BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78015_g1_i1 len=587 path=[565:0-586]

Length=587
                                                                      Score     E

ref|XP_006356833.1|  PREDICTED: transcription factor bHLH74-like ...    233   2e-71   
ref|XP_004238065.1|  PREDICTED: transcription factor bHLH74             232   3e-71   
ref|XP_009763855.1|  PREDICTED: transcription factor bHLH74             232   4e-71   
ref|XP_009590631.1|  PREDICTED: transcription factor bHLH74             231   1e-70   
ref|XP_004141299.1|  PREDICTED: transcription factor bHLH74-like        208   1e-63   
gb|KDP41578.1|  hypothetical protein JCGZ_15985                         210   2e-62   
gb|ABN51065.1|  basic helix-loop-helix protein                          210   2e-62   Sesamum indicum [beniseed]
ref|XP_011074329.1|  PREDICTED: transcription factor bHLH74-like        210   2e-62   
ref|XP_004163540.1|  PREDICTED: transcription factor bHLH74-like        208   1e-61   
gb|KGN55298.1|  hypothetical protein Csa_4G645240                       208   1e-61   
ref|XP_008452681.1|  PREDICTED: transcription factor bHLH74-like        207   2e-61   
ref|XP_011069808.1|  PREDICTED: transcription factor bHLH74-like        208   2e-61   
ref|XP_004290997.1|  PREDICTED: transcription factor bHLH74-like        207   4e-61   
ref|XP_007018426.1|  Basic helix-loop-helix DNA-binding superfami...    206   6e-61   
ref|XP_007018425.1|  Basic helix-loop-helix DNA-binding superfami...    207   1e-60   
ref|XP_004498946.1|  PREDICTED: transcription factor bHLH74-like ...    205   3e-60   
ref|XP_004498947.1|  PREDICTED: transcription factor bHLH74-like ...    204   8e-60   
ref|XP_002510047.1|  DNA binding protein, putative                      202   1e-59   Ricinus communis
ref|XP_011017077.1|  PREDICTED: transcription factor bHLH74-like ...    202   3e-59   
emb|CBI19359.3|  unnamed protein product                                202   4e-59   
ref|XP_008357997.1|  PREDICTED: transcription factor bHLH74-like        202   5e-59   
ref|XP_011017076.1|  PREDICTED: transcription factor bHLH74-like ...    201   8e-59   
ref|XP_010687581.1|  PREDICTED: transcription factor bHLH74             200   1e-58   
gb|KHG12363.1|  Transcription factor bHLH74 -like protein               200   2e-58   
ref|XP_010664917.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    202   2e-58   
gb|KDO81442.1|  hypothetical protein CISIN_1g014374mg                   199   3e-58   
ref|XP_009361221.1|  PREDICTED: transcription factor bHLH74 isofo...    199   3e-58   
ref|XP_007160954.1|  hypothetical protein PHAVU_001G031300g             199   4e-58   
ref|XP_003556954.1|  PREDICTED: transcription factor bHLH74-like        199   4e-58   
ref|XP_006433666.1|  hypothetical protein CICLE_v10001249mg             199   7e-58   
gb|KDO81441.1|  hypothetical protein CISIN_1g014374mg                   199   7e-58   
ref|XP_009361213.1|  PREDICTED: transcription factor bHLH74 isofo...    199   8e-58   
ref|XP_006472332.1|  PREDICTED: transcription factor bHLH74-like ...    198   1e-57   
ref|XP_006417495.1|  hypothetical protein EUTSA_v10008002mg             196   1e-57   
ref|XP_002302386.2|  hypothetical protein POPTR_0002s11540g             197   2e-57   Populus trichocarpa [western balsam poplar]
emb|CDY53834.1|  BnaA09g57260D                                          196   2e-57   
ref|XP_010645305.1|  PREDICTED: transcription factor bHLH74 isofo...    191   2e-57   
ref|XP_008220408.1|  PREDICTED: transcription factor bHLH74 isofo...    197   4e-57   
gb|KEH39990.1|  transcription factor                                    197   4e-57   
ref|XP_008393688.1|  PREDICTED: transcription factor bHLH74 isofo...    197   5e-57   
dbj|BAF01172.1|  bHLH transcription factor like protein                 193   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008393690.1|  PREDICTED: transcription factor bHLH74 isofo...    196   6e-57   
ref|XP_009118268.1|  PREDICTED: transcription factor bHLH74-like        193   8e-57   
ref|XP_008220406.1|  PREDICTED: transcription factor bHLH74 isofo...    196   8e-57   
emb|CDY22605.1|  BnaC08g42390D                                          194   9e-57   
ref|XP_003544498.1|  PREDICTED: transcription factor bHLH74-like        196   9e-57   
gb|KEH39987.1|  transcription factor                                    196   1e-56   
ref|XP_010548590.1|  PREDICTED: transcription factor bHLH74-like        194   1e-56   
gb|KEH39988.1|  transcription factor                                    195   1e-56   
gb|KFK43307.1|  hypothetical protein AALP_AA1G107500                    193   2e-56   
ref|NP_172483.4|  transcription factor bHLH74                           193   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KEH39989.1|  transcription factor                                    194   4e-56   
gb|EYU36399.1|  hypothetical protein MIMGU_mgv1a008799mg                192   6e-56   
ref|XP_010458347.1|  PREDICTED: transcription factor bHLH74             192   7e-56   
ref|XP_006305146.1|  hypothetical protein CARUB_v10009514mg             192   7e-56   
ref|XP_002892548.1|  hypothetical protein ARALYDRAFT_888270             192   7e-56   
ref|XP_010475871.1|  PREDICTED: transcription factor bHLH74-like        192   7e-56   
ref|XP_010490708.1|  PREDICTED: transcription factor bHLH74             192   9e-56   
dbj|BAF02146.1|  bHLH transcription factor like protein                 192   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148330.1|  PREDICTED: transcription factor bHLH74-like ...    191   9e-56   
ref|XP_009148331.1|  PREDICTED: transcription factor bHLH74-like ...    191   1e-55   
gb|KHN17184.1|  Transcription factor bHLH74                             194   1e-54   
ref|XP_003634844.1|  PREDICTED: transcription factor bHLH74 isofo...    189   2e-54   
ref|XP_009144473.1|  PREDICTED: transcription factor bHLH74-like ...    186   4e-54   
ref|XP_009144471.1|  PREDICTED: transcription factor bHLH74-like ...    186   6e-54   
ref|XP_011013279.1|  PREDICTED: transcription factor bHLH74-like ...    187   1e-53   
ref|XP_011013278.1|  PREDICTED: transcription factor bHLH74-like ...    187   1e-53   
emb|CDY20659.1|  BnaC08g13990D                                          185   1e-53   
emb|CDY31048.1|  BnaA08g25980D                                          183   6e-53   
ref|XP_002306505.1|  basic helix-loop-helix family protein              185   6e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010248338.1|  PREDICTED: transcription factor bHLH74-like ...    185   1e-52   
ref|XP_007222174.1|  hypothetical protein PRUPE_ppa007762mg             183   2e-52   
ref|XP_010939355.1|  PREDICTED: transcription factor bHLH74-like ...    182   7e-52   
ref|XP_010939354.1|  PREDICTED: transcription factor bHLH74-like ...    182   9e-52   
ref|XP_010248337.1|  PREDICTED: transcription factor bHLH74-like ...    183   1e-51   
ref|XP_010939353.1|  PREDICTED: transcription factor bHLH49-like ...    181   2e-51   
ref|XP_010273628.1|  PREDICTED: transcription factor bHLH74-like ...    182   3e-51   
ref|XP_010273618.1|  PREDICTED: transcription factor bHLH74-like ...    182   3e-51   
ref|XP_010939352.1|  PREDICTED: transcription factor bHLH49-like ...    181   3e-51   
ref|XP_010939350.1|  PREDICTED: transcription factor bHLH62-like ...    181   3e-51   
ref|XP_010109419.1|  hypothetical protein L484_007082                   180   6e-51   
ref|XP_010061617.1|  PREDICTED: transcription factor bHLH74-like        179   2e-50   
ref|XP_002889780.1|  predicted protein                                  171   2e-50   
gb|EYU22588.1|  hypothetical protein MIMGU_mgv1a025708mg                175   9e-50   
gb|KDO81444.1|  hypothetical protein CISIN_1g014374mg                   176   1e-49   
emb|CDY63738.1|  BnaC05g07820D                                          174   2e-49   
ref|XP_006472333.1|  PREDICTED: transcription factor bHLH74-like ...    176   3e-49   
gb|KHN04418.1|  Transcription factor bHLH74                             172   3e-49   
ref|XP_010059819.1|  PREDICTED: transcription factor bHLH74             175   7e-49   
ref|XP_008785729.1|  PREDICTED: transcription factor bHLH74-like ...    173   1e-48   
emb|CDY57925.1|  BnaA06g37950D                                          173   2e-48   
ref|XP_008785728.1|  PREDICTED: transcription factor bHLH74-like ...    172   2e-48   
gb|EPS72135.1|  basic helix-loop-helix protein                          164   3e-48   
ref|XP_006578066.1|  PREDICTED: transcription factor bHLH74-like ...    172   3e-48   
ref|XP_003523632.1|  PREDICTED: transcription factor bHLH74-like ...    171   6e-48   
ref|XP_010248336.1|  PREDICTED: transcription factor bHLH74-like ...    173   7e-48   
ref|XP_006348629.1|  PREDICTED: transcription factor bHLH49-like ...    173   1e-47   
ref|XP_010936187.1|  PREDICTED: transcription factor bHLH74-like        171   2e-47   
ref|XP_006348631.1|  PREDICTED: transcription factor bHLH49-like ...    173   2e-47   
ref|NP_001051150.1|  Os03g0728900                                       169   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004239006.1|  PREDICTED: transcription factor bHLH49             173   2e-47   
ref|XP_010248339.1|  PREDICTED: transcription factor bHLH74-like ...    170   3e-47   
ref|XP_002463945.1|  hypothetical protein SORBIDRAFT_01g009380          168   3e-47   Sorghum bicolor [broomcorn]
ref|XP_006650534.1|  PREDICTED: transcription factor bHLH49-like        168   4e-47   
ref|XP_010248335.1|  PREDICTED: transcription factor bHLH74-like ...    171   6e-47   
ref|XP_010248334.1|  PREDICTED: transcription factor bHLH74-like ...    171   7e-47   
ref|XP_010553663.1|  PREDICTED: transcription factor bHLH74-like ...    168   1e-46   
gb|KHG16496.1|  Transcription factor bHLH62 -like protein               169   1e-46   
emb|CDX85122.1|  BnaC07g07840D                                          167   1e-46   
gb|ABK94855.1|  unknown                                                 167   2e-46   Populus trichocarpa [western balsam poplar]
tpg|DAA51145.1|  TPA: putative HLH DNA-binding domain superfamily...    163   2e-46   
dbj|BAJ92166.1|  predicted protein                                      166   2e-46   
ref|XP_003560304.1|  PREDICTED: transcription factor bHLH74-like        166   4e-46   
gb|KDO70234.1|  hypothetical protein CISIN_1g0086311mg                  162   4e-46   
gb|KDO70235.1|  hypothetical protein CISIN_1g0086311mg                  162   5e-46   
gb|EMS66130.1|  Transcription factor bHLH74                             167   5e-46   
tpg|DAA61908.1|  TPA: putative HLH DNA-binding domain superfamily...    167   6e-46   
gb|AFW67723.1|  putative HLH DNA-binding domain superfamily protein     164   8e-46   
ref|NP_001131789.1|  uncharacterized protein LOC100193160               164   1e-45   Zea mays [maize]
gb|KDO70233.1|  hypothetical protein CISIN_1g0086311mg                  162   1e-45   
ref|XP_008644536.1|  PREDICTED: transcription factor bHLH49-like ...    164   1e-45   
gb|KDO70232.1|  hypothetical protein CISIN_1g0086311mg                  162   1e-45   
ref|XP_008644537.1|  PREDICTED: transcription factor bHLH49-like ...    164   1e-45   
ref|XP_010544022.1|  PREDICTED: transcription factor bHLH74-like ...    165   1e-45   
ref|XP_002460392.1|  hypothetical protein SORBIDRAFT_02g027430          166   2e-45   Sorghum bicolor [broomcorn]
gb|KHG04243.1|  Transcription factor bHLH62 -like protein               168   2e-45   
ref|XP_011102313.1|  PREDICTED: transcription factor bHLH49-like        166   2e-45   
ref|XP_004981901.1|  PREDICTED: transcription factor bHLH49-like ...    163   2e-45   
ref|XP_003628711.1|  BHLH transcription factor                          167   2e-45   
ref|XP_003578282.1|  PREDICTED: transcription factor bHLH49-like        166   2e-45   
ref|XP_009593502.1|  PREDICTED: transcription factor bHLH49-like        167   3e-45   
ref|XP_003576061.2|  PREDICTED: transcription factor bHLH49-like        163   3e-45   
ref|XP_009767242.1|  PREDICTED: transcription factor bHLH49             167   4e-45   
gb|ADD60699.1|  putative TA1 protein                                    166   4e-45   Oryza officinalis
gb|KCW68611.1|  hypothetical protein EUGRSUZ_F02220                     164   4e-45   
ref|XP_007034153.1|  Basic helix-loop-helix DNA-binding superfami...    167   5e-45   
ref|XP_006655999.1|  PREDICTED: transcription factor bHLH49-like        165   6e-45   
gb|KFK39667.1|  hypothetical protein AALP_AA3G273700                    163   6e-45   
gb|EMS47333.1|  Transcription factor bHLH49                             164   6e-45   
ref|XP_009387111.1|  PREDICTED: transcription factor bHLH49-like        163   7e-45   
ref|XP_006352666.1|  PREDICTED: transcription factor bHLH78-like        165   7e-45   
gb|ADD60710.1|  putative TA1 protein                                    164   8e-45   Oryza brachyantha
dbj|BAJ93982.1|  predicted protein                                      164   9e-45   
ref|XP_008466092.1|  PREDICTED: transcription factor bHLH49-like        166   1e-44   
ref|XP_009106418.1|  PREDICTED: transcription factor bHLH77-like        162   1e-44   
ref|XP_011021251.1|  PREDICTED: transcription factor bHLH49-like ...    166   1e-44   
ref|XP_004957102.1|  PREDICTED: transcription factor bHLH49-like        166   1e-44   
ref|XP_011021235.1|  PREDICTED: transcription factor bHLH49-like ...    166   1e-44   
ref|XP_011021258.1|  PREDICTED: transcription factor bHLH49-like ...    166   1e-44   
ref|XP_004149484.1|  PREDICTED: transcription factor bHLH49-like        166   1e-44   
gb|KGN49799.1|  hypothetical protein Csa_5G135350                       166   1e-44   
ref|XP_004166054.1|  PREDICTED: transcription factor bHLH49-like        166   1e-44   
ref|XP_010553664.1|  PREDICTED: transcription factor bHLH74-like ...    162   1e-44   
ref|XP_007034154.1|  Basic helix-loop-helix DNA-binding superfami...    166   1e-44   
emb|CDY45835.1|  BnaA02g14180D                                          164   1e-44   
gb|ADD60686.1|  putative TA1 protein                                    164   1e-44   Oryza australiensis
ref|XP_009127689.1|  PREDICTED: transcription factor bHLH49-like        164   1e-44   
ref|XP_010553662.1|  PREDICTED: transcription factor bHLH74-like ...    162   2e-44   
ref|XP_008644538.1|  PREDICTED: transcription factor bHLH49-like ...    160   2e-44   
emb|CDY33568.1|  BnaC06g29840D                                          164   2e-44   
emb|CDX77488.1|  BnaA07g06260D                                          161   2e-44   
gb|KEH27902.1|  BHLH transcription factor                               165   2e-44   
ref|XP_002514566.1|  conserved hypothetical protein                     165   2e-44   Ricinus communis
emb|CDX81575.1|  BnaC02g18790D                                          164   2e-44   
gb|EPS62866.1|  hypothetical protein M569_11921                         154   3e-44   
ref|XP_009631088.1|  PREDICTED: transcription factor bHLH49-like ...    165   3e-44   
ref|XP_009631087.1|  PREDICTED: transcription factor bHLH49-like ...    165   3e-44   
gb|ADD60674.1|  putative TA1 protein                                    163   3e-44   Oryza meyeriana var. granulata
ref|NP_001057380.1|  Os06g0275600                                       163   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|ADX60284.1|  bHLH transcription factor                               162   4e-44   
ref|XP_009356474.1|  PREDICTED: transcription factor bHLH49-like        164   5e-44   
ref|XP_002314910.2|  basic helix-loop-helix family protein              164   5e-44   Populus trichocarpa [western balsam poplar]
emb|CDY56230.1|  BnaCnng29920D                                          160   5e-44   
ref|XP_011009204.1|  PREDICTED: transcription factor bHLH49             164   5e-44   
ref|XP_006391072.1|  hypothetical protein EUTSA_v10018444mg             163   6e-44   
ref|XP_006857065.1|  hypothetical protein AMTR_s00065p00068810          162   7e-44   
ref|XP_009105442.1|  PREDICTED: transcription factor bHLH49             162   7e-44   
ref|XP_011102214.1|  PREDICTED: transcription factor bHLH49-like        163   8e-44   
ref|XP_010913103.1|  PREDICTED: transcription factor bHLH78-like ...    163   8e-44   
ref|XP_006484281.1|  PREDICTED: transcription factor bHLH49-like ...    163   8e-44   
ref|XP_011077884.1|  PREDICTED: transcription factor bHLH49             163   8e-44   
ref|XP_006363573.1|  PREDICTED: transcription factor bHLH49-like        162   8e-44   
emb|CBI27416.3|  unnamed protein product                                163   9e-44   
ref|XP_010654187.1|  PREDICTED: transcription factor bHLH49 isofo...    164   9e-44   
ref|XP_002312366.2|  hypothetical protein POPTR_0008s11240g             164   9e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010681176.1|  PREDICTED: transcription factor bHLH49 isofo...    163   1e-43   
gb|EEC84745.1|  hypothetical protein OsI_31742                          161   1e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001063455.1|  Os09g0474100                                       161   1e-43   Oryza sativa Japonica Group [Japonica rice]
gb|ACF22714.1|  putative TA1 protein                                    161   1e-43   Brachypodium distachyon [annual false brome]
ref|XP_006484279.1|  PREDICTED: transcription factor bHLH49-like ...    163   1e-43   
ref|XP_003563957.1|  PREDICTED: transcription factor bHLH49-like        162   1e-43   
ref|NP_001031255.1|  transcription factor bHLH49                        162   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177058.1|  transcription factor bHLH49                           162   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006437828.1|  hypothetical protein CICLE_v10031122mg             163   1e-43   
ref|XP_009412181.1|  PREDICTED: transcription factor bHLH76-like        162   1e-43   
gb|AAM10942.1|AF488584_1  putative bHLH transcription factor            162   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660739.1|  PREDICTED: transcription factor bHLH49-like        161   1e-43   
emb|CDX95974.1|  BnaA07g27570D                                          162   1e-43   
ref|XP_009776786.1|  PREDICTED: transcription factor bHLH49-like        163   1e-43   
ref|XP_010681178.1|  PREDICTED: transcription factor bHLH49 isofo...    162   1e-43   
ref|XP_010488446.1|  PREDICTED: transcription factor bHLH77-like        160   1e-43   
ref|XP_006414789.1|  hypothetical protein EUTSA_v10025750mg             159   1e-43   
ref|XP_002301743.2|  hypothetical protein POPTR_0002s23650g             163   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006302168.1|  hypothetical protein CARUB_v10020178mg             162   2e-43   
ref|XP_008797587.1|  PREDICTED: transcription factor bHLH49-like ...    161   2e-43   
gb|KDP32569.1|  hypothetical protein JCGZ_13119                         162   2e-43   
emb|CDP00498.1|  unnamed protein product                                162   2e-43   
gb|EEC80389.1|  hypothetical protein OsI_22515                          162   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008389360.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    162   2e-43   
ref|XP_010511918.1|  PREDICTED: transcription factor bHLH49-like        162   2e-43   
ref|XP_008243775.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    162   2e-43   
ref|XP_009392658.1|  PREDICTED: transcription factor bHLH77             158   2e-43   
ref|XP_010681179.1|  PREDICTED: transcription factor bHLH49 isofo...    162   2e-43   
ref|XP_010415500.1|  PREDICTED: transcription factor bHLH49-like        162   2e-43   
ref|XP_010466724.1|  PREDICTED: transcription factor bHLH77             159   2e-43   
ref|XP_009102591.1|  PREDICTED: transcription factor bHLH77 isofo...    159   2e-43   
ref|XP_010512743.1|  PREDICTED: transcription factor bHLH77-like        159   2e-43   
ref|XP_010542232.1|  PREDICTED: transcription factor bHLH49-like        154   2e-43   
ref|XP_007045714.1|  Basic helix-loop-helix DNA-binding superfami...    162   2e-43   
ref|NP_189011.2|  transcription factor bHLH77                           159   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513668.1|  PREDICTED: transcription factor bHLH49-like        154   2e-43   
ref|XP_011070886.1|  PREDICTED: transcription factor bHLH49-like ...    162   2e-43   
ref|XP_008339739.1|  PREDICTED: transcription factor bHLH49-like        162   2e-43   
ref|XP_007225728.1|  hypothetical protein PRUPE_ppa003619mg             162   2e-43   
ref|XP_011070889.1|  PREDICTED: transcription factor bHLH49-like ...    162   2e-43   
ref|XP_007045713.1|  Basic helix-loop-helix DNA-binding superfami...    162   3e-43   
ref|XP_010654214.1|  PREDICTED: transcription factor bHLH49 isofo...    162   3e-43   
ref|XP_010261463.1|  PREDICTED: transcription factor bHLH49             162   3e-43   
ref|XP_010654210.1|  PREDICTED: transcription factor bHLH49 isofo...    162   3e-43   
ref|XP_007045712.1|  Basic helix-loop-helix DNA-binding superfami...    162   3e-43   
ref|XP_006492985.1|  PREDICTED: transcription factor bHLH62-like        161   3e-43   
ref|XP_010942244.1|  PREDICTED: transcription factor bHLH49-like ...    160   3e-43   
gb|KDO52837.1|  hypothetical protein CISIN_1g011621mg                   161   3e-43   
gb|EEE65517.1|  hypothetical protein OsJ_20959                          162   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010470832.1|  PREDICTED: transcription factor bHLH49-like        161   3e-43   
ref|XP_010044347.1|  PREDICTED: transcription factor bHLH49             162   3e-43   
ref|XP_006421053.1|  hypothetical protein CICLE_v10004862mg             161   3e-43   
ref|XP_008446487.1|  PREDICTED: transcription factor bHLH49 isofo...    162   3e-43   
ref|XP_008446489.1|  PREDICTED: transcription factor bHLH49 isofo...    162   4e-43   
ref|XP_008446486.1|  PREDICTED: transcription factor bHLH49 isofo...    162   4e-43   
ref|XP_009762311.1|  PREDICTED: transcription factor bHLH63-like        160   4e-43   
ref|XP_006297936.1|  hypothetical protein CARUB_v10013979mg             159   4e-43   
ref|XP_004297184.1|  PREDICTED: transcription factor bHLH49-like        160   4e-43   
ref|XP_009757727.1|  PREDICTED: transcription factor bHLH62-like        161   4e-43   
ref|XP_002887213.1|  basic helix-loop-helix family protein              161   4e-43   
ref|NP_001169165.1|  uncharacterized protein LOC100383015               160   4e-43   Zea mays [maize]
ref|XP_010913102.1|  PREDICTED: transcription factor bHLH78-like ...    161   4e-43   
ref|XP_011042744.1|  PREDICTED: transcription factor bHLH77-like        162   4e-43   
ref|XP_011084194.1|  PREDICTED: transcription factor bHLH78-like        161   5e-43   
tpg|DAA40320.1|  TPA: putative HLH DNA-binding domain superfamily...    160   5e-43   
ref|NP_001052532.2|  Os04g0350700                                       155   5e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415543.1|  PREDICTED: transcription factor bHLH49-like        159   5e-43   
ref|XP_002885587.1|  predicted protein                                  159   5e-43   
ref|XP_004147655.1|  PREDICTED: transcription factor bHLH78-like        161   5e-43   
ref|XP_006848450.1|  hypothetical protein AMTR_s00013p00245920          161   5e-43   
ref|XP_006414788.1|  hypothetical protein EUTSA_v10025750mg             157   5e-43   
ref|XP_008797586.1|  PREDICTED: transcription factor bHLH49-like ...    160   6e-43   
ref|XP_010257881.1|  PREDICTED: transcription factor bHLH49 isofo...    160   6e-43   
ref|XP_010036765.1|  PREDICTED: transcription factor bHLH62-like        161   6e-43   
ref|XP_006418851.1|  hypothetical protein EUTSA_v10002586mg             158   6e-43   
ref|XP_009627192.1|  PREDICTED: transcription factor bHLH49-like        161   6e-43   
ref|XP_004490333.1|  PREDICTED: transcription factor bHLH49-like        161   7e-43   
ref|XP_004242541.1|  PREDICTED: transcription factor bHLH62-like        160   7e-43   
ref|XP_004510232.1|  PREDICTED: transcription factor bHLH78-like ...    160   7e-43   
ref|XP_008439060.1|  PREDICTED: transcription factor bHLH62-like        160   8e-43   
emb|CDP10270.1|  unnamed protein product                                160   8e-43   
ref|XP_010100794.1|  hypothetical protein L484_015823                   160   1e-42   
ref|XP_004159328.1|  PREDICTED: transcription factor bHLH49-like        160   1e-42   
ref|XP_010257872.1|  PREDICTED: transcription factor bHLH49 isofo...    160   1e-42   
ref|XP_006573184.1|  PREDICTED: transcription factor bHLH49-like ...    160   1e-42   
ref|XP_009355681.1|  PREDICTED: transcription factor bHLH49-like        160   1e-42   
ref|XP_004510231.1|  PREDICTED: transcription factor bHLH78-like ...    160   1e-42   
ref|XP_006573185.1|  PREDICTED: transcription factor bHLH49-like ...    160   1e-42   
ref|XP_004135136.1|  PREDICTED: transcription factor bHLH49-like        160   1e-42   
ref|XP_002320444.1|  hypothetical protein POPTR_0014s14650g             160   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009621298.1|  PREDICTED: transcription factor bHLH78-like ...    159   2e-42   
ref|XP_009621297.1|  PREDICTED: transcription factor bHLH78-like ...    159   2e-42   
ref|XP_010243164.1|  PREDICTED: transcription factor bHLH62-like        160   2e-42   
ref|XP_008797585.1|  PREDICTED: transcription factor bHLH49-like ...    159   2e-42   
gb|EEE60794.1|  hypothetical protein OsJ_14380                          155   2e-42   
ref|XP_004971039.1|  PREDICTED: transcription factor bHLH78-like ...    159   2e-42   
ref|XP_006346952.1|  PREDICTED: transcription factor bHLH64-like        155   2e-42   
ref|XP_009627868.1|  PREDICTED: transcription factor bHLH62-like        159   2e-42   
ref|XP_004973759.1|  PREDICTED: transcription factor bHLH49-like        157   2e-42   
ref|XP_010943354.1|  PREDICTED: transcription factor bHLH49 isofo...    159   2e-42   
ref|XP_009391925.1|  PREDICTED: transcription factor bHLH76-like ...    159   2e-42   
ref|XP_004248023.1|  PREDICTED: transcription factor bHLH62             158   2e-42   
ref|XP_002468224.1|  hypothetical protein SORBIDRAFT_01g042070          155   2e-42   
ref|XP_006358792.1|  PREDICTED: transcription factor bHLH62-like        158   3e-42   
gb|KDP31423.1|  hypothetical protein JCGZ_11799                         159   3e-42   
ref|XP_010943352.1|  PREDICTED: transcription factor bHLH49 isofo...    159   3e-42   
gb|EEE69896.1|  hypothetical protein OsJ_29731                          161   3e-42   
ref|XP_010246667.1|  PREDICTED: transcription factor bHLH78             159   3e-42   
gb|KHG17782.1|  Transcription factor bHLH49 -like protein               159   3e-42   
gb|EEC74814.1|  hypothetical protein OsI_10634                          155   3e-42   
ref|XP_008783047.1|  PREDICTED: transcription factor bHLH49-like ...    159   3e-42   
ref|XP_010942243.1|  PREDICTED: transcription factor bHLH49-like ...    158   4e-42   
gb|EMT20393.1|  Transcription factor bHLH49                             157   4e-42   
dbj|BAK00309.1|  predicted protein                                      157   4e-42   
ref|XP_004228422.1|  PREDICTED: transcription factor bHLH49-like        159   4e-42   
ref|XP_009771720.1|  PREDICTED: transcription factor bHLH78-like        158   4e-42   
ref|XP_006574976.1|  PREDICTED: transcription factor bHLH49-like ...    159   4e-42   
ref|XP_009373612.1|  PREDICTED: transcription factor bHLH62-like        159   4e-42   
ref|XP_009371096.1|  PREDICTED: transcription factor bHLH62 isofo...    159   4e-42   
ref|XP_006365113.1|  PREDICTED: transcription factor bHLH64-like        157   4e-42   
ref|XP_010091656.1|  hypothetical protein L484_026510                   159   5e-42   
ref|XP_003520142.1|  PREDICTED: transcription factor bHLH49-like ...    159   5e-42   
ref|XP_004509761.1|  PREDICTED: transcription factor bHLH49-like ...    157   5e-42   
ref|XP_010907240.1|  PREDICTED: transcription factor bHLH62             159   5e-42   
ref|XP_008809650.1|  PREDICTED: transcription factor bHLH78-like ...    159   5e-42   
ref|XP_011000012.1|  PREDICTED: transcription factor bHLH77             159   5e-42   
ref|XP_008788970.1|  PREDICTED: transcription factor bHLH49-like        158   5e-42   
ref|XP_009419432.1|  PREDICTED: transcription factor bHLH49-like ...    155   5e-42   
gb|EMT26213.1|  Transcription factor bHLH49                             157   6e-42   
ref|XP_008809649.1|  PREDICTED: transcription factor bHLH78-like ...    159   6e-42   
ref|XP_010551346.1|  PREDICTED: transcription factor bHLH49-like        158   6e-42   
ref|XP_009792953.1|  PREDICTED: transcription factor bHLH49-like ...    158   6e-42   
ref|XP_009792959.1|  PREDICTED: transcription factor bHLH49-like ...    158   6e-42   
ref|XP_010257880.1|  PREDICTED: transcription factor bHLH49 isofo...    158   6e-42   
ref|XP_009406341.1|  PREDICTED: transcription factor bHLH62-like        158   7e-42   
ref|XP_008807018.1|  PREDICTED: transcription factor bHLH49-like ...    157   7e-42   
ref|XP_010532469.1|  PREDICTED: transcription factor bHLH49-like ...    158   7e-42   
ref|XP_002445977.1|  hypothetical protein SORBIDRAFT_07g028945          155   7e-42   
ref|XP_010685111.1|  PREDICTED: transcription factor bHLH78             158   7e-42   
gb|EMS57911.1|  Transcription factor bHLH49                             157   7e-42   
ref|XP_008337491.1|  PREDICTED: transcription factor bHLH77             158   8e-42   
gb|KHG22593.1|  Transcription factor bHLH49 -like protein               158   8e-42   
ref|XP_010544015.1|  PREDICTED: transcription factor bHLH74-like ...    155   9e-42   
ref|XP_006484808.1|  PREDICTED: transcription factor bHLH78-like ...    158   9e-42   
gb|KHN20066.1|  Transcription factor bHLH63                             155   9e-42   
ref|XP_006437241.1|  hypothetical protein CICLE_v10031135mg             158   9e-42   
ref|XP_009417028.1|  PREDICTED: transcription factor bHLH74-like        154   9e-42   
gb|KDO60872.1|  hypothetical protein CISIN_1g044652mg                   158   9e-42   
ref|XP_008807015.1|  PREDICTED: transcription factor bHLH49-like ...    157   1e-41   
ref|XP_004230908.1|  PREDICTED: transcription factor bHLH63-like ...    156   1e-41   
emb|CBI17295.3|  unnamed protein product                                157   1e-41   
ref|XP_004296985.1|  PREDICTED: transcription factor bHLH78-like        157   1e-41   
ref|XP_002489318.1|  hypothetical protein SORBIDRAFT_0010s017130        154   1e-41   
ref|XP_009788675.1|  PREDICTED: transcription factor bHLH62-like        157   1e-41   
gb|EMT10296.1|  Transcription factor bHLH74                             155   1e-41   
gb|KHG04515.1|  Transcription factor bHLH63 -like protein               156   1e-41   
emb|CCW72584.1|  ORW1943Ba0047B01.3                                     156   1e-41   
ref|XP_008813505.1|  PREDICTED: transcription factor bHLH62-like ...    157   1e-41   
ref|XP_009407236.1|  PREDICTED: transcription factor bHLH49-like        154   1e-41   
ref|XP_003527205.1|  PREDICTED: transcription factor bHLH63-like        155   1e-41   
ref|XP_010532461.1|  PREDICTED: transcription factor bHLH49-like ...    157   1e-41   
emb|CAE00874.1|  TA1 protein                                            150   1e-41   
ref|XP_002977203.1|  hypothetical protein SELMODRAFT_106386             149   2e-41   
emb|CDP01005.1|  unnamed protein product                                148   2e-41   
ref|XP_008813504.1|  PREDICTED: transcription factor bHLH62-like ...    157   2e-41   
ref|XP_011089038.1|  PREDICTED: transcription factor bHLH62 isofo...    157   2e-41   
ref|XP_009371097.1|  PREDICTED: transcription factor bHLH62 isofo...    157   2e-41   
ref|XP_010315306.1|  PREDICTED: transcription factor bHLH63-like ...    155   2e-41   
ref|XP_010552543.1|  PREDICTED: transcription factor bHLH49-like ...    154   2e-41   
emb|CAN73299.1|  hypothetical protein VITISV_005183                     157   2e-41   
ref|XP_002264969.2|  PREDICTED: transcription factor bHLH77-like        157   2e-41   
ref|XP_006412217.1|  hypothetical protein EUTSA_v10025748mg             153   2e-41   
ref|XP_002966517.1|  hypothetical protein SELMODRAFT_72702              146   2e-41   
ref|XP_009386001.1|  PREDICTED: transcription factor bHLH62-like        156   3e-41   
ref|XP_009391756.1|  PREDICTED: transcription factor bHLH49-like        155   3e-41   
ref|XP_010552542.1|  PREDICTED: transcription factor bHLH49-like ...    154   3e-41   
gb|KDP45272.1|  hypothetical protein JCGZ_15137                         156   3e-41   
ref|XP_008222784.1|  PREDICTED: transcription factor bHLH62             156   3e-41   
ref|XP_004507453.1|  PREDICTED: transcription factor bHLH63-like        154   3e-41   
ref|XP_010451395.1|  PREDICTED: transcription factor bHLH62-like        155   3e-41   
ref|XP_009390383.1|  PREDICTED: transcription factor bHLH77-like        156   3e-41   
ref|XP_002516384.1|  transcription factor, putative                     156   4e-41   
ref|XP_009587041.1|  PREDICTED: transcription factor bHLH63-like        155   4e-41   
ref|XP_007049642.1|  Basic helix-loop-helix DNA-binding superfami...    156   4e-41   
ref|XP_010527427.1|  PREDICTED: transcription factor bHLH77-like        154   4e-41   
ref|XP_007221818.1|  hypothetical protein PRUPE_ppa003543mg             156   4e-41   
ref|XP_002534345.1|  transcription factor, putative                     156   4e-41   
ref|XP_006653293.1|  PREDICTED: transcription factor bHLH62-like        150   5e-41   
ref|XP_006484809.1|  PREDICTED: transcription factor bHLH78-like ...    155   5e-41   
ref|XP_010093880.1|  hypothetical protein L484_019916                   155   5e-41   
ref|XP_010645304.1|  PREDICTED: transcription factor bHLH74 isofo...    154   5e-41   
ref|XP_008651560.1|  PREDICTED: BHLH transcription factor isoform X1    152   6e-41   
ref|XP_006602464.1|  PREDICTED: transcription factor bHLH78-like ...    155   6e-41   
ref|XP_006661402.1|  PREDICTED: transcription factor bHLH77-like        152   6e-41   
ref|XP_006437240.1|  hypothetical protein CICLE_v10031135mg             155   6e-41   
tpg|DAA62210.1|  TPA: putative HLH DNA-binding domain superfamily...    152   6e-41   
ref|XP_010464354.1|  PREDICTED: transcription factor bHLH62-like        154   6e-41   
ref|XP_010486282.1|  PREDICTED: transcription factor bHLH62-like        154   7e-41   
ref|NP_001151910.1|  BHLH transcription factor                          152   7e-41   
ref|XP_006645221.1|  PREDICTED: transcription factor bHLH78-like        155   7e-41   
ref|XP_010552794.1|  PREDICTED: transcription factor bHLH49-like        155   8e-41   
gb|AFK40379.1|  unknown                                                 153   8e-41   
ref|XP_003603935.1|  Transcription factor BEE                           153   8e-41   
gb|KHG19333.1|  Transcription factor bHLH62 -like protein               155   8e-41   
gb|AES74186.2|  BHLH transcription factor                               153   8e-41   
ref|XP_006878569.1|  hypothetical protein AMTR_s00011p00241810          154   8e-41   
gb|EAZ09639.1|  hypothetical protein OsI_31923                          152   9e-41   
ref|NP_001063582.1|  Os09g0501600                                       152   9e-41   
ref|XP_009379992.1|  PREDICTED: transcription factor bHLH77             155   9e-41   
ref|XP_010552546.1|  PREDICTED: transcription factor bHLH49-like ...    155   1e-40   
ref|XP_009144689.1|  PREDICTED: transcription factor bHLH77-like ...    150   1e-40   
ref|XP_010929074.1|  PREDICTED: transcription factor bHLH49-like        154   1e-40   
gb|KEH22550.1|  BHLH transcription factor                               154   1e-40   
ref|XP_010552544.1|  PREDICTED: transcription factor bHLH49-like ...    155   1e-40   
ref|XP_007134164.1|  hypothetical protein PHAVU_010G024800g             155   1e-40   
ref|XP_004233521.1|  PREDICTED: transcription factor HBI1               150   1e-40   
ref|XP_006602463.1|  PREDICTED: transcription factor bHLH78-like ...    155   1e-40   
ref|XP_010525275.1|  PREDICTED: transcription factor bHLH62-like        154   1e-40   
gb|KHN10339.1|  Transcription factor bHLH62                             155   1e-40   
ref|NP_001152551.1|  DNA binding protein                                154   1e-40   
ref|XP_002458978.1|  hypothetical protein SORBIDRAFT_03g043690          154   1e-40   
ref|XP_010927987.1|  PREDICTED: transcription factor bHLH49-like        154   1e-40   
gb|KEH22551.1|  BHLH transcription factor                               154   1e-40   
gb|ABR16552.1|  unknown                                                 155   1e-40   
emb|CDY08308.1|  BnaA05g13110D                                          150   2e-40   
ref|XP_010552795.1|  PREDICTED: transcription factor bHLH49-like        154   2e-40   
ref|XP_010532719.1|  PREDICTED: transcription factor bHLH77             152   2e-40   
ref|XP_006407846.1|  hypothetical protein EUTSA_v10020729mg             153   2e-40   
ref|XP_006367876.1|  PREDICTED: transcription factor bHLH49-like ...    154   2e-40   
ref|XP_009144688.1|  PREDICTED: transcription factor bHLH77-like ...    149   2e-40   
emb|CDX75440.1|  BnaA01g02620D                                          150   2e-40   
gb|EYU24278.1|  hypothetical protein MIMGU_mgv1a006404mg                153   2e-40   
ref|XP_009111901.1|  PREDICTED: transcription factor bHLH63-like        150   2e-40   
emb|CDP03937.1|  unnamed protein product                                154   2e-40   
ref|XP_004500808.1|  PREDICTED: transcription factor bHLH63-like        151   2e-40   
ref|XP_001780050.1|  predicted protein                                  146   2e-40   
ref|XP_006297628.1|  hypothetical protein CARUB_v10013649mg             153   2e-40   
tpg|DAA44192.1|  TPA: putative HLH DNA-binding domain superfamily...    147   2e-40   
gb|KDO47528.1|  hypothetical protein CISIN_1g022116mg                   150   2e-40   
ref|XP_011088410.1|  PREDICTED: transcription factor bHLH63             152   2e-40   
gb|KHN25381.1|  Transcription factor bHLH63                             152   2e-40   
ref|XP_008681607.1|  PREDICTED: putative HLH DNA-binding domain s...    149   2e-40   
ref|XP_009380361.1|  PREDICTED: transcription factor bHLH63 isofo...    151   3e-40   
gb|ABK24344.1|  unknown                                                 153   3e-40   
ref|XP_003606932.1|  BHLH transcription factor                          150   3e-40   
ref|XP_009144685.1|  PREDICTED: transcription factor bHLH77-like ...    149   3e-40   
ref|XP_003581118.1|  PREDICTED: transcription factor bHLH78-like        152   3e-40   
ref|XP_001783811.1|  predicted protein                                  145   3e-40   
ref|XP_006592100.1|  PREDICTED: transcription factor bHLH49-like ...    152   3e-40   
ref|XP_010236738.1|  PREDICTED: transcription factor bHLH49-like        150   3e-40   
emb|CDY64034.1|  BnaC06g42050D                                          149   3e-40   
gb|EYU28613.1|  hypothetical protein MIMGU_mgv1a010637mg                149   3e-40   
ref|XP_007140690.1|  hypothetical protein PHAVU_008G133600g             154   3e-40   
ref|XP_003541034.1|  PREDICTED: transcription factor bHLH49-like ...    151   3e-40   
ref|XP_009102592.1|  PREDICTED: transcription factor bHLH77 isofo...    150   4e-40   
ref|XP_009760399.1|  PREDICTED: transcription factor bHLH78-like        152   4e-40   
ref|XP_004492265.1|  PREDICTED: transcription factor bHLH78-like        153   4e-40   
ref|NP_001167725.1|  putative HLH DNA-binding domain superfamily ...    147   4e-40   
ref|XP_003532257.1|  PREDICTED: transcription factor bHLH78-like        154   4e-40   
gb|AIB04283.1|  bHLH transcription factor                               148   4e-40   
ref|XP_011024588.1|  PREDICTED: transcription factor bHLH62             153   4e-40   
gb|ACF83761.1|  unknown                                                 150   4e-40   
ref|XP_002303073.2|  basic helix-loop-helix family protein              153   4e-40   
gb|EAZ19313.1|  hypothetical protein OsJ_34859                          149   4e-40   
ref|XP_003547776.2|  PREDICTED: transcription factor bHLH62-like        153   4e-40   
ref|XP_006576637.1|  PREDICTED: transcription factor bHLH62-like        153   4e-40   
gb|KHN05778.1|  Transcription factor bHLH62                             153   5e-40   
emb|CBI37656.3|  unnamed protein product                                150   5e-40   
gb|ACU23524.1|  unknown                                                 151   5e-40   
ref|XP_008681606.1|  PREDICTED: putative HLH DNA-binding domain s...    148   5e-40   
ref|XP_008681609.1|  PREDICTED: putative HLH DNA-binding domain s...    148   5e-40   
ref|XP_009381314.1|  PREDICTED: transcription factor bHLH77-like        152   5e-40   
gb|AAM10951.1|AF488595_1  putative bHLH transcription factor            152   6e-40   
ref|XP_008681598.1|  PREDICTED: putative HLH DNA-binding domain s...    148   6e-40   
ref|XP_009596972.1|  PREDICTED: transcription factor bHLH62-like        152   6e-40   
ref|XP_006363454.1|  PREDICTED: transcription factor bHLH78-like        152   7e-40   
tpg|DAA40452.1|  TPA: putative HLH DNA-binding domain superfamily...    149   7e-40   
ref|XP_011089037.1|  PREDICTED: transcription factor bHLH62 isofo...    152   7e-40   
ref|NP_187390.1|  transcription factor bHLH62                           151   7e-40   
dbj|BAD44326.1|  putative bHLH transcription factor (bHLH062)           151   8e-40   
ref|NP_001136513.1|  uncharacterized protein LOC100216628               149   8e-40   
ref|XP_006581283.1|  PREDICTED: transcription factor bHLH74-like ...    148   8e-40   
ref|XP_008810719.1|  PREDICTED: transcription factor BEE 2-like i...    149   9e-40   
ref|XP_010499063.1|  PREDICTED: transcription factor bHLH76-like        150   9e-40   
ref|XP_003522925.1|  PREDICTED: transcription factor bHLH63-like        150   1e-39   
ref|XP_002884644.1|  predicted protein                                  151   1e-39   
ref|XP_008681593.1|  PREDICTED: putative HLH DNA-binding domain s...    148   1e-39   
ref|XP_007042170.1|  Cryptochrome-interacting basic-helix-loop-he...    150   1e-39   
ref|XP_010673318.1|  PREDICTED: transcription factor bHLH78             152   1e-39   
gb|KHN33752.1|  Transcription factor bHLH63                             150   1e-39   
tpg|DAA40453.1|  TPA: putative HLH DNA-binding domain superfamily...    149   1e-39   
gb|KFK38192.1|  hypothetical protein AALP_AA3G081200                    151   1e-39   
ref|XP_003537877.1|  PREDICTED: transcription factor bHLH49-like ...    150   1e-39   
ref|XP_002893410.1|  DNA binding protein                                149   1e-39   
ref|XP_006590895.1|  PREDICTED: transcription factor bHLH49-like ...    150   1e-39   
gb|ABK24441.1|  unknown                                                 148   1e-39   
ref|NP_001183599.1|  putative HLH DNA-binding domain superfamily ...    151   1e-39   
tpg|DAA44193.1|  TPA: putative HLH DNA-binding domain superfamily...    147   1e-39   
ref|XP_010940086.1|  PREDICTED: transcription factor bHLH63-like        149   1e-39   
ref|XP_008681588.1|  PREDICTED: putative HLH DNA-binding domain s...    147   1e-39   
ref|NP_001031093.1|  protein CIB5                                       149   1e-39   
ref|XP_007042171.1|  Cryptochrome-interacting basic-helix-loop-he...    150   1e-39   
ref|NP_001045188.1|  Os01g0915600                                       151   1e-39   
ref|XP_010477873.1|  PREDICTED: transcription factor bHLH76-like        150   1e-39   
ref|XP_007042169.1|  Cryptochrome-interacting basic-helix-loop-he...    150   2e-39   
ref|XP_008795935.1|  PREDICTED: transcription factor bHLH63-like        148   2e-39   
ref|XP_010925976.1|  PREDICTED: transcription factor bHLH63-like        149   2e-39   
gb|ABF94800.1|  Helix-loop-helix DNA-binding domain containing pr...    153   2e-39   
ref|XP_008681576.1|  PREDICTED: putative HLH DNA-binding domain s...    148   2e-39   
ref|XP_009378517.1|  PREDICTED: transcription factor bHLH63-like ...    150   2e-39   
ref|XP_009419224.1|  PREDICTED: transcription factor bHLH49-like        147   2e-39   
gb|AIA57941.1|  basic helix-loop-helix protein                          142   2e-39   
emb|CDY28061.1|  BnaC05g44630D                                          150   2e-39   
gb|ACN21632.1|  putative basic helix-loop-helix protein BHLH7           148   2e-39   
ref|XP_008377294.1|  PREDICTED: transcription factor bHLH63 isofo...    150   2e-39   



>ref|XP_006356833.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356834.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356835.1| PREDICTED: transcription factor bHLH74-like isoform X3 [Solanum 
tuberosum]
Length=382

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 145/212 (68%), Gaps = 44/212 (21%)
 Frame = +2

Query  8    DVLECSKEQ-GKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATN  124
            D  +CSKEQ G K+HKT QN S+                     K++YVHVRAKRGQATN
Sbjct  166  DSSDCSKEQDGGKRHKTDQNVSSNLRSKQAGKQVKDDSDGGEPPKDSYVHVRAKRGQATN  225

Query  125  SHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLAT  304
            SHSLAERVRRE+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLAT
Sbjct  226  SHSLAERVRRERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLAT  285

Query  305  VNPEMNLDVEQILPKDIF-------------------LPGLNIPHRSFTCIPGST-PLHA  424
            VNPE+N D+++IL K++                    LP   I H SF  IPG+T P H 
Sbjct  286  VNPELNFDIDRILSKEMLHQQTSNAALLGLGPGLSSSLPFPGISHGSFAGIPGTTPPFHP  345

Query  425  LPQNVWDNDLQSILQKGFD---SMSNRGPNDR  511
            LPQNVWDN+LQS+LQ GFD   SM+N GPN R
Sbjct  346  LPQNVWDNELQSLLQMGFDSTSSMNNMGPNGR  377



>ref|XP_004238065.1| PREDICTED: transcription factor bHLH74 [Solanum lycopersicum]
 ref|XP_010320290.1| PREDICTED: transcription factor bHLH74 [Solanum lycopersicum]
 ref|XP_010320291.1| PREDICTED: transcription factor bHLH74 [Solanum lycopersicum]
 ref|XP_010320292.1| PREDICTED: transcription factor bHLH74 [Solanum lycopersicum]
Length=382

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 144/212 (68%), Gaps = 44/212 (21%)
 Frame = +2

Query  8    DVLECSKEQ-GKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATN  124
            D  +CSKEQ G K+HKT QN S+                     K+NYVHVRAKRGQATN
Sbjct  166  DSSDCSKEQDGGKRHKTDQNVSSNLRNKQAGKQVKDDSDGGEPPKDNYVHVRAKRGQATN  225

Query  125  SHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLAT  304
            SHSLAERVRRE+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLAT
Sbjct  226  SHSLAERVRRERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLAT  285

Query  305  VNPEMNLDVEQILPKDIF-------------------LPGLNIPHRSFTCIPGST-PLHA  424
            VNPE+N D+++IL K++                    LP   I H SF  IP +T P H 
Sbjct  286  VNPELNFDIDRILSKEMLHQQTSNAALLGLGPGLSSSLPFPGISHGSFAGIPATTPPFHP  345

Query  425  LPQNVWDNDLQSILQKGFD---SMSNRGPNDR  511
            LPQNVWDN+LQS+LQ GFD   SM+N GPN R
Sbjct  346  LPQNVWDNELQSLLQMGFDSTSSMNNMGPNGR  377



>ref|XP_009763855.1| PREDICTED: transcription factor bHLH74 [Nicotiana sylvestris]
Length=396

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 146/211 (69%), Gaps = 43/211 (20%)
 Frame = +2

Query  8    DVLECSKEQGKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATNS  127
            D  +CSKEQ  K+HKT QN+ +                     K+NYVH+RAKRGQATNS
Sbjct  181  DSSDCSKEQDGKRHKTDQNNISNLRSKETGKQVKEDSDGGEPPKDNYVHIRAKRGQATNS  240

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRRE+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  241  HSLAERVRRERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  300

Query  308  NPEMNLDVEQILPKDIF-------------------LPGLNIPHRSFTCIPGST-PLHAL  427
            NPE+N D+++ILPK++                    LP   I H SFT +PG+T P H L
Sbjct  301  NPELNFDIDRILPKEMLHQQTSNAVLLGLGPGMSSSLPFPGISHGSFTGMPGTTPPFHPL  360

Query  428  PQNVWDNDLQSILQKGFD---SMSNRGPNDR  511
            PQ+VWDN+LQS+LQ GF+   S++N GPN R
Sbjct  361  PQHVWDNELQSLLQMGFEANSSINNMGPNGR  391



>ref|XP_009590631.1| PREDICTED: transcription factor bHLH74 [Nicotiana tomentosiformis]
 ref|XP_009590632.1| PREDICTED: transcription factor bHLH74 [Nicotiana tomentosiformis]
 ref|XP_009590633.1| PREDICTED: transcription factor bHLH74 [Nicotiana tomentosiformis]
Length=397

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 146/212 (69%), Gaps = 44/212 (21%)
 Frame = +2

Query  8    DVLECSKEQGKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATNS  127
            D  +CSKEQ  K+HKT QN+S+                     K+NYVH+RAKRGQATNS
Sbjct  181  DNSDCSKEQDGKRHKTDQNNSSNLRSKEAGKQVKEDSDGGEPPKDNYVHIRAKRGQATNS  240

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRRE+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  241  HSLAERVRRERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  300

Query  308  NPEMNLDVEQILPKDIF-------------------LPGLNIPHRSFTCIPGST-PLHAL  427
            NPE+N D+++IL K++                    LP   I H SFT +PG+T P H L
Sbjct  301  NPELNFDIDRILSKEMLHQQTSNAVLLGLGPGMSSSLPFPGISHGSFTGMPGTTPPFHPL  360

Query  428  PQNVWDNDLQSILQKGFD---SMSN-RGPNDR  511
            PQNVWDN+LQS+LQ GF+   SMSN  GPN R
Sbjct  361  PQNVWDNELQSLLQMGFETNSSMSNIVGPNGR  392



>ref|XP_004141299.1| PREDICTED: transcription factor bHLH74-like [Cucumis sativus]
Length=249

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 28/190 (15%)
 Frame = +2

Query  26   KEQGKK-KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            K  GK+ K K+  +  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPG
Sbjct  55   KSTGKQTKEKSSNSAEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPG  114

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFL-------  361
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N+D+E+IL KDIF        
Sbjct  115  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPDVNVDIERILSKDIFNIRGSSGN  174

Query  362  -----PGLNI-----PHRSF------TCIP-GSTPLHALPQNVWDNDLQSILQKGFDSMS  490
                 PGL+      PHR F      + +P  ST    +PQ + ++DLQS+LQ GFDS S
Sbjct  175  VLGFDPGLSAVSPVPPHRMFQFQGTMSSMPTTSTQFPPMPQTMLESDLQSLLQMGFDSGS  234

Query  491  ---NRGPNDR  511
               N GPN R
Sbjct  235  TIDNLGPNGR  244



>gb|KDP41578.1| hypothetical protein JCGZ_15985 [Jatropha curcas]
Length=412

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 134/212 (63%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATN  124
            G+  +  KEQ +KK +T QN  A                     KENY+HVRA+RGQATN
Sbjct  196  GNSSDFQKEQDEKKPRTEQNTGANLRGKQAAKPTKDNSNSGEAPKENYIHVRARRGQATN  255

Query  125  SHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLAT  304
            SHSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLAT
Sbjct  256  SHSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLAT  315

Query  305  VNPEMNLDVEQILPKDI------------FLPGLNIPHRSFTCIPGSTP--------LHA  424
            VNPE+N+D+E+IL KDI            F PG+N    S    P + P           
Sbjct  316  VNPELNIDIERILSKDILHPRGGNSAFMGFTPGMNAHPYSHGMFPSTIPAIPNTNPQFPH  375

Query  425  LPQNVWDNDLQSILQKGFDS---MSNRGPNDR  511
            +P  V DNDLQS+ Q GFDS   M + GPN R
Sbjct  376  VPHTVLDNDLQSLFQMGFDSSSAMDSLGPNGR  407



>gb|ABN51065.1| basic helix-loop-helix protein [Sesamum indicum]
Length=400

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 137/194 (71%), Gaps = 35/194 (18%)
 Frame = +2

Query  8    DVLECSKEQGKKKH-----KTRQ-------NDS---ARKENYVHVRAKRGQATNSHSLAE  142
            D+ E  KE  +KK+     ++RQ       N S   A KENY+HVRAKRGQATNSHSLAE
Sbjct  190  DLAELPKEYDEKKNSGPSSRSRQAVKEAKDNSSGAEASKENYIHVRAKRGQATNSHSLAE  249

Query  143  RVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMN  322
            RVRRE+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N
Sbjct  250  RVRRERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELN  309

Query  323  LDVEQILPKDIFL------------PGLN-------IPHRSFTCIPGSTP-LHALPQNVW  442
            +D+E++L KDI              PGL+       +P  +    PG+ P   +LPQN+W
Sbjct  310  VDIERLLSKDILHSRGSNATALGIGPGLSSSHPFQGLPQGTLNAFPGTAPQFQSLPQNLW  369

Query  443  DNDLQSILQKGFDS  484
            +N+LQ+ILQ G+DS
Sbjct  370  NNELQNILQNGYDS  383



>ref|XP_011074329.1| PREDICTED: transcription factor bHLH74-like [Sesamum indicum]
 ref|XP_011074330.1| PREDICTED: transcription factor bHLH74-like [Sesamum indicum]
Length=405

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 137/194 (71%), Gaps = 35/194 (18%)
 Frame = +2

Query  8    DVLECSKEQGKKKH-----KTRQ-------NDS---ARKENYVHVRAKRGQATNSHSLAE  142
            D+ E  KE  +KK+     ++RQ       N S   A KENY+HVRAKRGQATNSHSLAE
Sbjct  195  DLAELPKEYDEKKNSGPSSRSRQAVKEAKDNSSGAEASKENYIHVRAKRGQATNSHSLAE  254

Query  143  RVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMN  322
            RVRRE+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N
Sbjct  255  RVRRERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELN  314

Query  323  LDVEQILPKDIFL------------PGLN-------IPHRSFTCIPGSTP-LHALPQNVW  442
            +D+E++L KDI              PGL+       +P  +    PG+ P   +LPQN+W
Sbjct  315  VDIERLLSKDILHSRGSNATALGIGPGLSSSHPFQGLPQGTLNAFPGTAPQFQSLPQNLW  374

Query  443  DNDLQSILQKGFDS  484
            +N+LQ+ILQ G+DS
Sbjct  375  NNELQNILQNGYDS  388



>ref|XP_004163540.1| PREDICTED: transcription factor bHLH74-like [Cucumis sativus]
Length=402

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 28/190 (15%)
 Frame = +2

Query  26   KEQGKK-KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            K  GK+ K K+  +  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPG
Sbjct  208  KSTGKQTKEKSSNSAEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPG  267

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFL-------  361
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N+D+E+IL KDIF        
Sbjct  268  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPDVNVDIERILSKDIFNIRGSSGN  327

Query  362  -----PGLNI-----PHRSF------TCIP-GSTPLHALPQNVWDNDLQSILQKGFDSMS  490
                 PGL+      PHR F      + +P  ST    +PQ + ++DLQS+LQ GFDS S
Sbjct  328  VLGFDPGLSAVSPVPPHRMFQFQGTMSSMPTTSTQFPPMPQTMLESDLQSLLQMGFDSGS  387

Query  491  ---NRGPNDR  511
               N GPN R
Sbjct  388  TIDNLGPNGR  397



>gb|KGN55298.1| hypothetical protein Csa_4G645240 [Cucumis sativus]
Length=402

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 28/190 (15%)
 Frame = +2

Query  26   KEQGKK-KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            K  GK+ K K+  +  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPG
Sbjct  208  KSTGKQTKEKSSNSAEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPG  267

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFL-------  361
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N+D+E+IL KDIF        
Sbjct  268  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPDVNVDIERILSKDIFNIRGSSGN  327

Query  362  -----PGLNI-----PHRSF------TCIP-GSTPLHALPQNVWDNDLQSILQKGFDSMS  490
                 PGL+      PHR F      + +P  ST    +PQ + ++DLQS+LQ GFDS S
Sbjct  328  VLGFDPGLSAVSPVPPHRMFQFQGTMSSMPTTSTQFPPMPQTMLESDLQSLLQMGFDSGS  387

Query  491  ---NRGPNDR  511
               N GPN R
Sbjct  388  TIDNLGPNGR  397



>ref|XP_008452681.1| PREDICTED: transcription factor bHLH74-like [Cucumis melo]
Length=402

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 136/190 (72%), Gaps = 28/190 (15%)
 Frame = +2

Query  26   KEQGKK-KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            K  GK+ K K+  +  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPG
Sbjct  208  KSTGKQTKEKSNNSAEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPG  267

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFL-------  361
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N+D+E+IL KDIF        
Sbjct  268  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPDVNVDIERILSKDIFNVRGSNGN  327

Query  362  -----PGLNI-----PHRSF------TCIP-GSTPLHALPQNVWDNDLQSILQKGFDSMS  490
                 PGL+      PHR F      + +P  ST    LPQ + ++DLQS+LQ GFDS S
Sbjct  328  VLGFDPGLSAVSPVPPHRMFQFQGTMSNMPTTSTQFPPLPQTMLESDLQSLLQMGFDSGS  387

Query  491  ---NRGPNDR  511
               N GPN R
Sbjct  388  TIDNLGPNGR  397



>ref|XP_011069808.1| PREDICTED: transcription factor bHLH74-like [Sesamum indicum]
Length=422

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 23/166 (14%)
 Frame = +2

Query  77   KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYV  256
            K+NY+HVRAKRGQATNSHSLAERVRRE+ISERMRLLQELVPGCNKI GKA+MLD+II YV
Sbjct  250  KDNYIHVRAKRGQATNSHSLAERVRRERISERMRLLQELVPGCNKITGKAMMLDEIINYV  309

Query  257  QSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF------------LPGLNIPHR-----  385
            QSLQQQVEFLSMKLATVNPE+N+D+++IL +DI              PGL++ H      
Sbjct  310  QSLQQQVEFLSMKLATVNPELNVDIDRILSEDILQLRGSNATGLGIAPGLSLSHSLPAYT  369

Query  386  --SFTCIPGST-PLHALPQNVWDNDLQSILQKGFD---SMSNRGPN  505
              +F   PG T P H +PQ++W+N+LQ ILQ GFD   S+S  GPN
Sbjct  370  QGTFNGGPGPTPPFHPIPQHLWNNELQGILQMGFDPDSSISRLGPN  415



>ref|XP_004290997.1| PREDICTED: transcription factor bHLH74-like [Fragaria vesca subsp. 
vesca]
Length=430

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 127/177 (72%), Gaps = 21/177 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+ GK+   T Q+  A K++Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  239  KQAGKQTKDTSQSGDAAKDSYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  298

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E+IL KDI          
Sbjct  299  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEVNIDIERILSKDIMNSRNGSAAI  358

Query  356  --FLPGLNIPH--------RSFTCIPGSTP-LHALPQNVWDNDLQSILQKGFDSMSN  493
              F PG+N  H         +   +P + P   ++PQ V DN+LQ +   GFDS SN
Sbjct  359  FGFSPGMNSSHPYAHGMFQGTLPNMPSTAPQFPSMPQTVMDNELQGLFHMGFDSSSN  415



>ref|XP_007018426.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY15651.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=398

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 131/184 (71%), Gaps = 24/184 (13%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+   + Q   A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  207  KQIAKQAKDSSQTGEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  266

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E++L KDI          
Sbjct  267  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDLERVLSKDILHSRGGSAGI  326

Query  356  --FLPGLN----IPHRSF----TCIPGSTP-LHALPQNVWDNDLQSILQKGFDS---MSN  493
              F PGLN     P R F    + +P + P    LPQ V DN+LQ++ Q G+DS   M +
Sbjct  327  LGFGPGLNSSHPFPPRIFPGTISGVPSTNPQFPPLPQTVLDNELQNLFQMGYDSSSAMDS  386

Query  494  RGPN  505
             GPN
Sbjct  387  LGPN  390



>ref|XP_007018425.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY15650.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=482

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 132/186 (71%), Gaps = 24/186 (13%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+   + Q   A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  292  KQIAKQAKDSSQTGEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  351

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E++L KDI          
Sbjct  352  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDLERVLSKDILHSRGGSAGI  411

Query  356  --FLPGLN----IPHRSF----TCIPGSTP-LHALPQNVWDNDLQSILQKGFDS---MSN  493
              F PGLN     P R F    + +P + P    LPQ V DN+LQ++ Q G+DS   M +
Sbjct  412  LGFGPGLNSSHPFPPRIFPGTISGVPSTNPQFPPLPQTVLDNELQNLFQMGYDSSSAMDS  471

Query  494  RGPNDR  511
             GPN R
Sbjct  472  LGPNGR  477



>ref|XP_004498946.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Cicer 
arietinum]
Length=426

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 128/179 (72%), Gaps = 23/179 (13%)
 Frame = +2

Query  44   KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGK  223
            K  ++    A K+N++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI GK
Sbjct  243  KENSQSGGDASKDNFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKITGK  302

Query  224  AVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI-----------FLPGL  370
            AVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DVE+IL KDI           F+PG+
Sbjct  303  AVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVERILSKDILQSRMGLGIGGFMPGI  362

Query  371  N----IPHRSF----TCIP-GSTPLHALPQNVWDNDLQSILQKGFDS---MSNRGPNDR  511
            +     P+ SF      +P  ST   +LPQNV D+D QS    G+DS   + N GPN R
Sbjct  363  SSSHPFPNASFQGNMAGMPSSSTQFPSLPQNVLDHDFQSFYGMGYDSNTALDNLGPNGR  421



>ref|XP_004498947.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Cicer 
arietinum]
Length=423

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 20/176 (11%)
 Frame = +2

Query  44   KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGK  223
            K  ++    A K+N++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI GK
Sbjct  243  KENSQSGGDASKDNFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKITGK  302

Query  224  AVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------FLPGLN--  373
            AVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DVE+IL KD         F+PG++  
Sbjct  303  AVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVERILSKDSRMGLGIGGFMPGISSS  362

Query  374  --IPHRSF----TCIP-GSTPLHALPQNVWDNDLQSILQKGFDS---MSNRGPNDR  511
               P+ SF      +P  ST   +LPQNV D+D QS    G+DS   + N GPN R
Sbjct  363  HPFPNASFQGNMAGMPSSSTQFPSLPQNVLDHDFQSFYGMGYDSNTALDNLGPNGR  418



>ref|XP_002510047.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52234.1| DNA binding protein, putative [Ricinus communis]
Length=408

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 134/212 (63%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATN  124
            G+  +  KEQ +KK +T QN +A                     KENY+HVRA+RGQATN
Sbjct  192  GNSSDIPKEQDEKKSRTEQNTAANLRGKQAAKQAKENSHSGEAPKENYIHVRARRGQATN  251

Query  125  SHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLAT  304
            SHSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLAT
Sbjct  252  SHSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLAT  311

Query  305  VNPEMNLDVEQILPKDI------------FLPGLNIPHRSFTCIPGSTP--------LHA  424
            VNPE+N+D+E+IL KDI              PG+N    S    P + P           
Sbjct  312  VNPELNIDIERILSKDILHSRGGNAAIMGLSPGINAHPYSHGIFPPNIPVIPNTNPQFPP  371

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            +P  V +NDLQ++ Q GFDS S   + GPN R
Sbjct  372  MPHTVLENDLQNLFQMGFDSGSAIDSLGPNGR  403



>ref|XP_011017077.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Populus 
euphratica]
Length=398

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 126/185 (68%), Gaps = 23/185 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+     Q+    KENY HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGC
Sbjct  209  KQAAKQAKDDTQSGEVPKENYFHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGC  268

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+ +DVE+IL KDI          
Sbjct  269  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELQIDVERILSKDILHSRGGNAAI  328

Query  356  --FLPGLN---IPHRSF----TCIPGSTP-LHALPQNVWDNDLQSILQKGFDSMS---NR  496
              + PG++    PHR F      IP S P     P  V DN+LQS  Q GFDS S   N 
Sbjct  329  LGYSPGISSHPYPHRIFQPGIQVIPNSNPQFSPAPHAVLDNELQSYFQMGFDSSSAIDNL  388

Query  497  GPNDR  511
            GPN R
Sbjct  389  GPNAR  393



>emb|CBI19359.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 123/171 (72%), Gaps = 18/171 (11%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K       N  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  242  KQPNKHAKDNSSNGEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  301

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E++L KDI          
Sbjct  302  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIERLLSKDILNSRGGSTSV  361

Query  356  --FLPGLN----IPHR-SFTCIPG-STPLHALPQNVWDNDLQSILQKGFDS  484
              F PG++     PH  S   +PG  TP     Q VWD +LQS+LQ GFDS
Sbjct  362  LGFGPGMSSSHPYPHGISQGTLPGIPTPQFHSTQAVWDGELQSLLQMGFDS  412



>ref|XP_008357997.1| PREDICTED: transcription factor bHLH74-like [Malus domestica]
Length=433

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 136/212 (64%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            G+  +  KEQ +KK KT +N +A                    K++Y+HVRA+RGQATNS
Sbjct  217  GESSDYLKEQDEKKAKTEENAAANLRGKQMGKQTKENSQSGDPKDSYIHVRARRGQATNS  276

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  277  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  336

Query  308  NPEMNLDVEQILPKDI------------FLPGLNIPH--------RSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F PG+   H         +   +P S P   +
Sbjct  337  NPELNIDIERILTKDILNSRSGGGAIFGFSPGIGSSHPYPPGMFPGNLPSMPTSAPQFPS  396

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            LPQNV DN+LQ +   GFDS S   N G N R
Sbjct  397  LPQNVLDNELQGLFHMGFDSSSANDNMGQNGR  428



>ref|XP_011017076.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Populus 
euphratica]
Length=399

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 125/183 (68%), Gaps = 23/183 (13%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+     Q+    KENY HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGC
Sbjct  209  KQAAKQAKDDTQSGEVPKENYFHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGC  268

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+ +DVE+IL KDI          
Sbjct  269  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELQIDVERILSKDILHSRGGNAAI  328

Query  356  --FLPGLN---IPHRSF----TCIPGSTP-LHALPQNVWDNDLQSILQKGFDSMS---NR  496
              + PG++    PHR F      IP S P     P  V DN+LQS  Q GFDS S   N 
Sbjct  329  LGYSPGISSHPYPHRIFQPGIQVIPNSNPQFSPAPHAVLDNELQSYFQMGFDSSSAIDNL  388

Query  497  GPN  505
            GPN
Sbjct  389  GPN  391



>ref|XP_010687581.1| PREDICTED: transcription factor bHLH74 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687589.1| PREDICTED: transcription factor bHLH74 [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 129/184 (70%), Gaps = 23/184 (13%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK+ GK+     Q + + K+NY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVP
Sbjct  221  SSKQAGKQPKDDLQGEDS-KQNYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVP  279

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------  355
            GCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E++L KDI        
Sbjct  280  GCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNVDIERLLSKDILHSRGSGP  339

Query  356  ----FLPGLNIP-------HRSFTCIPGSTPLHALPQNVWDNDLQSILQKGFDS---MSN  493
                F  G+          H++ T    ++  H + Q VWD DLQS+L  GFDS   ++ 
Sbjct  340  PVLGFDQGMGSSHAFSQGIHQNLTMPNSASQYHHMSQAVWDGDLQSLLHMGFDSNSAVAG  399

Query  494  RGPN  505
             GPN
Sbjct  400  LGPN  403



>gb|KHG12363.1| Transcription factor bHLH74 -like protein [Gossypium arboreum]
Length=413

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 135/214 (63%), Gaps = 45/214 (21%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR--------------------KENYVHVRAKRGQATN  124
            G+  +  KE   KK KT QN +A                     KENY+HVRA+RGQATN
Sbjct  195  GESCDVPKEHDSKKQKTEQNATANSRGKQVVKQAKDSSQTGEAPKENYIHVRARRGQATN  254

Query  125  SHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLAT  304
            SHSLAERVRREKISERM+LLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLAT
Sbjct  255  SHSLAERVRREKISERMKLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLAT  314

Query  305  VNPEMNLDVEQILPKDI------------FLPGLNIPH--------RSFTCIPGSTPLHA  424
            VNPE+N+D+E+IL KDI            F PG+N  H         + + IP + P   
Sbjct  315  VNPELNIDLERILSKDILHSRGGNAAVVGFNPGINSSHPFSSGIFPGTISGIPNTNPQFP  374

Query  425  --LPQNVWDNDLQSILQKGFDS---MSNRGPNDR  511
               PQ V DN+LQ++ Q GFDS   M + GP  R
Sbjct  375  PLPPQTVLDNELQNLFQMGFDSSSAMDSLGPIGR  408



>ref|XP_010664917.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH74 [Vitis 
vinifera]
Length=500

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 122/171 (71%), Gaps = 18/171 (11%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K       N  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  312  KQPNKHAKDNSSNGEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  371

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E++L KDI          
Sbjct  372  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIERLLSKDILNSRGGSTSV  431

Query  356  --FLPGLNIPHR-----SFTCIPG-STPLHALPQNVWDNDLQSILQKGFDS  484
              F PG++  H      S   +PG  TP     Q VWD +LQS+LQ GFDS
Sbjct  432  LGFGPGMSSSHPYPHGISQGTLPGIPTPQFHSTQAVWDGELQSLLQMGFDS  482



>gb|KDO81442.1| hypothetical protein CISIN_1g014374mg [Citrus sinensis]
Length=402

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 133/212 (63%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            GD     KEQ +KK K  QN  A                     + Y+H+RAKRGQATNS
Sbjct  186  GDSSGILKEQDEKKQKIEQNTGANMRGKQAAKPTKDSSLSGEAPKEYIHMRAKRGQATNS  245

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  246  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  305

Query  308  NPEMNLDVEQILPKDI------------FLPGLN--------IPHRSFTCIPGSTP-LHA  424
            NPE+NLD+E+IL KDI            F  G+N        I   +   IPG+ P    
Sbjct  306  NPELNLDIERILSKDILHARSGSAATIGFSSGMNSSRPYPPGIFQGTMPSIPGANPQFPP  365

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            LPQ+V D++ QS+ Q G+DS S   + GPN R
Sbjct  366  LPQSVLDHEFQSLFQMGYDSTSAVDSLGPNGR  397



>ref|XP_009361221.1| PREDICTED: transcription factor bHLH74 isoform X2 [Pyrus x bretschneideri]
Length=430

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 136/212 (64%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            G+  +  KEQ +KK KT +N +A                    K++Y+HVRA+RGQATNS
Sbjct  214  GESSDYLKEQDEKKAKTGENAAANLRGKQMGRQAKENSQSGDPKDSYIHVRARRGQATNS  273

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  274  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  333

Query  308  NPEMNLDVEQILPKDI------------FLPGLNIP--------HRSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F PG+  P        H +   +  S P   +
Sbjct  334  NPELNIDIERILSKDILNSRSGGGAIFGFSPGIGSPHPYPPGMFHGNLPSLLTSAPQFPS  393

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            LPQNV DN+LQ +   GFDS S   N G N R
Sbjct  394  LPQNVLDNELQGLFHMGFDSSSAIDNMGQNGR  425



>ref|XP_007160954.1| hypothetical protein PHAVU_001G031300g [Phaseolus vulgaris]
 gb|ESW32948.1| hypothetical protein PHAVU_001G031300g [Phaseolus vulgaris]
Length=429

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 126/181 (70%), Gaps = 23/181 (13%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            + K  + Q+  A KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI 
Sbjct  244  QAKDNSSQSGEAPKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIT  303

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI-----------FLP  364
            GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DV++IL KDI           + P
Sbjct  304  GKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVDRILSKDILQSRIGHGIGAYGP  363

Query  365  GLNIPHR--------SFTCIPG-STPLHALPQNVWDNDLQSILQKGFDS---MSNRGPND  508
            G+N  H         +   +P  S+    LPQNV D++ QS    G+DS   + N GPN 
Sbjct  364  GINSSHTFPSGNFHGTLAGMPSTSSQFPPLPQNVLDHEFQSFYGIGYDSNTALDNLGPNG  423

Query  509  R  511
            R
Sbjct  424  R  424



>ref|XP_003556954.1| PREDICTED: transcription factor bHLH74-like [Glycine max]
 gb|KHN36993.1| Transcription factor bHLH74 [Glycine soja]
Length=435

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 127/180 (71%), Gaps = 23/180 (13%)
 Frame = +2

Query  41   KKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAG  220
            K +   Q+  A KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI G
Sbjct  251  KDNNNSQSGEAPKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKITG  310

Query  221  KAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI-----------FLPG  367
            KAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DV++IL KDI           + PG
Sbjct  311  KAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVDRILSKDILQSRIGHGIGAYGPG  370

Query  368  LN----IPHRSF-TCIPG----STPLHALPQNVWDNDLQSILQKGFDS---MSNRGPNDR  511
            +N     P+ SF   + G    S+    LPQNV D++ QS    G+DS   + N GPN R
Sbjct  371  INSSHTFPNGSFHGTLAGMSSTSSQFPPLPQNVLDHEFQSFYGIGYDSNTALDNLGPNGR  430



>ref|XP_006433666.1| hypothetical protein CICLE_v10001249mg [Citrus clementina]
 gb|ESR46906.1| hypothetical protein CICLE_v10001249mg [Citrus clementina]
Length=426

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 133/212 (63%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            GD     KEQ +KK K  QN  A                     + Y+H+RAKRGQATNS
Sbjct  210  GDSSGILKEQDEKKQKIEQNTGANMRGKQAAKPTKDSSLSGEAPKEYIHMRAKRGQATNS  269

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  270  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  329

Query  308  NPEMNLDVEQILPKDI------------FLPGLN--------IPHRSFTCIPGSTP-LHA  424
            NPE+NLD+E+IL KDI            F  G+N        I   +   IPG+ P    
Sbjct  330  NPELNLDIERILSKDILHARSGSAATIGFSSGMNSSRPYPPGIFQGTMPSIPGANPQFPP  389

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            LPQ+V D++ QS+ Q G+DS S   + GPN R
Sbjct  390  LPQSVLDHEFQSLFQMGYDSTSAVDSLGPNGR  421



>gb|KDO81441.1| hypothetical protein CISIN_1g014374mg [Citrus sinensis]
Length=426

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 133/212 (63%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            GD     KEQ +KK K  QN  A                     + Y+H+RAKRGQATNS
Sbjct  210  GDSSGILKEQDEKKQKIEQNTGANMRGKQAAKPTKDSSLSGEAPKEYIHMRAKRGQATNS  269

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  270  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  329

Query  308  NPEMNLDVEQILPKDI------------FLPGLN--------IPHRSFTCIPGSTP-LHA  424
            NPE+NLD+E+IL KDI            F  G+N        I   +   IPG+ P    
Sbjct  330  NPELNLDIERILSKDILHARSGSAATIGFSSGMNSSRPYPPGIFQGTMPSIPGANPQFPP  389

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            LPQ+V D++ QS+ Q G+DS S   + GPN R
Sbjct  390  LPQSVLDHEFQSLFQMGYDSTSAVDSLGPNGR  421



>ref|XP_009361213.1| PREDICTED: transcription factor bHLH74 isoform X1 [Pyrus x bretschneideri]
Length=431

 Score =   199 bits (505),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 132/202 (65%), Gaps = 40/202 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            G+  +  KEQ +KK KT +N +A                    K++Y+HVRA+RGQATNS
Sbjct  214  GESSDYLKEQDEKKAKTGENAAANLRGKQMGRQAKENSQSGDPKDSYIHVRARRGQATNS  273

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  274  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  333

Query  308  NPEMNLDVEQILPKDI------------FLPGLNIP--------HRSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F PG+  P        H +   +  S P   +
Sbjct  334  NPELNIDIERILSKDILNSRSGGGAIFGFSPGIGSPHPYPPGMFHGNLPSLLTSAPQFPS  393

Query  425  LPQNVWDNDLQSILQKGFDSMS  490
            LPQNV DN+LQ +   GFDS S
Sbjct  394  LPQNVLDNELQGLFHMGFDSSS  415



>ref|XP_006472332.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Citrus 
sinensis]
Length=426

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 133/212 (63%), Gaps = 43/212 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            GD     KEQ +KK K  QN  A                     + Y+H+RAKRGQATNS
Sbjct  210  GDSSGILKEQDEKKQKIEQNTGANMRGKQAAKPTKDSSLSGEAPKEYIHMRAKRGQATNS  269

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  270  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  329

Query  308  NPEMNLDVEQILPKDI------------FLPGLN--------IPHRSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F  G+N        I   +   IPG+ P    
Sbjct  330  NPELNIDIERILSKDILHARSGSAATIGFSSGMNSSRPYPPGIFQGTMPSIPGANPQFPP  389

Query  425  LPQNVWDNDLQSILQKGFDSMS---NRGPNDR  511
            LPQ+V D++ QS+ Q G+DS S   + GPN R
Sbjct  390  LPQSVLDHEFQSLFQMGYDSTSAVDSLGPNGR  421



>ref|XP_006417495.1| hypothetical protein EUTSA_v10008002mg [Eutrema salsugineum]
 gb|ESQ35848.1| hypothetical protein EUTSA_v10008002mg [Eutrema salsugineum]
Length=363

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 131/191 (69%), Gaps = 32/191 (17%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  170  DQSQKKHKNDQSKETMNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  229

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  230  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNVDIDRILAKDL  289

Query  356  F------LPGLNIPHRSFTCIPGSTP---------LHALPQNVWDNDLQSILQKGF----  478
                    P L +    FT   G+ P          H LPQ   +++LQS+ Q GF    
Sbjct  290  LQSRDRNTPTLGL--NPFTGFQGTIPNISTTANPQYHPLPQTTLESELQSLYQMGFVSNP  347

Query  479  DSMSNRGPNDR  511
             +MS+  PN R
Sbjct  348  STMSSFSPNGR  358



>ref|XP_002302386.2| hypothetical protein POPTR_0002s11540g, partial [Populus trichocarpa]
 gb|EEE81659.2| hypothetical protein POPTR_0002s11540g, partial [Populus trichocarpa]
Length=427

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 124/183 (68%), Gaps = 23/183 (13%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+     Q+    KENY HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGC
Sbjct  238  KQAAKQAKDDTQSGEVPKENYFHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGC  297

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+ +DVE+IL KDI          
Sbjct  298  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELQIDVERILSKDILHSRGGNAAI  357

Query  356  --FLPGLN---IPHRSF----TCIPGSTP-LHALPQNVWDNDLQSILQKGFDSMS---NR  496
              F PG++     HR F      IP S P     P  V DN+LQS  Q GFDS S   N 
Sbjct  358  LGFSPGISSHPYSHRIFQPGIQVIPNSNPQFSPAPHAVLDNELQSYFQMGFDSSSAIDNL  417

Query  497  GPN  505
            GPN
Sbjct  418  GPN  420



>emb|CDY53834.1| BnaA09g57260D [Brassica napus]
Length=347

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 131/183 (72%), Gaps = 23/183 (13%)
 Frame = +2

Query  29   EQGKKKHKTRQN------DSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            +Q +KKHK  QN      + A KENY+H+RA+RGQATNSHSLAERVRREKISERMRLLQE
Sbjct  145  DQSQKKHKDGQNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQE  204

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP-G  367
            LVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++I+ KD+  P  
Sbjct  205  LVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEVNIDIDRIIAKDLLQPRD  264

Query  368  LNIPH---RSFTCIPGSTP---------LHALPQNVWDNDLQSILQKGF----DSMSNRG  499
             N P      FT   G+ P          ++LPQ   +++LQS+ Q GF     +MS+  
Sbjct  265  RNTPTLGLSPFTSFHGTIPNISTTANPQYNSLPQTTLESELQSLYQMGFVSNPSTMSSFS  324

Query  500  PND  508
            PN+
Sbjct  325  PNN  327



>ref|XP_010645305.1| PREDICTED: transcription factor bHLH74 isoform X3 [Vitis vinifera]
Length=224

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 124/182 (68%), Gaps = 25/182 (14%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            C K  G +   + Q   A KE+Y+HVRAKRGQATNSHSLAERVRRE+ISERM+ LQ+LVP
Sbjct  30   CGKLIGAEVKMSSQTGEAPKEDYIHVRAKRGQATNSHSLAERVRRERISERMKFLQDLVP  89

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------  355
            GCNKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV PEMN+ +E+IL  DI        
Sbjct  90   GCNKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVYPEMNVQIERILSSDIHHSKGGTA  149

Query  356  ----FLPGLN----IPHRSFTCI-PG-------STPLHALPQNVWDNDLQSILQKGFDSM  487
                F PG+N    IP  +   I P        S+P+  +P NVWDN+LQ I Q GF S 
Sbjct  150  PILGFGPGMNSAYPIPQVTLQAISPAIESSTLQSSPMSPMP-NVWDNELQGIKQMGFTST  208

Query  488  SN  493
            ++
Sbjct  209  AD  210



>ref|XP_008220408.1| PREDICTED: transcription factor bHLH74 isoform X2 [Prunus mume]
Length=435

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 131/189 (69%), Gaps = 28/189 (15%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+ GK+  ++ Q+    K++Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  243  KQMGKQAKESSQSGDP-KDSYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  301

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E+IL KDI          
Sbjct  302  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIERILSKDILNSRSGSGAI  361

Query  356  --FLPGLN----IPHRSF----TCIPGSTP----LHALPQNVWDNDLQSILQKGFDSMS-  490
              F PG++     PH  F      +P S P      +LPQ V D++LQ +   GFDS S 
Sbjct  362  FGFSPGISSSHPYPHGMFPGNLPSMPSSAPQAPQFPSLPQTVLDSELQGLFHMGFDSSSA  421

Query  491  --NRGPNDR  511
              N G N R
Sbjct  422  IDNLGQNGR  430



>gb|KEH39990.1| transcription factor [Medicago truncatula]
Length=426

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 128/185 (69%), Gaps = 23/185 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            ++ GK+      +  A K+N++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  237  EQSGKQAKDNSPSGDASKDNFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  296

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DVE++L KDI          
Sbjct  297  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVERLLSKDILQSRLGLGIG  356

Query  356  -FLPGLN----IPHRSF----TCIP-GSTPLHALPQNVWDNDLQSILQKGFD---SMSNR  496
             F+PG++     P+ SF      +P  ST    LPQN  D+D Q+    G+D   ++ N 
Sbjct  357  GFVPGMSSSHPFPNASFQGNMAGMPSSSTQFPPLPQNALDHDFQNFYGMGYDPNTALDNL  416

Query  497  GPNDR  511
            G N R
Sbjct  417  GSNGR  421



>ref|XP_008393688.1| PREDICTED: transcription factor bHLH74 isoform X1 [Malus domestica]
 ref|XP_008393689.1| PREDICTED: transcription factor bHLH74 isoform X1 [Malus domestica]
Length=431

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 131/202 (65%), Gaps = 40/202 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            G+  +  KEQ +KK KT +N +A                    K++Y+HVRA+RGQATNS
Sbjct  214  GESSDYLKEQDEKKAKTXENAAANLRGKQMGKQTKENSQSGDPKDSYIHVRARRGQATNS  273

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMR LQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  274  HSLAERVRREKISERMRSLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  333

Query  308  NPEMNLDVEQILPKDI------------FLPGLNIP--------HRSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F PG+  P        H +   +  S P   +
Sbjct  334  NPELNIDIERILSKDILNSRSGGGAVFRFSPGIGSPHPYHPGMFHGNLPSMLTSAPZFPS  393

Query  425  LPQNVWDNDLQSILQKGFDSMS  490
            LPQNV DN+LQ +   GFDS S
Sbjct  394  LPQNVLDNELQGLXHMGFDSSS  415



>dbj|BAF01172.1| bHLH transcription factor like protein [Arabidopsis thaliana]
Length=314

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 132/192 (69%), Gaps = 34/192 (18%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  121  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  180

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  181  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  240

Query  356  F------LPGL----------NIPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF---  478
                    P L          NIP+ S T  P   P   LPQ   +++LQ++ Q GF   
Sbjct  241  LQSRDRNTPTLGLNPFAGFQGNIPNLSATTNPQYNP---LPQTTLESELQNLYQMGFVSN  297

Query  479  -DSMSNRGPNDR  511
              +MS+  PN R
Sbjct  298  PSTMSSFSPNGR  309



>ref|XP_008393690.1| PREDICTED: transcription factor bHLH74 isoform X2 [Malus domestica]
Length=430

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 131/202 (65%), Gaps = 40/202 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            G+  +  KEQ +KK KT +N +A                    K++Y+HVRA+RGQATNS
Sbjct  214  GESSDYLKEQDEKKAKTXENAAANLRGKQMGKQTKENSQSGDPKDSYIHVRARRGQATNS  273

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMR LQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  274  HSLAERVRREKISERMRSLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  333

Query  308  NPEMNLDVEQILPKDI------------FLPGLNIP--------HRSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F PG+  P        H +   +  S P   +
Sbjct  334  NPELNIDIERILSKDILNSRSGGGAVFRFSPGIGSPHPYHPGMFHGNLPSMLTSAPZFPS  393

Query  425  LPQNVWDNDLQSILQKGFDSMS  490
            LPQNV DN+LQ +   GFDS S
Sbjct  394  LPQNVLDNELQGLXHMGFDSSS  415



>ref|XP_009118268.1| PREDICTED: transcription factor bHLH74-like [Brassica rapa]
Length=332

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 131/184 (71%), Gaps = 28/184 (15%)
 Frame = +2

Query  29   EQGKKKHKTRQN------DSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            +Q +KKHK  QN      + A KENY+H+RA+RG+ATNSHSLAERVRREKISERMRLLQE
Sbjct  146  DQNQKKHKDGQNKESSQSEEAPKENYIHMRARRGKATNSHSLAERVRREKISERMRLLQE  205

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP--  364
            LVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++I+ KD+  P  
Sbjct  206  LVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEVNIDIDRIIAKDLLQPRD  265

Query  365  ------GLNIPHRSF------TCIPGSTPLHALPQNVWDNDLQSILQKGF----DSMSNR  496
                  GLN P  SF      T  P   P   LPQ   +++LQS+ Q GF     +MS+ 
Sbjct  266  RNIPTLGLN-PFTSFQGNISTTTNPQYNP---LPQTTLESELQSLYQMGFVSNPSTMSSF  321

Query  497  GPND  508
             PN+
Sbjct  322  SPNN  325



>ref|XP_008220406.1| PREDICTED: transcription factor bHLH74 isoform X1 [Prunus mume]
 ref|XP_008220407.1| PREDICTED: transcription factor bHLH74 isoform X1 [Prunus mume]
Length=436

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 127/179 (71%), Gaps = 25/179 (14%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+ GK+  ++ Q+    K++Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  243  KQMGKQAKESSQSGDP-KDSYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  301

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E+IL KDI          
Sbjct  302  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIERILSKDILNSRSGSGAI  361

Query  356  --FLPGLN----IPHRSF----TCIPGSTP----LHALPQNVWDNDLQSILQKGFDSMS  490
              F PG++     PH  F      +P S P      +LPQ V D++LQ +   GFDS S
Sbjct  362  FGFSPGISSSHPYPHGMFPGNLPSMPSSAPQAPQFPSLPQTVLDSELQGLFHMGFDSSS  420



>emb|CDY22605.1| BnaC08g42390D [Brassica napus]
Length=353

 Score =   194 bits (493),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 137/201 (68%), Gaps = 35/201 (17%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  150  DQSQKKHKDGQSKETMNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  209

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++ILPKD+
Sbjct  210  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEVNIDIDRILPKDL  269

Query  356  F------LPGLNI-PHRSF------TCIPGSTPLHALPQNVWDNDLQSILQKGF----DS  484
                    P L + P  SF      T  P   P   LPQ   +++LQS+ Q GF     +
Sbjct  270  LQSRDRNTPTLGLNPFTSFQGNISTTTNPQYNP---LPQTTLESELQSLYQMGFVTNPST  326

Query  485  MSNRGPND----R*QI*FSLF  535
            MS+  P++      Q  FSLF
Sbjct  327  MSSFSPSNGKLKATQTCFSLF  347



>ref|XP_003544498.1| PREDICTED: transcription factor bHLH74-like [Glycine max]
Length=429

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 123/181 (68%), Gaps = 23/181 (13%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            + K    Q+  A KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI 
Sbjct  244  QAKDNNSQSGEAPKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIT  303

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI-----------FLP  364
            GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DV++IL KDI           + P
Sbjct  304  GKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVDRILSKDILQSRIGHGIGAYGP  363

Query  365  GLN----IPHRSFTCIPGSTP-----LHALPQNVWDNDLQSILQKGFDS---MSNRGPND  508
            G+N     P+ SF       P        LPQNV D++ QS    G+DS   + N  PN 
Sbjct  364  GINSSHTFPNGSFHGTLAGMPSTSSQFPPLPQNVLDHEFQSFYGIGYDSNTALDNLEPNG  423

Query  509  R  511
            R
Sbjct  424  R  424



>gb|KEH39987.1| transcription factor [Medicago truncatula]
Length=421

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 128/185 (69%), Gaps = 23/185 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            ++ GK+      +  A K+N++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  237  EQSGKQAKDNSPSGDASKDNFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  296

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DVE++L KDI          
Sbjct  297  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVERLLSKDILQSRLGLGIG  356

Query  356  -FLPGLN----IPHRSF----TCIP-GSTPLHALPQNVWDNDLQSILQKGFD---SMSNR  496
             F+PG++     P+ SF      +P  ST    LPQN  D+D Q+    G+D   ++ N 
Sbjct  357  GFVPGMSSSHPFPNASFQGNMAGMPSSSTQFPPLPQNALDHDFQNFYGMGYDPNTALDNL  416

Query  497  GPNDR  511
            G N +
Sbjct  417  GSNGK  421



>ref|XP_010548590.1| PREDICTED: transcription factor bHLH74-like [Tarenaya hassleriana]
 ref|XP_010548597.1| PREDICTED: transcription factor bHLH74-like [Tarenaya hassleriana]
Length=373

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 13/152 (9%)
 Frame = +2

Query  59   QNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLD  238
            Q+  A KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD
Sbjct  203  QSGEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKITGKAVMLD  262

Query  239  KIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP--------GLNIPHRSFT  394
            +II YVQSLQQQVEFLSMKLATVNPE+N+D++++L KDI LP        G+N+ H  + 
Sbjct  263  EIINYVQSLQQQVEFLSMKLATVNPELNVDIDRVLAKDILLPRDRNIPMLGMNL-HHPYG  321

Query  395  CIPGSTPLH----ALPQNVWDNDLQSILQKGF  478
             +P    +H     L Q   D +LQS+ Q GF
Sbjct  322  AMPNIPTMHPQFSPLSQTALDTELQSLYQMGF  353



>gb|KEH39988.1| transcription factor [Medicago truncatula]
Length=423

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 127/182 (70%), Gaps = 20/182 (11%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            ++ GK+      +  A K+N++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  237  EQSGKQAKDNSPSGDASKDNFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  296

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------FL  361
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DVE++L KD         F+
Sbjct  297  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVERLLSKDSRLGLGIGGFV  356

Query  362  PGLN----IPHRSF----TCIP-GSTPLHALPQNVWDNDLQSILQKGFD---SMSNRGPN  505
            PG++     P+ SF      +P  ST    LPQN  D+D Q+    G+D   ++ N G N
Sbjct  357  PGMSSSHPFPNASFQGNMAGMPSSSTQFPPLPQNALDHDFQNFYGMGYDPNTALDNLGSN  416

Query  506  DR  511
             R
Sbjct  417  GR  418



>gb|KFK43307.1| hypothetical protein AALP_AA1G107500 [Arabis alpina]
Length=360

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 129/181 (71%), Gaps = 23/181 (13%)
 Frame = +2

Query  29   EQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCN  208
            EQ K+  ++ Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERMRLLQELVPGCN
Sbjct  178  EQSKETKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQELVPGCN  237

Query  209  KIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP--------  364
            KI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+           
Sbjct  238  KITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDLLQSRDRNTTTL  297

Query  365  GLN--------IPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF----DSMSNRGPND  508
            GLN        IP+ S    P   P   LPQ   +++LQ++ Q GF     +MS+  PN 
Sbjct  298  GLNPFSGYQGPIPNISTATNPQYNP---LPQTTLESELQNLYQMGFVSNPSTMSSFSPNG  354

Query  509  R  511
            R
Sbjct  355  R  355



>ref|NP_172483.4| transcription factor bHLH74 [Arabidopsis thaliana]
 sp|Q6NKN9.1|BH074_ARATH RecName: Full=Transcription factor bHLH74; AltName: Full=Basic 
helix-loop-helix protein 74; Short=AtbHLH74; Short=bHLH 74; 
AltName: Full=Protein ACTIVATOR FOR CELL ELONGATION 2; AltName: 
Full=Transcription factor EN 90; AltName: Full=bHLH transcription 
factor bHLH074 [Arabidopsis thaliana]
 gb|AAT06474.1| At1g10120 [Arabidopsis thaliana]
 dbj|BAD93978.1| bHLH transcription factor like protein [Arabidopsis thaliana]
 gb|AEE28544.1| transcription factor bHLH74 [Arabidopsis thaliana]
Length=366

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 132/192 (69%), Gaps = 34/192 (18%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  173  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  232

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  233  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  292

Query  356  F------LPGL----------NIPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF---  478
                    P L          NIP+ S T  P   P   LPQ   +++LQ++ Q GF   
Sbjct  293  LQSRDRNTPTLGLNPFAGFQGNIPNLSATTNPQYNP---LPQTTLESELQNLYQMGFVSN  349

Query  479  -DSMSNRGPNDR  511
              +MS+  PN R
Sbjct  350  PSTMSSFSPNGR  361



>gb|KEH39989.1| transcription factor [Medicago truncatula]
Length=418

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 127/182 (70%), Gaps = 20/182 (11%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            ++ GK+      +  A K+N++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  237  EQSGKQAKDNSPSGDASKDNFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  296

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------FL  361
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DVE++L KD         F+
Sbjct  297  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVERLLSKDSRLGLGIGGFV  356

Query  362  PGLN----IPHRSF----TCIP-GSTPLHALPQNVWDNDLQSILQKGFD---SMSNRGPN  505
            PG++     P+ SF      +P  ST    LPQN  D+D Q+    G+D   ++ N G N
Sbjct  357  PGMSSSHPFPNASFQGNMAGMPSSSTQFPPLPQNALDHDFQNFYGMGYDPNTALDNLGSN  416

Query  506  DR  511
             +
Sbjct  417  GK  418



>gb|EYU36399.1| hypothetical protein MIMGU_mgv1a008799mg [Erythranthe guttata]
Length=362

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 125/187 (67%), Gaps = 30/187 (16%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQN-----DSAR-----KENYVHVRAKRGQATNSHSLAERVRR  154
            G+  E  KE  KK   T+Q      D +      KE+Y+ VRAKRGQATNSHSLAERVRR
Sbjct  160  GNTCEFPKEDEKKNTGTKQGVKQAKDGSNGAEPSKEDYILVRAKRGQATNSHSLAERVRR  219

Query  155  EKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVE  334
            E+ISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D++
Sbjct  220  ERISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNVDID  279

Query  335  QILPKDIF-LPGLNIPHRSFTCIPGSTPLHALP-----------------QNVWDNDLQS  460
            +IL KD+    G N         PG +P HA P                  N+W++DLQS
Sbjct  280  RILSKDLLHTRGGNATE--LGVGPGFSPSHAFPGLLNGYAGPPPPFHPLPPNLWNSDLQS  337

Query  461  ILQKGFD  481
            ILQ GFD
Sbjct  338  ILQMGFD  344



>ref|XP_010458347.1| PREDICTED: transcription factor bHLH74 [Camelina sativa]
Length=369

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 132/191 (69%), Gaps = 32/191 (17%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  176  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  235

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  236  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  295

Query  356  F------LPGLNIPHRSFTCIPGSTP---------LHALPQNVWDNDLQSILQKGF----  478
                    P L +    FT   G+ P          ++LPQ   +++LQ++ Q GF    
Sbjct  296  LQSRDRNTPTLGL--NPFTGFQGTIPNLSTTTNPHYNSLPQTTLESELQNLYQMGFVSNP  353

Query  479  DSMSNRGPNDR  511
             +MS+  PN R
Sbjct  354  STMSSFSPNGR  364



>ref|XP_006305146.1| hypothetical protein CARUB_v10009514mg [Capsella rubella]
 gb|EOA38044.1| hypothetical protein CARUB_v10009514mg [Capsella rubella]
Length=365

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 132/191 (69%), Gaps = 32/191 (17%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  172  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  231

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  232  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINVDIDRILAKDL  291

Query  356  F------LPGLNIPHRSFTCIPGSTP---------LHALPQNVWDNDLQSILQKGF----  478
                    P L +    FT   G+ P          ++LPQ   +++LQ++ Q GF    
Sbjct  292  LQSRDRNTPTLGL--NPFTGFQGTIPNLSTTTNPQYNSLPQTTLESELQNLYQMGFVSNP  349

Query  479  DSMSNRGPNDR  511
             +MS+  PN R
Sbjct  350  STMSSFSPNGR  360



>ref|XP_002892548.1| hypothetical protein ARALYDRAFT_888270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68807.1| hypothetical protein ARALYDRAFT_888270 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 132/192 (69%), Gaps = 34/192 (18%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  171  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  230

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  231  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  290

Query  356  FLP--------GLN--------IPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF---  478
                       GLN        IP+ S T  P   P   LPQ   +++LQ++ Q GF   
Sbjct  291  LQSRDRNTPTLGLNPFSGFQGTIPNLSTTTNPQYNP---LPQTTLESELQNLYQMGFVSN  347

Query  479  -DSMSNRGPNDR  511
              +MS+  PN R
Sbjct  348  PTTMSSFSPNGR  359



>ref|XP_010475871.1| PREDICTED: transcription factor bHLH74-like [Camelina sativa]
Length=371

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 132/191 (69%), Gaps = 32/191 (17%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  178  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  237

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  238  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  297

Query  356  F------LPGLNIPHRSFTCIPGSTP---------LHALPQNVWDNDLQSILQKGF----  478
                    P L +    FT   G+ P          ++LPQ   +++LQ++ Q GF    
Sbjct  298  LQSRDRNTPTLGL--NPFTGFQGTIPNLSTTTNPQYNSLPQTTLESELQNLYQMGFVSNP  355

Query  479  DSMSNRGPNDR  511
             +MS+  PN R
Sbjct  356  STMSSFSPNGR  366



>ref|XP_010490708.1| PREDICTED: transcription factor bHLH74 [Camelina sativa]
Length=368

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 132/191 (69%), Gaps = 32/191 (17%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  175  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  234

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  235  RLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  294

Query  356  F------LPGLNIPHRSFTCIPGSTP---------LHALPQNVWDNDLQSILQKGF----  478
                    P L +    FT   G+ P          ++LPQ   +++LQ++ Q GF    
Sbjct  295  LQSRDRNTPTLGL--NPFTGFQGTIPNLSTTTNPQYNSLPQTTLESELQNLYQMGFVSNP  352

Query  479  DSMSNRGPNDR  511
             +MS+  PN R
Sbjct  353  STMSSFSPNGR  363



>dbj|BAF02146.1| bHLH transcription factor like protein [Arabidopsis thaliana]
Length=366

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 131/192 (68%), Gaps = 34/192 (18%)
 Frame = +2

Query  29   EQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERM  175
            +Q +KKHK           + Q++ A KENY+H+RA+RGQATNSHSLAERVRREKISERM
Sbjct  173  DQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERM  232

Query  176  RLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            RLLQEL PGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+
Sbjct  233  RLLQELAPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEINIDIDRILAKDL  292

Query  356  F------LPGL----------NIPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF---  478
                    P L          NIP+ S T  P   P   LPQ   +++LQ++ Q GF   
Sbjct  293  LQSRDRNTPTLGLNPFAGFQGNIPNLSATTNPQYNP---LPQTTLESELQNLYQMGFVSN  349

Query  479  -DSMSNRGPNDR  511
              +MS+  PN R
Sbjct  350  PSTMSSFSPNGR  361



>ref|XP_009148330.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Brassica 
rapa]
Length=349

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 129/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            K   ++ Q+D A KENY+H+RA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI 
Sbjct  172  KMTKESSQSDEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIT  231

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQIL---PKDIFLP--GLNIPH  382
            GKAVMLD+II YVQSLQQQVEFLSMKL+TVNPE+N+D++++L   P+D   P  GLN   
Sbjct  232  GKAVMLDEIINYVQSLQQQVEFLSMKLSTVNPELNIDIDRLLAKDPRDRNTPTLGLNPFA  291

Query  383  RSFTCIPG-STP----LHALPQNVWDNDLQSILQKGF----DSMSNRGPND  508
            R    IP  STP     ++LPQ   +++LQS+ Q GF     +MS+  PN+
Sbjct  292  RFQGTIPNISTPTAPQYNSLPQTTLESELQSLYQMGFVSNPSTMSSFSPNN  342



>ref|XP_009148331.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Brassica 
rapa]
Length=348

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 129/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            K   ++ Q+D A KENY+H+RA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI 
Sbjct  171  KMTKESSQSDEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIT  230

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQIL---PKDIFLP--GLNIPH  382
            GKAVMLD+II YVQSLQQQVEFLSMKL+TVNPE+N+D++++L   P+D   P  GLN   
Sbjct  231  GKAVMLDEIINYVQSLQQQVEFLSMKLSTVNPELNIDIDRLLAKDPRDRNTPTLGLNPFA  290

Query  383  RSFTCIPG-STP----LHALPQNVWDNDLQSILQKGF----DSMSNRGPND  508
            R    IP  STP     ++LPQ   +++LQS+ Q GF     +MS+  PN+
Sbjct  291  RFQGTIPNISTPTAPQYNSLPQTTLESELQSLYQMGFVSNPSTMSSFSPNN  341



>gb|KHN17184.1| Transcription factor bHLH74 [Glycine soja]
Length=640

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 123/180 (68%), Gaps = 23/180 (13%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            + K    Q+  A KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGCNKI 
Sbjct  244  QAKDNNSQSGEAPKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIT  303

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI-----------FLP  364
            GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N DV++IL KDI           + P
Sbjct  304  GKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNFDVDRILSKDILQSRIGHGIGAYGP  363

Query  365  GLN----IPHRSFTCIPGSTP-----LHALPQNVWDNDLQSILQKGFDS---MSNRGPND  508
            G+N     P+ SF       P        LPQNV D++ QS    G+DS   + N  PND
Sbjct  364  GINSSHTFPNGSFHGTLAGMPSTSSQFPPLPQNVLDHEFQSFYGIGYDSNTALDNLEPND  423



>ref|XP_003634844.1| PREDICTED: transcription factor bHLH74 isoform X1 [Vitis vinifera]
 ref|XP_010645299.1| PREDICTED: transcription factor bHLH74 isoform X1 [Vitis vinifera]
 ref|XP_010645300.1| PREDICTED: transcription factor bHLH74 isoform X1 [Vitis vinifera]
 ref|XP_010645301.1| PREDICTED: transcription factor bHLH74 isoform X1 [Vitis vinifera]
 ref|XP_010645302.1| PREDICTED: transcription factor bHLH74 isoform X1 [Vitis vinifera]
 ref|XP_010645303.1| PREDICTED: transcription factor bHLH74 isoform X1 [Vitis vinifera]
 emb|CBI41042.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 124/182 (68%), Gaps = 25/182 (14%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            C K  G +   + Q   A KE+Y+HVRAKRGQATNSHSLAERVRRE+ISERM+ LQ+LVP
Sbjct  221  CGKLIGAEVKMSSQTGEAPKEDYIHVRAKRGQATNSHSLAERVRRERISERMKFLQDLVP  280

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------  355
            GCNKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV PEMN+ +E+IL  DI        
Sbjct  281  GCNKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVYPEMNVQIERILSSDIHHSKGGTA  340

Query  356  ----FLPGLN----IPHRSFTCI-PG-------STPLHALPQNVWDNDLQSILQKGFDSM  487
                F PG+N    IP  +   I P        S+P+  +P NVWDN+LQ I Q GF S 
Sbjct  341  PILGFGPGMNSAYPIPQVTLQAISPAIESSTLQSSPMSPMP-NVWDNELQGIKQMGFTST  399

Query  488  SN  493
            ++
Sbjct  400  AD  401



>ref|XP_009144473.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 130/189 (69%), Gaps = 32/189 (17%)
 Frame = +2

Query  29   EQGKKKHK--------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            +Q +KKHK        + Q++ A ++NY+H+RA+RGQATNSHSLAERVRREKISERMRLL
Sbjct  127  DQSQKKHKNDQSKEKESSQSEEAPEKNYIHMRARRGQATNSHSLAERVRREKISERMRLL  186

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            QELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KDI   
Sbjct  187  QELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDIMQS  246

Query  365  ---------GLN--------IPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF----D  481
                     GLN        IP+   T      PLH   Q   +++LQS+ Q GF     
Sbjct  247  RDVRTTPTLGLNPFSGFQGTIPNVPTTTNSQYNPLH---QTTLESELQSLYQMGFVSNPS  303

Query  482  SMSNRGPND  508
            +MS+  PN+
Sbjct  304  TMSSFSPNN  312



>ref|XP_009144471.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Brassica 
rapa]
 ref|XP_009144472.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 130/189 (69%), Gaps = 32/189 (17%)
 Frame = +2

Query  29   EQGKKKHK--------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            +Q +KKHK        + Q++ A ++NY+H+RA+RGQATNSHSLAERVRREKISERMRLL
Sbjct  156  DQSQKKHKNDQSKEKESSQSEEAPEKNYIHMRARRGQATNSHSLAERVRREKISERMRLL  215

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            QELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KDI   
Sbjct  216  QELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDIMQS  275

Query  365  ---------GLN--------IPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF----D  481
                     GLN        IP+   T      PLH   Q   +++LQS+ Q GF     
Sbjct  276  RDVRTTPTLGLNPFSGFQGTIPNVPTTTNSQYNPLH---QTTLESELQSLYQMGFVSNPS  332

Query  482  SMSNRGPND  508
            +MS+  PN+
Sbjct  333  TMSSFSPNN  341



>ref|XP_011013279.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 123/182 (68%), Gaps = 22/182 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+     Q+  A K++Y+HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGC
Sbjct  217  KQVAKQAKDNPQSGEAPKDDYIHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGC  276

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE++ DVE+I  KDI          
Sbjct  277  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEVSNDVEKIQSKDILHPRGGNAAI  336

Query  356  --FLPGLNIPHRSFTCI-PG------STPLHALPQNVWDNDLQSILQKGFDSMS---NRG  499
              F PG+N    S     PG      S P  +    V DN+LQS  Q GFDS S   + G
Sbjct  337  LGFSPGINSHQYSHGIFQPGMPVILNSNPQFSPAHAVLDNELQSFFQMGFDSSSAVDSLG  396

Query  500  PN  505
            PN
Sbjct  397  PN  398



>ref|XP_011013278.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Populus 
euphratica]
Length=406

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 123/182 (68%), Gaps = 22/182 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+     Q+  A K++Y+HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGC
Sbjct  217  KQVAKQAKDNPQSGEAPKDDYIHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGC  276

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE++ DVE+I  KDI          
Sbjct  277  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPEVSNDVEKIQSKDILHPRGGNAAI  336

Query  356  --FLPGLNIPHRSFTCI-PG------STPLHALPQNVWDNDLQSILQKGFDSMS---NRG  499
              F PG+N    S     PG      S P  +    V DN+LQS  Q GFDS S   + G
Sbjct  337  LGFSPGINSHQYSHGIFQPGMPVILNSNPQFSPAHAVLDNELQSFFQMGFDSSSAVDSLG  396

Query  500  PN  505
            PN
Sbjct  397  PN  398



>emb|CDY20659.1| BnaC08g13990D [Brassica napus]
Length=333

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 130/189 (69%), Gaps = 32/189 (17%)
 Frame = +2

Query  29   EQGKKKHK--------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            +Q +KKHK        + Q++ A ++NY+H+RA+RGQATNSHSLAERVRREKISERMRLL
Sbjct  127  DQSQKKHKNDQSKEKESSQSEEAPEKNYIHMRARRGQATNSHSLAERVRREKISERMRLL  186

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            QELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KD+   
Sbjct  187  QELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDLMQS  246

Query  365  ---------GLN--------IPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF----D  481
                     GLN        IP+   T  P   PLH   Q    ++LQS+ Q GF     
Sbjct  247  RDVSSTPTLGLNPFSGFQGTIPNVPTTTNPQYNPLH---QASNKSELQSLYQMGFVSNPS  303

Query  482  SMSNRGPND  508
            +MS+  PN+
Sbjct  304  TMSSFSPNN  312



>emb|CDY31048.1| BnaA08g25980D [Brassica napus]
Length=314

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 129/189 (68%), Gaps = 32/189 (17%)
 Frame = +2

Query  29   EQGKKKHK--------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            +Q +KKHK        + Q++ A ++NY+H+RA+RGQATNSHSLAERVRREKISERMRLL
Sbjct  127  DQSQKKHKNDQSKEKESSQSEEAPEKNYIHMRARRGQATNSHSLAERVRREKISERMRLL  186

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            QELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KDI   
Sbjct  187  QELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDIMQS  246

Query  365  ---------GLN--------IPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGF----D  481
                     GLN        IP+   T      PLH   Q    ++LQS+ Q GF     
Sbjct  247  RDVRTTPTLGLNPFSGFQGTIPNVPTTTNSQYNPLH---QASNKSELQSLYQMGFVSNPS  303

Query  482  SMSNRGPND  508
            +MS+  PN+
Sbjct  304  TMSSFSPNN  312



>ref|XP_002306505.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE93501.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=407

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 123/183 (67%), Gaps = 23/183 (13%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K+     Q+  A K++Y+HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGC
Sbjct  217  KQVAKQAKDNPQSGEAPKDDYIHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGC  276

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+  DVE+I  KDI          
Sbjct  277  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELYNDVEKIQSKDILHSRGGNAAI  336

Query  356  --FLPGLNIPHRSFTCIPGSTP--LHALPQ------NVWDNDLQSILQKGFDSMS---NR  496
              F PG+N    S        P  L++ PQ       V DN+LQS  Q GFDS S   + 
Sbjct  337  LGFSPGINSHQYSHGIFQPGIPVILNSNPQFSPAHHAVLDNELQSFFQMGFDSSSAVDSL  396

Query  497  GPN  505
            GPN
Sbjct  397  GPN  399



>ref|XP_010248338.1| PREDICTED: transcription factor bHLH74-like isoform X5 [Nelumbo 
nucifera]
Length=440

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 123/174 (71%), Gaps = 23/174 (13%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN    KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  248  KLTGKQAKDQSQNGEGPKEDYIHVRARRGQATNSHSLAERVRREKISERMRYLQDLVPGC  307

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATVNPE+N+D+EQIL KDI          
Sbjct  308  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPEINIDIEQILSKDILHSRGGSSGI  367

Query  356  --FLPGL--NIPHRSFT------CIPGSTP-LHALPQ--NVWDNDLQSILQKGF  478
              F P +  ++P +  T       I GS P L  + Q  + W+++LQ+++Q GF
Sbjct  368  LGFAPAMSSSLPQQHITQPDGAFLIQGSNPQLTTMSQAPSAWEDELQNVMQLGF  421



>ref|XP_007222174.1| hypothetical protein PRUPE_ppa007762mg [Prunus persica]
 gb|EMJ23373.1| hypothetical protein PRUPE_ppa007762mg [Prunus persica]
Length=356

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 8/149 (5%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+ GK+  ++ Q+  A K++Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  199  KQMGKQAKESSQSGDA-KDSYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  257

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHR  385
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E+IL KDI    LN    
Sbjct  258  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIERILSKDI----LNSRSG  313

Query  386  S---FTCIPGSTPLHALPQNVWDNDLQSI  463
            S   F   PG +  H  P  ++  +L S+
Sbjct  314  SGAIFGFSPGISSSHPYPHGMFPGNLPSM  342



>ref|XP_010939355.1| PREDICTED: transcription factor bHLH74-like isoform X5 [Elaeis 
guineensis]
Length=372

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 121/175 (69%), Gaps = 25/175 (14%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+D A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  180  KQAAKLAKEHSQDDDALKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  239

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPG------  367
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV+PE+N D+EQIL KDIF         
Sbjct  240  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVSPELNFDLEQILSKDIFHAQDGGSAV  299

Query  368  LNIPHRSFTCIP---GSTPLHALPQ---------------NVWDNDLQSILQKGF  478
            L    R  +  P   G +P H + Q               +VW ++LQ+++Q GF
Sbjct  300  LGFGPRMSSLRPHLYGPSP-HGVMQSEIMCSVPHSEDMISSVWHDELQNVVQMGF  353



>ref|XP_010939354.1| PREDICTED: transcription factor bHLH74-like isoform X4 [Elaeis 
guineensis]
Length=385

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 121/187 (65%), Gaps = 36/187 (19%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+D A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  180  KQAAKLAKEHSQDDDALKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  239

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV+PE+N D+EQIL KDIF         
Sbjct  240  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVSPELNFDLEQILSKDIFHAQDGGSAV  299

Query  359  ----------LPGLNIP------HRSFTC-IPGS------TPLHALP----QNVWDNDLQ  457
                       P L  P           C +P S       P H  P     +VW ++LQ
Sbjct  300  LGFGPRMSSLRPHLYGPSPHGVMQSEIMCSVPHSEDMVRAAPPHTSPVAQISSVWHDELQ  359

Query  458  SILQKGF  478
            +++Q GF
Sbjct  360  NVVQMGF  366



>ref|XP_010248337.1| PREDICTED: transcription factor bHLH74-like isoform X4 [Nelumbo 
nucifera]
Length=445

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 123/179 (69%), Gaps = 28/179 (16%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN    KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  248  KLTGKQAKDQSQNGEGPKEDYIHVRARRGQATNSHSLAERVRREKISERMRYLQDLVPGC  307

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATVNPE+N+D+EQIL KD+          
Sbjct  308  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPEINIDIEQILSKDVSKTEILHSRG  367

Query  356  -------FLPGL--NIPHRSFT------CIPGSTP-LHALPQ--NVWDNDLQSILQKGF  478
                   F P +  ++P +  T       I GS P L  + Q  + W+++LQ+++Q GF
Sbjct  368  GSSGILGFAPAMSSSLPQQHITQPDGAFLIQGSNPQLTTMSQAPSAWEDELQNVMQLGF  426



>ref|XP_010939353.1| PREDICTED: transcription factor bHLH49-like isoform X3 [Elaeis 
guineensis]
Length=414

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 121/175 (69%), Gaps = 25/175 (14%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+D A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  180  KQAAKLAKEHSQDDDALKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  239

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPG------  367
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV+PE+N D+EQIL KDIF         
Sbjct  240  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVSPELNFDLEQILSKDIFHAQDGGSAV  299

Query  368  LNIPHRSFTCIP---GSTPLHALPQ---------------NVWDNDLQSILQKGF  478
            L    R  +  P   G +P H + Q               +VW ++LQ+++Q GF
Sbjct  300  LGFGPRMSSLRPHLYGPSP-HGVMQSEIMCSVPHSEDMISSVWHDELQNVVQMGF  353



>ref|XP_010273628.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Nelumbo 
nucifera]
Length=434

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 120/176 (68%), Gaps = 26/176 (15%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN  A KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  243  KVTGKQAKDRSQNGDAPKEDYIHVRARRGQATNSHSLAERVRREKISERMRFLQDLVPGC  302

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NK+ GKA MLD+II YVQSLQ+QVEFLSMKLATVNPE+N+++E+ L KD+          
Sbjct  303  NKVTGKAGMLDEIINYVQSLQRQVEFLSMKLATVNPELNINMERFLSKDMLHSRGGSSST  362

Query  356  --FLPGL--NIPHRSFTCIPGS-----------TPLHALPQNVWDNDLQSILQKGF  478
              F PG+  + P +  T   G+           TP+  +P   WD++LQ ++Q GF
Sbjct  363  PGFAPGMSSSFPQQHITPSQGALPVVQGTNPQLTPIPPIP-GAWDDELQGVIQLGF  417



>ref|XP_010273618.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Nelumbo 
nucifera]
Length=436

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 120/176 (68%), Gaps = 26/176 (15%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN  A KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  245  KVTGKQAKDRSQNGDAPKEDYIHVRARRGQATNSHSLAERVRREKISERMRFLQDLVPGC  304

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NK+ GKA MLD+II YVQSLQ+QVEFLSMKLATVNPE+N+++E+ L KD+          
Sbjct  305  NKVTGKAGMLDEIINYVQSLQRQVEFLSMKLATVNPELNINMERFLSKDMLHSRGGSSST  364

Query  356  --FLPGL--NIPHRSFTCIPGS-----------TPLHALPQNVWDNDLQSILQKGF  478
              F PG+  + P +  T   G+           TP+  +P   WD++LQ ++Q GF
Sbjct  365  PGFAPGMSSSFPQQHITPSQGALPVVQGTNPQLTPIPPIP-GAWDDELQGVIQLGF  419



>ref|XP_010939352.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Elaeis 
guineensis]
Length=417

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 121/187 (65%), Gaps = 36/187 (19%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+D A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  170  KQAAKLAKEHSQDDDALKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  229

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV+PE+N D+EQIL KDIF         
Sbjct  230  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVSPELNFDLEQILSKDIFHAQDGGSAV  289

Query  359  ----------LPGLNIP------HRSFTC-IPGS------TPLHALP----QNVWDNDLQ  457
                       P L  P           C +P S       P H  P     +VW ++LQ
Sbjct  290  LGFGPRMSSLRPHLYGPSPHGVMQSEIMCSVPHSEDMVRAAPPHTSPVAQISSVWHDELQ  349

Query  458  SILQKGF  478
            +++Q GF
Sbjct  350  NVVQMGF  356



>ref|XP_010939350.1| PREDICTED: transcription factor bHLH62-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010939351.1| PREDICTED: transcription factor bHLH62-like isoform X1 [Elaeis 
guineensis]
Length=427

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 121/187 (65%), Gaps = 36/187 (19%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+D A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  180  KQAAKLAKEHSQDDDALKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  239

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLATV+PE+N D+EQIL KDIF         
Sbjct  240  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVSPELNFDLEQILSKDIFHAQDGGSAV  299

Query  359  ----------LPGLNIP------HRSFTC-IPGS------TPLHALP----QNVWDNDLQ  457
                       P L  P           C +P S       P H  P     +VW ++LQ
Sbjct  300  LGFGPRMSSLRPHLYGPSPHGVMQSEIMCSVPHSEDMVRAAPPHTSPVAQISSVWHDELQ  359

Query  458  SILQKGF  478
            +++Q GF
Sbjct  360  NVVQMGF  366



>ref|XP_010109419.1| hypothetical protein L484_007082 [Morus notabilis]
 gb|EXC22412.1| hypothetical protein L484_007082 [Morus notabilis]
Length=400

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+ GK+   +  +    KENY+HVRA+RGQATNSHSLAERVRREKISERMRLLQELVPGC
Sbjct  241  KQTGKQAKDSADSGETPKENYIHVRARRGQATNSHSLAERVRREKISERMRLLQELVPGC  300

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            NKI GKAVMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+E++L KDI 
Sbjct  301  NKITGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIERLLSKDIL  351



>ref|XP_010061617.1| PREDICTED: transcription factor bHLH74-like [Eucalyptus grandis]
 ref|XP_010061618.1| PREDICTED: transcription factor bHLH74-like [Eucalyptus grandis]
 ref|XP_010061619.1| PREDICTED: transcription factor bHLH74-like [Eucalyptus grandis]
 ref|XP_010061620.1| PREDICTED: transcription factor bHLH74-like [Eucalyptus grandis]
 gb|KCW68610.1| hypothetical protein EUGRSUZ_F02220 [Eucalyptus grandis]
Length=417

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 26/177 (15%)
 Frame = +2

Query  44   KHKTRQ------NDS-ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            KH T+Q      ND  A KENY+H+RA+RGQATNSHSLAERVRREKISERMR+LQELVPG
Sbjct  234  KHNTKQSKDDSSNDGEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRMLQELVPG  293

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKD----------  352
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKL+T+ P M++D+E+ L K+          
Sbjct  294  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLSTLIPGMSIDLEKALSKEAHSRGGGATN  353

Query  353  -IFLPGLNIPH--------RSFTCIPGSTPLHALPQNVWDNDLQSILQKGFDSMSNR  496
                PG+ +PH         +   +P +     L Q   D +LQ++   GFDS+S R
Sbjct  354  LALNPGMGLPHLYAQGVLKGTLPIMPSTDQYRPLSQASLDGELQALYNMGFDSISGR  410



>ref|XP_002889780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66039.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=140

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 11/124 (9%)
 Frame = +2

Query  17   ECSKEQGKKKHK-----------TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKI  163
            +   +Q +KKHK           + QN+   KE Y+H+RA+RGQATNSHSLAERVRREKI
Sbjct  11   QSGSDQSQKKHKNDQSKETMNKESSQNEEEPKEKYIHMRARRGQATNSHSLAERVRREKI  70

Query  164  SERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQIL  343
            SERMRLLQELVPGCNKI GKA MLD+II Y+QSLQQQVEFLSMKLATVNP++N+D+++IL
Sbjct  71   SERMRLLQELVPGCNKITGKAFMLDEIINYIQSLQQQVEFLSMKLATVNPDINIDIDRIL  130

Query  344  PKDI  355
             KD+
Sbjct  131  AKDV  134



>gb|EYU22588.1| hypothetical protein MIMGU_mgv1a025708mg, partial [Erythranthe 
guttata]
Length=334

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +2

Query  32   QGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNK  211
            +GK  +   Q     KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K
Sbjct  155  RGKNGNLEPQGSDPPKEDYIHVRARRGQATNSHSLAERIRREKISERMKLLQDLVPGCSK  214

Query  212  IAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP--GLN----  373
            + GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+ ++E ++ KDI  P  GL+    
Sbjct  215  VTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDFNIEGLIAKDILQPRTGLSSSIP  274

Query  374  IPHRSFTCIPGSTPLHA-LPQNVWDNDLQSILQKGFDSMS  490
             P+      P   P H   P   W+++  ++ + GF+S S
Sbjct  275  FPNDMTMLFPPFQPTHMQAPSTAWEDEFHNVFRNGFNSSS  314



>gb|KDO81444.1| hypothetical protein CISIN_1g014374mg [Citrus sinensis]
Length=394

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 114/183 (62%), Gaps = 40/183 (22%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            GD     KEQ +KK K  QN  A                     + Y+H+RAKRGQATNS
Sbjct  210  GDSSGILKEQDEKKQKIEQNTGANMRGKQAAKPTKDSSLSGEAPKEYIHMRAKRGQATNS  269

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  270  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  329

Query  308  NPEMNLDVEQILPKDI------------FLPGLN--------IPHRSFTCIPGSTP-LHA  424
            NPE+NLD+E+IL KDI            F  G+N        I   +   IPG+ P    
Sbjct  330  NPELNLDIERILSKDILHARSGSAATIGFSSGMNSSRPYPPGIFQGTMPSIPGANPQFPP  389

Query  425  LPQ  433
            LPQ
Sbjct  390  LPQ  392



>emb|CDY63738.1| BnaC05g07820D [Brassica napus]
Length=342

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SKE+  K+  + Q+D A KENY+H+RA+RGQATNSHSLAERVRREKISERMRLLQELVPG
Sbjct  168  SKEKMNKE--SSQSDEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQELVPG  225

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKL+TVNPE+N+D++++L KD+ 
Sbjct  226  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLSTVNPELNIDIDRLLAKDLL  277



>ref|XP_006472333.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Citrus 
sinensis]
Length=394

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 114/185 (62%), Gaps = 40/185 (22%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSAR-------------------KENYVHVRAKRGQATNS  127
            GD     KEQ +KK K  QN  A                     + Y+H+RAKRGQATNS
Sbjct  210  GDSSGILKEQDEKKQKIEQNTGANMRGKQAAKPTKDSSLSGEAPKEYIHMRAKRGQATNS  269

Query  128  HSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATV  307
            HSLAERVRREKISERMRLLQELVPGCNKI GKAVMLD+II YVQSLQQQVEFLSMKLATV
Sbjct  270  HSLAERVRREKISERMRLLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLATV  329

Query  308  NPEMNLDVEQILPKDI------------FLPGLN--------IPHRSFTCIPGSTP-LHA  424
            NPE+N+D+E+IL KDI            F  G+N        I   +   IPG+ P    
Sbjct  330  NPELNIDIERILSKDILHARSGSAATIGFSSGMNSSRPYPPGIFQGTMPSIPGANPQFPP  389

Query  425  LPQNV  439
            LPQ  
Sbjct  390  LPQGA  394



>gb|KHN04418.1| Transcription factor bHLH74 [Glycine soja]
Length=277

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            C K+  K+K    +++   KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVP
Sbjct  151  CGKQLLKQKKDDSESEEGSKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVP  210

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNI  376
            GC+K  GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N +VEQI  KD+ +   N+
Sbjct  211  GCDKKTGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPQLNFNVEQICSKDVSVGLYNL  269



>ref|XP_010059819.1| PREDICTED: transcription factor bHLH74 [Eucalyptus grandis]
 gb|KCW66267.1| hypothetical protein EUGRSUZ_F00100 [Eucalyptus grandis]
Length=411

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 13/128 (10%)
 Frame = +2

Query  32   QGKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCN  208
            QGK+  K  R N  A KENY+HVRA+RGQATNSHSLAERVRREKISERMR+LQELVPGCN
Sbjct  222  QGKQTGKQVRDNVEAPKENYIHVRARRGQATNSHSLAERVRREKISERMRMLQELVPGCN  281

Query  209  KIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRS  388
            KI GKAVMLD+II YVQSLQQQVEFLSMKLA V+PE+++++E+IL KDIF          
Sbjct  282  KITGKAVMLDEIINYVQSLQQQVEFLSMKLAAVSPELSINLERILSKDIF----------  331

Query  389  FTCIPGST  412
              C PGS+
Sbjct  332  --CSPGSS  337



>ref|XP_008785729.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Phoenix 
dactylifera]
Length=361

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 120/175 (69%), Gaps = 25/175 (14%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+  A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  169  KQAAKLAKEISQDGDAPKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  228

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF--------L  361
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLA V+PE+N D+EQIL KDI         +
Sbjct  229  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLAAVSPELNFDLEQILSKDILHAQDGGSAV  288

Query  362  PGLNIPHRS--FTCIPGSTP--------LHALP------QNVWDNDLQSILQKGF  478
             G   P RS     + G +P        + + P       ++W ++LQ+++Q GF
Sbjct  289  LGFG-PRRSSLHPHLYGPSPQGVMQSEIMCSAPNSGDMISSIWHDELQNVVQMGF  342



>emb|CDY57925.1| BnaA06g37950D [Brassica napus]
Length=398

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 100/110 (91%), Gaps = 2/110 (2%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SKE+  K+  + Q+D A KENY+H+RA+RGQATNSHSLAERVRREKISERMRLLQELVPG
Sbjct  169  SKEKMTKE--SSQSDEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQELVPG  226

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKD  352
            CNKI GKAVMLD+II YVQSLQQQVEFLSMKL+TVNPE+N+D++++L KD
Sbjct  227  CNKITGKAVMLDEIINYVQSLQQQVEFLSMKLSTVNPELNIDIDRLLAKD  276



>ref|XP_008785728.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Phoenix 
dactylifera]
Length=374

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 118/188 (63%), Gaps = 38/188 (20%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+  A KE+Y+HVRAKRGQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  169  KQAAKLAKEISQDGDAPKEDYIHVRAKRGQATNSHSLAERVRREKISERMRLLQDLVPGC  228

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF--------L  361
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLA V+PE+N D+EQIL KDI         +
Sbjct  229  NKITGKAVMLDEIINYVQSLQRQVEFLSMKLAAVSPELNFDLEQILSKDILHAQDGGSAV  288

Query  362  PGLNIPHRS-------------------FTCIPGS------TPLHALP----QNVWDNDL  454
             G   P RS                       P S       P H  P     ++W ++L
Sbjct  289  LGFG-PRRSSLHPHLYGPSPQGVMQSEIMCSAPNSGDMVRAAPPHICPVAQISSIWHDEL  347

Query  455  QSILQKGF  478
            Q+++Q GF
Sbjct  348  QNVVQMGF  355



>gb|EPS72135.1| basic helix-loop-helix protein, partial [Genlisea aurea]
Length=97

 Score =   164 bits (415),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  83   NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQS  262
            +YVHVRAKRGQATNSHSLAERVRRE+ISERM+LLQELVPGC+KI GKAVMLD+II YVQS
Sbjct  1    SYVHVRAKRGQATNSHSLAERVRRERISERMKLLQELVPGCSKITGKAVMLDEIINYVQS  60

Query  263  LQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLN  373
            LQQQVEFLSMKLA+VNPE+N+D+E++L  D   P LN
Sbjct  61   LQQQVEFLSMKLASVNPEINMDIERVLSNDPLHPHLN  97



>ref|XP_006578066.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Glycine 
max]
Length=378

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            C K+  K+K    +++   KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVP
Sbjct  206  CGKQLLKQKKDDSESEEGSKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVP  265

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            GC+K  GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N +VEQI  KD+
Sbjct  266  GCDKKTGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPQLNFNVEQICSKDV  317



>ref|XP_003523632.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Glycine 
max]
Length=376

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            C K+  K+K    +++   KEN++HVRA+RGQATNSHSLAERVRREKISERMRLLQELVP
Sbjct  206  CGKQLLKQKKDDSESEEGSKENFIHVRARRGQATNSHSLAERVRREKISERMRLLQELVP  265

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP-GLNI  376
            GC+K  GKAVMLD+II YVQSLQQQVEFLSMKLATVNP++N +VEQI  KD  +  G   
Sbjct  266  GCDKKTGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPQLNFNVEQICSKDSHIGHGPIG  325

Query  377  PHRSFTCIPG-STPLHALPQNVWDNDLQSILQKGFDSMS  490
             + +   +P  ST    +PQ+V +   QS  +  +++++
Sbjct  326  GYGASISMPNPSTQFPPMPQSVLN---QSFYETSYNTIT  361



>ref|XP_010248336.1| PREDICTED: transcription factor bHLH74-like isoform X3 [Nelumbo 
nucifera]
Length=462

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 123/196 (63%), Gaps = 45/196 (23%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN    KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  248  KLTGKQAKDQSQNGEGPKEDYIHVRARRGQATNSHSLAERVRREKISERMRYLQDLVPGC  307

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVE----------------------FLSMKLATVNPEM  319
            NKI GKAVMLD+II YVQSLQ+QVE                      FLSMKLATVNPE+
Sbjct  308  NKITGKAVMLDEIINYVQSLQRQVEQSQEYSLTMVAADAKTQADHCKFLSMKLATVNPEI  367

Query  320  NLDVEQILPKDI------------FLPGL--NIPHRSFT------CIPGSTP-LHALPQ-  433
            N+D+EQIL KDI            F P +  ++P +  T       I GS P L  + Q 
Sbjct  368  NIDIEQILSKDILHSRGGSSGILGFAPAMSSSLPQQHITQPDGAFLIQGSNPQLTTMSQA  427

Query  434  -NVWDNDLQSILQKGF  478
             + W+++LQ+++Q GF
Sbjct  428  PSAWEDELQNVMQLGF  443



>ref|XP_006348629.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348630.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Solanum 
tuberosum]
Length=520

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 116/202 (57%), Gaps = 48/202 (24%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAER+RREKISERM+ LQ+LVP
Sbjct  298  ASKPGGKNGKQGSQFSDPTKEEYIHVRARRGQATNSHSLAERIRREKISERMKYLQDLVP  357

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-------  358
            GCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ D++ +L KDI        
Sbjct  358  GCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFDIDSLLAKDILQSRAGPS  417

Query  359  ---------------------------LPGLNIPHRSF-----------TCIPGS--TPL  418
                                       LPG   P  +F           +C PG    P 
Sbjct  418  SSLAFPPDMTLAYPPLHPPQAGMLQSSLPGYGFPSEAFRRAINPHLATTSCGPGDYKDPS  477

Query  419  HALPQNVWDNDLQSILQKGFDS  484
               P N WDN+L +++Q G +S
Sbjct  478  SQAP-NEWDNELHNVVQMGLNS  498



>ref|XP_010936187.1| PREDICTED: transcription factor bHLH74-like [Elaeis guineensis]
Length=385

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 119/187 (64%), Gaps = 36/187 (19%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+  K   +  Q+  A KE+Y+HVRAK GQATNSHSLAERVRREKISERMRLLQ+LVPGC
Sbjct  179  KQAAKHAKEHLQDGDAPKEDYIHVRAKHGQATNSHSLAERVRREKISERMRLLQDLVPGC  238

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            NKI GKAVMLD+II YVQSLQ+QVEFLSMKLA V+PE+NL++EQIL KDI          
Sbjct  239  NKIIGKAVMLDEIINYVQSLQRQVEFLSMKLAAVSPELNLNIEQILLKDILHAQDGGSAV  298

Query  356  --FLPGLNI--PHRSFTCIPG------------------STPLHALP----QNVWDNDLQ  457
              F  G++   PH   +   G                  + P H  P     + W ++LQ
Sbjct  299  LGFGSGMSSLHPHLYGSSTRGVMRTEIMQNVPNSGDMLRAAPPHISPMAQISSAWHDELQ  358

Query  458  SILQKGF  478
            +I+Q GF
Sbjct  359  NIVQMGF  365



>ref|XP_006348631.1| PREDICTED: transcription factor bHLH49-like isoform X3 [Solanum 
tuberosum]
Length=519

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 116/202 (57%), Gaps = 48/202 (24%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAER+RREKISERM+ LQ+LVP
Sbjct  297  ASKPGGKNGKQGSQFSDPTKEEYIHVRARRGQATNSHSLAERIRREKISERMKYLQDLVP  356

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-------  358
            GCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ D++ +L KDI        
Sbjct  357  GCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFDIDSLLAKDILQSRAGPS  416

Query  359  ---------------------------LPGLNIPHRSF-----------TCIPGS--TPL  418
                                       LPG   P  +F           +C PG    P 
Sbjct  417  SSLAFPPDMTLAYPPLHPPQAGMLQSSLPGYGFPSEAFRRAINPHLATTSCGPGDYKDPS  476

Query  419  HALPQNVWDNDLQSILQKGFDS  484
               P N WDN+L +++Q G +S
Sbjct  477  SQAP-NEWDNELHNVVQMGLNS  497



>ref|NP_001051150.1| Os03g0728900 [Oryza sativa Japonica Group]
 gb|AAO38474.1| putative Helix-loop-helix DNA-binding domain containing protein 
[Oryza sativa Japonica Group]
 gb|AAT77054.1| putative DNA binding protein [Oryza sativa Japonica Group]
 gb|ABF98675.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13064.1| Os03g0728900 [Oryza sativa Japonica Group]
 gb|EAY90876.1| hypothetical protein OsI_12481 [Oryza sativa Indica Group]
 gb|EAZ28456.1| hypothetical protein OsJ_12437 [Oryza sativa Japonica Group]
Length=327

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (78%), Gaps = 6/136 (4%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            CSK Q K+      +    KE+YVHVRAKRGQATNSHSLAER+RR+KISERM+LLQ+LVP
Sbjct  125  CSKMQSKEDSS---DGDGTKEDYVHVRAKRGQATNSHSLAERLRRKKISERMKLLQDLVP  181

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIP  379
            GC+KI GKAVMLD+II YVQSLQ+QVEFLSMKLATVNPE++ D+EQIL K + L      
Sbjct  182  GCSKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPELSFDIEQILSKQMMLS--QDR  239

Query  380  HRSFTCI-PGSTPLHA  424
            H +F  + PGS+ L A
Sbjct  240  HLAFYGVDPGSSALVA  255



>ref|XP_004239006.1| PREDICTED: transcription factor bHLH49 [Solanum lycopersicum]
Length=517

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 115/202 (57%), Gaps = 48/202 (24%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAER+RREKISERM+ LQ+LVP
Sbjct  295  ASKPGGKNGKQGSQFSDPTKEEYIHVRARRGQATNSHSLAERIRREKISERMKYLQDLVP  354

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-------  358
            GCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ D++ +L KDI        
Sbjct  355  GCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFDIDGLLAKDILQSRAGPS  414

Query  359  ---------------------------LPGLNIPHRSF-----------TCIPGS--TPL  418
                                       LPG   P   F           +C PG    P 
Sbjct  415  SSLAFPPDMTMAYSPLHPPQAGLLQSGLPGYGFPSEGFRRAINPHLATTSCGPGDYKDPS  474

Query  419  HALPQNVWDNDLQSILQKGFDS  484
               P N WDN+L +I+Q G +S
Sbjct  475  SQAP-NEWDNELHNIVQMGLNS  495



>ref|XP_010248339.1| PREDICTED: transcription factor bHLH74-like isoform X6 [Nelumbo 
nucifera]
Length=393

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 122/198 (62%), Gaps = 50/198 (25%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKI  214
            GK+     QN    KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGCNKI
Sbjct  177  GKQAKDQSQNGEGPKEDYIHVRARRGQATNSHSLAERVRREKISERMRYLQDLVPGCNKI  236

Query  215  AGKAVMLDKIIKYVQSLQQQVE----------------------FLSMKLATVNPEMNLD  328
             GKAVMLD+II YVQSLQ+QVE                      FLSMKLATVNPE+N+D
Sbjct  237  TGKAVMLDEIINYVQSLQRQVEQSQEYSLTMVAADAKTQADHCKFLSMKLATVNPEINID  296

Query  329  VEQILPKDI-----------------FLPGL--NIPHRSFT------CIPGSTP-LHALP  430
            +EQIL KD+                 F P +  ++P +  T       I GS P L  + 
Sbjct  297  IEQILSKDVSKTEILHSRGGSSGILGFAPAMSSSLPQQHITQPDGAFLIQGSNPQLTTMS  356

Query  431  Q--NVWDNDLQSILQKGF  478
            Q  + W+++LQ+++Q GF
Sbjct  357  QAPSAWEDELQNVMQLGF  374



>ref|XP_002463945.1| hypothetical protein SORBIDRAFT_01g009380 [Sorghum bicolor]
 gb|EER90943.1| hypothetical protein SORBIDRAFT_01g009380 [Sorghum bicolor]
Length=315

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVHVRAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGCNKI GKAVMLD+II 
Sbjct  130  GTKEDYVHVRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCNKITGKAVMLDEIIN  189

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPLHA  424
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQI+ K + L      H +F  + PGS+ L A
Sbjct  190  YVQSLQRQVEFLSMKLATVNPELGFDIEQIISKQMMLS--QDRHLAFYGVDPGSSSLTA  246



>ref|XP_006650534.1| PREDICTED: transcription factor bHLH49-like [Oryza brachyantha]
Length=326

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (78%), Gaps = 6/136 (4%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            CSK Q K+      +    KE+YVHVRAKRGQATNSHSLAER+RR+KISERM+LLQ+LVP
Sbjct  125  CSKMQSKEDSS---DGDGTKEDYVHVRAKRGQATNSHSLAERLRRKKISERMKLLQDLVP  181

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIP  379
            GC+KI GKAVMLD+II YVQSLQ+QVEFLSMKLATVNPE++ D+EQIL K + L      
Sbjct  182  GCSKITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPELSFDIEQILSKQMMLS--QDR  239

Query  380  HRSFTCI-PGSTPLHA  424
            H +F  + PGS+ L A
Sbjct  240  HLAFYGVDPGSSALVA  255



>ref|XP_010248335.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Nelumbo 
nucifera]
Length=466

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 123/200 (62%), Gaps = 49/200 (25%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN    KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  248  KLTGKQAKDQSQNGEGPKEDYIHVRARRGQATNSHSLAERVRREKISERMRYLQDLVPGC  307

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVE---------------------FLSMKLATVNPEMN  322
            NKI GKAVMLD+II YVQSLQ+QVE                     FLSMKLATVNPE+N
Sbjct  308  NKITGKAVMLDEIINYVQSLQRQVESQEYSLTMVAADAKTQADHCKFLSMKLATVNPEIN  367

Query  323  LDVEQILPKDI-----------------FLPGL--NIPHRSFT------CIPGSTP-LHA  424
            +D+EQIL KD+                 F P +  ++P +  T       I GS P L  
Sbjct  368  IDIEQILSKDVSKTEILHSRGGSSGILGFAPAMSSSLPQQHITQPDGAFLIQGSNPQLTT  427

Query  425  LPQ--NVWDNDLQSILQKGF  478
            + Q  + W+++LQ+++Q GF
Sbjct  428  MSQAPSAWEDELQNVMQLGF  447



>ref|XP_010248334.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 123/201 (61%), Gaps = 50/201 (25%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+     QN    KE+Y+HVRA+RGQATNSHSLAERVRREKISERMR LQ+LVPGC
Sbjct  248  KLTGKQAKDQSQNGEGPKEDYIHVRARRGQATNSHSLAERVRREKISERMRYLQDLVPGC  307

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVE----------------------FLSMKLATVNPEM  319
            NKI GKAVMLD+II YVQSLQ+QVE                      FLSMKLATVNPE+
Sbjct  308  NKITGKAVMLDEIINYVQSLQRQVEQSQEYSLTMVAADAKTQADHCKFLSMKLATVNPEI  367

Query  320  NLDVEQILPKDI-----------------FLPGL--NIPHRSFT------CIPGSTP-LH  421
            N+D+EQIL KD+                 F P +  ++P +  T       I GS P L 
Sbjct  368  NIDIEQILSKDVSKTEILHSRGGSSGILGFAPAMSSSLPQQHITQPDGAFLIQGSNPQLT  427

Query  422  ALPQ--NVWDNDLQSILQKGF  478
             + Q  + W+++LQ+++Q GF
Sbjct  428  TMSQAPSAWEDELQNVMQLGF  448



>ref|XP_010553663.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Tarenaya 
hassleriana]
Length=362

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 118/177 (67%), Gaps = 22/177 (12%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSAR---KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELV  196
            ++ G KK   ++N  +R   KENY+ VRA+RG+AT+ HSLAERVRREKIS+RM LLQELV
Sbjct  186  EDSGAKKPTNKKNSGSREPPKENYILVRARRGRATSCHSLAERVRREKISKRMSLLQELV  245

Query  197  PGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF------  358
            PGCNKI GK VMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KDI       
Sbjct  246  PGCNKITGKTVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDILGSRDRN  305

Query  359  -----LPGLNIPHRSFTCIPGSTP--------LHALPQNVWDNDLQSILQKGFDSMS  490
                 L  +  P   F  I G+ P        L   PQ   + ++QS+ + GF S S
Sbjct  306  RSMFRLNAVMNPLPPFGIIQGTIPNLLTTNPQLDPAPQTEPEAEIQSLYRIGFVSNS  362



>gb|KHG16496.1| Transcription factor bHLH62 -like protein [Gossypium arboreum]
Length=441

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 121/188 (64%), Gaps = 37/188 (20%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKE---NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            SK+ G  K   ++ DS   E   +Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+L
Sbjct  234  SKQNGTVKASNKE-DSKPAEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDL  292

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLN  373
            VPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M++++E +L KD+F     
Sbjct  293  VPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDVNMETLLSKDMFQSRGL  352

Query  374  IPHRSFTCIP----GSTPLHA-----------------LPQ------------NVWDNDL  454
            +PH  ++  P    G  P                    LPQ            ++W++DL
Sbjct  353  LPHTVYSMEPTFPFGYQPQQGLALNNGIANTTSQQGFQLPQVNGFIDGNPQVGSIWEDDL  412

Query  455  QSILQKGF  478
            QSI+Q GF
Sbjct  413  QSIVQMGF  420



>emb|CDX85122.1| BnaC07g07840D [Brassica napus]
Length=331

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 108/180 (60%), Gaps = 30/180 (17%)
 Frame = +2

Query  29   EQGKKKHKTRQNDSARK----ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELV  196
            E G  K      D A+     ++Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+LV
Sbjct  129  EAGSSKKDDGNKDDAKPPEPPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQDLV  188

Query  197  PGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLD----------------  328
            PGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLAT+NP M  +                
Sbjct  189  PGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATINPRMEFNPSAALSTEMVQPGEAL  248

Query  329  ---------VEQILPKDIFLPGLNIPHRSFTCIPGSTPL-HALPQNVWDNDLQSILQKGF  478
                      EQ LP   +    N+P  S T  P S     A  Q  WDNDLQSI+Q GF
Sbjct  249  TQSLYSMACSEQRLPSAYYSLAKNMPRFSDTQFPSSDAFVQAETQGFWDNDLQSIVQMGF  308



>gb|ABK94855.1| unknown [Populus trichocarpa]
Length=348

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 123/203 (61%), Gaps = 49/203 (24%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK+ GK+  +        KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  125  TSKDAGKQGKQGSLGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  184

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGL---  370
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+F P +   
Sbjct  185  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLAKDVFDPKILQL  244

Query  371  -NIPHRSF----------------------TCIPGS---------------TPLHA----  424
              +P  S                       T  PG                TP+ A    
Sbjct  245  HAVPPSSLAFSLEMPMAYPPSHPSQAGLIPTAFPGMNNHSDIICRTINSQLTPMTAGFKE  304

Query  425  ---LPQNVWDNDLQSILQKGFDS  484
               LP NVWD++L++++Q  +++
Sbjct  305  PAQLP-NVWDDELRNVVQMSYET  326



>tpg|DAA51145.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=209

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  23   GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  82

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPLHA  424
            YVQSLQ+QVEFLSMKL+TVNPE+  D+EQI+ K + L      H +F  + PGS+ L A
Sbjct  83   YVQSLQRQVEFLSMKLSTVNPELGFDIEQIISKQMMLS--QDRHLAFYGVDPGSSSLTA  139



>dbj|BAJ92166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  77   KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYV  256
            KENYVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGCNKI GKAVMLD+II YV
Sbjct  132  KENYVHLRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCNKITGKAVMLDEIINYV  191

Query  257  QSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFL  361
            QSLQ+QVEFLSMKLATVNPE+  D+EQIL K + L
Sbjct  192  QSLQRQVEFLSMKLATVNPELGFDIEQILSKQMML  226



>ref|XP_003560304.1| PREDICTED: transcription factor bHLH74-like [Brachypodium distachyon]
Length=326

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 3/129 (2%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  138  GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  197

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPLHAL  427
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQIL K + L      H +F    PGS+ L   
Sbjct  198  YVQSLQRQVEFLSMKLATVNPELGFDIEQILSKQMMLS--QDRHLAFYGADPGSSTLAHF  255

Query  428  PQNVWDNDL  454
             Q +   D+
Sbjct  256  NQGIMQPDM  264



>gb|KDO70234.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=225

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  37   KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  96

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  97   SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  147



>gb|KDO70235.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=218

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  37   KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  96

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  97   SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  147



>gb|EMS66130.1| Transcription factor bHLH74 [Triticum urartu]
Length=413

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  77   KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYV  256
            KENYVH RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGCNKI GKAVMLD+II YV
Sbjct  216  KENYVHFRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCNKITGKAVMLDEIINYV  275

Query  257  QSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            QSLQ+QVEFLSMKLATVNPE+  D+EQIL K + LP
Sbjct  276  QSLQRQVEFLSMKLATVNPELGFDIEQILSKQMMLP  311



>tpg|DAA61908.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04281.1| bHLH transcription factor, partial [Zea mays]
Length=434

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 102/125 (82%), Gaps = 4/125 (3%)
 Frame = +2

Query  35   GKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNK  211
            GK K K  R+   ++KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K
Sbjct  232  GKSKGKGARETSESQKEDYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSK  291

Query  212  IAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRS  388
            + GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG  +P  S
Sbjct  292  VTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--VPSSS  349

Query  389  FTCIP  403
                P
Sbjct  350  LGFSP  354



>gb|AFW67723.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05498.1| bHLH transcription factor, partial [Zea mays]
Length=284

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  98   GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  157

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPL  418
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQI+ K + L      H +F  + PGS+ L
Sbjct  158  YVQSLQRQVEFLSMKLATVNPELGFDIEQIISKQMLLS--QDRHLAFYGVEPGSSGL  212



>ref|NP_001131789.1| uncharacterized protein LOC100193160 [Zea mays]
 ref|XP_008647764.1| PREDICTED: uncharacterized protein LOC100193160 isoform X1 [Zea 
mays]
 ref|XP_008647791.1| PREDICTED: uncharacterized protein LOC100193160 isoform X1 [Zea 
mays]
 gb|ACF80353.1| unknown [Zea mays]
 tpg|DAA51146.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04350.1| bHLH transcription factor, partial [Zea mays]
Length=316

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  130  GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  189

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPLHA  424
            YVQSLQ+QVEFLSMKL+TVNPE+  D+EQI+ K + L      H +F  + PGS+ L A
Sbjct  190  YVQSLQRQVEFLSMKLSTVNPELGFDIEQIISKQMMLS--QDRHLAFYGVDPGSSSLTA  246



>gb|KDO70233.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=245

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  37   KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  96

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  97   SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  147



>ref|XP_008644536.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Zea mays]
Length=317

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  131  GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  190

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPL  418
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQI+ K + L      H +F  + PGS+ L
Sbjct  191  YVQSLQRQVEFLSMKLATVNPELGFDIEQIISKQMLLS--QDRHLAFYGVEPGSSGL  245



>gb|KDO70232.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=253

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  37   KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  96

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  97   SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  147



>ref|XP_008644537.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Zea mays]
Length=316

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  130  GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  189

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI-PGSTPL  418
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQI+ K + L      H +F  + PGS+ L
Sbjct  190  YVQSLQRQVEFLSMKLATVNPELGFDIEQIISKQMLLS--QDRHLAFYGVEPGSSGL  244



>ref|XP_010544022.1| PREDICTED: transcription factor bHLH74-like isoform X2 [Tarenaya 
hassleriana]
Length=376

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 109/163 (67%), Gaps = 21/163 (13%)
 Frame = +2

Query  41   KKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAG  220
            K+ +  Q+    K NY+HVR +RGQAT SHSLAERVRREKISERMRLLQELVPGC+KI G
Sbjct  196  KEEENSQSGETPKGNYIHVRTRRGQATKSHSLAERVRREKISERMRLLQELVPGCSKITG  255

Query  221  KAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI------------FLP  364
            KAVMLD+II YVQSLQQQVEFLSMKL+ VNPE+ +D+++   KDI               
Sbjct  256  KAVMLDEIINYVQSLQQQVEFLSMKLSAVNPEVKIDIDRTRAKDILHSRDENGYVLGLRT  315

Query  365  GLNIPHRSFTCIPGSTP--------LHALPQNVWDNDLQSILQ  469
            G+N+ H  +  I G  P        L+ L Q V D +LQSI Q
Sbjct  316  GMNLLH-PYNTIQGIIPNIPTTNSQLNPLSQTVIDTELQSIYQ  357



>ref|XP_002460392.1| hypothetical protein SORBIDRAFT_02g027430 [Sorghum bicolor]
 gb|EER96913.1| hypothetical protein SORBIDRAFT_02g027430 [Sorghum bicolor]
Length=438

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 4/125 (3%)
 Frame = +2

Query  35   GKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNK  211
            GK K K  ++   ++KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K
Sbjct  235  GKSKGKGAKETSESQKEDYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSK  294

Query  212  IAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRS  388
            + GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG  +P  S
Sbjct  295  VTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--VPSSS  352

Query  389  FTCIP  403
                P
Sbjct  353  LGFSP  357



>gb|KHG04243.1| Transcription factor bHLH62 -like protein [Gossypium arboreum]
Length=517

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 121/212 (57%), Gaps = 62/212 (29%)
 Frame = +2

Query  29   EQGKKKHKTRQNDSARKE------------NYVHVRAKRGQATNSHSLAERVRREKISER  172
            ++   K   +QNDSA+ E            +Y+HVRA+RGQAT+SHSLAERVRREKISER
Sbjct  293  DESTAKRSKQQNDSAKAENKENPKPPEPPKDYIHVRARRGQATDSHSLAERVRREKISER  352

Query  173  MRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKD  352
            M+ LQ+LVPGCNK+ GKA+MLD+II YVQSLQ+QVEFLSMKLATVNP MN + E +L KD
Sbjct  353  MKFLQDLVPGCNKVTGKALMLDEIINYVQSLQRQVEFLSMKLATVNPRMNANTEALLSKD  412

Query  353  IFLPGLNIPHR---------------------------------SFTCIPGSTPLH----  421
            +F    ++PH                                   F+  P +  LH    
Sbjct  413  MFRSRGSLPHSHYPMDSSVLAFGLRYQPQQGLPMNNVISNDTQIQFSMNPANAALHKTQG  472

Query  422  -----------ALPQ--NVWDNDLQSILQKGF  478
                       A PQ  + WD+DLQSI+Q GF
Sbjct  473  LQLPPVDGITDANPQIGSFWDDDLQSIVQMGF  504



>ref|XP_011102313.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
Length=421

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 116/181 (64%), Gaps = 28/181 (15%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   ++ Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  220  SKPGGKHGKQSSQGSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  279

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF--------  358
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E  L KDI         
Sbjct  280  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGFLAKDILQSRAGMSS  339

Query  359  ---LPGLN----IPHRSFT----------CIPGS--TPLHALPQNVWDNDLQSILQKGFD  481
                PGL     + + S T           I G    P    P NVW+++L +++  GF+
Sbjct  340  SLAFPGLIQAGLLSNSSETLRRPISLQSPAISGGFKEPTSQGP-NVWEDELHNVVHMGFN  398

Query  482  S  484
            S
Sbjct  399  S  399



>ref|XP_004981901.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Setaria 
italica]
 ref|XP_004981902.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Setaria 
italica]
Length=317

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 7/121 (6%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  131  GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  190

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCI---PGSTPLH  421
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQIL + + L       R F      PGS+ L 
Sbjct  191  YVQSLQRQVEFLSMKLATVNPELGFDIEQILSQQMMLS----QDRHFAIYGADPGSSSLA  246

Query  422  A  424
            A
Sbjct  247  A  247



>ref|XP_003628711.1| BHLH transcription factor [Medicago truncatula]
 gb|AET03187.1| transcription factor [Medicago truncatula]
Length=467

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            +K  GK   +  Q      E YVHVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  281  AKASGKNAKQGSQASDPPNEGYVHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  340

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            CNK+ GKAVMLD+II YVQSLQQQVEFLSMKLATVNP ++ ++E++LPKDI 
Sbjct  341  CNKVTGKAVMLDEIINYVQSLQQQVEFLSMKLATVNPHVDFNMERLLPKDIL  392



>ref|XP_003578282.1| PREDICTED: transcription factor bHLH49-like [Brachypodium distachyon]
 ref|XP_010238258.1| PREDICTED: transcription factor bHLH49-like [Brachypodium distachyon]
 ref|XP_010238259.1| PREDICTED: transcription factor bHLH49-like [Brachypodium distachyon]
Length=415

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKI  214
            GK K K  + +S+ KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+
Sbjct  222  GKSKGKGAK-ESSEKEDYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKV  280

Query  215  AGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSF  391
             GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG++     F
Sbjct  281  TGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPGVSSSSIGF  340

Query  392  T  394
            +
Sbjct  341  S  341



>ref|XP_009593502.1| PREDICTED: transcription factor bHLH49-like [Nicotiana tomentosiformis]
 ref|XP_009593503.1| PREDICTED: transcription factor bHLH49-like [Nicotiana tomentosiformis]
 ref|XP_009593504.1| PREDICTED: transcription factor bHLH49-like [Nicotiana tomentosiformis]
Length=507

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 115/191 (60%), Gaps = 38/191 (20%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK   +  Q     KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+ LQ+LVPGC
Sbjct  295  KSGGKNVKQGSQASDPTKEDYIHVRARRGQATNSHSLAERIRREKISERMKFLQDLVPGC  354

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            NK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+++ +++ +L K+I          
Sbjct  355  NKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQLDFNIDGLLAKNILQSRAGPSSS  414

Query  359  -----------------LPGLNIPHRSF--------TCIPGSTPLHALPQ----NVWDND  451
                              PG  IP  +F            G    +  P     +VWDN+
Sbjct  415  FAFPPDMTMQYPPLHPPQPGYGIPSDAFRRAITPHLAATSGGPSEYKDPSSEGPSVWDNE  474

Query  452  LQSILQKGFDS  484
            L +I+Q G +S
Sbjct  475  LHNIVQMGLNS  485



>ref|XP_003576061.2| PREDICTED: transcription factor bHLH49-like [Brachypodium distachyon]
Length=323

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 3/127 (2%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKI  214
            GK K K    D  +  +Y+HVRA+RGQAT+SHSLAERVRREKISERM+LLQ+LVP CNK+
Sbjct  126  GKGKEKEVAEDPHK--DYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPSCNKV  183

Query  215  AGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFT  394
             GKAVMLD+II YVQSLQ+QVEFLSMKL+TVNP+M  DV+  LPKD   P  ++P  ++T
Sbjct  184  TGKAVMLDEIINYVQSLQRQVEFLSMKLSTVNPQMEFDVDNFLPKDDNEP-CSLPATAYT  242

Query  395  CIPGSTP  415
               G+ P
Sbjct  243  AAEGANP  249



>ref|XP_009767242.1| PREDICTED: transcription factor bHLH49 [Nicotiana sylvestris]
 ref|XP_009767243.1| PREDICTED: transcription factor bHLH49 [Nicotiana sylvestris]
Length=507

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 116/193 (60%), Gaps = 38/193 (20%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
              K  GK   +  Q     KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+ LQ+LVP
Sbjct  293  AGKSGGKNGKQGSQASDPTKEDYIHVRARRGQATNSHSLAERIRREKISERMKFLQDLVP  352

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI--------  355
            GCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+++ +++ +L K+I        
Sbjct  353  GCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQLDFNIDGLLAKNILQSRAGPS  412

Query  356  ----FLP--------------GLNIPHRSF--------TCIPGSTPLHALPQ----NVWD  445
                F P              G  IP  +F            G    +  P     +VWD
Sbjct  413  SSLAFPPDMTMPYPPLHPPQPGYGIPSDAFRRAITPHLAATSGGPSEYKHPSSEGPSVWD  472

Query  446  NDLQSILQKGFDS  484
            N+L +I+Q G +S
Sbjct  473  NELHNIVQMGLNS  485



>gb|ADD60699.1| putative TA1 protein [Oryza officinalis]
Length=435

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+   T+ N  + KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  238  KSSGKQ---TKDNAGSPKEDYIHVRARRGQATNSHSLAERVRREKISERMKYLQDLVPGC  294

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHR  385
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++E+IL KDIF         
Sbjct  295  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIERILSKDIFQSRGTTASS  354

Query  386  SFTCIP  403
            +F   P
Sbjct  355  AFGFFP  360



>gb|KCW68611.1| hypothetical protein EUGRSUZ_F02220 [Eucalyptus grandis]
Length=398

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 18/132 (14%)
 Frame = +2

Query  41   KKHKTRQ------NDS-ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             KH T+Q      ND  A KENY+H+RA+RGQATNSHSLAERVRREKISERMR+LQELVP
Sbjct  233  SKHNTKQSKDDSSNDGEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRMLQELVP  292

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKD---------  352
            GCNKI GKAVMLD+II YVQSLQQQVEFLSMKL+T+ P M++D+E+ L K+         
Sbjct  293  GCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLSTLIPGMSIDLEKALSKEAHSRGGGAT  352

Query  353  --IFLPGLNIPH  382
                 PG+ +PH
Sbjct  353  NLALNPGMGLPH  364



>ref|XP_007034153.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY05079.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
Length=578

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 125/218 (57%), Gaps = 60/218 (28%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKEN---------YVHVRAKRGQATNSHSLAERVRRE  157
            G+  E +++ G  K     N    KEN         Y+HVRA+RGQAT+SHSLAERVRRE
Sbjct  339  GNAKEKTEQNGNGKAANDGNQKQGKENSKPPEPPKDYIHVRARRGQATDSHSLAERVRRE  398

Query  158  KISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQ  337
            KISERM+ LQ+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKL+TVNP M++++E 
Sbjct  399  KISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLSTVNPRMDINMEA  458

Query  338  ILPKDIFLPGLNIPHRSF---TCIPG----------STPLH-------------------  421
            +L KD+F  G ++PH  +   +  P           + PLH                   
Sbjct  459  LLSKDMFRSGGSLPHALYSMDSSAPAFPFGYQLQQQALPLHSGISNNIETQFSMNPLNAV  518

Query  422  -----------------ALPQ--NVWDNDLQSILQKGF  478
                             A PQ  + W++DLQSI+Q GF
Sbjct  519  LRKTQGVQLPPIDGFTDANPQVASFWEDDLQSIVQMGF  556



>ref|XP_006655999.1| PREDICTED: transcription factor bHLH49-like [Oryza brachyantha]
Length=420

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +2

Query  14   LECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            +   K  GK+    + N  + KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+L
Sbjct  219  VASGKSSGKQ---AKDNAGSPKEEYIHVRARRGQATNSHSLAERVRREKISERMKYLQDL  275

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLN  373
            VPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++++IL KDIF     
Sbjct  276  VPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIDRILSKDIFQSQGA  335

Query  374  IPHRSFTCIPG  406
            I    F  +PG
Sbjct  336  IASSVFGFLPG  346



>gb|KFK39667.1| hypothetical protein AALP_AA3G273700 [Arabis alpina]
Length=363

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 106/169 (63%), Gaps = 26/169 (15%)
 Frame = +2

Query  80   ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQ  259
            ++Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+LVPGCN+I GKAVMLD+II YVQ
Sbjct  182  KDYIHVRARRGQATDSHSLAERARREKISERMTLLQDLVPGCNRITGKAVMLDEIINYVQ  241

Query  260  SLQQQVEFLSMKLATVNPEMNLDV-------------------------EQILPKDIFLP  364
            SLQ+QVEFLSMKLAT+NP M  +                          EQ LP   +  
Sbjct  242  SLQRQVEFLSMKLATINPRMEFNATAALSTEMIQPGESLTQSLYAIACSEQRLPSGYYSI  301

Query  365  GLNIPHRSFTCIPGSTPL-HALPQNVWDNDLQSILQKGFDSMSNRGPND  508
            G N+P  S T  P +     A     W+NDLQSI+Q GF  +  +  N+
Sbjct  302  GKNMPRFSDTQFPSTDGFVQAETPGFWENDLQSIVQMGFGDIQQQSSNN  350



>gb|EMS47333.1| Transcription factor bHLH49 [Triticum urartu]
Length=391

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  65   DSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKI  244
            +S+ KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+ GKAVMLD+I
Sbjct  193  ESSEKEDYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKVTGKAVMLDEI  252

Query  245  IKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSFT  394
            I YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG++     F+
Sbjct  253  INYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPGVSSSSMGFS  303



>ref|XP_009387111.1| PREDICTED: transcription factor bHLH49-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387112.1| PREDICTED: transcription factor bHLH49-like [Musa acuminata subsp. 
malaccensis]
Length=344

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
            A K++Y+HVRAKRGQATNSHSLAER+RREKISERM+LLQ+LVPGC+KI GKA+MLD+II 
Sbjct  159  ASKDDYIHVRAKRGQATNSHSLAERIRREKISERMKLLQDLVPGCSKINGKAMMLDEIIN  218

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            YVQSLQ+QVEFLSMKLA VNPE+N D+EQIL  DI
Sbjct  219  YVQSLQRQVEFLSMKLAAVNPELNFDLEQILSGDI  253



>ref|XP_006352666.1| PREDICTED: transcription factor bHLH78-like [Solanum tuberosum]
Length=467

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 115/164 (70%), Gaps = 13/164 (8%)
 Frame = +2

Query  41   KKHKTRQNDSARKE------------NYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            ++ K  ++D A KE            +Y+HVRA+RGQAT+SHSLAERVRREKIS+RM+LL
Sbjct  283  EEQKGSEDDGAEKEAKENRKIAEPQKDYIHVRARRGQATDSHSLAERVRREKISQRMKLL  342

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKA+MLD+II YVQSLQ QVEFLSMKLA+VNP M+  ++ +L K+I  P
Sbjct  343  QDLVPGCNKVTGKALMLDEIINYVQSLQHQVEFLSMKLASVNPRMDFHIDSLLHKEISQP  402

Query  365  GLNIPHRSFTCIPGSTPLHALPQNVWDNDLQSILQKGFDSMSNR  496
              ++    F        L  LP  + ++DLQSI+Q GF+  SN+
Sbjct  403  SGSLHQHVFLVDGYGENLAQLP-TICEDDLQSIVQMGFNQNSNQ  445



>gb|ADD60710.1| putative TA1 protein [Oryza brachyantha]
Length=426

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +2

Query  14   LECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            +   K  GK+    + N  + KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+L
Sbjct  225  VASGKSSGKQ---AKDNAGSPKEEYIHVRARRGQATNSHSLAERVRREKISERMKYLQDL  281

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLN  373
            VPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++++IL KDIF     
Sbjct  282  VPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIDRILSKDIFQSQGA  341

Query  374  IPHRSFTCIPG  406
            I    F  +PG
Sbjct  342  IASSVFGFLPG  352



>dbj|BAJ93982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKI  214
            G+ K K  +  S  KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+
Sbjct  222  GRSKGKGAKEGS-EKEDYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKV  280

Query  215  AGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSF  391
             GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG++     F
Sbjct  281  TGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPGVSSSSMGF  340

Query  392  T  394
            +
Sbjct  341  S  341



>ref|XP_008466092.1| PREDICTED: transcription factor bHLH49-like [Cucumis melo]
 ref|XP_008466100.1| PREDICTED: transcription factor bHLH49-like [Cucumis melo]
Length=533

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 123/194 (63%), Gaps = 41/194 (21%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK+  +  Q   A KE Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQ+LVPG
Sbjct  317  SKPAGKQGKQDSQPSDAPKEEYIHVRARRGQATNSHSLAERVRREKISERMRLLQDLVPG  376

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---------  355
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L K++         
Sbjct  377  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLTKELIQSKAGPSL  436

Query  356  --FLPGLNIP----HRSF-----TCIP--GSTP----------LHALPQ---------NV  439
              F P + +P    H S       C+P  GS+P          L +L           N 
Sbjct  437  FGFPPDMPVPYLPQHSSHHGLIPPCLPTMGSSPDLLRRTINSQLTSLVGGFKEPVQLPNR  496

Query  440  WDNDLQSILQKGFD  481
            W+N+L +++   FD
Sbjct  497  WENELDNVVPMNFD  510



>ref|XP_009106418.1| PREDICTED: transcription factor bHLH77-like [Brassica rapa]
Length=332

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 111/183 (61%), Gaps = 32/183 (17%)
 Frame = +2

Query  11   VLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            + +C   +G  K     +D+   ++Y+HVRA+RGQAT+SHSLAER RREKISERM +LQ+
Sbjct  132  IDKCDDSKGDNK-----DDAKPTKDYIHVRARRGQATDSHSLAERARREKISERMTMLQD  186

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPG-  367
            LVPGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M  +    L  ++   G 
Sbjct  187  LVPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMEFNANAALSTEMIQQGE  246

Query  368  -------------------------LNIPHRSFTCIPGSTPL-HALPQNVWDNDLQSILQ  469
                                      N+P  S T +P S     A  Q  W+NDLQSI+Q
Sbjct  247  SLTQSLYAMACSEQRLPSGGYYSLTKNMPRFSDTHLPSSDGFVQAETQGFWENDLQSIVQ  306

Query  470  KGF  478
             GF
Sbjct  307  MGF  309



>ref|XP_011021251.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Populus 
euphratica]
Length=573

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK+ GK+  +        KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  350  SSKDAGKQGKQGSLGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  409

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+F P
Sbjct  410  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLAKDVFDP  464



>ref|XP_004957102.1| PREDICTED: transcription factor bHLH49-like [Setaria italica]
Length=516

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +2

Query  35   GKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNK  211
            GK K K  ++   ++KE+Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K
Sbjct  313  GKSKGKGAKETSESQKEDYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSK  372

Query  212  IAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRS  388
            + GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG++     
Sbjct  373  VTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPGVSSSSLG  432

Query  389  FT  394
            F+
Sbjct  433  FS  434



>ref|XP_011021235.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Populus 
euphratica]
 ref|XP_011021243.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Populus 
euphratica]
Length=577

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK+ GK+  +        KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  350  SSKDAGKQGKQGSLGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  409

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+F P
Sbjct  410  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLAKDVFDP  464



>ref|XP_011021258.1| PREDICTED: transcription factor bHLH49-like isoform X3 [Populus 
euphratica]
Length=570

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK+ GK+  +        KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  350  SSKDAGKQGKQGSLGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  409

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+F P
Sbjct  410  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLAKDVFDP  464



>ref|XP_004149484.1| PREDICTED: transcription factor bHLH49-like [Cucumis sativus]
Length=533

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK+  +  Q   A KE Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQ+LVPG
Sbjct  317  SKPAGKQGKQDSQPSDAPKEEYIHVRARRGQATNSHSLAERVRREKISERMRLLQDLVPG  376

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPH  382
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L K+ F+     P 
Sbjct  377  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLTKE-FIQSKAGP-  434

Query  383  RSFTCIPGSTPLHALPQ  433
             S    P   P+  LPQ
Sbjct  435  -SLFGFPPDMPVPYLPQ  450



>gb|KGN49799.1| hypothetical protein Csa_5G135350 [Cucumis sativus]
Length=533

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK+  +  Q   A KE Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQ+LVPG
Sbjct  317  SKPAGKQGKQDSQPSDAPKEEYIHVRARRGQATNSHSLAERVRREKISERMRLLQDLVPG  376

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPH  382
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L K+ F+     P 
Sbjct  377  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLTKE-FIQSKAGP-  434

Query  383  RSFTCIPGSTPLHALPQ  433
             S    P   P+  LPQ
Sbjct  435  -SLFGFPPDMPVPYLPQ  450



>ref|XP_004166054.1| PREDICTED: transcription factor bHLH49-like [Cucumis sativus]
Length=533

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK+  +  Q   A KE Y+HVRA+RGQATNSHSLAERVRREKISERMRLLQ+LVPG
Sbjct  317  SKPAGKQGKQDSQPSDAPKEEYIHVRARRGQATNSHSLAERVRREKISERMRLLQDLVPG  376

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPH  382
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L K+ F+     P 
Sbjct  377  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLTKE-FIQSKAGP-  434

Query  383  RSFTCIPGSTPLHALPQ  433
             S    P   P+  LPQ
Sbjct  435  -SLFGFPPDMPVPYLPQ  450



>ref|XP_010553664.1| PREDICTED: transcription factor bHLH74-like isoform X3 [Tarenaya 
hassleriana]
Length=354

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 3/114 (3%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSAR---KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELV  196
            ++ G KK   ++N  +R   KENY+ VRA+RG+AT+ HSLAERVRREKIS+RM LLQELV
Sbjct  155  EDSGAKKPTNKKNSGSREPPKENYILVRARRGRATSCHSLAERVRREKISKRMSLLQELV  214

Query  197  PGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            PGCNKI GK VMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KDI 
Sbjct  215  PGCNKITGKTVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDIL  268



>ref|XP_007034154.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY05080.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
Length=563

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (75%), Gaps = 9/139 (6%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKEN---------YVHVRAKRGQATNSHSLAERVRRE  157
            G+  E +++ G  K     N    KEN         Y+HVRA+RGQAT+SHSLAERVRRE
Sbjct  339  GNAKEKTEQNGNGKAANDGNQKQGKENSKPPEPPKDYIHVRARRGQATDSHSLAERVRRE  398

Query  158  KISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQ  337
            KISERM+ LQ+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKL+TVNP M++++E 
Sbjct  399  KISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLSTVNPRMDINMEA  458

Query  338  ILPKDIFLPGLNIPHRSFT  394
            +L KD+F  G ++PH  ++
Sbjct  459  LLSKDMFRSGGSLPHALYS  477



>emb|CDY45835.1| BnaA02g14180D [Brassica napus]
Length=453

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 16/145 (11%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  243  GNKTNSGKQQGKQT-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  295

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD+   
Sbjct  296  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEALLAKDV---  352

Query  365  GLNIPHRSFTCIPGSTPLHALPQNV  439
                  R      GS+     PQN+
Sbjct  353  ------RELQLRGGSSSATPFPQNM  371



>gb|ADD60686.1| putative TA1 protein [Oryza australiensis]
Length=436

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 3/130 (2%)
 Frame = +2

Query  14   LECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            +   K  GK+   T+ N  + KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ L
Sbjct  235  VASGKSSGKQ---TKDNAGSPKEEYIHVRARRGQATNSHSLAERVRREKISERMKYLQNL  291

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLN  373
            VPGC K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++E+IL KDIF    +
Sbjct  292  VPGCTKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIERILSKDIFQSRGS  351

Query  374  IPHRSFTCIP  403
                +F  +P
Sbjct  352  AASSAFGFLP  361



>ref|XP_009127689.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127690.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127691.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127693.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127694.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
Length=473

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 16/145 (11%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  263  GNKTNSGKQQGKQT-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  315

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD+   
Sbjct  316  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLESLLAKDV---  372

Query  365  GLNIPHRSFTCIPGSTPLHALPQNV  439
                  R      GS+     PQN+
Sbjct  373  ------RELQLRGGSSSATPFPQNM  391



>ref|XP_010553662.1| PREDICTED: transcription factor bHLH74-like isoform X1 [Tarenaya 
hassleriana]
Length=385

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 3/114 (3%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSAR---KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELV  196
            ++ G KK   ++N  +R   KENY+ VRA+RG+AT+ HSLAERVRREKIS+RM LLQELV
Sbjct  186  EDSGAKKPTNKKNSGSREPPKENYILVRARRGRATSCHSLAERVRREKISKRMSLLQELV  245

Query  197  PGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            PGCNKI GK VMLD+II YVQSLQQQVEFLSMKLATVNPE+N+D+++IL KDI 
Sbjct  246  PGCNKITGKTVMLDEIINYVQSLQQQVEFLSMKLATVNPELNIDIDRILAKDIL  299



>ref|XP_008644538.1| PREDICTED: transcription factor bHLH49-like isoform X3 [Zea mays]
Length=313

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
              KE+YVH+RAKRGQATNSHSLAER+RR+KISERM+LLQ+LVPGC+KI GKAVMLD+II 
Sbjct  131  GTKEDYVHIRAKRGQATNSHSLAERLRRKKISERMKLLQDLVPGCSKITGKAVMLDEIIN  190

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            YVQSLQ+QVEFLSMKLATVNPE+  D+EQI+ K +  P
Sbjct  191  YVQSLQRQVEFLSMKLATVNPELGFDIEQIISKQVKPP  228



>emb|CDY33568.1| BnaC06g29840D [Brassica napus]
Length=482

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 120/186 (65%), Gaps = 38/186 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  274  GNKTNSGKQQGKQA-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  326

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---  355
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ + E +L KD    
Sbjct  327  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNREGLLAKDALQL  386

Query  356  ---------FLPGL-----NIPH----RSFTCI------PGSTPLHALPQ----NVWDND  451
                     F P +      +PH    ++ +C+      P S P++   +    N W+ D
Sbjct  387  RAGTSSATPFPPNMPMVYPPLPHGFMQQTLSCMGRTVSSPLSPPINGGYKRQEANGWEGD  446

Query  452  LQSILQ  469
            LQ+++Q
Sbjct  447  LQNVIQ  452



>emb|CDX77488.1| BnaA07g06260D [Brassica napus]
Length=329

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 109/183 (60%), Gaps = 35/183 (19%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKEN---------YVHVRAKRGQATNSHSLAERVRREKISERMRLLQ  187
            G K+ K  +  S+ K++         Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ
Sbjct  124  GSKRSKQDEAGSSNKDDAKPPEPPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQ  183

Query  188  ELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLD-------------  328
            +LVPGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLAT+NP M  +             
Sbjct  184  DLVPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATINPRMEFNPSAALSTEMVQPG  243

Query  329  ------------VEQILPKDIFLPGLNIPHRSFTCIPGSTPL-HALPQNVWDNDLQSILQ  469
                         EQ LP   +    N+P  S    P +     A  Q  W+NDLQSI+Q
Sbjct  244  EALTQSLYSMACSEQRLPSAYYSLAKNMPRFSDAQFPSTDAFVQAETQGFWENDLQSIVQ  303

Query  470  KGF  478
             GF
Sbjct  304  MGF  306



>gb|KEH27902.1| BHLH transcription factor [Medicago truncatula]
Length=558

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK   +  QN    KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQELVPGC
Sbjct  342  KASGKNAKQGSQNSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQELVPGC  401

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KD+ 
Sbjct  402  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIESLLAKDVL  452



>ref|XP_002514566.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47672.1| conserved hypothetical protein [Ricinus communis]
Length=566

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 120/204 (59%), Gaps = 44/204 (22%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  348  KTSGKQGKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  407

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----------  355
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI          
Sbjct  408  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDILHSRAVPSST  467

Query  356  --FLPGLNIPHRSF---------TCIPGS---------------TPLHA-------LPQN  436
              F P + + +  F            PG                TPL         LP N
Sbjct  468  LAFSPDMIMAYPPFNTSQPGLIQASFPGMESHSDVLRRTISSQLTPLSGVFKEPTQLP-N  526

Query  437  VWDNDLQSILQKGFDSMSNRGPND  508
             WD++L +++Q G+ + + +   D
Sbjct  527  AWDDELHNVVQMGYGTGTTQDSQD  550



>emb|CDX81575.1| BnaC02g18790D [Brassica napus]
Length=475

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 16/145 (11%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  268  GNKTNSGKQQGKQT-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  320

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD+   
Sbjct  321  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEALLAKDV---  377

Query  365  GLNIPHRSFTCIPGSTPLHALPQNV  439
                  R      GS+     PQN+
Sbjct  378  ------RELQLRGGSSSATPFPQNM  396



>gb|EPS62866.1| hypothetical protein M569_11921, partial [Genlisea aurea]
Length=101

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  77   KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYV  256
            KE YVH+RA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC+K+ GKAVMLD+II YV
Sbjct  9    KEGYVHIRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYV  68

Query  257  QSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            QSLQ+QVEFLSMKLA VN  M+L++E +L KD+
Sbjct  69   QSLQRQVEFLSMKLAAVNSHMDLNIEGLLAKDV  101



>ref|XP_009631088.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Nicotiana 
tomentosiformis]
Length=526

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 9/155 (6%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKI  214
            GK   +  Q+    KE Y+H+RA+RGQATNSHSLAER+RREKISERM+ LQ+LVPGCNK+
Sbjct  313  GKNSKQGSQSADPPKEEYIHIRARRGQATNSHSLAERLRREKISERMKYLQDLVPGCNKV  372

Query  215  AGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFT  394
             GKAVMLD+II YVQSLQ+QVEFLSMKLAT+NP ++ +++ +L KDIF     +P  S  
Sbjct  373  TGKAVMLDEIINYVQSLQRQVEFLSMKLATINPRLDFNIDGLLAKDIFH-SRTVPSSSLA  431

Query  395  CIPGST-PLHALPQNVWDNDLQ-SILQKGFDSMSN  493
              P  T P H+  Q      LQ  +LQ G   + N
Sbjct  432  FAPDMTMPYHSSQQ------LQPGLLQSGLPGLGN  460



>ref|XP_009631087.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Nicotiana 
tomentosiformis]
Length=528

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 9/155 (6%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKI  214
            GK   +  Q+    KE Y+H+RA+RGQATNSHSLAER+RREKISERM+ LQ+LVPGCNK+
Sbjct  315  GKNSKQGSQSADPPKEEYIHIRARRGQATNSHSLAERLRREKISERMKYLQDLVPGCNKV  374

Query  215  AGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFT  394
             GKAVMLD+II YVQSLQ+QVEFLSMKLAT+NP ++ +++ +L KDIF     +P  S  
Sbjct  375  TGKAVMLDEIINYVQSLQRQVEFLSMKLATINPRLDFNIDGLLAKDIFH-SRTVPSSSLA  433

Query  395  CIPGST-PLHALPQNVWDNDLQ-SILQKGFDSMSN  493
              P  T P H+  Q      LQ  +LQ G   + N
Sbjct  434  FAPDMTMPYHSSQQ------LQPGLLQSGLPGLGN  462



>gb|ADD60674.1| putative TA1 protein [Oryza granulata]
Length=430

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  35   GKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNK  211
            GK   K  + N  + KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC+K
Sbjct  232  GKSSRKQAKDNAGSPKEEYIHVRARRGQATNSHSLAERVRREKISERMKYLQDLVPGCSK  291

Query  212  IAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            + GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++L++E IL KDIF
Sbjct  292  VTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDLNIESILSKDIF  340



>ref|NP_001057380.1| Os06g0275600 [Oryza sativa Japonica Group]
 dbj|BAD68029.1| putative TA1 protein [Oryza sativa Japonica Group]
 dbj|BAF19294.1| Os06g0275600 [Oryza sativa Japonica Group]
Length=437

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRL  181
            G+    S   GK   K  + N  + KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ 
Sbjct  229  GEPKRSSVASGKSSGKQIKDNAGSPKEDYIHVRARRGQATNSHSLAERVRREKISERMKY  288

Query  182  LQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            LQ+LVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++E+IL KDIF
Sbjct  289  LQDLVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIERILSKDIF  347



>gb|ADX60284.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=437

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRL  181
            G+    S   GK   K  + N  + KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ 
Sbjct  229  GEPERSSVASGKSSGKQIKDNAGSPKEDYIHVRARRGQATNSHSLAERVRREKISERMKY  288

Query  182  LQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            LQ+LVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++E+IL KDIF
Sbjct  289  LQDLVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIERILSKDIF  347



>ref|XP_009356474.1| PREDICTED: transcription factor bHLH49-like [Pyrus x bretschneideri]
Length=549

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K   K+  +  Q     KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  333  KTTAKQGKQGSQASDPPKEDYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  392

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFL  361
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ D+E +L KDI L
Sbjct  393  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFDIEGLLAKDILL  444



>ref|XP_002314910.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF01081.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=562

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  344  TSKASGKQGKQGSQGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  403

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  404  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDIL  456



>emb|CDY56230.1| BnaCnng29920D [Brassica napus]
Length=333

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 110/179 (61%), Gaps = 28/179 (16%)
 Frame = +2

Query  11   VLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            + +C   +G  K     +D+   ++Y+HVRA+RGQAT+SHSLAER RREKISERM +LQ+
Sbjct  137  IDKCDDSKGDNK-----DDANPTKDYIHVRARRGQATDSHSLAERARREKISERMTMLQD  191

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDV-------------  331
            LVPGCN+I GKAVMLD+II YVQSLQ+QV+FLSMKLATVNP M  +              
Sbjct  192  LVPGCNRITGKAVMLDEIINYVQSLQRQVQFLSMKLATVNPRMEFNANAALSTEGESLTQ  251

Query  332  --------EQILPKDIFLP-GLNIPHRSFTCIPGSTPL-HALPQNVWDNDLQSILQKGF  478
                    EQ LP   +     N+P  S T  P S        Q  W+NDLQSI+Q GF
Sbjct  252  SLYAMACSEQRLPSGGYYSLAKNMPRFSDTHFPSSDGFVQTETQGFWENDLQSIVQMGF  310



>ref|XP_011009204.1| PREDICTED: transcription factor bHLH49 [Populus euphratica]
Length=562

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  344  TSKAGGKQGKQGSQGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  403

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  404  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDIL  456



>ref|XP_006391072.1| hypothetical protein EUTSA_v10018444mg [Eutrema salsugineum]
 gb|ESQ28358.1| hypothetical protein EUTSA_v10018444mg [Eutrema salsugineum]
Length=497

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 102/145 (70%), Gaps = 18/145 (12%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  291  GNKTNSGKQQGKQT-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  343

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD    
Sbjct  344  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKD----  399

Query  365  GLNIPHRSFTCIPGSTPLHALPQNV  439
                   +     GS+     PQNV
Sbjct  400  -------ALQLRAGSSSAAPFPQNV  417



>ref|XP_006857065.1| hypothetical protein AMTR_s00065p00068810 [Amborella trichopoda]
 gb|ERN18532.1| hypothetical protein AMTR_s00065p00068810 [Amborella trichopoda]
Length=412

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 120/197 (61%), Gaps = 46/197 (23%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            +K   K+  +  QN  A KE Y+HVRA+RGQATNSHSLAERVRRE+ISERM+ LQ+LVPG
Sbjct  201  AKPSSKQGMEQPQNGDAPKEGYIHVRARRGQATNSHSLAERVRRERISERMKFLQDLVPG  260

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---------  355
            C+K+ GKA+MLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E+IL +D+         
Sbjct  261  CSKVTGKALMLDEIINYVQSLQKQVEFLSMKLATVNPQMDSNIERILSEDLLSMKLAMNN  320

Query  356  ---------------------------FLPG--LNIPH----RSFTCIPGSTPL---HAL  427
                                       F PG  L+ P     R  T   G+      + +
Sbjct  321  LQVESDIQRILSKDILNSQGGVPLLLDFSPGHCLSDPFVNSSRQGTSHAGTAARSIENTI  380

Query  428  PQNVWDNDLQSILQKGF  478
            P  VWD+DL SI+Q GF
Sbjct  381  P-GVWDDDLHSIVQMGF  396



>ref|XP_009105442.1| PREDICTED: transcription factor bHLH49 [Brassica rapa]
 ref|XP_009105443.1| PREDICTED: transcription factor bHLH49 [Brassica rapa]
Length=476

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 101/138 (73%), Gaps = 9/138 (7%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  267  GNKTNSGKQQGKQT-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  319

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD    
Sbjct  320  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDALQ-  378

Query  365  GLNIPHRSFTCIPGSTPL  418
             L     S T  P + P+
Sbjct  379  -LRAGTSSATPFPPNMPM  395



>ref|XP_011102214.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
 ref|XP_011102215.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
 ref|XP_011102216.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
 ref|XP_011102217.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
 ref|XP_011102218.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
 ref|XP_011102219.1| PREDICTED: transcription factor bHLH49-like [Sesamum indicum]
Length=536

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   ++ Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  320  SKPGGKHGKQSSQGSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  379

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E  L KDI 
Sbjct  380  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGFLAKDIL  431



>ref|XP_010913103.1| PREDICTED: transcription factor bHLH78-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 12/141 (9%)
 Frame = +2

Query  80   ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQ  259
            ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+LVPGCNK+ GKAVMLD+II YVQ
Sbjct  353  KDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQ  412

Query  260  SLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCIPGSTPLHALPQNV  439
            SLQ+QVEFLSMKLATVNP+++  +E +LPKD++   L     +F+C          P   
Sbjct  413  SLQRQVEFLSMKLATVNPQLDFSMENLLPKDVYP--LEAISTAFSC----------PHQP  460

Query  440  WDNDLQSILQKGFDSMSNRGP  502
              N LQS++  G ++  +  P
Sbjct  461  QGNPLQSVVTNGLENQCSLNP  481



>ref|XP_006484281.1| PREDICTED: transcription factor bHLH49-like isoform X3 [Citrus 
sinensis]
Length=530

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  342  KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  401

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  402  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  452



>ref|XP_011077884.1| PREDICTED: transcription factor bHLH49 [Sesamum indicum]
Length=536

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   ++ Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  320  SKPGGKHGKQSSQGSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  379

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E  L KDI 
Sbjct  380  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGFLAKDIL  431



>ref|XP_006363573.1| PREDICTED: transcription factor bHLH49-like [Solanum tuberosum]
Length=463

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 15/139 (11%)
 Frame = +2

Query  17   ECSKEQGKKKHKTR---QNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQ  187
            E +KEQ       R   +N+   KE+Y+H+RA+RGQATNSHSLAER+RREKISERM+ LQ
Sbjct  273  EMTKEQNLNSIACRPGGKNEDPPKEDYIHIRARRGQATNSHSLAERLRREKISERMKFLQ  332

Query  188  ELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI----  355
            +LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLAT+NP ++ +++ +L KDI    
Sbjct  333  DLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATINPRLDFNIDALLAKDILLLR  392

Query  356  --------FLPGLNIPHRS  388
                    F P L +P++S
Sbjct  393  ADPSSSLAFAPDLTLPYQS  411



>emb|CBI27416.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 120/197 (61%), Gaps = 43/197 (22%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  278  SKNTGKHGKQGAQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  337

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---------  355
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI         
Sbjct  338  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGMLGKDILQSRVGPSS  397

Query  356  ---FLPGLNIPHRSF---------TCIPG------------STPLHAL--------PQ--  433
               F P   +P+              +PG            ++ L A+        PQ  
Sbjct  398  TMGFSPETTMPYPQLHPSQPGLIQVGLPGLGNSSDAIRRTINSQLAAMSGGYKESAPQLP  457

Query  434  NVWDNDLQSILQKGFDS  484
            NVW+++L +++Q GF +
Sbjct  458  NVWEDELHNVVQMGFST  474



>ref|XP_010654187.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera]
 ref|XP_010654195.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera]
 ref|XP_010654202.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera]
 ref|XP_010654208.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera]
Length=568

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 120/197 (61%), Gaps = 43/197 (22%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  350  SKNTGKHGKQGAQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  409

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---------  355
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI         
Sbjct  410  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGMLGKDILQSRVGPSS  469

Query  356  ---FLPGLNIPHRSF---------TCIPG------------STPLHAL--------PQ--  433
               F P   +P+              +PG            ++ L A+        PQ  
Sbjct  470  TMGFSPETTMPYPQLHPSQPGLIQVGLPGLGNSSDAIRRTINSQLAAMSGGYKESAPQLP  529

Query  434  NVWDNDLQSILQKGFDS  484
            NVW+++L +++Q GF +
Sbjct  530  NVWEDELHNVVQMGFST  546



>ref|XP_002312366.2| hypothetical protein POPTR_0008s11240g [Populus trichocarpa]
 gb|EEE89733.2| hypothetical protein POPTR_0008s11240g [Populus trichocarpa]
Length=567

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 121/199 (61%), Gaps = 46/199 (23%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK+ GK+  +        KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  349  TSKDAGKQGKQGSLGSDQPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  408

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-------  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KDI        
Sbjct  409  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIEGLLAKDILQLHAVPP  468

Query  359  ---------------------------LPGLNIPHRSFTCIPGS---TPLHA-------L  427
                                        PG+N  H    C   +   TP+ A       L
Sbjct  469  SSLAFSLEMPMAYPPSHPSQAGLIPTAFPGMNN-HSDIICRTINSQLTPMTAGFKEPAQL  527

Query  428  PQNVWDNDLQSILQKGFDS  484
            P NVWD++L++++Q  +++
Sbjct  528  P-NVWDDELRNVVQMSYET  545



>ref|XP_010681176.1| PREDICTED: transcription factor bHLH49 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010681177.1| PREDICTED: transcription factor bHLH49 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=522

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 117/190 (62%), Gaps = 44/190 (23%)
 Frame = +2

Query  44   KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGK  223
            KH  + +DS +KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC+K+ GK
Sbjct  309  KHAKQSSDS-QKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGK  367

Query  224  AVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---FLPGLNIPHRSFT  394
            AVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KDI    L     P     
Sbjct  368  AVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIERLLSKDISQQMLSARAGPSSGLA  427

Query  395  C---IPGSTP-LH-----ALPQ-------------------------------NVWDNDL  454
                IP + P LH      LP                                NVWD +L
Sbjct  428  LSPEIPMTYPALHPIQTPGLPGTGNSSDTLRRAISSQLLNMGGGYKEPALQLPNVWDGEL  487

Query  455  QSILQKGFDS  484
             +I+Q GF++
Sbjct  488  HNIVQMGFNA  497



>gb|EEC84745.1| hypothetical protein OsI_31742 [Oryza sativa Indica Group]
Length=428

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
            ++KE Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+ GKAVMLD+II 
Sbjct  240  SQKEEYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKVTGKAVMLDEIIN  299

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSFTCIP  403
            YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG  +P  S    P
Sbjct  300  YVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--VPSSSIGFSP  349



>ref|NP_001063455.1| Os09g0474100 [Oryza sativa Japonica Group]
 dbj|BAD34345.1| TA1 protein-like [Oryza sativa Japonica Group]
 dbj|BAF25369.1| Os09g0474100 [Oryza sativa Japonica Group]
 dbj|BAH00478.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60275.1| bHLH- transcription factor [Oryza sativa Japonica Group]
Length=428

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
            ++KE Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+ GKAVMLD+II 
Sbjct  240  SQKEEYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKVTGKAVMLDEIIN  299

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSFTCIP  403
            YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG  +P  S    P
Sbjct  300  YVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--VPSSSIGFSP  349



>gb|ACF22714.1| putative TA1 protein [Brachypodium distachyon]
Length=428

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 100/137 (73%), Gaps = 12/137 (9%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+   T  N  A KE+Y+H+RA+ GQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  243  KSNGKQ---TEDNSDAPKEDYIHIRARSGQATNSHSLAERVRREKISERMKFLQDLVPGC  299

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHR  385
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKL+TVNP ++ ++E+IL KD F         
Sbjct  300  SKVIGKAVMLDEIINYVQSLQRQVEFLSMKLSTVNPALDFNIERILSKDFF---------  350

Query  386  SFTCIPGSTPLHALPQN  436
                 P S+    LP+N
Sbjct  351  QSQGTPASSAFGFLPEN  367



>ref|XP_006484279.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484280.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Citrus 
sinensis]
Length=558

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  342  KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  401

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  402  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  452



>ref|XP_003563957.1| PREDICTED: transcription factor bHLH49-like [Brachypodium distachyon]
Length=441

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 100/137 (73%), Gaps = 12/137 (9%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+   T  N  A KE+Y+H+RA+ GQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  243  KSNGKQ---TEDNSDAPKEDYIHIRARSGQATNSHSLAERVRREKISERMKFLQDLVPGC  299

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHR  385
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKL+TVNP ++ ++E+IL KD F         
Sbjct  300  SKVIGKAVMLDEIINYVQSLQRQVEFLSMKLSTVNPALDFNIERILSKDFF---------  350

Query  386  SFTCIPGSTPLHALPQN  436
                 P S+    LP+N
Sbjct  351  QSQGTPASSAFGFLPEN  367



>ref|NP_001031255.1| transcription factor bHLH49 [Arabidopsis thaliana]
 dbj|BAH57052.1| AT1G68920 [Arabidopsis thaliana]
 gb|AEE34863.1| transcription factor bHLH49 [Arabidopsis thaliana]
Length=485

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+    K + +Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  279  KKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  338

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            NK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  339  NKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDAL  389



>ref|NP_177058.1| transcription factor bHLH49 [Arabidopsis thaliana]
 ref|NP_849863.2| transcription factor bHLH49 [Arabidopsis thaliana]
 sp|Q9CAA9.1|BH049_ARATH RecName: Full=Transcription factor bHLH49; AltName: Full=Basic 
helix-loop-helix protein 49; Short=AtbHLH49; Short=bHLH 49; 
AltName: Full=Protein ACTIVATOR FOR CELL ELONGATION 1; AltName: 
Full=Transcription factor EN 82; AltName: Full=bHLH transcription 
factor bHLH049 [Arabidopsis thaliana]
 gb|AAG51583.1|AC011665_4 putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAM91106.1| At1g68920/T6L1_10 [Arabidopsis thaliana]
 gb|AAN72270.1| At1g68920/T6L1_10 [Arabidopsis thaliana]
 gb|AEE34861.1| transcription factor bHLH49 [Arabidopsis thaliana]
 gb|AEE34862.1| transcription factor bHLH49 [Arabidopsis thaliana]
Length=486

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+    K + +Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  280  KKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  339

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            NK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  340  NKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDAL  390



>ref|XP_006437828.1| hypothetical protein CICLE_v10031122mg [Citrus clementina]
 gb|ESR51068.1| hypothetical protein CICLE_v10031122mg [Citrus clementina]
Length=558

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  342  KSAGKQGKQGSQTSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  401

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KD+ 
Sbjct  402  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEELLAKDVL  452



>ref|XP_009412181.1| PREDICTED: transcription factor bHLH76-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412189.1| PREDICTED: transcription factor bHLH76-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 12/125 (10%)
 Frame = +2

Query  17   ECSKEQGKKKHKTRQNDS------------ARKENYVHVRAKRGQATNSHSLAERVRREK  160
            E +K+  + KHK  QN S            A KE YVHVRA+RGQATNSHSLAERVRREK
Sbjct  269  EATKDDTETKHKVEQNSSKHGGKNGKDNSEAAKEGYVHVRARRGQATNSHSLAERVRREK  328

Query  161  ISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQI  340
            ISERM+ LQELVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKL+ VNP+++  VE++
Sbjct  329  ISERMKYLQELVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLSAVNPQLDFSVERL  388

Query  341  LPKDI  355
            L K++
Sbjct  389  LAKNL  393



>gb|AAM10942.1|AF488584_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=486

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+    K + +Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  280  KKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  339

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            NK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  340  NKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDAL  390



>ref|XP_006660739.1| PREDICTED: transcription factor bHLH49-like [Oryza brachyantha]
Length=434

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
            ++KE Y+HVRA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+ GKAVMLD+II 
Sbjct  246  SQKEEYIHVRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKVTGKAVMLDEIIN  305

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSFTCIP  403
            YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG  +P  S    P
Sbjct  306  YVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--VPSSSIGFSP  355



>emb|CDX95974.1| BnaA07g27570D [Brassica napus]
Length=479

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 100/138 (72%), Gaps = 9/138 (7%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK+        S  K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  270  GNKTNSGKQQGKQA-------SDPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  322

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLP  364
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+  +E +L KD    
Sbjct  323  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFSLEGLLAKDALQ-  381

Query  365  GLNIPHRSFTCIPGSTPL  418
             L     S T  P + P+
Sbjct  382  -LRAGTSSATPFPPNMPM  398



>ref|XP_009776786.1| PREDICTED: transcription factor bHLH49-like [Nicotiana sylvestris]
Length=542

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 109/159 (69%), Gaps = 15/159 (9%)
 Frame = +2

Query  35   GKKKHKTR-QNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNK  211
            G+K  K R Q     KE Y+H+RA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGCNK
Sbjct  327  GEKNSKERSQASDPPKEEYIHIRARRGQATNSHSLAERVRREKISERMKYLQDLVPGCNK  386

Query  212  IAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSF  391
            + GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+++ +++ +L KDI L     P  S 
Sbjct  387  VTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQLDFNLDGLLAKDI-LQSQAGPSSSL  445

Query  392  TCIPGS-----TPLHALPQNVWDNDLQSILQKGFDSMSN  493
               P +     T LHAL           +LQ GF  + N
Sbjct  446  VFPPDNMTMPYTSLHAL--------QSGLLQSGFPGVGN  476



>ref|XP_010681178.1| PREDICTED: transcription factor bHLH49 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=519

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 117/190 (62%), Gaps = 44/190 (23%)
 Frame = +2

Query  44   KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGK  223
            KH  + +DS +KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC+K+ GK
Sbjct  309  KHAKQSSDS-QKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGK  367

Query  224  AVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---FLPGLNIPHRSFT  394
            AVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KDI    L     P     
Sbjct  368  AVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIERLLSKDISQQMLSARAGPSSGLA  427

Query  395  C---IPGSTP-LH-----ALPQ-------------------------------NVWDNDL  454
                IP + P LH      LP                                NVWD +L
Sbjct  428  LSPEIPMTYPALHPIQTPGLPGTGNSSDTLRRAISSQLLNMGGGYKEPALQLPNVWDGEL  487

Query  455  QSILQKGFDS  484
             +I+Q GF++
Sbjct  488  HNIVQMGFNA  497



>ref|XP_010488446.1| PREDICTED: transcription factor bHLH77-like [Camelina sativa]
Length=368

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 116/192 (60%), Gaps = 30/192 (16%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKE---NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            S + G +K  ++ +D+   E   +Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+L
Sbjct  163  SSKNGIEKCDSKGDDAKPPEAPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQDL  222

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDV--------------  331
            VPGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M  +               
Sbjct  223  VPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMEFNANASLSTEMIQPGES  282

Query  332  -----------EQILPKDIFLPGLNIPHRSFTCIPGSTPL-HALPQNVWD-NDLQSILQK  472
                       EQ LP   +  G N+P  S T  P +     A     W+ NDLQSI+Q 
Sbjct  283  LTQSLYAIACSEQRLPSAYYSLGKNMPRFSDTQFPSNDGFVQAETPGFWENNDLQSIVQM  342

Query  473  GFDSMSNRGPND  508
            GF  +  +  N+
Sbjct  343  GFGDIQQQSSNN  354



>ref|XP_006414789.1| hypothetical protein EUTSA_v10025750mg [Eutrema salsugineum]
 gb|ESQ56242.1| hypothetical protein EUTSA_v10025750mg [Eutrema salsugineum]
Length=316

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 113/187 (60%), Gaps = 36/187 (19%)
 Frame = +2

Query  50   KTRQNDSARKEN-------YVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCN  208
            +++QN++ + EN       Y+HVRA+RGQAT+SHS+AER RREKISERM+LLQ+LVPGCN
Sbjct  117  RSKQNETEKSENKEEPRKDYIHVRARRGQATDSHSIAERARREKISERMKLLQDLVPGCN  176

Query  209  KIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNP--EMNLDV-----------------  331
            +I GKAVMLD+II YVQSLQ QVEFLSMKLAT+NP  E N +                  
Sbjct  177  RITGKAVMLDEIINYVQSLQTQVEFLSMKLATINPITEFNANALLSAELGESLTQAISCS  236

Query  332  EQILPKDIFLPGLNIPHRSF---------TCIPGSTPLHALPQNVWDNDLQSILQKGFDS  484
            E  LP +    G NIP R F         +       +HA     W+NDLQSI+Q GF  
Sbjct  237  EARLPSEYLSLGKNIP-RFFETQTQFLNSSSASNGGFVHAEAPVFWENDLQSIVQMGFRD  295

Query  485  MSNRGPN  505
            +     N
Sbjct  296  IQQENTN  302



>ref|XP_002301743.2| hypothetical protein POPTR_0002s23650g [Populus trichocarpa]
 gb|EEE81016.2| hypothetical protein POPTR_0002s23650g [Populus trichocarpa]
Length=567

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 6/137 (4%)
 Frame = +2

Query  29   EQGKKKHKTRQNDSARKE---NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
            E+    HK ++++S   E   +Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+LVP
Sbjct  344  EEENGNHKQKKDNSNPPEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVP  403

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIP  379
            GCNK+ GKAVMLD+II YVQSLQ+QVEFLSMK+ATVNP+M +++E  L KDIF    ++P
Sbjct  404  GCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKMATVNPKMEINMETFLSKDIFQSRGSMP  463

Query  380  HRSFTCIPGSTPLHALP  430
            H  +  +  STP  A P
Sbjct  464  HGLYP-LDSSTP--AFP  477



>ref|XP_006302168.1| hypothetical protein CARUB_v10020178mg [Capsella rubella]
 gb|EOA35066.1| hypothetical protein CARUB_v10020178mg [Capsella rubella]
Length=499

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K+    K + +Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  293  KKTNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  352

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            NK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  353  NKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDAL  403



>ref|XP_008797587.1| PREDICTED: transcription factor bHLH49-like isoform X3 [Phoenix 
dactylifera]
Length=465

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 14/149 (9%)
 Frame = +2

Query  77   KENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYV  256
            KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC+K+ GKAVMLD+II YV
Sbjct  299  KEDYIHVRARRGQATNSHSLAERVRREKISERMKYLQDLVPGCSKVTGKAVMLDEIINYV  358

Query  257  QSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF----LPGLNIPHRSFTCIPGS-----  409
            QSLQ+QVEFLSMKLATVNP ++ ++E +L KD      + G+  P  +   +  +     
Sbjct  359  QSLQRQVEFLSMKLATVNPRVDFNIEGLLSKDGLVQAGISGMGSPSDAVRRVMNAQLAVM  418

Query  410  ----TPLHALPQNVWDNDLQSILQKGFDS  484
                 P   +P NVWD++L +++Q  + +
Sbjct  419  NGFKEPTPQIP-NVWDDELHNVMQLSYST  446



>gb|KDP32569.1| hypothetical protein JCGZ_13119 [Jatropha curcas]
Length=483

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 11/124 (9%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKEN-----------YVHVRAKRGQATNSHSLAERVRREKIS  166
            C+K + ++++  ++ +S  KEN           Y+HVRA+RGQAT+SHSLAERVRREKIS
Sbjct  253  CAKAKEEEENGKQKQNSNNKENPNPKAAEPPKDYIHVRARRGQATDSHSLAERVRREKIS  312

Query  167  ERMRLLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILP  346
            ERM+ LQ+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+ ++E IL 
Sbjct  313  ERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDFNMEAILS  372

Query  347  KDIF  358
            KDIF
Sbjct  373  KDIF  376



>emb|CDP00498.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             SK  GK   +  Q   + KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  335  SSKPGGKNGKQGPQASGSPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  394

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KD+ 
Sbjct  395  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDVL  447



>gb|EEC80389.1| hypothetical protein OsI_22515 [Oryza sativa Indica Group]
Length=494

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRL  181
            G+    S   GK   K  + N  + KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ 
Sbjct  286  GEPKRSSVASGKSSGKQIKDNAGSPKEDYIHVRARRGQATNSHSLAERVRREKISERMKY  345

Query  182  LQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            LQ+LVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++E+IL KDIF
Sbjct  346  LQDLVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIERILSKDIF  404



>ref|XP_008389360.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH49-like 
[Malus domestica]
Length=552

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K   K+  +  Q     KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  330  KTTAKQGKQGSQASDPPKEDYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  389

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ D+E +L KDI 
Sbjct  390  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFDIEGLLAKDIL  440



>ref|XP_010511918.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
Length=497

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 6/116 (5%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK      Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  290  GNKTNSGKQQGK------QSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  343

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKD  352
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD
Sbjct  344  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKD  399



>ref|XP_008243775.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH49 [Prunus 
mume]
Length=543

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             +K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  325  TNKTTGKQSKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  384

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  385  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDIL  437



>ref|XP_009392658.1| PREDICTED: transcription factor bHLH77 [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 120/187 (64%), Gaps = 40/187 (21%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKE---NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            G  + K ++N++   E   +Y+HVRA+RGQAT+SHSLAERVRREKIS+RM+LLQ+LVPGC
Sbjct  108  GASQKKGKENNAKPPEPPKDYIHVRARRGQATDSHSLAERVRREKISKRMKLLQDLVPGC  167

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQI-----------LPKD  352
            NKI GKA+MLD+II YVQSLQ+QVEFLSMKLAT+NP+++ D+E +           LP+ 
Sbjct  168  NKITGKAMMLDEIINYVQSLQRQVEFLSMKLATINPQLDFDLETLLQENMHQEHEPLPQQ  227

Query  353  IF-LPGLNIPHRSFTCIPGSTPLHAL----------PQ--------------NVWDNDLQ  457
            ++ L G +    S+   P  +PL +           PQ              N W++DLQ
Sbjct  228  VYPLEGTSTAF-SYAQRPQGSPLQSAITNGLGVGQQPQCPIDGLADATSQLGNFWESDLQ  286

Query  458  SILQKGF  478
             ++Q GF
Sbjct  287  YVVQLGF  293



>ref|XP_010681179.1| PREDICTED: transcription factor bHLH49 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = +2

Query  44   KHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGK  223
            KH  + +DS +KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC+K+ GK
Sbjct  309  KHAKQSSDS-QKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGK  367

Query  224  AVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI  355
            AVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E++L KDI
Sbjct  368  AVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIERLLSKDI  411



>ref|XP_010415500.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
 ref|XP_010415501.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
Length=507

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 6/118 (5%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK      Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  300  GNKTNSGKQQGK------QSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  353

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  354  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDAL  411



>ref|XP_010466724.1| PREDICTED: transcription factor bHLH77 [Camelina sativa]
Length=369

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 112/182 (62%), Gaps = 30/182 (16%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKE---NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            S + G +K  ++ +D+   E   +Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+L
Sbjct  163  SSKNGIEKCDSKGDDAKPPEAPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQDL  222

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDV--------------  331
            VPGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M  +               
Sbjct  223  VPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMEFNANAALSTEMIQPGES  282

Query  332  -----------EQILPKDIFLPGLNIPHRSFTCIPGSTPL-HALPQNVWD-NDLQSILQK  472
                       EQ LP   +  G N+P  S T  P +     A     W+ NDLQSI+Q 
Sbjct  283  LTQSLYAMACSEQRLPSAYYSLGKNMPRFSDTQFPSNDGFVQAETPGFWENNDLQSIVQM  342

Query  473  GF  478
            GF
Sbjct  343  GF  344



>ref|XP_009102591.1| PREDICTED: transcription factor bHLH77 isoform X1 [Brassica rapa]
Length=329

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 109/183 (60%), Gaps = 35/183 (19%)
 Frame = +2

Query  35   GKKKHKTRQNDSARKEN---------YVHVRAKRGQATNSHSLAERVRREKISERMRLLQ  187
            G K+ K  +  S+ K++         Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ
Sbjct  124  GSKRSKQDEAGSSNKDDAKPPEPPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQ  183

Query  188  ELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLD-------------  328
            +LVPGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLAT+NP M  +             
Sbjct  184  DLVPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATINPRMEFNPSAALSTEMVQPG  243

Query  329  ------------VEQILPKDIFLPGLNIPHRSFTCIPGSTPL-HALPQNVWDNDLQSILQ  469
                         EQ LP   +    N+P  S T    +     A  Q  W+NDLQSI+Q
Sbjct  244  EALTQSLYSMACSEQRLPSAYYSLAKNMPRFSDTQFHSTDAFVQAETQGFWENDLQSIVQ  303

Query  470  KGF  478
             GF
Sbjct  304  MGF  306



>ref|XP_010512743.1| PREDICTED: transcription factor bHLH77-like [Camelina sativa]
Length=369

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 112/182 (62%), Gaps = 30/182 (16%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKE---NYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            S + G +K  ++ +D+   E   +Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+L
Sbjct  163  SSKNGIEKCDSKGDDAKPPEAPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQDL  222

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDV--------------  331
            VPGCN+I GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M  +               
Sbjct  223  VPGCNRITGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMEFNANAALSTEMIQPGES  282

Query  332  -----------EQILPKDIFLPGLNIPHRSFTCIPGSTPL-HALPQNVWD-NDLQSILQK  472
                       EQ LP   +  G N+P  S T  P +     A     W+ NDLQSI+Q 
Sbjct  283  LTQSLYAIACSEQRLPSAYYSLGKNMPRFSDTQFPSNDGFVQAETPGFWENNDLQSIVQM  342

Query  473  GF  478
            GF
Sbjct  343  GF  344



>ref|XP_010542232.1| PREDICTED: transcription factor bHLH49-like, partial [Tarenaya 
hassleriana]
Length=191

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 102/150 (68%), Gaps = 14/150 (9%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            KK    +Q     KE Y+H+RA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGCNK+ 
Sbjct  36   KKTSGGKQASDPPKEGYIHMRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVT  95

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTC  397
            GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP++ L+++ ++ K+           +   
Sbjct  96   GKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQLELNLDGLMAKE-----------ALQL  144

Query  398  IPGSTPLHALPQNVWD---NDLQSILQKGF  478
             PG +     PQ++       L  + Q GF
Sbjct  145  RPGPSSAPPFPQSIMPMAYPPLPHLSQPGF  174



>ref|XP_007045714.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
 ref|XP_007045715.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY01546.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY01547.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3 [Theobroma cacao]
Length=552

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  341  KTTGKQGKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  400

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  401  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDII  451



>ref|NP_189011.2| transcription factor bHLH77 [Arabidopsis thaliana]
 sp|Q9LK48.1|BH077_ARATH RecName: Full=Transcription factor bHLH77; AltName: Full=Basic 
helix-loop-helix protein 77; Short=AtbHLH77; Short=bHLH 77; 
AltName: Full=Protein ACTIVATOR FOR CELL ELONGATION 3; AltName: 
Full=Transcription factor EN 87; AltName: Full=bHLH transcription 
factor bHLH077 [Arabidopsis thaliana]
 dbj|BAB01846.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL38882.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20186.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE76802.1| transcription factor bHLH77 [Arabidopsis thaliana]
Length=371

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 102/160 (64%), Gaps = 27/160 (17%)
 Frame = +2

Query  80   ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQ  259
            ++Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+LVPGCN+I GKAVMLD+II YVQ
Sbjct  186  KDYIHVRARRGQATDSHSLAERARREKISERMTLLQDLVPGCNRITGKAVMLDEIINYVQ  245

Query  260  SLQQQVEFLSMKLATVNPEMNLDV-------------------------EQILPKDIFLP  364
            SLQ+QVEFLSMKLATVNP M  +                          EQ LP   +  
Sbjct  246  SLQRQVEFLSMKLATVNPRMEFNANASLSTEMIQPGESLTQSLYAMACSEQRLPSAYYSL  305

Query  365  GLNIPHRSFTCIPGSTPL-HALPQNVWD-NDLQSILQKGF  478
            G N+P  S T  P +    H      W+ NDLQSI+Q GF
Sbjct  306  GKNMPRFSDTQFPSNDGFVHTETPGFWENNDLQSIVQMGF  345



>ref|XP_010513668.1| PREDICTED: transcription factor bHLH49-like, partial [Camelina 
sativa]
Length=173

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 6/118 (5%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK      Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKI ER++ L
Sbjct  35   GNKTNSGKQQGK------QSSDPPKDGYIHVRARRGQATNSHSLAERVRREKIIERVKFL  88

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  89   QDLVPGCNKVTGKAVMLDEIINYVQSLQCQVEFLSMKLATVNPQMDFNLEGLLAKDAL  146



>ref|XP_011070886.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Sesamum 
indicum]
 ref|XP_011070888.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Sesamum 
indicum]
Length=527

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 94/122 (77%), Gaps = 2/122 (2%)
 Frame = +2

Query  5    GDVLECSKEQGKKKH--KTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMR  178
            GD    S      KH  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+
Sbjct  306  GDQNPASTSNPGAKHGKQASQGSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMK  365

Query  179  LLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
             LQ+LVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+L++E +L KD+ 
Sbjct  366  FLQDLVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDLNMEGLLAKDVL  425

Query  359  LP  364
             P
Sbjct  426  QP  427



>ref|XP_008339739.1| PREDICTED: transcription factor bHLH49-like [Malus domestica]
Length=558

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  340  KTTGKQGKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  399

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  400  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDIL  450



>ref|XP_007225728.1| hypothetical protein PRUPE_ppa003619mg [Prunus persica]
 gb|EMJ26927.1| hypothetical protein PRUPE_ppa003619mg [Prunus persica]
Length=561

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             +K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  343  TNKTTGKQSKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  402

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  403  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLTKDIL  455



>ref|XP_011070889.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Sesamum 
indicum]
Length=524

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 94/122 (77%), Gaps = 2/122 (2%)
 Frame = +2

Query  5    GDVLECSKEQGKKKH--KTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMR  178
            GD    S      KH  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+
Sbjct  306  GDQNPASTSNPGAKHGKQASQGSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMK  365

Query  179  LLQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
             LQ+LVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+L++E +L KD+ 
Sbjct  366  FLQDLVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDLNMEGLLAKDVL  425

Query  359  LP  364
             P
Sbjct  426  QP  427



>ref|XP_007045713.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY01545.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=556

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  341  KTTGKQGKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  400

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  401  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDII  451



>ref|XP_010654214.1| PREDICTED: transcription factor bHLH49 isoform X3 [Vitis vinifera]
Length=531

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  350  SKNTGKHGKQGAQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  409

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  410  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGMLGKDIL  461



>ref|XP_010261463.1| PREDICTED: transcription factor bHLH49 [Nelumbo nucifera]
 ref|XP_010261471.1| PREDICTED: transcription factor bHLH49 [Nelumbo nucifera]
 ref|XP_010261481.1| PREDICTED: transcription factor bHLH49 [Nelumbo nucifera]
Length=542

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             +K  GK    + Q   A KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  324  TAKPAGKHGKDSSQPSDAPKEDYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  383

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA VNP ++ ++E  L KDI 
Sbjct  384  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLAAVNPRLDFNIEGFLAKDIL  436



>ref|XP_010654210.1| PREDICTED: transcription factor bHLH49 isoform X2 [Vitis vinifera]
Length=534

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  350  SKNTGKHGKQGAQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  409

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  410  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGMLGKDIL  461



>ref|XP_007045712.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01544.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=581

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK+  +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPGC
Sbjct  341  KTTGKQGKQGSQASDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGC  400

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI 
Sbjct  401  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDII  451



>ref|XP_006492985.1| PREDICTED: transcription factor bHLH62-like [Citrus sinensis]
Length=481

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARK----ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            SK+   K   ++  D+++     ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+
Sbjct  254  SKQDENKSDSSKTKDNSKPVEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQD  313

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGL  370
            LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+L++E +L KD+F    
Sbjct  314  LVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDLNMEALLSKDLFQSCG  373

Query  371  NIPHRSFTCIPGSTPLHALP  430
             + H  +   PG   +   P
Sbjct  374  YVQHSLY---PGDCSVQTFP  390



>ref|XP_010942244.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Elaeis 
guineensis]
Length=436

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 28/155 (18%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             S+  GK+   + +     KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  291  SSRPNGKQAKDSTE---GSKEDYIHVRARRGQATNSHSLAERVRREKISERMKYLQDLVP  347

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIP  379
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KDI        
Sbjct  348  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRVDCNIEGLLSKDI--------  399

Query  380  HRSFTCIPGSTPLHALPQNVWDNDLQSILQKGFDS  484
                              NVWD++L +++Q  + +
Sbjct  400  -----------------PNVWDDELHNVMQLSYST  417



>gb|KDO52837.1| hypothetical protein CISIN_1g011621mg [Citrus sinensis]
Length=481

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARK----ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            SK+   K   ++  D+++     ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+
Sbjct  254  SKQDENKSDSSKTKDNSKPVEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQD  313

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGL  370
            LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+L++E +L KD+F    
Sbjct  314  LVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDLNMEALLSKDLFQSCG  373

Query  371  NIPHRSFTCIPGSTPLHALP  430
             + H  +   PG   +   P
Sbjct  374  YVQHSLY---PGDCSVQTFP  390



>gb|EEE65517.1| hypothetical protein OsJ_20959 [Oryza sativa Japonica Group]
Length=545

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHK-TRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRL  181
            G+    S   GK   K  + N  + KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ 
Sbjct  337  GEPKRSSVASGKSSGKQIKDNAGSPKEDYIHVRARRGQATNSHSLAERVRREKISERMKY  396

Query  182  LQELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            LQ+LVPGC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLA+VNP ++ ++E+IL KDIF
Sbjct  397  LQDLVPGCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLASVNPTLDFNIERILSKDIF  455



>ref|XP_010470832.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
Length=505

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 6/118 (5%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K+QGK      Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  298  GNKTNSGKQQGK------QSSDPPKDGYIHVRAQRGQATNSHSLAERVRREKISERMKFL  351

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD  
Sbjct  352  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDAL  409



>ref|XP_010044347.1| PREDICTED: transcription factor bHLH49 [Eucalyptus grandis]
 gb|KCW86438.1| hypothetical protein EUGRSUZ_B03106 [Eucalyptus grandis]
Length=569

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 101/145 (70%), Gaps = 9/145 (6%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            SK   K      Q    +KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVPG
Sbjct  345  SKATAKNNKPGTQGSDPQKEDYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPG  404

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF------LP  364
            C+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++ ++E +L KD+         
Sbjct  405  CSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDFNIEGLLAKDLLHSRAGPSS  464

Query  365  GLNIPHRSFTCIPGSTPLHALPQNV  439
             L +PH      P   P+H  P  +
Sbjct  465  TLGLPHDMPMSFP---PMHLPPPGL  486



>ref|XP_006421053.1| hypothetical protein CICLE_v10004862mg [Citrus clementina]
 gb|ESR34293.1| hypothetical protein CICLE_v10004862mg [Citrus clementina]
Length=481

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARK----ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQE  190
            SK+   K   ++  D+++     ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+
Sbjct  254  SKQDENKSDSSKTKDNSKPVEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQD  313

Query  191  LVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGL  370
            LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP M+L++E +L KD+F    
Sbjct  314  LVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRMDLNMEALLSKDLFQSCG  373

Query  371  NIPHRSFTCIPGSTPLHALP  430
             + H  +   PG   +   P
Sbjct  374  YVQHSLY---PGDCSVQTFP  390



>ref|XP_008446487.1| PREDICTED: transcription factor bHLH49 isoform X2 [Cucumis melo]
Length=553

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 114/192 (59%), Gaps = 41/192 (21%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQELVPGC
Sbjct  354  KGTGKHGKQASQPSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQELVPGC  413

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++++++ ++ KDI          
Sbjct  414  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDINIDGVVTKDILQSRVGPLST  473

Query  359  ----------LPGLNIPH-----RSFTCIPGSTPLHALP-----------------QNVW  442
                       P  NI H      +F  I  S  L +                   +NVW
Sbjct  474  LGFSSHMPVACPPPNISHHELIPSNFPAIGSSEMLRSTMNSHMTQRSGGFKNPSQIKNVW  533

Query  443  DNDLQSILQKGF  478
            D +LQ+I+Q  F
Sbjct  534  DGELQNIVQMSF  545



>ref|XP_008446489.1| PREDICTED: transcription factor bHLH49 isoform X3 [Cucumis melo]
Length=545

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 114/192 (59%), Gaps = 41/192 (21%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQELVPGC
Sbjct  346  KGTGKHGKQASQPSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQELVPGC  405

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++++++ ++ KDI          
Sbjct  406  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDINIDGVVTKDILQSRVGPLST  465

Query  359  ----------LPGLNIPHR-----SFTCIPGSTPLHALP-----------------QNVW  442
                       P  NI H      +F  I  S  L +                   +NVW
Sbjct  466  LGFSSHMPVACPPPNISHHELIPSNFPAIGSSEMLRSTMNSHMTQRSGGFKNPSQIKNVW  525

Query  443  DNDLQSILQKGF  478
            D +LQ+I+Q  F
Sbjct  526  DGELQNIVQMSF  537



>ref|XP_008446486.1| PREDICTED: transcription factor bHLH49 isoform X1 [Cucumis melo]
Length=554

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 114/192 (59%), Gaps = 41/192 (21%)
 Frame = +2

Query  26   KEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGC  205
            K  GK   +  Q     KE Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQELVPGC
Sbjct  355  KGTGKHGKQASQPSDPPKEEYIHVRARRGQATNSHSLAERVRREKISERMKFLQELVPGC  414

Query  206  NKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF---------  358
            +K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++++++ ++ KDI          
Sbjct  415  SKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDINIDGVVTKDILQSRVGPLST  474

Query  359  ----------LPGLNIPHR-----SFTCIPGSTPLHALP-----------------QNVW  442
                       P  NI H      +F  I  S  L +                   +NVW
Sbjct  475  LGFSSHMPVACPPPNISHHELIPSNFPAIGSSEMLRSTMNSHMTQRSGGFKNPSQIKNVW  534

Query  443  DNDLQSILQKGF  478
            D +LQ+I+Q  F
Sbjct  535  DGELQNIVQMSF  546



>ref|XP_009762311.1| PREDICTED: transcription factor bHLH63-like [Nicotiana sylvestris]
Length=444

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 9/155 (6%)
 Frame = +2

Query  23   SKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPG  202
            S E  K+K K  ++   +K +Y+HVRA+RGQAT+SHSLAERVRREKISERMR LQ+LVPG
Sbjct  218  SYESSKEKSKITED---KKPDYIHVRARRGQATDSHSLAERVRREKISERMRFLQDLVPG  274

Query  203  CNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGL-NIP  379
            CNKI GKA MLD+II YVQSLQ+QVEFLSMKLA VNP +++DV+  L KDIF     N P
Sbjct  275  CNKITGKAGMLDEIINYVQSLQRQVEFLSMKLAAVNPRLDIDVDNFLNKDIFATSTSNFP  334

Query  380  HRSFTCIPG-STPLHALPQNVWDNDLQSILQKGFD  481
                T   G S+ + ++ Q  +++  Q +   GF+
Sbjct  335  ----TVGAGTSSEMLSMAQRQFNSLQQIVSSSGFE  365



>ref|XP_006297936.1| hypothetical protein CARUB_v10013979mg [Capsella rubella]
 ref|XP_006297937.1| hypothetical protein CARUB_v10013979mg [Capsella rubella]
 gb|EOA30834.1| hypothetical protein CARUB_v10013979mg [Capsella rubella]
 gb|EOA30835.1| hypothetical protein CARUB_v10013979mg [Capsella rubella]
Length=370

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 106/170 (62%), Gaps = 27/170 (16%)
 Frame = +2

Query  80   ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQ  259
            ++Y+HVRA+RGQAT+SHSLAER RREKISERM LLQ+LVPGCN+I GKAVMLD+II YVQ
Sbjct  188  KDYIHVRARRGQATDSHSLAERARREKISERMTLLQDLVPGCNRITGKAVMLDEIINYVQ  247

Query  260  SLQQQVEFLSMKLATVNPEMNLDV-------------------------EQILPKDIFLP  364
            SLQ+QVEFLSMKLATVNP M  +                          EQ LP   +  
Sbjct  248  SLQRQVEFLSMKLATVNPRMEFNANSTLSTEMIQPGESLTQSLYAIACSEQRLPSAYYSL  307

Query  365  GLNIPHRSFTCIPGSTPL-HALPQNVWD-NDLQSILQKGFDSMSNRGPND  508
            G N+P  S T  P +     A     W+ NDLQSI+Q GF  +  +  N+
Sbjct  308  GKNMPRFSDTQFPSNDGFVQAETPGFWENNDLQSIVQMGFGDIQQQSSNN  357



>ref|XP_004297184.1| PREDICTED: transcription factor bHLH49-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  20   CSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVP  199
             +K  GK   +  Q     KE+Y+HVRA+RGQATNSHSLAERVRREKISERM+ LQ+LVP
Sbjct  232  TNKISGKLVKQGSQTSDPPKEDYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVP  291

Query  200  GCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF  358
            GC+K+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+ 
Sbjct  292  GCSKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPRLDLNIESLLEKDML  344



>ref|XP_009757727.1| PREDICTED: transcription factor bHLH62-like [Nicotiana sylvestris]
Length=490

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  14   LECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQEL  193
            +E SK   +      Q      ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+LLQ+L
Sbjct  269  MEESKGNNEGDETQNQKPPEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDL  328

Query  194  VPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLN  373
            VPGCNK+ GKA+MLD+II YVQSLQ+QVEFLSMKLA+VNP ++   E +LPKDI  P  +
Sbjct  329  VPGCNKVTGKALMLDEIINYVQSLQRQVEFLSMKLASVNPSLDFPAENLLPKDICQPNGS  388

Query  374  IPHRSF  391
            +P   F
Sbjct  389  LPQPVF  394



>ref|XP_002887213.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63472.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 118/185 (64%), Gaps = 37/185 (20%)
 Frame = +2

Query  5    GDVLECSKEQGKKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLL  184
            G+     K QGK      Q+    K+ Y+HVRA+RGQATNSHSLAERVRREKISERM+ L
Sbjct  279  GNKTNSGKRQGK------QSSDLPKDGYIHVRARRGQATNSHSLAERVRREKISERMKFL  332

Query  185  QELVPGCNKIAGKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDI---  355
            Q+LVPGCNK+ GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M+ ++E +L KD    
Sbjct  333  QDLVPGCNKVTGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQMDFNLEGLLAKDALQL  392

Query  356  ----------FLPGLN-----IPH----RSFTCIPG--STPLHAL-------PQNVWDND  451
                      F P +      +PH    ++ + I    S+PL ++         N W+ D
Sbjct  393  RAGSSSTTTPFTPNMAMAYPPLPHGFMQQTLSSIGRTISSPLSSMNGGFKRQETNGWEGD  452

Query  452  LQSIL  466
            LQ+++
Sbjct  453  LQNVI  457



>ref|NP_001169165.1| uncharacterized protein LOC100383015 [Zea mays]
 gb|ACN31824.1| unknown [Zea mays]
Length=443

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
            ++KE+Y+H+RA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+ GKAVMLD+II 
Sbjct  238  SQKEDYIHIRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKVTGKAVMLDEIIN  297

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSFTCIP  403
            YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG   P  S    P
Sbjct  298  YVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--APSSSLGFPP  347



>ref|XP_010913102.1| PREDICTED: transcription factor bHLH78-like isoform X1 [Elaeis 
guineensis]
Length=550

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  80   ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQ  259
            ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+LVPGCNK+ GKAVMLD+II YVQ
Sbjct  353  KDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQ  412

Query  260  SLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTCIPGSTPLHALPQNV  439
            SLQ+QVEFLSMKLATVNP+++  +E +LPKD+      +P + +     ST   + P   
Sbjct  413  SLQRQVEFLSMKLATVNPQLDFSMENLLPKDMHQAHRPLPTQVYPLEAISTAF-SCPHQP  471

Query  440  WDNDLQSILQKGFDSMSNRGP  502
              N LQS++  G ++  +  P
Sbjct  472  QGNPLQSVVTNGLENQCSLNP  492



>ref|XP_011042744.1| PREDICTED: transcription factor bHLH77-like [Populus euphratica]
Length=566

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +2

Query  38   KKKHKTRQNDSARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIA  217
            +K+ K   N     ++Y+HVRA+RGQAT+SHSLAERVRREKISERM+ LQ+LVPGCNK+ 
Sbjct  345  QKQKKNNSNPPEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVT  404

Query  218  GKAVMLDKIIKYVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSFTC  397
            GKAVMLD+II YVQSLQ+QVEFLSMKLATVNP+M +++E  L K+IF    ++PH  +  
Sbjct  405  GKAVMLDEIINYVQSLQRQVEFLSMKLATVNPKMEINMETFLSKEIFQSRGSMPHGLYP-  463

Query  398  IPGSTPLHALP  430
            +  STP  A P
Sbjct  464  LDSSTP--AFP  472



>ref|XP_011084194.1| PREDICTED: transcription factor bHLH78-like [Sesamum indicum]
Length=519

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 112/175 (64%), Gaps = 42/175 (24%)
 Frame = +2

Query  80   ENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIKYVQ  259
            ++Y+HVRA+RGQAT++HSLAERVRREKISERM++LQ+LVPGCNK+ GKAVMLD+II YVQ
Sbjct  324  KDYIHVRARRGQATDAHSLAERVRREKISERMKVLQDLVPGCNKVTGKAVMLDEIINYVQ  383

Query  260  SLQQQVEFLSMKLATVNPEMNLDVEQILPKDIFLPGLNIPHRSF--------------TC  397
            SLQ+QVEFLSMKLATVNP M+ ++E ++ KD+F    ++PH  +              T 
Sbjct  384  SLQRQVEFLSMKLATVNPRMDFNMEALMSKDMFQSRGSLPHNMYPSDSYPFQSQPNLHTA  443

Query  398  IPGST--PLHA--------------LP------------QNVWDNDLQSILQKGF  478
            +P ++  P  A              LP               W++DL S++Q GF
Sbjct  444  LPSASEAPFTANNFNSALGRNQTMQLPPMDNFSETASQVSTFWEDDLHSVVQMGF  498



>tpg|DAA40320.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04385.1| bHLH transcription factor, partial [Zea mays]
Length=453

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +2

Query  71   ARKENYVHVRAKRGQATNSHSLAERVRREKISERMRLLQELVPGCNKIAGKAVMLDKIIK  250
            ++KE+Y+H+RA+RGQATNSHSLAER+RREKISERM+LLQ+LVPGC+K+ GKAVMLD+II 
Sbjct  248  SQKEDYIHIRARRGQATNSHSLAERLRREKISERMKLLQDLVPGCSKVTGKAVMLDEIIN  307

Query  251  YVQSLQQQVEFLSMKLATVNPEMNLDVEQILPKDIF-LPGLNIPHRSFTCIP  403
            YVQSLQ+QVEFLSMKLATVNP ++L++E +L KD+   PG   P  S    P
Sbjct  308  YVQSLQRQVEFLSMKLATVNPRLDLNIEGLLSKDLLRFPG--APSSSLGFPP  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 679482509436