPA+VS  WT++W+YWVGPLIGGGLAG IYE  FI  TH  
Sbjct  185  NILLGGAFSGAAMNPAVTFGPAVVSWTWTNNWIYWVGPLIGGGLAGLIYEVVFISHTHEQ  244

Query  863  IATQE  877
            + T +
Sbjct  245  LPTTD  249



>ref|XP_009761134.1| PREDICTED: probable aquaporin TIP-type RB7-18C [Nicotiana sylvestris]
Length=250

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 170/247 (69%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA GN ++++ +  I+A + EFI T LFVF GVG+A++ ++L  +A +    +       
Sbjct  4    IAFGNYNDSVSAASIKAYLAEFIATLLFVFAGVGSAISYNKLTTDAALDPAGLVAVAVAH  63

Query  332  vavm---ISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               +   +S    ISG HLNPAVT GL++GG+IT++  F Y I QLL S  AC LL ++T
Sbjct  64   AFALFVGVSMAANISGGHLNPAVTFGLVVGGNITILTGFFYWIAQLLGSTVACLLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H +A+G+   +GV+MEI++TF+L++TVYAT  DP+KG+L  + P+  G +VGA
Sbjct  124  GGLAVPTHGVAAGLTGFEGVVMEIVITFALVYTVYATAADPQKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG+++ +W+YWVGPLIGGGLAG IY   FI  +H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFSQNWIYWVGPLIGGGLAGLIYGDVFI-GSHDP  242

Query  863  IATQEAF  883
            +   E +
Sbjct  243  LPVSEDY  249



>emb|CDM82810.1| unnamed protein product [Triticum aestivum]
Length=248

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 176/246 (72%), Gaps = 5/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQL---QGNALVGlffvamah  322
            IALG+  EA    C++A++ E + TFLFVF GVG+A+   Q     G+    L  VA+ H
Sbjct  4    IALGHRREASDPGCLRAVLGELVLTFLFVFVGVGSAIVGGQAVAAGGDTSAALIAVALGH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            ALVVAV  +AG  ISGAH+NPAVTL L +GGHIT+IR+  +++ Q+L S  AC LL  LT
Sbjct  64   ALVVAVFATAGFHISGAHMNPAVTLSLAVGGHITLIRAGFFVLAQMLGSSLACILLRALT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TP H LA+GVG  QGV+ E++ TF+LLFT+YA I+DPK  +  G GPLLTGL+VGA
Sbjct  124  GGLVTPVHALAAGVGPIQGVVAEVVFTFTLLFTIYAAILDPKS-SAPGFGPLLTGLLVGA  182

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHV  859
            N +AGG+ +GASMNPARSFGPAL SGNW +HWVYWVGPL GG LA  +YE  F V  TH 
Sbjct  183  NTIAGGALTGASMNPARSFGPALASGNWANHWVYWVGPLAGGPLAVAVYEFIFTVPATHQ  242

Query  860  PIATQE  877
             + T E
Sbjct  243  QLPTVE  248



>ref|XP_009397029.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 171/245 (70%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA     ++A + EFI T +FVF G G+ MA  +L G A     GL   A+AH
Sbjct  6    IAVGTQEEATHPGTLKAALAEFISTLIFVFAGQGSGMAFSKLTGGAATTPAGLIAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G+ +GG+IT++RS +Y I QLL S  AC LL Y T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGVFIGGNITLLRSIIYWIAQLLGSTVACLLLRYST  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL+T +  L SGV   + +++EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGLSTGSFAL-SGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGA  184

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F GASMNPA SFGPALVS +W DHWVYW GPLIGGGLAG +YE FFI  TH  
Sbjct  185  NILAGGAFDGASMNPAVSFGPALVSWSWDDHWVYWAGPLIGGGLAGLVYEFFFISHTHEQ  244

Query  863  IATQE  877
            +++ +
Sbjct  245  LSSAD  249



>ref|XP_010465638.1| PREDICTED: aquaporin TIP2-1 [Camelina sativa]
Length=250

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 173/246 (70%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFGDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITVI    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++ +G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPTHSVGAGLGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMSSSEHV  243

Query  860  PIATQE  877
            P+ + +
Sbjct  244  PLDSAD  249



>ref|XP_002316308.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|ABK94058.1| unknown [Populus trichocarpa]
 gb|EEF02479.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 167/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   EA   D ++A + EFI   +FVF G G+ MA ++L  NA     GL   A+AH
Sbjct  6    IAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVAAALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G L+GG+IT++RS LY I QLL SV AC LL + T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLLLKFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL TPA  L+SGVG    ++ EI++TF L++TVYAT VDPKKGNL  + P+  G +VGA
Sbjct  126  GGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVR-THV  859
            NI+AGG+F GASMNPA SFGPA+VS  WT+HWVYW+GP IG  +A  +Y+  FI    H 
Sbjct  186  NILAGGAFDGASMNPAVSFGPAVVSWTWTNHWVYWLGPFIGAAIAALVYDNIFIGSGGHE  245

Query  860  PIATQE  877
            P+ T +
Sbjct  246  PLPTND  251



>gb|AAG44946.1|AF290619_1 putative gamma TIP [Nicotiana glauca]
Length=251

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 169/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+  E  QS  ++A + EFICT +FVF G G+ MA ++L  + +    GL   ++AH
Sbjct  6    IAVGSHEELRQSGTLKAALAEFICTLIFVFAGQGSGMAFNKLSADGVATPAGLISASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT+ R  LY++ QLL S  AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIVAQLLGSTVACFLLEFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG++T A  L++GV      + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F+GASMNPA SFGPALVS  WT  WVYW GPL+GGG+AG +YE  FI  +H P
Sbjct  186  NILAGGAFTGASMNPAVSFGPALVSWTWTHQWVYWAGPLVGGGIAGVVYELVFINHSHEP  245

Query  863  IATQE  877
            + + +
Sbjct  246  LPSGD  250



>ref|XP_011004488.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=252

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 168/246 (68%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQ---GNALVGlffvamah  322
            IA+G+  E  Q D ++A + EFI T +FVF G G+ MA  +L     N   GL   A+AH
Sbjct  6    IAVGHYHETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIAAAIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT+ R  LY I QLL S  AC LL ++T
Sbjct  66   AFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGVLYWIAQLLGSTVACLLLKFVT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL T A  L+SGVG     ++EI++TF L++TVYAT +DPKKGNL  + P+  G +VGA
Sbjct  126  GGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGNLGIIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFI-VRTHV  859
            NI+ GG+F GASMNPA SFGPALVS +WT+HWVYW GPLIGGGLAG IYE FFI   TH 
Sbjct  186  NILVGGAFDGASMNPAVSFGPALVSWSWTNHWVYWAGPLIGGGLAGLIYELFFIGFGTHE  245

Query  860  PIATQE  877
             + T +
Sbjct  246  QLPTTD  251



>dbj|BAP33940.1| tonoplast intrinsic protein [Triticum aestivum]
Length=249

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 170/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++  +  ++A + EFI T LFVF GVG+A+A  +L  +  +   GL  +A+AH
Sbjct  4    LAFGSCGDSFSATSVRAYVAEFIATLLFVFAGVGSAIAYGKLTDDGALDPAGLVAIAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V ++    ISG HLNPAVT GL +GGHIT++    Y + QLL S AAC LL ++T
Sbjct  64   AFALFVGVAIAANISGGHLNPAVTFGLAVGGHITILTGIFYWVAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G   P H +A+G+   +GV+MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  HGKAIPTHGVAAGMNEFEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +GN+  +WVYWVGPLIGGGLAGF+Y   FI   + P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLIGGGLAGFVYGDVFI-AXYQP  242

Query  863  IATQE  877
            +A Q+
Sbjct  243  VADQD  247



>ref|XP_010504014.1| PREDICTED: aquaporin TIP2-1-like [Camelina sativa]
Length=250

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 173/246 (70%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFGDSFSLASLKAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITVI    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++ +G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPIHSVGAGLGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMSSSEHV  243

Query  860  PIATQE  877
            P+ + +
Sbjct  244  PLDSAD  249



>gb|ADE76384.1| unknown [Picea sitchensis]
Length=253

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 170/247 (69%), Gaps = 5/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNA---LVGlffvamah  322
            +A+G   E    D ++A + E I T +FVF G G+ MA  +L G+A     GL  VA+AH
Sbjct  6    LAVGRPEEVTHPDTLKAALAEGISTLIFVFAGEGSGMAFAKLTGDASSTPAGLVAVALAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
             L + V ++    ISG H+NPAVT G L+GGHIT++R  LY + QL+ +  AC LL + T
Sbjct  66   GLALFVAVAVSANISGGHVNPAVTFGALVGGHITLLRGILYWLVQLIGATVACLLLDFTT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL+T A +L+SGVG G  ++ EI++TF L++TVYAT +DPKKG L  + PL  G +V A
Sbjct  126  GGLSTTAFSLSSGVGVGNALVFEIVMTFGLVYTVYATAIDPKKGTLATIAPLCIGFIVSA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV--RTH  856
            NI+AGG+F GASMNPAR+FGPALVS    +HW+YWVGPLIGGGLAGF+YE F I    TH
Sbjct  186  NILAGGAFDGASMNPARAFGPALVSWTRENHWIYWVGPLIGGGLAGFVYELFMISPEPTH  245

Query  857  VPIATQE  877
             P+ + +
Sbjct  246  EPLPSHD  252



>ref|XP_010487476.1| PREDICTED: aquaporin TIP2-1-like [Camelina sativa]
Length=250

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 173/246 (70%), Gaps = 4/246 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++     ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  +A+ H
Sbjct  4    VAFGSFGDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V ++ G  ISG H+NPAVT GL +GG ITVI    Y I QLL S AAC LL ++T
Sbjct  64   GFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGL  P H++ +G+G  +GV+MEII+TF+L++TVYAT  DPKKG+L  + PL  GL+VGA
Sbjct  124  GGLAVPIHSVGAGLGALEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRT-HV  859
            NI+A G FSG SMNPARSFGPA+ +G+++ HWVYWVGPLIGGGLAG IY   F+  + HV
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMSSSEHV  243

Query  860  PIATQE  877
            P+ + +
Sbjct  244  PLDSAD  249



>gb|ABD65120.1| Tonoplast intrinsic protein, putative [Brassica oleracea]
 emb|CDY64499.1| BnaC01g41690D [Brassica napus]
Length=250

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 167/247 (68%), Gaps = 4/247 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALVGlffvamahalv  331
            IA+G+  ++     ++A + EFI T LFVF GVG+A+A  +L  NA +    +       
Sbjct  4    IAIGSLGDSFSVASLKAYLSEFIATLLFVFAGVGSAIAFGKLTSNAALDPAGLVAVAVAH  63

Query  332  vavm---ISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               +   +S    ISG HLNPAVTLGL +GG+ITVI SF Y I Q L S+ AC LL ++T
Sbjct  64   AFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITSFFYWIAQCLGSIVACLLLVFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
             G + P H +A+G+G  +G++MEI++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  IGESVPTHGVAAGLGAVEGIVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG+++  W+YWVGPL+GG LAG IY   FI  ++ P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFI-GSYAP  242

Query  863  IATQEAF  883
              T E++
Sbjct  243  APTTESY  249



>ref|NP_001105033.1| aquaporin TIP4-1 [Zea mays]
 sp|Q9ATL6.1|TIP41_MAIZE RecName: Full=Aquaporin TIP4-1; AltName: Full=Tonoplast intrinsic 
protein 4-1; AltName: Full=ZmTIP4-1; AltName: Full=ZmTIP4;1 
[Zea mays]
 gb|AAK26772.1| tonoplast membrane integral protein ZmTIP4-1 [Zea mays]
Length=255

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 179/234 (76%), Gaps = 6/234 (3%)
 Frame = +2

Query  191  CIQALIVEFICTFLFVFTGVGAAMA--TDQLQGNAL--VGlffvamahalvvavmISAGL  358
            C++A++ E + TFLFVFTGV AAMA  +D   G+A+    L  VA+AHAL   V+++AG 
Sbjct  22   CVRAVLAELVLTFLFVFTGVSAAMAAGSDGKPGDAMPMATLAAVAIAHALAAGVLVTAGF  81

Query  359  RISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltyltgglttPAHTLAS  538
             +SG HLNPAVT+GL++ GHIT +R+ LY+  QLLAS AAC LL +L+GG+ TP H L  
Sbjct  82   HVSGGHLNPAVTVGLMVRGHITKLRAVLYVAAQLLASSAACVLLRFLSGGMVTPVHALGR  141

Query  539  GVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgANIMAGGSFSGAS  718
            G+   QG++ME+ILTFSLLF  YA I+DP+   +  +GPLLTGL+VGAN +AGG+F+GAS
Sbjct  142  GISPMQGLVMEVILTFSLLFVTYAMILDPRS-QVRAIGPLLTGLIVGANSLAGGNFTGAS  200

Query  719  MNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIV-RTHVPIATQE  877
            MNPARSFGPAL +G+WT+HWVYW+GPL+GG LAGF+YE+ F+V + H P+   E
Sbjct  201  MNPARSFGPALATGDWTNHWVYWIGPLLGGPLAGFVYESLFLVQKMHEPLLNGE  254



>ref|XP_008380900.1| PREDICTED: aquaporin TIP2-1-like [Malus domestica]
 ref|XP_008348503.1| PREDICTED: aquaporin TIP2-1-like [Malus domestica]
Length=248

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 170/244 (70%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++      +A + EFI T LFVF GVG+A+A ++L  +A +   GL  +A+AH
Sbjct  4    IAFGRCDDSFSLGSXKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAIAIAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
               + V +S G  ISG H+NPAVT GL +GG IT++    Y   QLL ++ A  +L ++T
Sbjct  64   GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWAAQLLGAIVAAFILKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H+LA+GVG  +GV+ EII+TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTIPTHSLAAGVGVIEGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ SG++ ++W+YWVGPL+GGGLAG +Y   F+ R H P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVASGDFHNNWIYWVGPLVGGGLAGLVYGNLFMYREHEP  243

Query  863  IATQ  874
            + ++
Sbjct  244  LVSE  247



>gb|AFK36325.1| unknown [Lotus japonicus]
Length=246

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 168/244 (69%), Gaps = 5/244 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA G   ++     I+A I EFI T +FVF GVG+A+A  +L  +A +   GL  VA+ H
Sbjct  4    IAFGRFDDSFSFGSIKAYIAEFISTLIFVFAGVGSAIAYGKLTSDAALDPAGLVAVAICH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT GL +GG IT++    Y I QLL S+ AC LL ++T
Sbjct  64   AFALFVAVSVGANISGGHVNPAVTFGLALGGQITLLTGLFYWIAQLLGSIVACFLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GGLT P H++A+G G  +GV+ EII+TF L +TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGLTLPIHSVAAGAG--EGVVTEIIITFGLAYTVYATAADPKKGSLGTIAPIAIGFIVGA  181

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+VSG++ D+W+YWVGPLIGGGLAG IY   F    H P
Sbjct  182  NILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGVIYTYVFFPFQHAP  241

Query  863  IATQ  874
            +A+ 
Sbjct  242  LASD  245



>ref|XP_010933649.1| PREDICTED: probable aquaporin TIP2-1 [Elaeis guineensis]
Length=249

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 170/245 (69%), Gaps = 4/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            +A G+  ++L    ++A + EFI T LFVF GVG+A+A  +L  +A +   GL  VA+AH
Sbjct  4    LAFGSVGDSLSVGSLKAYLAEFIATLLFVFAGVGSAIAYAKLTADAALDPAGLVAVAVAH  63

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S    ISG HLNPAVT GL +GGHIT++    Y + QLL S  AC LL ++T
Sbjct  64   AFGLFVGVSMAANISGGHLNPAVTFGLAVGGHITILTGIFYWVAQLLGSTVACLLLKFVT  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG   P H +A+G+   +GV+ME+++TF+L++TVYAT  DPKKG+L  + P+  G +VGA
Sbjct  124  GGKAIPTHGVAAGMNELEGVVMEVVITFALVYTVYATAADPKKGSLGTVAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+A G FSG SMNPARSFGPA+ +GN+  +WVYWVGPLIGGGLAG IY   FI  ++ P
Sbjct  184  NILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLIGGGLAGLIYGDIFI-ASYQP  242

Query  863  IATQE  877
            +  QE
Sbjct  243  VPAQE  247



>ref|XP_009800738.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana sylvestris]
 emb|CAA69353.1| aquaporin 1 [Nicotiana tabacum]
Length=251

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 168/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G+  E  QS  ++A + EFICT +FVF G G+ MA ++L  +      GL   ++AH
Sbjct  6    IAVGSHEELRQSGTLKAALAEFICTLIFVFAGQGSGMAFNKLSADGTATPAGLISASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAVT G  +GG+IT+ R  LY++ QLL S  AC LL + T
Sbjct  66   AFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIVAQLLGSTVACFLLEFAT  125

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
            GG++T A  L++GV      + EI++TF L++TVYAT VDPKKG+L  + P+  G +VGA
Sbjct  126  GGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGA  185

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+AGG+F+GASMNPA SFGPALVS  WT  WVYW GPL+GGG+AG +YE  FI  +H P
Sbjct  186  NILAGGAFTGASMNPAVSFGPALVSWTWTHQWVYWAGPLVGGGIAGVVYELIFINHSHEP  245

Query  863  IATQE  877
            + + +
Sbjct  246  LPSGD  250



>sp|P42067.2|TIP1_MEDSA RecName: Full=Probable aquaporin TIP-type; AltName: Full=Membrane 
channel protein 1; AltName: Full=MsMCP1 [Medicago sativa]
 gb|AAC04846.1| tonoplast intrinsic protein homolog MSMCP1 [Medicago sativa]
Length=249

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 166/245 (68%), Gaps = 5/245 (2%)
 Frame = +2

Query  152  IALGNGSEALQSDCIQALIVEFICTFLFVFTGVGAAMATDQLQGNALV---Glffvamah  322
            IA+G   EA   D ++A + EFI TF+FVF G G+ +A ++L  +      GL   ++AH
Sbjct  6    IAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAH  65

Query  323  alvvavmISAGLRISGAHLNPAVTLGLLMGGHITVIRSFLYLIDQLLASVAACAlltylt  502
            A  + V +S G  ISG H+NPAV  G  +GG+IT++R  +Y+I QLL S+  C+ L    
Sbjct  66   AFALFVAVSVGANISGGHVNPAV-FGAFVGGNITLLRGIVYIIAQLLGSIV-CSALLVFV  123

Query  503  gglttPAHTLASGVGYGQGVIMEIILTFSLLFTVYATIVDPKKgnldglgplltglvvgA  682
               + PA  L+ GVG G  +++EI++TF L++TVYAT VDPKKGN+  + P+  G +VGA
Sbjct  124  TASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGA  183

Query  683  NIMAGGSFSGASMNPARSFGPALVSGNWTDHWVYWVGPLIGGGLAGFIYETFFIVRTHVP  862
            NI+ GG+F+GASMNPA SFGPA+VS +W++HWVYW GPLIGGG+AG +YE  FI  TH  
Sbjct  184  NILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQ  243

Query  863  IATQE  877
            + T +
Sbjct  244  LPTTD  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426